2Q8TA

Crystal structure of the cc chemokine ccl14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
PYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
molecule tags Cytokine
molecule keywords CCL14
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8tA00
1BBXC 2B2YA 1LV9A 2RA4A 3UI2A 4R8IA 4IUQA 2K04A 1WTRA 4IUTA 2B2VA 1QNKA 1DOMA 2JP1A 4X3UA 1DONA 1WTOA 1EIHA 1Q3LA 2L4NA 1J9OA 1MSHA 2L11A 2HDMA 2FJ2A 5EPLA 1G2TA 4XT1B 1U4RA 2HCCA 2Q8RE 1O80A 2EOTA 3HP3A 1SDFA 2B2YC 4X3SA 1U4LA 1GUWA 2L9HA 1S4ZA 5D14A 2KUMA 2MGSA 2Q8TA 4QUFA 2D9UA 1B53A 2K1BA 1XX8A 3I91A 1WVLA 1TVXA 3I90A 1ILQA 1MI2A 2BDNA 1HFGA 1B3AA 5CORA 5CBEE 4ZAIA 1ESRA 2B2VC 2DY7A 1HHVA 3DM1A 5E4XA 5EPKA 3FDTA 4RWSC 4IURA 3MTSA 3KUPA 1X3PA 2KVMA 1IL8A 1CA6A 1KNAA 3I8ZA 1G2SA 2N88A 3H91A 1CA5A 4HCSA 2K05A 3IFDA 4NW2A 5CMDA 4IUPA 1BNZA 4QUCA 4ZK9B 2J7ZA 1PFMA 2CVRA 4CJ1B 1MSGA 2DY8A 5DNFA 2K28A 3R93A 2MJ8A 1HUNA 5D65A 3QO2A 2MP1A 1RJTA 3G7LA 4ZLTF 2B2WA 1CM9A 1DOKA 1F9QA 3GV3A 4O42A 2RSOA 2H1EA 1B50A 4XT3B 1F9RA 1M8AA 3D6WA 1F2LA 2FINB 5COYA 3GV6A 1HRJA 1A15A 2VXWA 1NR2A 1BF4A 1WTWA 2X6GA 1AZQA 2MPMA 1SSOA 1RODA 1E0BA 2L1BA 2B2WC 4HAEA 4R9WA 4IUUA 1SAPA 1X3QA 5EJWA 3Q6SA 2KEEA 2KEDA 1IKLA 1J8IA 1BO0A 1WTVA 1HFNA 1B2TA 4X3KA 1XYIA 2X6LA 3DEOA 2B2TC 2IL8A 4CJ2C 2X69A 2FMMA 1EOTA 1RTNA 3DEPA 3SVMA 1WD1A 1VMCA 4HSVA 1O7ZA 2NYZD 3KBXA 1ML0D 2RVLA 3LWEA 2EPBA 1NCVA 2NWGA 1B4OA 3TZDA 4HEDA 1QG7A 3TN2A 2R3ZA 1EL0A 1QE6A 3F2UA 1DOLA 1ZXTA 3P7JA 4OIJA 4RAUC 1AZPA 2HDLA 2JYOA 1HUMA 2EE1A 2K01A 3FPUB 3MWYW 4RA8A 2FFKB 3ONAB 2HUGA 5EPJA 2HCIA 4OIKA 4X3TA 1KNEA 1U4MA 1WD0A 2KOLA 1EQTA 1F9SA 2L12A 3N52A 5EKIA 4DN4M 4CJ0B 1WTQA 1WTXA 2M2LA 2SDFA 1DZ1A 1PFBA 1NR4A 1PLFA 2NZ1D 4IUVA 5EQ0A 1JICA 1RTOA 4ZKCB 1U4PA 1G6ZA 2N55A 4LMQD 1RHPA 2RSNA 1WTPA 5JJZA 1EIGA 2K03A 2FHTA 1C8CA 1IKMA 3I3CA 4UAIA 2KECA 2B2UA 4XDXA 1NAPA 5E4WC 1G91A 1VMPA 4MN3A 1JE4A 1X32A 1PDQA 4MHEA 1MGSA 1PFNA 1ILPA 1AP0A 5AFWA 4U68A 4ZKBB 1O7YA 5T1IA 5CBAE 2B2TA 1F9PA 2B2UC 2XIWA 3IL8A 1HA6A 5T1GA 1ICWA
chains in the Genus database with same CATH superfamily
2BCOA 2B2YA 5I2XA 3HOZG 3GTQB 3DM3A 1Y1WB 4L5QA 5CR3A 4JI4L 1S5CD 4A93G 1GHJA 1H9KA 3TZUA 2L4NA 1GD7A 2KHJA 3V96A 5IP9G 2PQAA 3T1YQ 2PYKA 1U4RA 1O80A 2EOTA 4A3EB 4OXPA 1SDFA 4RG1A 3HOZH 4LAAA 5I4DA 2KUMA 1ASZA 1I3QB 1SNMA 2Q8TA 4QUFA 2Z1CA 1SMXA 5IP9H 3M3YB 3KDFB 1VS0A 1HHVA 2YTVA 2DUDA 4GOPA 1PZKD 3FEWX 2JN4A 3CD6A 4AYBB 2VS1A 4NKLA 4LK1C 5IWAQ 2F0GA 2LMCB 2CVRA 3H0GB 4FVMA 1TS5A 3D4WA 4CJ1B 3R93A 3S16B 2UXBQ 5C6AA 1VQMA 4K5XA 4DUZQ 4GS3A 3RD4A 3HOUG 2F0PA 3CC4A 2PZTA 1E2ZA 1STEA 3BZDB 1PYBA 1VQ8A 3NQTA 1CK1A 1V1QA 3HZXA 1HUNA 4BBRG 2Z6KA 5FLMG 3VYSA 2R7ZG 4X3KA 2AKWB 3SR1A 1VQJA 3KLSX 3JC66 2G9HD 4KY7A 1E1TA 3VR5A 3KBXA 3TRZA 2R7FA 1TR5A 5GAHC 2CH4W 4UP9A 3U4ZA 2OF1A 3S14B 3D4DA 1EYCA 3NHHA 3MHBA 2AQ2B 3JAMi 2FFKB 1XPUA 4OIKA 3DWAA 1XNQL 3GTGB 4F8MA 2L12A 4FF4A 2HHHL 4V190 3I73A 3KYHC 2KCCA 2RDFA 1AN8A 4FP5D 2K5DA 1QJOA 4DV3Q 5E1FA 3A7LA 1G91A 5C3EH 5E4WC 5JVG3 4JC0A 3NENA 4HR7B 1SJHD 1HNWQ 2JA7B 5CV4A 1G6PA 3KF6B 2B2UC 4OWWB 3OTOL 1EFWA 4EQNA 4A3IB 1EEFD 1SEBD 2K04A 2WINB 3CMAA 1W6KA 1C4QA 1V9PA 3OIQA 5C44B 1XJVA 1H9MA 4A3BG 1AH9A 5BN3A 2Q8IB 4GLAC 3OW2A 1O7LA 3I72A 3BYTB 1VQCA 5IE8A 2R7ZH 3CCMA 3TS0A 1S4ZA 1I50H 1R4QB 2EYPA 2NVXB 2NTTA 1TVXA 2F0JA 1SYEA 4B3SQ 1KRSA 3GQBA 3X3NA 4TSSA 1Q7YC 3RLNA 4PZ6A 3FDTA 2AMCB 2RBMA 4MIUA 2KVMA 4CDEC 1QILA 2N88A 1EIYB 4POGA 3BG3A 3I4MB 3DWPA 3J80c 3S2DH 1CQFA 4A93B 1K83B 2ZJQA 4JI8L 1YJNA 1O78A 3GTMH 4A3IH 1L0WA 2GVBA 2WKDA 4DR4Q 2K5QA 4JI0Q 4DK1A 2F3WA 2F0SA 3HOXH 3K57A 1E0BA 3G48A 2ZXOA 1MJEA 2E5LQ 5I2YA 1NE3A 1X3EA 2NZHA 4XYQA 4CKCA 4KTAA 5CV7A 2BA0A 1JT8A 2LY7A 3NBHA 4ZCKA 1I94Q 1Q1EA 2SEBD 5EBCA 3KF8A 1A63A 2A6EC 1WJJA 1K8GA 4DR1Q 1B44D 4NXMQ 3GTGH 1BOSA 3GTKB 1SNOA 1SMYD 1PH3A 1VQ7A 1TS3A 2R3ZA 2K33A 4A93H 1LO5D 4N9PA 4RAUC 4BBSH 2A6HD 2IT1A 2JYOA 1IW7C 5C5LA 3L3OC 5CV5A 2F0KA 5IODA 1PLFA 3K0XA 2F4IA 1X3GA 4XQQA 4G7OC 4BY1G 2JA5B 4MN3A 4UP8A 4BBSG 4A3JG 1X3FA 1AP0A 4U68A 4GNXA 1SE4A 4LFBQ 4GNXB 3S17B 1UE5A 3KF6A 4JBJA 4JBWA 3CC2A 3GTKH 4YHHL 3Q22A 3HOVB 3EROA 3UDGA 3E9HA 4H0LC 1HZAA 1WTOA 1EIHA 1J9OA 4A3FG 3OMCA 3I4NH 3UE1A 3G6EA 4QB4A 1T5XD 2F0UA 1AW7A 3VA5A 1K73C 4QIWE 1B3AA 1TS2A 1FNUA 1LTBD 2F3VA 4RWSC 5EAYA 4GLVB 2NN6H 3U4VA 4UP7A 2PCFB 1MKHA 1STAA 4HCSA 4UHVA 2O5IC 4WJ4A 1HNWL 4GNXC 5C5MA 4B3RL 1WOCA 3FP9A 2VUMG 4PG3A 4DV0L 5AJ3L 4HIKA 4LNQA 3NQIA 4YY3Q 1DCZA 3U9OA 4XT3B 5KNCA 5JJKA 1Y1VG 3A8KE 2WACA 2KA7A 2ICEC 1AZQA 2YU9B 5JAVA 1J6QA 1RODA 4HJ7A 1X3QA 4DV7Q 2LXKA 3P1HA 1GUNA 1BO0A 4RMFA 1MD2D 4IUNA 4L6TB 4B3SL 3PUXA 4OO1G 2N49A 1W2BA 3G71A 3ER0A 1ONLA 3UDFA 3HOVG 3HRZC 4N8FA 4NDXA 2VW9A 5K36H 4RCOA 4BXXH 1PXUA 3OTOQ 4QL5A 3GTJB 3NEMA 2UUCQ 2NWGA 2F1MA 5M9OA 4HEDA 1QG7A 1XMOL 2WAQE 5BR8Q 1W6JA 1XMQQ 4K2KA 4CDDC 4JK1C 1U9RA 1VCIA 2D0OA 3ULLA 1KNEA 4KJNA 1TT2A 2ZTCA 3M9BA 4F87A 3PO2G 4IPDA 2N55A 3CCVA 2FHTA 5CV8A 3F2DA 4OONA 2OCEA 1LTID 5IY0A 5C0XH 1XTDA 1TWCB 4Q5VA 3FHWA 3PO2B 1XNRQ 4R8IA 2F0QA 1ZKOA 2J4XA 3L9AX 4DR4L 3J7AV 1D2BA 1CHPD 4DAMA 1B9MA 2HCCA 3J81j 4RFBA 3S24A 4WFN3 1U4LA 1SYCA 3GD7A 3S15H 1FR3A 3H15A 3CMEA 1W3SA 5JPNC 1H9RA 2MUYA 5CORA 2K50A 1CTMA 2B2VC 3EBEA 1FD7D 3MTSA 2YYZA 4K6DA 3KUPA 4M8AA 1HTLD 4A3GH 1IL8A 2D5DA 2EY5A 1M1KC 3H0GG 2ALYB 3S1QH 4JI4Q 4NW2A 5C0XG 1AE3A 3A74A 4WJWA 5C3WA 4KLKA 5DNFA 4IPCA 2MJ8A 2R6GA 4B3TL 1VF5C 4ZLTF 5C3XA 2SNMA 3SHLA 2RSOA 1EY0A 4NXNL 1X9NA 2E2HB 2R92B 4EVOA 4IO9A 4K8JA 5ELEA 3NSWA 5FLXc 3RZDB 3T1HL 2WFWA 3EN2A 4C3JG 3NTHA 3QG1A 2C9OA 5ELDA 4I7ZC 2EYOA 3QOLA 1K8OA 2F0EA 2SOBA 3CQZH 3KJOA 1STBA 3PMFA 2P5ZX 2RDHA 1Y8OB 1BCPF 1OXVA 4EX5A 2PMZE 4QY7A 5J1ZA 1SFOH 3GTLB 4WJ3M 2MO0A 1QCBD 3CCJA 2I0QA 1S72A 1C7YA 2E2JB 1Y8NB 3T4AC 5C4JH 1AZPA 2R61A 3FPUB 4AYBG 2WP8J 1AFPA 4X3TA 1CFMA 2WIIB 1WD0A 4A3CH 3PO3H 2B63G 1Z9FA 1KABA 4PZ8A 1G8ZD 5C44H 5IT9E 1ESFA 4WRDA 1U4PA 1S3OA 1KC8C 1HCZA 4R4OA 2IHEA 2L0CA 1XPRA 2IX1A 1KDBA 4BA1I 1NAPA 1YEZA 2F0WA 1YNNC 4JI5Q 3CCLA 1QZGA 5AFWA 4ME5A 2PMZB 3A8IE 3CAMA 4CBVA 3ERQA 4AQYL 4P71A 3F2BA 1SNCA 5KIXA 1QNKA 4R8NA 4IFDH 1SLJA 1IHZA 4GN4B 4OO1H 3E0JA 2JA9A 2HDMA 2FJ2A 5EPLA 4X62L 1TWFB 3A7AB 1HZBA 4DU9A 5E7NA 2B2YC 2HD3A 5K36G 1EU3A 4FDBA 2PI2E 2R7DA 1B53A 3HFZB 1H95A 3H94A 3IRBA 2A69D 4KKTA 4R4QA 5LHY1 3M4PA 3F1ZA 3KJPA 4HJ9A 4C3IG 2ASBA 5E4XA 3F2CA 4IURA 4B9XA 4L63B 2BA1A 3U58A 1SFOB 1CA5A 2NVXH 1KDCA 4DF7A 4JI1Q 3VR2A 4IUPA 1FNVA 4PNYA 2PW5A 1ZYRD 4DV5Q 2K75A 4DR7L 3EA6A 2Z9HA 5D65A 5LMUL 2WB1G 1N8RC 4A3MG 2H1EA 1B50A 2EYLA 2KQ3A 2JEAI 2MNAA 1DJRD 4DFAA 3C3LA 1TWGH 4TRDA 2NVQB 5COYA 3GV6A 5IYBG 4X66Q 2BH2A 1FGBD 3S16H 5ELFA 4C3JB 3M4QA 3EIVA 4A3KG 3S2HH 3NBHB 1A6XA 2NTSA 1PRTF 2Q2UA 4LFCQ 2FMMA 3L0OA 1VMCA 1B8AA 1CKOA 4H7BA 1I3QH 1SYDA 2V1CC 2A6ED 3CRKC 3G6JB 1NNXA 1TIID 5IGDA 3TP5A 2KENA 2Z4HA 2RF4A 4POFA 1Y1WG 2GVAA 4DAVA 1VQBA 2EZVA 4PMCA 3HS0C 2O2LD 1NR4A 1YI2A 3CCUA 1J5EQ 4FF2A 4LF8L 3FMCA 1WTPA 4DR1L 1HH2P 1WCMB 4YIJA 1Q8IA 5I9PA 1TKWB 1GHKA 4YWMA 4XDXA 3W5OA 1E2VA 4KD3A 1CI3M 5IT9L 3E6ZX 4ME3A 2PZWA 2F0DA 3J7AF 3MXGA 2CHBD 3J80L 1RDPD 3FRPB 1O7IA 4DUYL 4GOPC 3UI2A 1VQLA 2E74C 3OSOA 2E5LL 4IUTA 1I4GA 3BZKA 4XXEA 3K59A 1B70B 4DR2Q 4A3DG 2DNCA 2E2DC 4X3SA 4JYAL 2NVYH 1VQ9A 3KLRA 2EY6A 2QKIC 3I90A 3MAQA 1GUGA 1QZHA 1N36Q 2EJFC 4QJFA 1PTOH 4AH6A 5KNBA 4DR6L 4APVA 1ENAA 2AQ1B 1Q82C 1X3PA 3J80E 1KDAA 1KNAA 4K0KL 4KMUC 3AMUA 4AQYQ 2N8NA 4DR5L 2NUCA 5J39A 1S5FD 3SEBA 1Z7TA 3R3OA 1CM9A 1DOKA 4RH6A 4DXFA 2CWAA 1Y1WH 1F9RA 1BCPB 3OWEB 2IY5B 2MO1A 2KHSA 2F0NA 4MNOA 1WTVA 3A55A 4DV6Q 5F2DA 3GO5A 5LL6S 5M5XH 3T51B 3SK4A 1OO9B 1VF7A 4L5SA 3CQZB 1WD1A 1IBLL 1CKNA 3ICEA 1PTOF 4XQNA 3DWQA 4DV0Q 2AUKA 2Q2HA 5NUCA 1SYBA 3N6RA 1EU4A 3EQLC 1CZWA 3M85A 4FO2A 2M00A 4KK7A 1DOLA 1M4VA 4J6HA 3VR4A 2VB3X 5HGQA 2KOLA 5IT9c 1HTPA 1UEAB 2CH4A 1GUTA 3SE0A 1RHPA 4KY6A 1LACA 5KNDA 1IKMA 2J0TD 3I3CA 2KECA 5J22A 3AFPA 4A75A 4JI2L 1TWGB 4LFCL 2A68D 3Q23A 3PUYA 1O7YA 4LF7Q 2Y0SG 3EJIA 1HZCA 3MXUA 2F4VL 1LT3D 1BR9A 4DNTB 3KOJA 2RCFA 2F0VA 1DM0B 5JOBA 1Y14B 2UUBL 5FLMH 1MIUA 4K2LA 3S1MH 1LTGD 4DK6C 3NUCA 1HZ9A 1WVLA 3D4RA 1H9SA 2UU9Q 3Q0AA 5ELNA 4ZAIA 2EJGC 3J7YW 4PZ7A 3PIPA 1E1OA 2JA8G 1YZ6A 3CHBD 2BOSA 2HIVA 1NJIC 2VUMB 4KHVA 1MSGA 3H0GH 4KD4A 1Y69U 1PHJA 1SROA 3KK7A 4P74A 2XSCA 2IX0A 2CWPA 1SNQA 3S1QB 4OEMB 3FVQA 5FO9B 1PYWD 3BYYB 4JV5Q 4X6AH 1DGSA 1YNJD 3H6MA 3S17H 2ZTDA 1LTRD 1K0SA 5GAGC 1J8IA 3CU7A 4JW0A 2CQOA 1TQOA 1I4XA 2FMCA 4KHPQ 3L7ZC 1Q90A 2F0HA 3CPWA 1JB3A 1B7YB 1XPOA 3FKIB 3M4OB 1L1OC 2K5VA 4DV1L 5FO7B 2PI2A 1SNDA 2XTIA 3WWVA 5ELCA 3TQYA 1C0AA 2KCTA 2EPBA 2CKZB 4EGVA 3TN2A 2JE6I 5M5WB 2L15A 4HTHA 2YU9H 4LF9Q 3S1NB 1NUCA 5C0XI 3RN2A 1JWUD 3GTOH 1HNZQ 4HSPA 3K7AB 3GTLH 5IGEA 3TMEA 2IWHA 2VQFQ 4ULLA 1RL2A 1STHA 5C4XH 2CCZA 1N36L 1G6ZA 1YHBA 3HKZG 3OPOA 3IKJA 4DV6L 4A3GG 1X65A 4NPSA 4IQZA 1X55A 4DUZL 1FGUA 2I07B 3QJYA 1RD9D 1KXLA 4DV2Q 1PH2A 3PIP3 2ICIA 4HMIA 3KLWA 1XNQQ 4B08A 3J81L 5FOBB 4O1NA 4E6IA 1NBWA 3HOXB 1LTAD 1EY7A 1WYDA 1IZ6A 2IX3A 3GTMB 3HOVH 2A5HA 3TP6A 2MGSA 4KHZA 1HJPA 1V8QA 3GTJH 2NVQH 5LMNQ 3I91A 3T13A 4IFDG 3BS1A 1ESRA 1VQAA 2PNRC 5M5YH 1VQ5A 1GJXA 1AEXA 1D6EC 1JOKA 4Q0FA 1N34Q 3C1FA 3I4MG 1XWEA 3TSSA 2CFMA 1KIXA 1OXSC 3SXHA 1BVSA 2J7ZA 2V4DA 3T53B 2E2JH 2Q2TA 2JXMB 2CW0C 3J7A5 4B3ML 3R2IA 4MTNA 2NN6G 2O4XA 3MVVA 2A6HC 3KDFA 2I5MX 1FYCA 5KYLA 2VXWA 1NR2A 3EVQA 4OELB 3CP0A 1PFSA 1JE5A 3M4YA 2L5TA 2D2CC 2OQ0A 4EQPA 1D5ZC 2UU9L 5FO8B 1VQFA 3Q24A 4R1JA 1YJWA 4QF4A 3HOUB 4QGUA 4IPGA 1Z47A 2LFNA 3RLOA 4HMJA 4H44C 2K14A 1K0RA 2YV5A 1F77A 4Z9CB 3PUVA 3SK8A 4ZUIA 1Y1VH 3A56A 3P7JA 4RKBA 2CW0D 1KHIA 1PRTB 1ZYRC 1QOHA 3STBD 3MEFA 3HGBA 4C2MB 1EUJA 2NZOA 4LUZA 3VR6A 1JICA 4ZKCB 1E3PA 1TWAH 2K03A 3VYTA 3GTQH 4DV5L 2B2UA 1DD2A 2C35B 1VMPA 1NMFA 5DLQE 5C44G 2K6AA 1ILPA 3RN5A 4JI7Q 2IJ0A 1SBBB 2QEXA 1FL0A 3H09A 2MQHA 3E5SA 2DJFC 5FJ8G 1II3A 1R9TH 5EKKA 4DK3C 5E3FA 1LT4D 3FKIH 4XT1B 1QWYA 1HNZL 2XNAC 1TWHH 2L9HA 1JWMD 2B3GA 1JCKB 2H4OA 2AQ3B 2OXPA 4QMGA 2UXBL 1EY6A 3I4OA 3AQQA 4GKJL 3PIO3 1K28A 1KLUD 4K5VA 5JVH3 3JAML 1JC7A 4ODGA 1IBKL 4DV1Q 1Y8PB 5BN5A 4NXNQ 2VNUD 1A2UA 1CA6A 2UXCL 4DUYQ 3I8ZA 5BN4A 1I6VC 3M3YH 3PQIA 3HOYB 3NE5B 3VYUA 3HOZB 4A3IG 2EXZA 3HKZE 3I7FA 1GUOA 2QGQA 1VQDA 1G291 1PYSB 3AYHB 3NP8A 2LKVA 1SSOA 1SAPA 1Q1BA 2UXDQ 1VQ6A 2Z4IA 3H3VC 3BDLA 2KEDA 3AEVA 4A76A 2X6LA 3LWUA 1UE7A 4YCVA 5JJLA 2K4KA 3PUWA 4KY5A 5IP7H 1EWIA 1EOTA 2K32A 1E24A 4LWCA 5A2QE 4A3KH 3ZYYX 5DEHA 4KN7C 2DNEA 4A3BH 3P75A 4IN3A 2KCMA 1QB5D 1P8LA 4OIJA 4LUOA 2K01A 5M5YB 2A74C 3PF5A 3MWYW 4DAPA 1SJED 5C3EG 1EYGA 1Q12A 5JPMC 4LF4L 4DV7L 3RZOB 5G3LF 1PFBA 1EY4A 2R92H 4FF1A 1C9OA 1SMYC 4JPBW 3MC0B 1IBLQ 1EIGA 5GROA 1P16A 1XXGA 3QWNA 2K5NA 4BBRB 1PTOD 5A2QL 4HN7A 2RDGA 2IPKD 2XWBB 4YY3L 1TU2B 2Z8LA 1IYVA 4CGYB 2KHIA 1BBXC 4B3MQ 3TS2A 3R8BA 2B2VA 1DOMA 3V2TA 5EBDA 1Q3LA 2F0FA 3PGZA 1LUZA 1GKHA 2Q8RE 5DAUA 5JEAH 2ZM6L 5C4ZA 4KKUA 1EIFA 4LF5Q 3MEHA 1F2MA 2D9UA 4PQXA 3DLLA 1I6HB 2CQAA 2XRSD 1U5KA 1LLRD 2DY7A 5EKLA 3ND9A 1F2ZA 2F4VQ 2PPBC 3JAMc 2EY1A 5C4HA 4X66L 1YJ9A 2R93H 2Z0SA 2K05A 4EQOA 1GXDC 4QUCA 3M7GA 4ZK9B 3SK6A 1PH7A 2LXJA 2EYHA 2KCNA 3L2PA 4R4IA 2B39A 3QO2A 3U50C 3UE0A 1UEBA 2JA8B 4FXKC 3TP7A 5M3FG 3A5ZB 2JQOA 3D6WA 5K5PA 3MA2B 4X65L 4DV4L 1A15A 4FXDA 4RGTA 2X6GA 4DK0A 1CSQA 4KI0A 3Q6SA 1EEID 2KEEA 1IKLA 1XTCD 3R2TA 4GKJQ 2MHVA 1SN8A 1V1PB 4Y7NH 4G7HC 5M3MB 1YNND 3SVMA 4RGMA 4IZ8A 2ZXRA 4J8QA 1PH1A 1WTHA 1J5EL 4IOCA 1ENCA 3F8TA 4LF8Q 1KAAA 5M5XB 1HR0Q 1NY4A 1I94L 2NB0A 4DR3Q 3KFUA 5IWAL 4J1MA 1V1PA 4GZYC 5DM73 5TSSA 3UDXA 1Q81C 4RHRA 1IBMQ 3S9WA 2F0TA 2OQKA 4WORA 4JBKA 4LF6L 4RCNA 4K14A 1GOZA 2ATWA 3MXNA 4DR2L 1X6OA 4B3TQ 1JE4A 3PSIA 1PDQA 2K7VA 1NSNS 1RCVD 2YTYA 2AHOB 5HURA 3W2DA 3HG9A 1CUKA 2MFIA 1QVFA 4YCUA 3CW2C 3IL8A 2HIXA 3O13A 4NMZA 4JI6L 3X3MA 1MHWC 3AB9A 1I4RA 3BDCA 2AWOA 4K6LA 3QB3A 3NPPA 3GTPH 4X3UA 2VQFL 4L5RC 3CF5A 2JA7H 2RCNA 3K80C 3MZ5A 2A69C 5M3MH 5HGTA 1E2WA 4LF4Q 4G57A 4KJOA 4HIOA 4FYDA 1GUWA 1SE8A 4BY7H 5D14A 3NELA 4LFBL 4R4CA 4TVAB 4PMWA 1LM0A 1XX8A 2K5HA 2OT2A 3CCSA 4JI5L 4V0BA 2IHFA 1MI2A 2BDNA 2DN8A 2WAQB 1VQKA 1LTTD 4XQJA 2Q2IA 2HHHQ 1A3VA 5IYDH 2WV6D 3K7UC 4C1NI 1B1ZA 1JMCA 3NBIA 4LF9L 1EQRA 3B6YA 3BU2A 4OX9L 2JA6B 2ZTEA 3K5LA 1UNSA 4O0AA 4QIWB 4X62Q 3J7ZC 4A3MH 5KRUA 2N78A 4CDFC 1WCMH 2G9DA 1CQVA 1D5XC 2AUJD 4C3IH 2WKCA 3V05A 4GKKL 1F2LA 2NVTH 2FINB 4F7XA 2RKSA 1GVPA 1BF4A 4P73A 4BBSB 2B63H 2R93G 4R9WA 3J81c 3CCQA 1HXYD 4LF5L 3J81E 4B3RQ 2B2TC 3I2ZA 2QDBA 4G7ZC 1VQHA 4RGNA 1Q86C 4HSVA 1HQRD 1EQVA 4BY7G 1X54A 1YNJC 4MTKA 3QR8A 2DJGC 4FNFA 3CCEA 5CV9A 1UE1A 4JBMA 1B4OA 5EGTA 1UE6A 1PTOB 3CCRA 1KLGD 5A35A 1BBWA 2OTJA 3M7NA 3ZJYC 1U4MA 3E3XA 1MBYA 3N52A 5IYCG 4BBRH 1GM5A 4DN4M 4DV4Q 2M2LA 3RMHA 2A73B 2VB2X 5C0XJ 3I4NB 4IJLA 1H9JA 4H13C 1M90C 1D1KA 1TWHB 4FXGC 3TREA 2ES2A 3HKZB 2VUMH 1KRTA 2BE5D 2YTXA 5IYDG 1X32A 2OTLA 1VQEA 4UY8C 5C4XG 4A3FB 4IFDJ 5I6WA 1A62A 5C4JB 1VQNA 1L0XB 5D3IB 2UUAL 4GN5A 5ELBA 1SR3A 1JB7A 5M3MG 4DXGA 4C3HH 4C3HB 1CSPA 3OIPA 1JQYD 4U673 4GOPB 3LNNA 3AU7A 1BDOA 2K5WA 2R7ZB 3HP3A 1TWAB 3AFQA 1TY0A 2ZJPA 1IBML 1D5MC 2F0MA 3RR5A 2IW3A 2WAQG 1FJGQ 3HOWB 1PH9A 1OTCA 4JI7L 2RHSB 1T5EA 1K3BC 3DM1A 1E22A 3OHXC 3G4SA 5C3EB 1EOVA 3CPFA 2PO4A 1L1OA 1SNPA 1JJ2A 2RQXA 1BNZA 1Q46A 2DY8A 4RKLA 4A3CG 1S40A 3RLFA 1A3UA 1SXTA 3J80i 4UPAA 3G7LA 5IOCA 2B2WA 3NTKA 1DXMA 3VR3A 4AIMA 4DR3L 1K8AC 1VDZA 1M8AA 1ICFB 1HRJA 1T9HA 2JA6G 1NTGA 4BWGB 2WB1E 1IBKQ 1YNXA 1VQIA 3HKSA 5IGGA 2EDGA 2VL6A 2JA5H 4YWKA 2IL8A 2EYJA 4CJ2C 4HIDA 4K0KQ 2E76C 1VQPA 1CKNB 2F0OA 4P72A 3DEPA 1JJGA 3T16A 1O7ZA 3IFTA 1BXTA 4OHJA 5DM63 4JI6Q 3RUZA 3TZDA 4JYAQ 2A19A 3VYRA 1LT5D 1JORA 4TKOB 4M1UB 4L5TA 5EPJA 3W3AA 1PVOA 3J81i 3T56B 1EQTA 1F9SA 3OW7A 4DR6Q 4CJ0B 1JR0D 4KV6A 5CV6A 5IYBH 1L2FA 2UXCQ 5AJ3Q 1K3RA 4IFDI 4BA2I 3PF4A 5D3DA 1WCMG 4PV1C 1RF2D 4L8JA 3A0JA 4O2DA 2XGTA 1MGSA 5CGKA 2B8GA 4OWXB 1N32Q 4ZKBB 5T1IA 4A3LH 1F9PA 3A8JE 3W1BA 2EYMA 2JSOA 1WI5A 5KGUA 2AWNA 2I5LX 1TY2A 3W1GA 2G5DA 4IUQA 1A0IA 1PZID 4S3SA 2VQEQ 3LX0A 2UXDL 5GADC 5KEEA 2QA4A 4I7AA 3HOWH 2KBNA 1G2TA 1G51A 3TEHB 2XRQD 1JJCB 4A3EH 2F0LA 4ALPA 3K5MA 5JEAG 1EYDA 2ZXPA 1PRTD 2QF7A 4A3LG 4HIMA 2HQLA 3SGIA 2C5CA 1WFQA 4J15A 2B63B 3C1EA 1ASYA 2DGYA 1JOOA 1VQ4A 1N33L 3GTOB 5LMNW 1BUVT 3ERSX 1JWSD 1I6HH 1KTKA 3IFDA 1L1OB 1SYGA 2VZAA 5FK9C 1SE2A 1PFMA 1ET6A 3PIOA 1X56A 1OXTA 2K28A 3M4OH 2F0IA 2F3IA 3I4LA 3PO2H 2XN9C 4HJAA 2EIFA 4CKBA 1F9QA 3MXPA 1QNUA 3URYA 4C2MH 4C56C 3WOEA 1A2TA 1OXXK 1XMQL 1SRUA 2LSSA 4LW1A 4IUUA 2HT1A 5LMUQ 1C48A 2XVSA 5G3LD 1XYIA 1IW7D 3QIAA 1EY5A 1D1IA 2QILA 3K6OA 2TMPA 4JI0L 1JOQA 4K8IA 4AYBE 3H3VI 4C3JH 2A1AA 2UUAQ 3C2PA 3CXCA 4ZUJA 5IP7G 3E9IA 3OYYA 3F2UA 4GN3B 1CKMA 2L55A 4RGOS 1IYJB 4DAYB 4LJZC 4ZYSA 1XNRL 4DAYA 1TS4A 4BY1H 4N8X1 3S15B 3KBGA 1U0LA 1FVIA 2RHQB 3CRLC 5FLXL 4KHPL 4XIGS 3A5UA 1FJGL 1CHQD 4JI3L 4A3KB 5JJZA 3S1MB 1C8CA 1S5DD 1I50B 2BDOA 3MFYA 5CYUA 2JEBI 4X64L 4LFAQ 5CBAE 1YIJA 2B2TA 1TWCH 4X65Q 5T1GA 1ICWA 2WB1B 1WTRA 2E75C 4A3DH 1DONA 2E2HH 1YHAA 3HEJA 4A3FH 3K58A 3MFGA 2Y0SE 3MXNB 1Q8KA 1YVCA 4JOIA 3JAME 4NP5A 2K1BA 3A54A 3ND8A 1ILQA 1HNXL 3ITPA 1UAPA 3TP8A 4FF3A 1D7QA 2JJQA 1FNWA 1G2SA 3H91A 3CC7A 1N32L 5CC4A 3DUZA 1QVGA 3NTIA 3HOXG 4UDUC 4ILWA 5M3FH 4ID6A 1PZJD 4G4KA 3K5NA 1QUQA 2PW7A 1F2YA 5KYIA 4O42A 1BCPD 4LF6Q 4R4TA 1ET9A 3DXJC 1PMRA 3S1NH 3BJUA 2O5JC 3VA7A 5I6YA 2B2WC 1VQOA 3FPPA 4F88A 3BZCA 4DV2L 4C3IB 4YCWA 5L37A 1OXUA 3DEOA 1N34L 3HOWG 3GP7A 1QUQB 1IYUA 1GO3E 2LS01 1S5BD 2NYZD 2D0PA 4I65A 4GKKQ 5IGFA 2E8GA 4Y7NB 2VQEL 4A3JB 2B8FA 1LTSD 1TWFH 4ABNA 2XWJB 1K9MC 2HCIA 1LABA 4JI2Q 3WDNA 3DMUA 4BY7B 4DA2A 1WTQA 3BVZA 1DZ1A 4TQUS 1I4PA 3QOJA 3RNUA 4GLXA 2B29A 2UUCL 1KL9A 4OX9Q 2OEOA 3D31A 3NXWA 1XMOQ 2OWOA 4JG2A 4LMQD 5BR8L 2NVYB 5FKAC 4A3GB 1N33Q 4UAIA 4LUVA 3PUZA 3BVMA 1PFNA 3BDOA 3PO3G 1BKBA 1V43A 5HY6A 1GUSA 2BE5C 2XIWA 3UDIA 3DHQA 1HA6A 1MJCA 2H5XA 2ID0A 3I70A 2RA4A 3K7AH 1RIPA 2NVTB 4DR7Q 5C4XB 3P20A 4P75A 4NXML 2JA5G 4KKSA 4QQBX 2E2IB 4LF7L 2E2IH 4YWLA 4HJ5A 2EJMA 5ISRA 1I5FA 3FKIG 5CBEE 1PTOC 5FJ8H 3H3VH 5M3FB 5EPKA 3OMGA 1HPCA 1A8VA 5J3BA 2UUBQ 3KLSA 2JA6H 1IL2A 4OO1I 4X64Q 1PH4A 4LFAL 2R92G 5FLXE 1Y1VB 1PH5A 1PRTC 3OWFA 5ELOA 1EFID 3KF8B 2MP1A 1RJTA 3HOUH 1LTLA 3GV3A 5H1SE 3BVGA 1KD1C 3S1RH 1WTWA 2NBFA 4YHHQ 2L1BA 5EJWA 1D8LA 3STBC 1CZGA 1V1OA 2N3SA 4JI3Q 2JA8H 3S2HB 2PZUA 2GN5A 2ZJRA 1HFNA 2PNHA 2ZT9C 1HNXQ 3D0FA 4A3DB 3GTPB 4DNIA 1YITA 4IJHA 5GAEC 3I4NG 4IALA 4Y52H 1KQSA 1K83H 1IXRA 1SE3A 1AE2A 4DPGA 1ML0D 3LWEA 1NCVA 5I9OA 3T1HQ 1LYLA 2NN6I 3PO3B 1DYQA 1EWHA 5LL6X 4ZRZA 4C3HG 1QE6A 4OL7A 2A8VA 3T1YL 1CT1D 1HUMA 1NMGA 2HQEA 3I56A 2TSSA 3ONAB 2HUGA 3NK9A 4ZQ3A 1A3TA 5EKIA 1VQGA 4P2CB 4DR5Q 3TDQA 4IUVA 1KAWA 2EVBA 5EQ0A 3Q8DA 3U9SA 4XYOA 2EXDA 4DNRB 1BCPC 2VY3A 4JCVE 3D3RA 1LT6D 3PCOB 2QCPX 1PA6A 4IOAA 4RHSA 4A4IA 2F52A 3HOYH 1H9SB 1HQMC 3RZDH 2ENBA 1EZ6A 5IYCH 4QCLA 1K8MA 2Z6KC 1LV9A 3I55A 1I4QA 3ULJA 4OWTB 1HR0W 2JP1A 3S1RB 4KN4C 1MSHA 2L11A 5IIFA 1STYA 3TBIB 5JEAJ 4BXXG 3VDYA 1PH6A 3RZOH 3NWTA 2KJXA 2M9VA 4OGQC 1HFGA 3S14H 5JJIA 2BH8A 1ZEQX 2SNSA 4JVZA 3SK5A 2PQAB 2QEJC 4HJ8A 2D62A 4CKEA 1EQQA 2R93B 5CMDA 4DGZA 3HOYG 1BQQT 4CHTB 1STGA 1UWVA 2GA4B 5LMNL 4C1NK 1RKNA 3K5OA 2ZM6Q 3D8GA 1B3QA 2EY2A 1QVCA 1I4HA 3K0YA 2Y0SB 1EYAA 5M5WH 2F03A 1S5ED 2MPMA 2Z6BA 4JI1L 4DKAC 1E7ZA 4HAEA 2EYFA 3D6CA 4BY1B 1L0YB 3GDEA 4DV3L 3K8AA 4A3EG 1B2TA 4CDCC 4BS9A 3WOFA 1HA5A 2X69A 1TXYA 2A68C 2I5HA 1RTNA 2JK8A 2RVLA 1EZ8A 1EY9A 2FXQA 2JA7G 4N9TA 1YBYA 1EL0A 5IGCA 4A3JH 2QDLA 1ZXTA 3E0EA 1UUPA 4NB3A 2HDLA 3CKIB 2EE1A 4RA8A 1SYFA 1Z6HA 4JOIC 3NWSA 3ULPA 3OOCA 2PQEA 1BBUA 3C46A 1WTXA 4K5WA 2QW7A 2SDFA 2EQSA 2NZ1D 1B9NA 3SDZA 4EQ5A 1R4PB 1RTOA 3I4MH 3S2DB 3K81C 1EY8A 2I46A 2RSNA 4PMBA 2K52A 3LGJA 1YHQA 3EFXD 1EWCA 3IAYA 1R9TB 4XTCS 4IPHA 4A3BB 4B9WA 4MHEA 1N9WA 1PH8A 4JV5L 5IGBA 1PV4A 4H02A 1HR0L 3PV0A 1STNA 4HCEA 1ENFA 5GQOA 4A3MB 4MZ9A 4JI8Q
chains in the Genus database with same CATH topology
2BCOA 2B2YA 5I2XA 3GTQB 1Y1WB 5CR3A 1S5CD 1GHJA 1H9KA 3TZUA 2L4NA 3V96A 2PYKA 1U4RA 1O80A 2EOTA 4A3EB 1SDFA 4LAAA 5I4DA 2KUMA 1I3QB 1SNMA 4QUFA 2Q8TA 2Z1CA 3M3YB 1HHVA 1PZKD 3FEWX 4AYBB 4NKLA 4LK1C 2F0GA 2LMCB 2CVRA 3D4WA 4CJ1B 1TS5A 3H0GB 4FVMA 3R93A 3S16B 5C6AA 4K5XA 3RD4A 2F0PA 2PZTA 1E2ZA 1STEA 3BZDB 3NQTA 1CK1A 3HZXA 1HUNA 3VYSA 4X3KA 3SR1A 3KLSX 2G9HD 4KY7A 3VR5A 3KBXA 1TR5A 2OF1A 3S14B 3D4DA 1EYCA 3NHHA 3MHBA 2AQ2B 2FFKB 4OIKA 3DWAA 3GTGB 4F8MA 2L12A 4FF4A 4V190 3I73A 2KCCA 2RDFA 1AN8A 4FP5D 2K5DA 1QJOA 5E1FA 3A7LA 1G91A 5E4WC 5JVG3 4HR7B 1SJHD 2JA7B 5CV4A 2B2UC 4EQNA 4A3IB 1EEFD 1SEBD 2K04A 2WINB 1W6KA 1C4QA 3OIQA 5C44B 1H9MA 5BN3A 2Q8IB 1O7LA 3I72A 3BYTB 1S4ZA 1R4QB 2EYPA 2NVXB 2NTTA 1TVXA 2F0JA 1SYEA 3GQBA 3X3NA 4TSSA 3FDTA 2RBMA 4MIUA 2KVMA 1QILA 2N88A 3BG3A 3I4MB 3DWPA 4A93B 1CQFA 1K83B 1O78A 2WKDA 2K5QA 4DK1A 2F3WA 2F0SA 3K57A 1E0BA 2ZXOA 5I2YA 4XYQA 4CKCA 4KTAA 5CV7A 2BA0A 2LY7A 3NBHA 1Q1EA 2SEBD 5EBCA 3KF8A 2A6EC 1B44D 1BOSA 3GTKB 1SNOA 1SMYD 1TS3A 2R3ZA 2K33A 1LO5D 4N9PA 4RAUC 2A6HD 2IT1A 2JYOA 1IW7C 5C5LA 3L3OC 5CV5A 2F0KA 5IODA 1PLFA 2F4IA 4XQQA 4G7OC 2JA5B 4MN3A 1AP0A 4U68A 1SE4A 3S17B 4JBWA 3Q22A 3HOVB 3EROA 4H0LC 1WTOA 1EIHA 1J9OA 3OMCA 4QB4A 1T5XD 2F0UA 1AW7A 3VA5A 1B3AA 1TS2A 1FNUA 1LTBD 2F3VA 4RWSC 2NN6H 2PCFB 1STAA 4HCSA 2O5IC 5C5MA 3NQIA 1DCZA 3U9OA 4XT3B 5KNCA 3A8KE 2WACA 2KA7A 2ICEC 1AZQA 2YU9B 5JAVA 1RODA 1X3QA 3P1HA 1GUNA 1BO0A 1MD2D 4IUNA 4L6TB 3PUXA 4OO1G 1ONLA 3HRZC 4NDXA 5K36H 4RCOA 1PXUA 3GTJB 2NWGA 2F1MA 5M9OA 4HEDA 1QG7A 1W6JA 4K2KA 4JK1C 1U9RA 1VCIA 1KNEA 1TT2A 4KJNA 4F87A 2N55A 2FHTA 5CV8A 1LTID 5C0XH 1TWCB 4Q5VA 3PO2B 4R8IA 2F0QA 1ZKOA 2J4XA 3L9AX 3J7AV 1D2BA 1CHPD 1B9MA 2HCCA 4RFBA 4WFN3 1U4LA 1SYCA 3GD7A 1FR3A 5JPNC 1H9RA 2MUYA 5CORA 1CTMA 2B2VC 1FD7D 3MTSA 2YYZA 4K6DA 3KUPA 4M8AA 1HTLD 1IL8A 2D5DA 2EY5A 4NW2A 5C0XG 5C3WA 4WJWA 5DNFA 2MJ8A 2R6GA 1VF5C 4ZLTF 5C3XA 2SNMA 3SHLA 2RSOA 1EY0A 2E2HB 2R92B 4EVOA 4K8JA 5ELEA 3NSWA 3RZDB 4C3JG 3NTHA 3QG1A 2C9OA 5ELDA 4I7ZC 2EYOA 3QOLA 1K8OA 2F0EA 2SOBA 1STBA 3PMFA 2RDHA 1Y8OB 1BCPF 1OXVA 5J1ZA 3GTLB 1QCBD 2E2JB 1AZPA 1Y8NB 3T4AC 2R61A 3FPUB 2WP8J 1AFPA 4X3TA 1CFMA 2WIIB 1WD0A 1KABA 1G8ZD 5IT9E 1ESFA 4WRDA 1U4PA 1HCZA 2L0CA 2IX1A 1KDBA 4BA1I 1NAPA 2F0WA 1YNNC 5AFWA 4ME5A 2PMZB 3A8IE 4CBVA 3ERQA 1SNCA 5KIXA 1QNKA 4R8NA 4IFDH 1IHZA 4OO1H 3E0JA 5EPLA 2HDMA 2FJ2A 1TWFB 3A7AB 4DU9A 2B2YC 5K36G 1EU3A 1B53A 3H94A 2A69D 4KKTA 5LHY1 4C3IG 5E4XA 4IURA 4B9XA 4L63B 2BA1A 1SFOB 1CA5A 1KDCA 4DF7A 3VR2A 4IUPA 1FNVA 4PNYA 2PW5A 1ZYRD 3EA6A 5D65A 2H1EA 1B50A 2EYLA 2KQ3A 2JEAI 2NVQB 1DJRD 4DFAA 3C3LA 4TRDA 5COYA 3GV6A 1FGBD 5ELFA 4C3JB 1A6XA 2NTSA 1PRTF 2FMMA 1VMCA 4H7BA 1SYDA 2A6ED 3CRKC 3G6JB 1TIID 5IGDA 3TP5A 2Z4HA 4DAVA 2EZVA 4PMCA 3HS0C 2O2LD 1NR4A 4FF2A 3FMCA 1WTPA 4YIJA 1WCMB 5I9PA 1Q8IA 1TKWB 1GHKA 4XDXA 1E2VA 4KD3A 1CI3M 5IT9L 3E6ZX 2PZWA 2F0DA 3J7AF 3MXGA 2CHBD 3J80L 1RDPD 3FRPB 3UI2A 2E74C 3OSOA 4IUTA 1I4GA 4XXEA 3K59A 2DNCA 2E2DC 4X3SA 3KLRA 2EY6A 2QKIC 3I90A 3MAQA 1GUGA 2EJFC 5KNBA 1PTOH 1ENAA 2AQ1B 1X3PA 3J80E 1KDAA 1KNAA 4KMUC 3AMUA 2NUCA 5J39A 1S5FD 3SEBA 1Z7TA 3R3OA 1CM9A 1DOKA 4RH6A 4DXFA 1F9RA 1BCPB 3OWEB 2KHSA 2F0NA 1WTVA 3A55A 5F2DA 3GO5A 5LL6S 3T51B 3SK4A 1OO9B 1VF7A 3CQZB 1WD1A 1PTOF 4XQNA 3DWQA 2AUKA 5NUCA 1SYBA 3N6RA 1EU4A 3EQLC 1CZWA 3M85A 4FO2A 2M00A 4KK7A 1DOLA 1M4VA 4J6HA 3VR4A 2VB3X 2KOLA 1HTPA 1UEAB 1GUTA 3SE0A 1RHPA 4KY6A 1LACA 5KNDA 1IKMA 2J0TD 3I3CA 2KECA 5J22A 1TWGB 2A68D 3Q23A 3PUYA 1O7YA 3EJIA 3MXUA 1LT3D 1BR9A 4DNTB 2F0VA 1DM0B 5JOBA 4K2LA 1LTGD 3NUCA 1WVLA 3D4RA 1H9SA 3Q0AA 4ZAIA 2EJGC 3J7YW 3CHBD 2BOSA 2VUMB 4KHVA 1MSGA 4KD4A 1Y69U 3KK7A 2XSCA 2IX0A 1SNQA 3S1QB 3FVQA 5FO9B 1PYWD 3BYYB 1YNJD 3H6MA 1LTRD 1J8IA 3CU7A 1TQOA 1I4XA 2FMCA 3L7ZC 1Q90A 2F0HA 1JB3A 3FKIB 3M4OB 5FO7B 1SNDA 5ELCA 2EPBA 4EGVA 3TN2A 2JE6I 5M5WB 4HTHA 3S1NB 1NUCA 5C0XI 1JWUD 4HSPA 3K7AB 5IGEA 3TMEA 2IWHA 4ULLA 1STHA 1G6ZA 3OPOA 3IKJA 4IQZA 2I07B 3QJYA 1RD9D 3PIP3 2ICIA 4HMIA 4B08A 3J81L 5FOBB 4O1NA 4E6IA 3HOXB 1LTAD 1EY7A 2IX3A 3GTMB 2A5HA 3TP6A 2MGSA 4KHZA 1V8QA 3I91A 3T13A 4IFDG 3BS1A 1ESRA 2PNRC 1GJXA 1AEXA 1D6EC 1JOKA 4Q0FA 3C1FA 1XWEA 3TSSA 1OXSC 3SXHA 2V4DA 2J7ZA 3T53B 2JXMB 2CW0C 3R2IA 2NN6G 2O4XA 3MVVA 2A6HC 1FYCA 5KYLA 2VXWA 1NR2A 3EVQA 3M4YA 2L5TA 2D2CC 4EQPA 1D5ZC 5FO8B 3Q24A 4QF4A 3HOUB 1Z47A 2LFNA 4HMJA 4H44C 1F77A 4Z9CB 3PUVA 3SK8A 4ZUIA 3A56A 3P7JA 4RKBA 2CW0D 1PRTB 1ZYRC 1QOHA 3HGBA 4C2MB 3VR6A 1JICA 4ZKCB 2K03A 3VYTA 2B2UA 1DD2A 1VMPA 2K6AA 1ILPA 2IJ0A 1SBBB 3H09A 3E5SA 1II3A 5EKKA 5E3FA 1LT4D 4XT1B 1QWYA 2XNAC 2L9HA 1JWMD 1JCKB 2H4OA 2AQ3B 2OXPA 4QMGA 1EY6A 3PIO3 1KLUD 4K5VA 5JVH3 3JAML 1JC7A 4ODGA 1Y8PB 5BN5A 2VNUD 1A2UA 1CA6A 3I8ZA 5BN4A 1I6VC 3HOYB 3NE5B 3VYUA 3HOZB 2EXZA 1GUOA 3NP8A 1G291 2LKVA 1SSOA 1SAPA 1Q1BA 2Z4IA 3H3VC 3BDLA 2KEDA 2X6LA 3LWUA 3PUWA 4KY5A 1EOTA 2K32A 5A2QE 3ZYYX 5DEHA 4KN7C 2DNEA 3P75A 4IN3A 1QB5D 4OIJA 2K01A 5M5YB 2A74C 3MWYW 4DAPA 1SJED 1Q12A 5JPMC 3RZOB 5G3LF 1PFBA 1EY4A 4FF1A 1SMYC 3MC0B 1EIGA 1XXGA 3QWNA 4BBRB 1PTOD 5A2QL 4HN7A 2RDGA 2IPKD 2XWBB 1TU2B 2Z8LA 1IYVA 4CGYB 1BBXC 3R8BA 2B2VA 1DOMA 3V2TA 5EBDA 1Q3LA 2F0FA 2Q8RE 5DAUA 5JEAH 5C4ZA 4KKUA 3MEHA 1F2MA 2D9UA 4PQXA 1I6HB 2CQAA 2XRSD 1LLRD 2DY7A 5EKLA 3ND9A 1F2ZA 2PPBC 2EY1A 5C4HA 2K05A 4EQOA 1GXDC 4QUCA 3M7GA 4ZK9B 3SK6A 2EYHA 2KCNA 2B39A 3QO2A 2JA8B 4FXKC 3TP7A 3D6WA 5K5PA 3MA2B 1A15A 4FXDA 4RGTA 2X6GA 4DK0A 4KI0A 3Q6SA 1EEID 2KEEA 1IKLA 1XTCD 3R2TA 2MHVA 1V1PB 4G7HC 5M3MB 1YNND 3SVMA 4RGMA 4IZ8A 2ZXRA 4J8QA 1ENCA 1KAAA 5M5XB 2NB0A 4J1MA 1V1PA 4GZYC 5DM73 5TSSA 4RHRA 3S9WA 2F0TA 4WORA 4RCNA 4K14A 1GOZA 3MXNA 1JE4A 1PDQA 2K7VA 1NSNS 1RCVD 5HURA 3W2DA 3HG9A 3IL8A 3O13A 4NMZA 3X3MA 3AB9A 1I4RA 3BDCA 2AWOA 4K6LA 3QB3A 3NPPA 4X3UA 3MZ5A 2A69C 5HGTA 1E2WA 4G57A 4KJOA 1GUWA 4FYDA 5D14A 4PMWA 1XX8A 2OT2A 4V0BA 1MI2A 2BDNA 2DN8A 2WAQB 1LTTD 4XQJA 1A3VA 2WV6D 4C1NI 1B1ZA 3NBIA 2JA6B 3K5LA 1UNSA 4QIWB 5KRUA 2G9DA 1CQVA 1D5XC 2AUJD 2WKCA 3V05A 1F2LA 2FINB 4F7XA 2RKSA 1BF4A 4BBSB 4R9WA 1HXYD 3J81E 2B2TC 2QDBA 4G7ZC 4RGNA 1HQRD 4HSVA 1EQVA 1YNJC 4FNFA 5CV9A 1B4OA 5EGTA 1PTOB 1KLGD 5A35A 3M7NA 1U4MA 1MBYA 3N52A 4DN4M 2M2LA 3RMHA 2A73B 2VB2X 5C0XJ 3I4NB 1H9JA 4H13C 1D1KA 1TWHB 4FXGC 3HKZB 2BE5D 1X32A 4A3FB 4IFDJ 5I6WA 5C4JB 1L0XB 5D3IB 5ELBA 4DXGA 4C3HB 3OIPA 1JQYD 4U673 3LNNA 3AU7A 1BDOA 2K5WA 2R7ZB 3HP3A 1TWAB 1TY0A 1D5MC 2F0MA 2IW3A 3HOWB 1T5EA 3DM1A 3OHXC 5C3EB 2PO4A 1SNPA 2RQXA 1BNZA 2DY8A 4RKLA 3RLFA 1A3UA 1SXTA 3G7LA 5IOCA 2B2WA 3NTKA 1DXMA 3VR3A 1VDZA 1M8AA 1HRJA 4BWGB 5IGGA 2EDGA 2IL8A 2EYJA 4CJ2C 2E76C 2F0OA 3DEPA 3T16A 1O7ZA 3IFTA 1BXTA 4OHJA 5DM63 3RUZA 3TZDA 3VYRA 1LT5D 1JORA 4TKOB 4M1UB 5EPJA 3W3AA 3T56B 1EQTA 1F9SA 3OW7A 4CJ0B 1JR0D 4KV6A 5CV6A 4IFDI 4BA2I 5D3DA 4PV1C 1RF2D 4L8JA 1MGSA 5CGKA 2B8GA 4ZKBB 5T1IA 1F9PA 3A8JE 2EYMA 2JSOA 5KGUA 2AWNA 1TY2A 4IUQA 1PZID 4S3SA 3LX0A 5KEEA 1G2TA 2XRQD 2F0LA 3K5MA 5JEAG 1EYDA 2ZXPA 1PRTD 2QF7A 2C5CA 2B63B 3C1EA 1JOOA 3GTOB 1BUVT 1JWSD 1KTKA 3IFDA 1SYGA 5FK9C 1SE2A 1PFMA 1ET6A 1OXTA 2K28A 2F0IA 3I4LA 2XN9C 4CKBA 1F9QA 3MXPA 1QNUA 3URYA 4C56C 3WOEA 1A2TA 1OXXK 4IUUA 5G3LD 1C48A 2XVSA 1XYIA 1IW7D 3QIAA 1EY5A 1D1IA 2QILA 3K6OA 2TMPA 1JOQA 4K8IA 3C2PA 4ZUJA 3F2UA 4RGOS 2L55A 4ZYSA 4LJZC 4DAYA 1TS4A 3S15B 3KBGA 5FLXL 3CRLC 4XIGS 1CHQD 4A3KB 5JJZA 3S1MB 1C8CA 1S5DD 1I50B 2BDOA 3MFYA 5CYUA 2JEBI 5CBAE 2B2TA 5T1GA 1ICWA 2WB1B 1WTRA 2E75C 1DONA 3HEJA 3K58A 3MFGA 3JAME 4NP5A 2K1BA 3A54A 3ND8A 1ILQA 3ITPA 1UAPA 3TP8A 4FF3A 1FNWA 1G2SA 3H91A 5CC4A 3DUZA 3NTIA 4UDUC 4ILWA 4ID6A 1PZJD 4G4KA 3K5NA 2PW7A 1F2YA 5KYIA 4O42A 1BCPD 1ET9A 3DXJC 1PMRA 2O5JC 3VA7A 5I6YA 2B2WC 3FPPA 4F88A 4C3IB 1OXUA 3DEOA 3GP7A 1IYUA 2LS01 1S5BD 2NYZD 4I65A 5IGFA 4A3JB 4Y7NB 2B8FA 1LTSD 4ABNA 2XWJB 2HCIA 1LABA 3WDNA 3DMUA 4BY7B 4DA2A 1WTQA 3BVZA 1DZ1A 4TQUS 1I4PA 3QOJA 2OEOA 3D31A 3NXWA 4LMQD 2NVYB 5FKAC 4A3GB 4UAIA 3PUZA 3BVMA 1PFNA 3BDOA 1V43A 1GUSA 2BE5C 2XIWA 3DHQA 1HA6A 2ID0A 3I70A 2RA4A 2NVTB 5C4XB 3P20A 4KKSA 2E2IB 2EJMA 5ISRA 5CBEE 1PTOC 5M3FB 5EPKA 3OMGA 1HPCA 4OO1I 3KLSA 5FLXE 1Y1VB 1PRTC 3OWFA 1EFID 2MP1A 1RJTA 3GV3A 3BVGA 1WTWA 2NBFA 2L1BA 5EJWA 1CZGA 1V1OA 3S2HB 2PZUA 1HFNA 2ZT9C 4A3DB 3GTPB 4IALA 1SE3A 1ML0D 3LWEA 1NCVA 5I9OA 2NN6I 3PO3B 1DYQA 1EWHA 5LL6X 4ZRZA 4C3HG 1QE6A 4OL7A 1CT1D 1HUMA 2HQEA 2TSSA 3ONAB 2HUGA 3NK9A 4ZQ3A 1A3TA 5EKIA 4P2CB 3TDQA 4IUVA 2EVBA 5EQ0A 3U9SA 4XYOA 4DNRB 1BCPC 3D3RA 1LT6D 2QCPX 4RHSA 1H9SB 1HQMC 2ENBA 1EZ6A 4QCLA 1K8MA 1LV9A 1I4QA 2JP1A 3S1RB 4KN4C 1MSHA 2L11A 5IIFA 1STYA 3TBIB 5JEAJ 3NWTA 2KJXA 2M9VA 4OGQC 1HFGA 1ZEQX 2SNSA 3SK5A 2QEJC 2D62A 4CKEA 2R93B 5CMDA 4DGZA 1BQQT 4CHTB 1STGA 2GA4B 4C1NK 1RKNA 3K5OA 3D8GA 2EY2A 1I4HA 3K0YA 2Y0SB 1EYAA 2F03A 1S5ED 2MPMA 4HAEA 2EYFA 3D6CA 4BY1B 1L0YB 1B2TA 4BS9A 3WOFA 1HA5A 2X69A 2A68C 1RTNA 2RVLA 1EZ8A 1EY9A 4N9TA 1EL0A 5IGCA 1ZXTA 1UUPA 2HDLA 3CKIB 2EE1A 4RA8A 1SYFA 1Z6HA 3NWSA 3C46A 3OOCA 2PQEA 1WTXA 4K5WA 2SDFA 2NZ1D 1B9NA 3SDZA 1R4PB 1RTOA 3S2DB 1EY8A 2I46A 2RSNA 4PMBA 3EFXD 1EWCA 3IAYA 1R9TB 4XTCS 4A3BB 4B9WA 4MHEA 5IGBA 3PV0A 1STNA 4HCEA 1ENFA 4A3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBX C;  2B2Y A;  1LV9 A;  2RA4 A;  3UI2 A;  4R8I A;  4IUQ A;  2K04 A;  1WTR A;  4IUT A;  2B2V A;  1QNK A;  1DOM A;  2JP1 A;  4X3U A;  1DON A;  1WTO A;  1EIH A;  1Q3L A;  2L4N A;  1J9O A;  1MSH A;  2L11 A;  2HDM A;  2FJ2 A;  5EPL A;  1G2T A;  4XT1 B;  1U4R A;  2HCC A;  2Q8R E;  1O80 A;  2EOT A;  3HP3 A;  1SDF A;  2B2Y C;  4X3S A;  1U4L A;  1GUW A;  2L9H A;  1S4Z A;  5D14 A;  2KUM A;  2MGS A;  2Q8T A;  4QUF A;  2D9U A;  1B53 A;  2K1B A;  1XX8 A;  3I91 A;  1WVL A;  1TVX A;  3I90 A;  1ILQ A;  1MI2 A;  2BDN A;  1HFG A;  1B3A A;  5COR A;  5CBE E;  4ZAI A;  1ESR A;  2B2V C;  2DY7 A;  1HHV A;  3DM1 A;  5E4X A;  5EPK A;  3FDT A;  4RWS C;  4IUR A;  3MTS A;  3KUP A;  1X3P A;  2KVM A;  1IL8 A;  1CA6 A;  1KNA A;  3I8Z A;  1G2S A;  2N88 A;  3H91 A;  1CA5 A;  4HCS A;  2K05 A;  3IFD A;  4NW2 A;  5CMD A;  4IUP A;  1BNZ A;  4QUC A;  4ZK9 B;  2J7Z A;  1PFM A;  2CVR A;  4CJ1 B;  1MSG A;  2DY8 A;  5DNF A;  2K28 A;  3R93 A;  2MJ8 A;  1HUN A;  5D65 A;  3QO2 A;  2MP1 A;  1RJT A;  3G7L A;  4ZLT F;  2B2W A;  1CM9 A;  1DOK A;  1F9Q A;  3GV3 A;  4O42 A;  2RSO A;  2H1E A;  1B50 A;  4XT3 B;  1F9R A;  1M8A A;  3D6W A;  1F2L A;  2FIN B;  5COY A;  3GV6 A;  1HRJ A;  1A15 A;  2VXW A;  1NR2 A;  1BF4 A;  1WTW A;  2X6G A;  1AZQ A;  2MPM A;  1SSO A;  1ROD A;  1E0B A;  2L1B A;  2B2W C;  4HAE A;  4R9W A;  4IUU A;  1SAP A;  1X3Q A;  5EJW A;  3Q6S A;  2KEE A;  2KED A;  1IKL A;  1J8I A;  1BO0 A;  1WTV A;  1HFN A;  1B2T A;  4X3K A;  1XYI A;  2X6L A;  3DEO A;  2B2T C;  2IL8 A;  4CJ2 C;  2X69 A;  2FMM A;  1EOT A;  1RTN A;  3DEP A;  3SVM A;  1WD1 A;  1VMC A;  4HSV A;  1O7Z A;  2NYZ D;  3KBX A;  1ML0 D;  2RVL A;  3LWE A;  2EPB A;  1NCV A;  2NWG A;  1B4O A;  3TZD A;  4HED A;  1QG7 A;  3TN2 A;  2R3Z A;  1EL0 A;  1QE6 A;  3F2U A;  1DOL A;  1ZXT A;  3P7J A;  4OIJ A;  4RAU C;  1AZP A;  2HDL A;  2JYO A;  1HUM A;  2EE1 A;  2K01 A;  3FPU B;  3MWY W;  4RA8 A;  2FFK B;  3ONA B;  2HUG A;  5EPJ A;  2HCI A;  4OIK A;  4X3T A;  1KNE A;  1U4M A;  1WD0 A;  2KOL A;  1EQT A;  1F9S A;  2L12 A;  3N52 A;  5EKI A;  4DN4 M;  4CJ0 B;  1WTQ A;  1WTX A;  2M2L A;  2SDF A;  1DZ1 A;  1PFB A;  1NR4 A;  1PLF A;  2NZ1 D;  4IUV A;  5EQ0 A;  1JIC A;  1RTO A;  4ZKC B;  1U4P A;  1G6Z A;  2N55 A;  4LMQ D;  1RHP A;  2RSN A;  1WTP A;  5JJZ A;  1EIG A;  2K03 A;  2FHT A;  1C8C A;  1IKM A;  3I3C A;  4UAI A;  2KEC A;  2B2U A;  4XDX A;  1NAP A;  5E4W C;  1G91 A;  1VMP A;  4MN3 A;  1JE4 A;  1X32 A;  1PDQ A;  4MHE A;  1MGS A;  1PFN A;  1ILP A;  1AP0 A;  5AFW A;  4U68 A;  4ZKB B;  1O7Y A;  5T1I A;  5CBA E;  2B2T A;  1F9P A;  2B2U C;  2XIW A;  3IL8 A;  1HA6 A;  5T1G A;  1ICW A; 
#chains in the Genus database with same CATH topology
 2BCO A;  2B2Y A;  5I2X A;  3HOZ G;  3GTQ B;  3DM3 A;  1Y1W B;  4L5Q A;  5CR3 A;  4JI4 L;  1S5C D;  4A93 G;  1GHJ A;  1H9K A;  3TZU A;  2L4N A;  1GD7 A;  2KHJ A;  3V96 A;  5IP9 G;  2PQA A;  3T1Y Q;  2PYK A;  1U4R A;  1O80 A;  2EOT A;  4A3E B;  4OXP A;  1SDF A;  4RG1 A;  3HOZ H;  4LAA A;  5I4D A;  2KUM A;  1ASZ A;  1I3Q B;  1SNM A;  2Q8T A;  4QUF A;  2Z1C A;  1SMX A;  5IP9 H;  3M3Y B;  3KDF B;  1VS0 A;  1HHV A;  2YTV A;  2DUD A;  4GOP A;  1PZK D;  3FEW X;  2JN4 A;  3CD6 A;  4AYB B;  2VS1 A;  4NKL A;  4LK1 C;  5IWA Q;  2F0G A;  2LMC B;  2CVR A;  3H0G B;  4FVM A;  1TS5 A;  3D4W A;  4CJ1 B;  3R93 A;  3S16 B;  2UXB Q;  5C6A A;  1VQM A;  4K5X A;  4DUZ Q;  4GS3 A;  3RD4 A;  3HOU G;  2F0P A;  3CC4 A;  2PZT A;  1E2Z A;  1STE A;  3BZD B;  1PYB A;  1VQ8 A;  3NQT A;  1CK1 A;  1V1Q A;  3HZX A;  1HUN A;  4BBR G;  2Z6K A;  5FLM G;  3VYS A;  2R7Z G;  4X3K A;  2AKW B;  3SR1 A;  1VQJ A;  3KLS X;  3JC6 6;  2G9H D;  4KY7 A;  1E1T A;  3VR5 A;  3KBX A;  3TRZ A;  2R7F A;  1TR5 A;  5GAH C;  2CH4 W;  4UP9 A;  3U4Z A;  2OF1 A;  3S14 B;  3D4D A;  1EYC A;  3NHH A;  3MHB A;  2AQ2 B;  3JAM i;  2FFK B;  1XPU A;  4OIK A;  3DWA A;  1XNQ L;  3GTG B;  4F8M A;  2L12 A;  4FF4 A;  2HHH L;  4V19 0;  3I73 A;  3KYH C;  2KCC A;  2RDF A;  1AN8 A;  4FP5 D;  2K5D A;  1QJO A;  4DV3 Q;  5E1F A;  3A7L A;  1G91 A;  5C3E H;  5E4W C;  5JVG 3;  4JC0 A;  3NEN A;  4HR7 B;  1SJH D;  1HNW Q;  2JA7 B;  5CV4 A;  1G6P A;  3KF6 B;  2B2U C;  4OWW B;  3OTO L;  1EFW A;  4EQN A;  4A3I B;  1EEF D;  1SEB D;  2K04 A;  2WIN B;  3CMA A;  1W6K A;  1C4Q A;  1V9P A;  3OIQ A;  5C44 B;  1XJV A;  1H9M A;  4A3B G;  1AH9 A;  5BN3 A;  2Q8I B;  4GLA C;  3OW2 A;  1O7L A;  3I72 A;  3BYT B;  1VQC A;  5IE8 A;  2R7Z H;  3CCM A;  3TS0 A;  1S4Z A;  1I50 H;  1R4Q B;  2EYP A;  2NVX B;  2NTT A;  1TVX A;  2F0J A;  1SYE A;  4B3S Q;  1KRS A;  3GQB A;  3X3N A;  4TSS A;  1Q7Y C;  3RLN A;  4PZ6 A;  3FDT A;  2AMC B;  2RBM A;  4MIU A;  2KVM A;  4CDE C;  1QIL A;  2N88 A;  1EIY B;  4POG A;  3BG3 A;  3I4M B;  3DWP A;  3J80 c;  3S2D H;  1CQF A;  4A93 B;  1K83 B;  2ZJQ A;  4JI8 L;  1YJN A;  1O78 A;  3GTM H;  4A3I H;  1L0W A;  2GVB A;  2WKD A;  4DR4 Q;  2K5Q A;  4JI0 Q;  4DK1 A;  2F3W A;  2F0S A;  3HOX H;  3K57 A;  1E0B A;  3G48 A;  2ZXO A;  1MJE A;  2E5L Q;  5I2Y A;  1NE3 A;  1X3E A;  2NZH A;  4XYQ A;  4CKC A;  4KTA A;  5CV7 A;  2BA0 A;  1JT8 A;  2LY7 A;  3NBH A;  4ZCK A;  1I94 Q;  1Q1E A;  2SEB D;  5EBC A;  3KF8 A;  1A63 A;  2A6E C;  1WJJ A;  1K8G A;  4DR1 Q;  1B44 D;  4NXM Q;  3GTG H;  1BOS A;  3GTK B;  1SNO A;  1SMY D;  1PH3 A;  1VQ7 A;  1TS3 A;  2R3Z A;  2K33 A;  4A93 H;  1LO5 D;  4N9P A;  4RAU C;  4BBS H;  2A6H D;  2IT1 A;  2JYO A;  1IW7 C;  5C5L A;  3L3O C;  5CV5 A;  2F0K A;  5IOD A;  1PLF A;  3K0X A;  2F4I A;  1X3G A;  4XQQ A;  4G7O C;  4BY1 G;  2JA5 B;  4MN3 A;  4UP8 A;  4BBS G;  4A3J G;  1X3F A;  1AP0 A;  4U68 A;  4GNX A;  1SE4 A;  4LFB Q;  4GNX B;  3S17 B;  1UE5 A;  3KF6 A;  4JBJ A;  4JBW A;  3CC2 A;  3GTK H;  4YHH L;  3Q22 A;  3HOV B;  3ERO A;  3UDG A;  3E9H A;  4H0L C;  1HZA A;  1WTO A;  1EIH A;  1J9O A;  4A3F G;  3OMC A;  3I4N H;  3UE1 A;  3G6E A;  4QB4 A;  1T5X D;  2F0U A;  1AW7 A;  3VA5 A;  1K73 C;  4QIW E;  1B3A A;  1TS2 A;  1FNU A;  1LTB D;  2F3V A;  4RWS C;  5EAY A;  4GLV B;  2NN6 H;  3U4V A;  4UP7 A;  2PCF B;  1MKH A;  1STA A;  4HCS A;  4UHV A;  2O5I C;  4WJ4 A;  1HNW L;  4GNX C;  5C5M A;  4B3R L;  1WOC A;  3FP9 A;  2VUM G;  4PG3 A;  4DV0 L;  5AJ3 L;  4HIK A;  4LNQ A;  3NQI A;  4YY3 Q;  1DCZ A;  3U9O A;  4XT3 B;  5KNC A;  5JJK A;  1Y1V G;  3A8K E;  2WAC A;  2KA7 A;  2ICE C;  1AZQ A;  2YU9 B;  5JAV A;  1J6Q A;  1ROD A;  4HJ7 A;  1X3Q A;  4DV7 Q;  2LXK A;  3P1H A;  1GUN A;  1BO0 A;  4RMF A;  1MD2 D;  4IUN A;  4L6T B;  4B3S L;  3PUX A;  4OO1 G;  2N49 A;  1W2B A;  3G71 A;  3ER0 A;  1ONL A;  3UDF A;  3HOV G;  3HRZ C;  4N8F A;  4NDX A;  2VW9 A;  5K36 H;  4RCO A;  4BXX H;  1PXU A;  3OTO Q;  4QL5 A;  3GTJ B;  3NEM A;  2UUC Q;  2NWG A;  2F1M A;  5M9O A;  4HED A;  1QG7 A;  1XMO L;  2WAQ E;  5BR8 Q;  1W6J A;  1XMQ Q;  4K2K A;  4CDD C;  4JK1 C;  1U9R A;  1VCI A;  2D0O A;  3ULL A;  1KNE A;  4KJN A;  1TT2 A;  2ZTC A;  3M9B A;  4F87 A;  3PO2 G;  4IPD A;  2N55 A;  3CCV A;  2FHT A;  5CV8 A;  3F2D A;  4OON A;  2OCE A;  1LTI D;  5IY0 A;  5C0X H;  1XTD A;  1TWC B;  4Q5V A;  3FHW A;  3PO2 B;  1XNR Q;  4R8I A;  2F0Q A;  1ZKO A;  2J4X A;  3L9A X;  4DR4 L;  3J7A V;  1D2B A;  1CHP D;  4DAM A;  1B9M A;  2HCC A;  3J81 j;  4RFB A;  3S24 A;  4WFN 3;  1U4L A;  1SYC A;  3GD7 A;  3S15 H;  1FR3 A;  3H15 A;  3CME A;  1W3S A;  5JPN C;  1H9R A;  2MUY A;  5COR A;  2K50 A;  1CTM A;  2B2V C;  3EBE A;  1FD7 D;  3MTS A;  2YYZ A;  4K6D A;  3KUP A;  4M8A A;  1HTL D;  4A3G H;  1IL8 A;  2D5D A;  2EY5 A;  1M1K C;  3H0G G;  2ALY B;  3S1Q H;  4JI4 Q;  4NW2 A;  5C0X G;  1AE3 A;  3A74 A;  4WJW A;  5C3W A;  4KLK A;  5DNF A;  4IPC A;  2MJ8 A;  2R6G A;  4B3T L;  1VF5 C;  4ZLT F;  5C3X A;  2SNM A;  3SHL A;  2RSO A;  1EY0 A;  4NXN L;  1X9N A;  2E2H B;  2R92 B;  4EVO A;  4IO9 A;  4K8J A;  5ELE A;  3NSW A;  5FLX c;  3RZD B;  3T1H L;  2WFW A;  3EN2 A;  4C3J G;  3NTH A;  3QG1 A;  2C9O A;  5ELD A;  4I7Z C;  2EYO A;  3QOL A;  1K8O A;  2F0E A;  2SOB A;  3CQZ H;  3KJO A;  1STB A;  3PMF A;  2P5Z X;  2RDH A;  1Y8O B;  1BCP F;  1OXV A;  4EX5 A;  2PMZ E;  4QY7 A;  5J1Z A;  1SFO H;  3GTL B;  4WJ3 M;  2MO0 A;  1QCB D;  3CCJ A;  2I0Q A;  1S72 A;  1C7Y A;  2E2J B;  1Y8N B;  3T4A C;  5C4J H;  1AZP A;  2R61 A;  3FPU B;  4AYB G;  2WP8 J;  1AFP A;  4X3T A;  1CFM A;  2WII B;  1WD0 A;  4A3C H;  3PO3 H;  2B63 G;  1Z9F A;  1KAB A;  4PZ8 A;  1G8Z D;  5C44 H;  5IT9 E;  1ESF A;  4WRD A;  1U4P A;  1S3O A;  1KC8 C;  1HCZ A;  4R4O A;  2IHE A;  2L0C A;  1XPR A;  2IX1 A;  1KDB A;  4BA1 I;  1NAP A;  1YEZ A;  2F0W A;  1YNN C;  4JI5 Q;  3CCL A;  1QZG A;  5AFW A;  4ME5 A;  2PMZ B;  3A8I E;  3CAM A;  4CBV A;  3ERQ A;  4AQY L;  4P71 A;  3F2B A;  1SNC A;  5KIX A;  1QNK A;  4R8N A;  4IFD H;  1SLJ A;  1IHZ A;  4GN4 B;  4OO1 H;  3E0J A;  2JA9 A;  2HDM A;  2FJ2 A;  5EPL A;  4X62 L;  1TWF B;  3A7A B;  1HZB A;  4DU9 A;  5E7N A;  2B2Y C;  2HD3 A;  5K36 G;  1EU3 A;  4FDB A;  2PI2 E;  2R7D A;  1B53 A;  3HFZ B;  1H95 A;  3H94 A;  3IRB A;  2A69 D;  4KKT A;  4R4Q A;  5LHY 1;  3M4P A;  3F1Z A;  3KJP A;  4HJ9 A;  4C3I G;  2ASB A;  5E4X A;  3F2C A;  4IUR A;  4B9X A;  4L63 B;  2BA1 A;  3U58 A;  1SFO B;  1CA5 A;  2NVX H;  1KDC A;  4DF7 A;  4JI1 Q;  3VR2 A;  4IUP A;  1FNV A;  4PNY A;  2PW5 A;  1ZYR D;  4DV5 Q;  2K75 A;  4DR7 L;  3EA6 A;  2Z9H A;  5D65 A;  5LMU L;  2WB1 G;  1N8R C;  4A3M G;  2H1E A;  1B50 A;  2EYL A;  2KQ3 A;  2JEA I;  2MNA A;  1DJR D;  4DFA A;  3C3L A;  1TWG H;  4TRD A;  2NVQ B;  5COY A;  3GV6 A;  5IYB G;  4X66 Q;  2BH2 A;  1FGB D;  3S16 H;  5ELF A;  4C3J B;  3M4Q A;  3EIV A;  4A3K G;  3S2H H;  3NBH B;  1A6X A;  2NTS A;  1PRT F;  2Q2U A;  4LFC Q;  2FMM A;  3L0O A;  1VMC A;  1B8A A;  1CKO A;  4H7B A;  1I3Q H;  1SYD A;  2V1C C;  2A6E D;  3CRK C;  3G6J B;  1NNX A;  1TII D;  5IGD A;  3TP5 A;  2KEN A;  2Z4H A;  2RF4 A;  4POF A;  1Y1W G;  2GVA A;  4DAV A;  1VQB A;  2EZV A;  4PMC A;  3HS0 C;  2O2L D;  1NR4 A;  1YI2 A;  3CCU A;  1J5E Q;  4FF2 A;  4LF8 L;  3FMC A;  1WTP A;  4DR1 L;  1HH2 P;  1WCM B;  4YIJ A;  1Q8I A;  5I9P A;  1TKW B;  1GHK A;  4YWM A;  4XDX A;  3W5O A;  1E2V A;  4KD3 A;  1CI3 M;  5IT9 L;  3E6Z X;  4ME3 A;  2PZW A;  2F0D A;  3J7A F;  3MXG A;  2CHB D;  3J80 L;  1RDP D;  3FRP B;  1O7I A;  4DUY L;  4GOP C;  3UI2 A;  1VQL A;  2E74 C;  3OSO A;  2E5L L;  4IUT A;  1I4G A;  3BZK A;  4XXE A;  3K59 A;  1B70 B;  4DR2 Q;  4A3D G;  2DNC A;  2E2D C;  4X3S A;  4JYA L;  2NVY H;  1VQ9 A;  3KLR A;  2EY6 A;  2QKI C;  3I90 A;  3MAQ A;  1GUG A;  1QZH A;  1N36 Q;  2EJF C;  4QJF A;  1PTO H;  4AH6 A;  5KNB A;  4DR6 L;  4APV A;  1ENA A;  2AQ1 B;  1Q82 C;  1X3P A;  3J80 E;  1KDA A;  1KNA A;  4K0K L;  4KMU C;  3AMU A;  4AQY Q;  2N8N A;  4DR5 L;  2NUC A;  5J39 A;  1S5F D;  3SEB A;  1Z7T A;  3R3O A;  1CM9 A;  1DOK A;  4RH6 A;  4DXF A;  2CWA A;  1Y1W H;  1F9R A;  1BCP B;  3OWE B;  2IY5 B;  2MO1 A;  2KHS A;  2F0N A;  4MNO A;  1WTV A;  3A55 A;  4DV6 Q;  5F2D A;  3GO5 A;  5LL6 S;  5M5X H;  3T51 B;  3SK4 A;  1OO9 B;  1VF7 A;  4L5S A;  3CQZ B;  1WD1 A;  1IBL L;  1CKN A;  3ICE A;  1PTO F;  4XQN A;  3DWQ A;  4DV0 Q;  2AUK A;  2Q2H A;  5NUC A;  1SYB A;  3N6R A;  1EU4 A;  3EQL C;  1CZW A;  3M85 A;  4FO2 A;  2M00 A;  4KK7 A;  1DOL A;  1M4V A;  4J6H A;  3VR4 A;  2VB3 X;  5HGQ A;  2KOL A;  5IT9 c;  1HTP A;  1UEA B;  2CH4 A;  1GUT A;  3SE0 A;  1RHP A;  4KY6 A;  1LAC A;  5KND A;  1IKM A;  2J0T D;  3I3C A;  2KEC A;  5J22 A;  3AFP A;  4A75 A;  4JI2 L;  1TWG B;  4LFC L;  2A68 D;  3Q23 A;  3PUY A;  1O7Y A;  4LF7 Q;  2Y0S G;  3EJI A;  1HZC A;  3MXU A;  2F4V L;  1LT3 D;  1BR9 A;  4DNT B;  3KOJ A;  2RCF A;  2F0V A;  1DM0 B;  5JOB A;  1Y14 B;  2UUB L;  5FLM H;  1MIU A;  4K2L A;  3S1M H;  1LTG D;  4DK6 C;  3NUC A;  1HZ9 A;  1WVL A;  3D4R A;  1H9S A;  2UU9 Q;  3Q0A A;  5ELN A;  4ZAI A;  2EJG C;  3J7Y W;  4PZ7 A;  3PIP A;  1E1O A;  2JA8 G;  1YZ6 A;  3CHB D;  2BOS A;  2HIV A;  1NJI C;  2VUM B;  4KHV A;  1MSG A;  3H0G H;  4KD4 A;  1Y69 U;  1PHJ A;  1SRO A;  3KK7 A;  4P74 A;  2XSC A;  2IX0 A;  2CWP A;  1SNQ A;  3S1Q B;  4OEM B;  3FVQ A;  5FO9 B;  1PYW D;  3BYY B;  4JV5 Q;  4X6A H;  1DGS A;  1YNJ D;  3H6M A;  3S17 H;  2ZTD A;  1LTR D;  1K0S A;  5GAG C;  1J8I A;  3CU7 A;  4JW0 A;  2CQO A;  1TQO A;  1I4X A;  2FMC A;  4KHP Q;  3L7Z C;  1Q90 A;  2F0H A;  3CPW A;  1JB3 A;  1B7Y B;  1XPO A;  3FKI B;  3M4O B;  1L1O C;  2K5V A;  4DV1 L;  5FO7 B;  2PI2 A;  1SND A;  2XTI A;  3WWV A;  5ELC A;  3TQY A;  1C0A A;  2KCT A;  2EPB A;  2CKZ B;  4EGV A;  3TN2 A;  2JE6 I;  5M5W B;  2L15 A;  4HTH A;  2YU9 H;  4LF9 Q;  3S1N B;  1NUC A;  5C0X I;  3RN2 A;  1JWU D;  3GTO H;  1HNZ Q;  4HSP A;  3K7A B;  3GTL H;  5IGE A;  3TME A;  2IWH A;  2VQF Q;  4ULL A;  1RL2 A;  1STH A;  5C4X H;  2CCZ A;  1N36 L;  1G6Z A;  1YHB A;  3HKZ G;  3OPO A;  3IKJ A;  4DV6 L;  4A3G G;  1X65 A;  4NPS A;  4IQZ A;  1X55 A;  4DUZ L;  1FGU A;  2I07 B;  3QJY A;  1RD9 D;  1KXL A;  4DV2 Q;  1PH2 A;  3PIP 3;  2ICI A;  4HMI A;  3KLW A;  1XNQ Q;  4B08 A;  3J81 L;  5FOB B;  4O1N A;  4E6I A;  1NBW A;  3HOX B;  1LTA D;  1EY7 A;  1WYD A;  1IZ6 A;  2IX3 A;  3GTM B;  3HOV H;  2A5H A;  3TP6 A;  2MGS A;  4KHZ A;  1HJP A;  1V8Q A;  3GTJ H;  2NVQ H;  5LMN Q;  3I91 A;  3T13 A;  4IFD G;  3BS1 A;  1ESR A;  1VQA A;  2PNR C;  5M5Y H;  1VQ5 A;  1GJX A;  1AEX A;  1D6E C;  1JOK A;  4Q0F A;  1N34 Q;  3C1F A;  3I4M G;  1XWE A;  3TSS A;  2CFM A;  1KIX A;  1OXS C;  3SXH A;  1BVS A;  2J7Z A;  2V4D A;  3T53 B;  2E2J H;  2Q2T A;  2JXM B;  2CW0 C;  3J7A 5;  4B3M L;  3R2I A;  4MTN A;  2NN6 G;  2O4X A;  3MVV A;  2A6H C;  3KDF A;  2I5M X;  1FYC A;  5KYL A;  2VXW A;  1NR2 A;  3EVQ A;  4OEL B;  3CP0 A;  1PFS A;  1JE5 A;  3M4Y A;  2L5T A;  2D2C C;  2OQ0 A;  4EQP A;  1D5Z C;  2UU9 L;  5FO8 B;  1VQF A;  3Q24 A;  4R1J A;  1YJW A;  4QF4 A;  3HOU B;  4QGU A;  4IPG A;  1Z47 A;  2LFN A;  3RLO A;  4HMJ A;  4H44 C;  2K14 A;  1K0R A;  2YV5 A;  1F77 A;  4Z9C B;  3PUV A;  3SK8 A;  4ZUI A;  1Y1V H;  3A56 A;  3P7J A;  4RKB A;  2CW0 D;  1KHI A;  1PRT B;  1ZYR C;  1QOH A;  3STB D;  3MEF A;  3HGB A;  4C2M B;  1EUJ A;  2NZO A;  4LUZ A;  3VR6 A;  1JIC A;  4ZKC B;  1E3P A;  1TWA H;  2K03 A;  3VYT A;  3GTQ H;  4DV5 L;  2B2U A;  1DD2 A;  2C35 B;  1VMP A;  1NMF A;  5DLQ E;  5C44 G;  2K6A A;  1ILP A;  3RN5 A;  4JI7 Q;  2IJ0 A;  1SBB B;  2QEX A;  1FL0 A;  3H09 A;  2MQH A;  3E5S A;  2DJF C;  5FJ8 G;  1II3 A;  1R9T H;  5EKK A;  4DK3 C;  5E3F A;  1LT4 D;  3FKI H;  4XT1 B;  1QWY A;  1HNZ L;  2XNA C;  1TWH H;  2L9H A;  1JWM D;  2B3G A;  1JCK B;  2H4O A;  2AQ3 B;  2OXP A;  4QMG A;  2UXB L;  1EY6 A;  3I4O A;  3AQQ A;  4GKJ L;  3PIO 3;  1K28 A;  1KLU D;  4K5V A;  5JVH 3;  3JAM L;  1JC7 A;  4ODG A;  1IBK L;  4DV1 Q;  1Y8P B;  5BN5 A;  4NXN Q;  2VNU D;  1A2U A;  1CA6 A;  2UXC L;  4DUY Q;  3I8Z A;  5BN4 A;  1I6V C;  3M3Y H;  3PQI A;  3HOY B;  3NE5 B;  3VYU A;  3HOZ B;  4A3I G;  2EXZ A;  3HKZ E;  3I7F A;  1GUO A;  2QGQ A;  1VQD A;  1G29 1;  1PYS B;  3AYH B;  3NP8 A;  2LKV A;  1SSO A;  1SAP A;  1Q1B A;  2UXD Q;  1VQ6 A;  2Z4I A;  3H3V C;  3BDL A;  2KED A;  3AEV A;  4A76 A;  2X6L A;  3LWU A;  1UE7 A;  4YCV A;  5JJL A;  2K4K A;  3PUW A;  4KY5 A;  5IP7 H;  1EWI A;  1EOT A;  2K32 A;  1E24 A;  4LWC A;  5A2Q E;  4A3K H;  3ZYY X;  5DEH A;  4KN7 C;  2DNE A;  4A3B H;  3P75 A;  4IN3 A;  2KCM A;  1QB5 D;  1P8L A;  4OIJ A;  4LUO A;  2K01 A;  5M5Y B;  2A74 C;  3PF5 A;  3MWY W;  4DAP A;  1SJE D;  5C3E G;  1EYG A;  1Q12 A;  5JPM C;  4LF4 L;  4DV7 L;  3RZO B;  5G3L F;  1PFB A;  1EY4 A;  2R92 H;  4FF1 A;  1C9O A;  1SMY C;  4JPB W;  3MC0 B;  1IBL Q;  1EIG A;  5GRO A;  1P16 A;  1XXG A;  3QWN A;  2K5N A;  4BBR B;  1PTO D;  5A2Q L;  4HN7 A;  2RDG A;  2IPK D;  2XWB B;  4YY3 L;  1TU2 B;  2Z8L A;  1IYV A;  4CGY B;  2KHI A;  1BBX C;  4B3M Q;  3TS2 A;  3R8B A;  2B2V A;  1DOM A;  3V2T A;  5EBD A;  1Q3L A;  2F0F A;  3PGZ A;  1LUZ A;  1GKH A;  2Q8R E;  5DAU A;  5JEA H;  2ZM6 L;  5C4Z A;  4KKU A;  1EIF A;  4LF5 Q;  3MEH A;  1F2M A;  2D9U A;  4PQX A;  3DLL A;  1I6H B;  2CQA A;  2XRS D;  1U5K A;  1LLR D;  2DY7 A;  5EKL A;  3ND9 A;  1F2Z A;  2F4V Q;  2PPB C;  3JAM c;  2EY1 A;  5C4H A;  4X66 L;  1YJ9 A;  2R93 H;  2Z0S A;  2K05 A;  4EQO A;  1GXD C;  4QUC A;  3M7G A;  4ZK9 B;  3SK6 A;  1PH7 A;  2LXJ A;  2EYH A;  2KCN A;  3L2P A;  4R4I A;  2B39 A;  3QO2 A;  3U50 C;  3UE0 A;  1UEB A;  2JA8 B;  4FXK C;  3TP7 A;  5M3F G;  3A5Z B;  2JQO A;  3D6W A;  5K5P A;  3MA2 B;  4X65 L;  4DV4 L;  1A15 A;  4FXD A;  4RGT A;  2X6G A;  4DK0 A;  1CSQ A;  4KI0 A;  3Q6S A;  1EEI D;  2KEE A;  1IKL A;  1XTC D;  3R2T A;  4GKJ Q;  2MHV A;  1SN8 A;  1V1P B;  4Y7N H;  4G7H C;  5M3M B;  1YNN D;  3SVM A;  4RGM A;  4IZ8 A;  2ZXR A;  4J8Q A;  1PH1 A;  1WTH A;  1J5E L;  4IOC A;  1ENC A;  3F8T A;  4LF8 Q;  1KAA A;  5M5X B;  1HR0 Q;  1NY4 A;  1I94 L;  2NB0 A;  4DR3 Q;  3KFU A;  5IWA L;  4J1M A;  1V1P A;  4GZY C;  5DM7 3;  5TSS A;  3UDX A;  1Q81 C;  4RHR A;  1IBM Q;  3S9W A;  2F0T A;  2OQK A;  4WOR A;  4JBK A;  4LF6 L;  4RCN A;  4K14 A;  1GOZ A;  2ATW A;  3MXN A;  4DR2 L;  1X6O A;  4B3T Q;  1JE4 A;  3PSI A;  1PDQ A;  2K7V A;  1NSN S;  1RCV D;  2YTY A;  2AHO B;  5HUR A;  3W2D A;  3HG9 A;  1CUK A;  2MFI A;  1QVF A;  4YCU A;  3CW2 C;  3IL8 A;  2HIX A;  3O13 A;  4NMZ A;  4JI6 L;  3X3M A;  1MHW C;  3AB9 A;  1I4R A;  3BDC A;  2AWO A;  4K6L A;  3QB3 A;  3NPP A;  3GTP H;  4X3U A;  2VQF L;  4L5R C;  3CF5 A;  2JA7 H;  2RCN A;  3K80 C;  3MZ5 A;  2A69 C;  5M3M H;  5HGT A;  1E2W A;  4LF4 Q;  4G57 A;  4KJO A;  4HIO A;  4FYD A;  1GUW A;  1SE8 A;  4BY7 H;  5D14 A;  3NEL A;  4LFB L;  4R4C A;  4TVA B;  4PMW A;  1LM0 A;  1XX8 A;  2K5H A;  2OT2 A;  3CCS A;  4JI5 L;  4V0B A;  2IHF A;  1MI2 A;  2BDN A;  2DN8 A;  2WAQ B;  1VQK A;  1LTT D;  4XQJ A;  2Q2I A;  2HHH Q;  1A3V A;  5IYD H;  2WV6 D;  3K7U C;  4C1N I;  1B1Z A;  1JMC A;  3NBI A;  4LF9 L;  1EQR A;  3B6Y A;  3BU2 A;  4OX9 L;  2JA6 B;  2ZTE A;  3K5L A;  1UNS A;  4O0A A;  4QIW B;  4X62 Q;  3J7Z C;  4A3M H;  5KRU A;  2N78 A;  4CDF C;  1WCM H;  2G9D A;  1CQV A;  1D5X C;  2AUJ D;  4C3I H;  2WKC A;  3V05 A;  4GKK L;  1F2L A;  2NVT H;  2FIN B;  4F7X A;  2RKS A;  1GVP A;  1BF4 A;  4P73 A;  4BBS B;  2B63 H;  2R93 G;  4R9W A;  3J81 c;  3CCQ A;  1HXY D;  4LF5 L;  3J81 E;  4B3R Q;  2B2T C;  3I2Z A;  2QDB A;  4G7Z C;  1VQH A;  4RGN A;  1Q86 C;  4HSV A;  1HQR D;  1EQV A;  4BY7 G;  1X54 A;  1YNJ C;  4MTK A;  3QR8 A;  2DJG C;  4FNF A;  3CCE A;  5CV9 A;  1UE1 A;  4JBM A;  1B4O A;  5EGT A;  1UE6 A;  1PTO B;  3CCR A;  1KLG D;  5A35 A;  1BBW A;  2OTJ A;  3M7N A;  3ZJY C;  1U4M A;  3E3X A;  1MBY A;  3N52 A;  5IYC G;  4BBR H;  1GM5 A;  4DN4 M;  4DV4 Q;  2M2L A;  3RMH A;  2A73 B;  2VB2 X;  5C0X J;  3I4N B;  4IJL A;  1H9J A;  4H13 C;  1M90 C;  1D1K A;  1TWH B;  4FXG C;  3TRE A;  2ES2 A;  3HKZ B;  2VUM H;  1KRT A;  2BE5 D;  2YTX A;  5IYD G;  1X32 A;  2OTL A;  1VQE A;  4UY8 C;  5C4X G;  4A3F B;  4IFD J;  5I6W A;  1A62 A;  5C4J B;  1VQN A;  1L0X B;  5D3I B;  2UUA L;  4GN5 A;  5ELB A;  1SR3 A;  1JB7 A;  5M3M G;  4DXG A;  4C3H H;  4C3H B;  1CSP A;  3OIP A;  1JQY D;  4U67 3;  4GOP B;  3LNN A;  3AU7 A;  1BDO A;  2K5W A;  2R7Z B;  3HP3 A;  1TWA B;  3AFQ A;  1TY0 A;  2ZJP A;  1IBM L;  1D5M C;  2F0M A;  3RR5 A;  2IW3 A;  2WAQ G;  1FJG Q;  3HOW B;  1PH9 A;  1OTC A;  4JI7 L;  2RHS B;  1T5E A;  1K3B C;  3DM1 A;  1E22 A;  3OHX C;  3G4S A;  5C3E B;  1EOV A;  3CPF A;  2PO4 A;  1L1O A;  1SNP A;  1JJ2 A;  2RQX A;  1BNZ A;  1Q46 A;  2DY8 A;  4RKL A;  4A3C G;  1S40 A;  3RLF A;  1A3U A;  1SXT A;  3J80 i;  4UPA A;  3G7L A;  5IOC A;  2B2W A;  3NTK A;  1DXM A;  3VR3 A;  4AIM A;  4DR3 L;  1K8A C;  1VDZ A;  1M8A A;  1ICF B;  1HRJ A;  1T9H A;  2JA6 G;  1NTG A;  4BWG B;  2WB1 E;  1IBK Q;  1YNX A;  1VQI A;  3HKS A;  5IGG A;  2EDG A;  2VL6 A;  2JA5 H;  4YWK A;  2IL8 A;  2EYJ A;  4CJ2 C;  4HID A;  4K0K Q;  2E76 C;  1VQP A;  1CKN B;  2F0O A;  4P72 A;  3DEP A;  1JJG A;  3T16 A;  1O7Z A;  3IFT A;  1BXT A;  4OHJ A;  5DM6 3;  4JI6 Q;  3RUZ A;  3TZD A;  4JYA Q;  2A19 A;  3VYR A;  1LT5 D;  1JOR A;  4TKO B;  4M1U B;  4L5T A;  5EPJ A;  3W3A A;  1PVO A;  3J81 i;  3T56 B;  1EQT A;  1F9S A;  3OW7 A;  4DR6 Q;  4CJ0 B;  1JR0 D;  4KV6 A;  5CV6 A;  5IYB H;  1L2F A;  2UXC Q;  5AJ3 Q;  1K3R A;  4IFD I;  4BA2 I;  3PF4 A;  5D3D A;  1WCM G;  4PV1 C;  1RF2 D;  4L8J A;  3A0J A;  4O2D A;  2XGT A;  1MGS A;  5CGK A;  2B8G A;  4OWX B;  1N32 Q;  4ZKB B;  5T1I A;  4A3L H;  1F9P A;  3A8J E;  3W1B A;  2EYM A;  2JSO A;  1WI5 A;  5KGU A;  2AWN A;  2I5L X;  1TY2 A;  3W1G A;  2G5D A;  4IUQ A;  1A0I A;  1PZI D;  4S3S A;  2VQE Q;  3LX0 A;  2UXD L;  5GAD C;  5KEE A;  2QA4 A;  4I7A A;  3HOW H;  2KBN A;  1G2T A;  1G51 A;  3TEH B;  2XRQ D;  1JJC B;  4A3E H;  2F0L A;  4ALP A;  3K5M A;  5JEA G;  1EYD A;  2ZXP A;  1PRT D;  2QF7 A;  4A3L G;  4HIM A;  2HQL A;  3SGI A;  2C5C A;  1WFQ A;  4J15 A;  2B63 B;  3C1E A;  1ASY A;  2DGY A;  1JOO A;  1VQ4 A;  1N33 L;  3GTO B;  5LMN W;  1BUV T;  3ERS X;  1JWS D;  1I6H H;  1KTK A;  3IFD A;  1L1O B;  1SYG A;  2VZA A;  5FK9 C;  1SE2 A;  1PFM A;  1ET6 A;  3PIO A;  1X56 A;  1OXT A;  2K28 A;  3M4O H;  2F0I A;  2F3I A;  3I4L A;  3PO2 H;  2XN9 C;  4HJA A;  2EIF A;  4CKB A;  1F9Q A;  3MXP A;  1QNU A;  3URY A;  4C2M H;  4C56 C;  3WOE A;  1A2T A;  1OXX K;  1XMQ L;  1SRU A;  2LSS A;  4LW1 A;  4IUU A;  2HT1 A;  5LMU Q;  1C48 A;  2XVS A;  5G3L D;  1XYI A;  1IW7 D;  3QIA A;  1EY5 A;  1D1I A;  2QIL A;  3K6O A;  2TMP A;  4JI0 L;  1JOQ A;  4K8I A;  4AYB E;  3H3V I;  4C3J H;  2A1A A;  2UUA Q;  3C2P A;  3CXC A;  4ZUJ A;  5IP7 G;  3E9I A;  3OYY A;  3F2U A;  4GN3 B;  1CKM A;  2L55 A;  4RGO S;  1IYJ B;  4DAY B;  4LJZ C;  4ZYS A;  1XNR L;  4DAY A;  1TS4 A;  4BY1 H;  4N8X 1;  3S15 B;  3KBG A;  1U0L A;  1FVI A;  2RHQ B;  3CRL C;  5FLX L;  4KHP L;  4XIG S;  3A5U A;  1FJG L;  1CHQ D;  4JI3 L;  4A3K B;  5JJZ A;  3S1M B;  1C8C A;  1S5D D;  1I50 B;  2BDO A;  3MFY A;  5CYU A;  2JEB I;  4X64 L;  4LFA Q;  5CBA E;  1YIJ A;  2B2T A;  1TWC H;  4X65 Q;  5T1G A;  1ICW A;  2WB1 B;  1WTR A;  2E75 C;  4A3D H;  1DON A;  2E2H H;  1YHA A;  3HEJ A;  4A3F H;  3K58 A;  3MFG A;  2Y0S E;  3MXN B;  1Q8K A;  1YVC A;  4JOI A;  3JAM E;  4NP5 A;  2K1B A;  3A54 A;  3ND8 A;  1ILQ A;  1HNX L;  3ITP A;  1UAP A;  3TP8 A;  4FF3 A;  1D7Q A;  2JJQ A;  1FNW A;  1G2S A;  3H91 A;  3CC7 A;  1N32 L;  5CC4 A;  3DUZ A;  1QVG A;  3NTI A;  3HOX G;  4UDU C;  4ILW A;  5M3F H;  4ID6 A;  1PZJ D;  4G4K A;  3K5N A;  1QUQ A;  2PW7 A;  1F2Y A;  5KYI A;  4O42 A;  1BCP D;  4LF6 Q;  4R4T A;  1ET9 A;  3DXJ C;  1PMR A;  3S1N H;  3BJU A;  2O5J C;  3VA7 A;  5I6Y A;  2B2W C;  1VQO A;  3FPP A;  4F88 A;  3BZC A;  4DV2 L;  4C3I B;  4YCW A;  5L37 A;  1OXU A;  3DEO A;  1N34 L;  3HOW G;  3GP7 A;  1QUQ B;  1IYU A;  1GO3 E;  2LS0 1;  1S5B D;  2NYZ D;  2D0P A;  4I65 A;  4GKK Q;  5IGF A;  2E8G A;  4Y7N B;  2VQE L;  4A3J B;  2B8F A;  1LTS D;  1TWF H;  4ABN A;  2XWJ B;  1K9M C;  2HCI A;  1LAB A;  4JI2 Q;  3WDN A;  3DMU A;  4BY7 B;  4DA2 A;  1WTQ A;  3BVZ A;  1DZ1 A;  4TQU S;  1I4P A;  3QOJ A;  3RNU A;  4GLX A;  2B29 A;  2UUC L;  1KL9 A;  4OX9 Q;  2OEO A;  3D31 A;  3NXW A;  1XMO Q;  2OWO A;  4JG2 A;  4LMQ D;  5BR8 L;  2NVY B;  5FKA C;  4A3G B;  1N33 Q;  4UAI A;  4LUV A;  3PUZ A;  3BVM A;  1PFN A;  3BDO A;  3PO3 G;  1BKB A;  1V43 A;  5HY6 A;  1GUS A;  2BE5 C;  2XIW A;  3UDI A;  3DHQ A;  1HA6 A;  1MJC A;  2H5X A;  2ID0 A;  3I70 A;  2RA4 A;  3K7A H;  1RIP A;  2NVT B;  4DR7 Q;  5C4X B;  3P20 A;  4P75 A;  4NXM L;  2JA5 G;  4KKS A;  4QQB X;  2E2I B;  4LF7 L;  2E2I H;  4YWL A;  4HJ5 A;  2EJM A;  5ISR A;  1I5F A;  3FKI G;  5CBE E;  1PTO C;  5FJ8 H;  3H3V H;  5M3F B;  5EPK A;  3OMG A;  1HPC A;  1A8V A;  5J3B A;  2UUB Q;  3KLS A;  2JA6 H;  1IL2 A;  4OO1 I;  4X64 Q;  1PH4 A;  4LFA L;  2R92 G;  5FLX E;  1Y1V B;  1PH5 A;  1PRT C;  3OWF A;  5ELO A;  1EFI D;  3KF8 B;  2MP1 A;  1RJT A;  3HOU H;  1LTL A;  3GV3 A;  5H1S E;  3BVG A;  1KD1 C;  3S1R H;  1WTW A;  2NBF A;  4YHH Q;  2L1B A;  5EJW A;  1D8L A;  3STB C;  1CZG A;  1V1O A;  2N3S A;  4JI3 Q;  2JA8 H;  3S2H B;  2PZU A;  2GN5 A;  2ZJR A;  1HFN A;  2PNH A;  2ZT9 C;  1HNX Q;  3D0F A;  4A3D B;  3GTP B;  4DNI A;  1YIT A;  4IJH A;  5GAE C;  3I4N G;  4IAL A;  4Y52 H;  1KQS A;  1K83 H;  1IXR A;  1SE3 A;  1AE2 A;  4DPG A;  1ML0 D;  3LWE A;  1NCV A;  5I9O A;  3T1H Q;  1LYL A;  2NN6 I;  3PO3 B;  1DYQ A;  1EWH A;  5LL6 X;  4ZRZ A;  4C3H G;  1QE6 A;  4OL7 A;  2A8V A;  3T1Y L;  1CT1 D;  1HUM A;  1NMG A;  2HQE A;  3I56 A;  2TSS A;  3ONA B;  2HUG A;  3NK9 A;  4ZQ3 A;  1A3T A;  5EKI A;  1VQG A;  4P2C B;  4DR5 Q;  3TDQ A;  4IUV A;  1KAW A;  2EVB A;  5EQ0 A;  3Q8D A;  3U9S A;  4XYO A;  2EXD A;  4DNR B;  1BCP C;  2VY3 A;  4JCV E;  3D3R A;  1LT6 D;  3PCO B;  2QCP X;  1PA6 A;  4IOA A;  4RHS A;  4A4I A;  2F52 A;  3HOY H;  1H9S B;  1HQM C;  3RZD H;  2ENB A;  1EZ6 A;  5IYC H;  4QCL A;  1K8M A;  2Z6K C;  1LV9 A;  3I55 A;  1I4Q A;  3ULJ A;  4OWT B;  1HR0 W;  2JP1 A;  3S1R B;  4KN4 C;  1MSH A;  2L11 A;  5IIF A;  1STY A;  3TBI B;  5JEA J;  4BXX G;  3VDY A;  1PH6 A;  3RZO H;  3NWT A;  2KJX A;  2M9V A;  4OGQ C;  1HFG A;  3S14 H;  5JJI A;  2BH8 A;  1ZEQ X;  2SNS A;  4JVZ A;  3SK5 A;  2PQA B;  2QEJ C;  4HJ8 A;  2D62 A;  4CKE A;  1EQQ A;  2R93 B;  5CMD A;  4DGZ A;  3HOY G;  1BQQ T;  4CHT B;  1STG A;  1UWV A;  2GA4 B;  5LMN L;  4C1N K;  1RKN A;  3K5O A;  2ZM6 Q;  3D8G A;  1B3Q A;  2EY2 A;  1QVC A;  1I4H A;  3K0Y A;  2Y0S B;  1EYA A;  5M5W H;  2F03 A;  1S5E D;  2MPM A;  2Z6B A;  4JI1 L;  4DKA C;  1E7Z A;  4HAE A;  2EYF A;  3D6C A;  4BY1 B;  1L0Y B;  3GDE A;  4DV3 L;  3K8A A;  4A3E G;  1B2T A;  4CDC C;  4BS9 A;  3WOF A;  1HA5 A;  2X69 A;  1TXY A;  2A68 C;  2I5H A;  1RTN A;  2JK8 A;  2RVL A;  1EZ8 A;  1EY9 A;  2FXQ A;  2JA7 G;  4N9T A;  1YBY A;  1EL0 A;  5IGC A;  4A3J H;  2QDL A;  1ZXT A;  3E0E A;  1UUP A;  4NB3 A;  2HDL A;  3CKI B;  2EE1 A;  4RA8 A;  1SYF A;  1Z6H A;  4JOI C;  3NWS A;  3ULP A;  3OOC A;  2PQE A;  1BBU A;  3C46 A;  1WTX A;  4K5W A;  2QW7 A;  2SDF A;  2EQS A;  2NZ1 D;  1B9N A;  3SDZ A;  4EQ5 A;  1R4P B;  1RTO A;  3I4M H;  3S2D B;  3K81 C;  1EY8 A;  2I46 A;  2RSN A;  4PMB A;  2K52 A;  3LGJ A;  1YHQ A;  3EFX D;  1EWC A;  3IAY A;  1R9T B;  4XTC S;  4IPH A;  4A3B B;  4B9W A;  4MHE A;  1N9W A;  1PH8 A;  4JV5 L;  5IGB A;  1PV4 A;  4H02 A;  1HR0 L;  3PV0 A;  1STN A;  4HCE A;  1ENF A;  5GQO A;  4A3M B;  4MZ9 A;  4JI8 Q; 
#chains in the Genus database with same CATH homology
 2BCO A;  2B2Y A;  5I2X A;  3GTQ B;  1Y1W B;  5CR3 A;  1S5C D;  1GHJ A;  1H9K A;  3TZU A;  2L4N A;  3V96 A;  2PYK A;  1U4R A;  1O80 A;  2EOT A;  4A3E B;  1SDF A;  4LAA A;  5I4D A;  2KUM A;  1I3Q B;  1SNM A;  4QUF A;  2Q8T A;  2Z1C A;  3M3Y B;  1HHV A;  1PZK D;  3FEW X;  4AYB B;  4NKL A;  4LK1 C;  2F0G A;  2LMC B;  2CVR A;  3D4W A;  4CJ1 B;  1TS5 A;  3H0G B;  4FVM A;  3R93 A;  3S16 B;  5C6A A;  4K5X A;  3RD4 A;  2F0P A;  2PZT A;  1E2Z A;  1STE A;  3BZD B;  3NQT A;  1CK1 A;  3HZX A;  1HUN A;  3VYS A;  4X3K A;  3SR1 A;  3KLS X;  2G9H D;  4KY7 A;  3VR5 A;  3KBX A;  1TR5 A;  2OF1 A;  3S14 B;  3D4D A;  1EYC A;  3NHH A;  3MHB A;  2AQ2 B;  2FFK B;  4OIK A;  3DWA A;  3GTG B;  4F8M A;  2L12 A;  4FF4 A;  4V19 0;  3I73 A;  2KCC A;  2RDF A;  1AN8 A;  4FP5 D;  2K5D A;  1QJO A;  5E1F A;  3A7L A;  1G91 A;  5E4W C;  5JVG 3;  4HR7 B;  1SJH D;  2JA7 B;  5CV4 A;  2B2U C;  4EQN A;  4A3I B;  1EEF D;  1SEB D;  2K04 A;  2WIN B;  1W6K A;  1C4Q A;  3OIQ A;  5C44 B;  1H9M A;  5BN3 A;  2Q8I B;  1O7L A;  3I72 A;  3BYT B;  1S4Z A;  1R4Q B;  2EYP A;  2NVX B;  2NTT A;  1TVX A;  2F0J A;  1SYE A;  3GQB A;  3X3N A;  4TSS A;  3FDT A;  2RBM A;  4MIU A;  2KVM A;  1QIL A;  2N88 A;  3BG3 A;  3I4M B;  3DWP A;  4A93 B;  1CQF A;  1K83 B;  1O78 A;  2WKD A;  2K5Q A;  4DK1 A;  2F3W A;  2F0S A;  3K57 A;  1E0B A;  2ZXO A;  5I2Y A;  4XYQ A;  4CKC A;  4KTA A;  5CV7 A;  2BA0 A;  2LY7 A;  3NBH A;  1Q1E A;  2SEB D;  5EBC A;  3KF8 A;  2A6E C;  1B44 D;  1BOS A;  3GTK B;  1SNO A;  1SMY D;  1TS3 A;  2R3Z A;  2K33 A;  1LO5 D;  4N9P A;  4RAU C;  2A6H D;  2IT1 A;  2JYO A;  1IW7 C;  5C5L A;  3L3O C;  5CV5 A;  2F0K A;  5IOD A;  1PLF A;  2F4I A;  4XQQ A;  4G7O C;  2JA5 B;  4MN3 A;  1AP0 A;  4U68 A;  1SE4 A;  3S17 B;  4JBW A;  3Q22 A;  3HOV B;  3ERO A;  4H0L C;  1WTO A;  1EIH A;  1J9O A;  3OMC A;  4QB4 A;  1T5X D;  2F0U A;  1AW7 A;  3VA5 A;  1B3A A;  1TS2 A;  1FNU A;  1LTB D;  2F3V A;  4RWS C;  2NN6 H;  2PCF B;  1STA A;  4HCS A;  2O5I C;  5C5M A;  3NQI A;  1DCZ A;  3U9O A;  4XT3 B;  5KNC A;  3A8K E;  2WAC A;  2KA7 A;  2ICE C;  1AZQ A;  2YU9 B;  5JAV A;  1ROD A;  1X3Q A;  3P1H A;  1GUN A;  1BO0 A;  1MD2 D;  4IUN A;  4L6T B;  3PUX A;  4OO1 G;  1ONL A;  3HRZ C;  4NDX A;  5K36 H;  4RCO A;  1PXU A;  3GTJ B;  2NWG A;  2F1M A;  5M9O A;  4HED A;  1QG7 A;  1W6J A;  4K2K A;  4JK1 C;  1U9R A;  1VCI A;  1KNE A;  1TT2 A;  4KJN A;  4F87 A;  2N55 A;  2FHT A;  5CV8 A;  1LTI D;  5C0X H;  1TWC B;  4Q5V A;  3PO2 B;  4R8I A;  2F0Q A;  1ZKO A;  2J4X A;  3L9A X;  3J7A V;  1D2B A;  1CHP D;  1B9M A;  2HCC A;  4RFB A;  4WFN 3;  1U4L A;  1SYC A;  3GD7 A;  1FR3 A;  5JPN C;  1H9R A;  2MUY A;  5COR A;  1CTM A;  2B2V C;  1FD7 D;  3MTS A;  2YYZ A;  4K6D A;  3KUP A;  4M8A A;  1HTL D;  1IL8 A;  2D5D A;  2EY5 A;  4NW2 A;  5C0X G;  5C3W A;  4WJW A;  5DNF A;  2MJ8 A;  2R6G A;  1VF5 C;  4ZLT F;  5C3X A;  2SNM A;  3SHL A;  2RSO A;  1EY0 A;  2E2H B;  2R92 B;  4EVO A;  4K8J A;  5ELE A;  3NSW A;  3RZD B;  4C3J G;  3NTH A;  3QG1 A;  2C9O A;  5ELD A;  4I7Z C;  2EYO A;  3QOL A;  1K8O A;  2F0E A;  2SOB A;  1STB A;  3PMF A;  2RDH A;  1Y8O B;  1BCP F;  1OXV A;  5J1Z A;  3GTL B;  1QCB D;  2E2J B;  1AZP A;  1Y8N B;  3T4A C;  2R61 A;  3FPU B;  2WP8 J;  1AFP A;  4X3T A;  1CFM A;  2WII B;  1WD0 A;  1KAB A;  1G8Z D;  5IT9 E;  1ESF A;  4WRD A;  1U4P A;  1HCZ A;  2L0C A;  2IX1 A;  1KDB A;  4BA1 I;  1NAP A;  2F0W A;  1YNN C;  5AFW A;  4ME5 A;  2PMZ B;  3A8I E;  4CBV A;  3ERQ A;  1SNC A;  5KIX A;  1QNK A;  4R8N A;  4IFD H;  1IHZ A;  4OO1 H;  3E0J A;  5EPL A;  2HDM A;  2FJ2 A;  1TWF B;  3A7A B;  4DU9 A;  2B2Y C;  5K36 G;  1EU3 A;  1B53 A;  3H94 A;  2A69 D;  4KKT A;  5LHY 1;  4C3I G;  5E4X A;  4IUR A;  4B9X A;  4L63 B;  2BA1 A;  1SFO B;  1CA5 A;  1KDC A;  4DF7 A;  3VR2 A;  4IUP A;  1FNV A;  4PNY A;  2PW5 A;  1ZYR D;  3EA6 A;  5D65 A;  2H1E A;  1B50 A;  2EYL A;  2KQ3 A;  2JEA I;  2NVQ B;  1DJR D;  4DFA A;  3C3L A;  4TRD A;  5COY A;  3GV6 A;  1FGB D;  5ELF A;  4C3J B;  1A6X A;  2NTS A;  1PRT F;  2FMM A;  1VMC A;  4H7B A;  1SYD A;  2A6E D;  3CRK C;  3G6J B;  1TII D;  5IGD A;  3TP5 A;  2Z4H A;  4DAV A;  2EZV A;  4PMC A;  3HS0 C;  2O2L D;  1NR4 A;  4FF2 A;  3FMC A;  1WTP A;  4YIJ A;  1WCM B;  5I9P A;  1Q8I A;  1TKW B;  1GHK A;  4XDX A;  1E2V A;  4KD3 A;  1CI3 M;  5IT9 L;  3E6Z X;  2PZW A;  2F0D A;  3J7A F;  3MXG A;  2CHB D;  3J80 L;  1RDP D;  3FRP B;  3UI2 A;  2E74 C;  3OSO A;  4IUT A;  1I4G A;  4XXE A;  3K59 A;  2DNC A;  2E2D C;  4X3S A;  3KLR A;  2EY6 A;  2QKI C;  3I90 A;  3MAQ A;  1GUG A;  2EJF C;  5KNB A;  1PTO H;  1ENA A;  2AQ1 B;  1X3P A;  3J80 E;  1KDA A;  1KNA A;  4KMU C;  3AMU A;  2NUC A;  5J39 A;  1S5F D;  3SEB A;  1Z7T A;  3R3O A;  1CM9 A;  1DOK A;  4RH6 A;  4DXF A;  1F9R A;  1BCP B;  3OWE B;  2KHS A;  2F0N A;  1WTV A;  3A55 A;  5F2D A;  3GO5 A;  5LL6 S;  3T51 B;  3SK4 A;  1OO9 B;  1VF7 A;  3CQZ B;  1WD1 A;  1PTO F;  4XQN A;  3DWQ A;  2AUK A;  5NUC A;  1SYB A;  3N6R A;  1EU4 A;  3EQL C;  1CZW A;  3M85 A;  4FO2 A;  2M00 A;  4KK7 A;  1DOL A;  1M4V A;  4J6H A;  3VR4 A;  2VB3 X;  2KOL A;  1HTP A;  1UEA B;  1GUT A;  3SE0 A;  1RHP A;  4KY6 A;  1LAC A;  5KND A;  1IKM A;  2J0T D;  3I3C A;  2KEC A;  5J22 A;  1TWG B;  2A68 D;  3Q23 A;  3PUY A;  1O7Y A;  3EJI A;  3MXU A;  1LT3 D;  1BR9 A;  4DNT B;  2F0V A;  1DM0 B;  5JOB A;  4K2L A;  1LTG D;  3NUC A;  1WVL A;  3D4R A;  1H9S A;  3Q0A A;  4ZAI A;  2EJG C;  3J7Y W;  3CHB D;  2BOS A;  2VUM B;  4KHV A;  1MSG A;  4KD4 A;  1Y69 U;  3KK7 A;  2XSC A;  2IX0 A;  1SNQ A;  3S1Q B;  3FVQ A;  5FO9 B;  1PYW D;  3BYY B;  1YNJ D;  3H6M A;  1LTR D;  1J8I A;  3CU7 A;  1TQO A;  1I4X A;  2FMC A;  3L7Z C;  1Q90 A;  2F0H A;  1JB3 A;  3FKI B;  3M4O B;  5FO7 B;  1SND A;  5ELC A;  2EPB A;  4EGV A;  3TN2 A;  2JE6 I;  5M5W B;  4HTH A;  3S1N B;  1NUC A;  5C0X I;  1JWU D;  4HSP A;  3K7A B;  5IGE A;  3TME A;  2IWH A;  4ULL A;  1STH A;  1G6Z A;  3OPO A;  3IKJ A;  4IQZ A;  2I07 B;  3QJY A;  1RD9 D;  3PIP 3;  2ICI A;  4HMI A;  4B08 A;  3J81 L;  5FOB B;  4O1N A;  4E6I A;  3HOX B;  1LTA D;  1EY7 A;  2IX3 A;  3GTM B;  2A5H A;  3TP6 A;  2MGS A;  4KHZ A;  1V8Q A;  3I91 A;  3T13 A;  4IFD G;  3BS1 A;  1ESR A;  2PNR C;  1GJX A;  1AEX A;  1D6E C;  1JOK A;  4Q0F A;  3C1F A;  1XWE A;  3TSS A;  1OXS C;  3SXH A;  2V4D A;  2J7Z A;  3T53 B;  2JXM B;  2CW0 C;  3R2I A;  2NN6 G;  2O4X A;  3MVV A;  2A6H C;  1FYC A;  5KYL A;  2VXW A;  1NR2 A;  3EVQ A;  3M4Y A;  2L5T A;  2D2C C;  4EQP A;  1D5Z C;  5FO8 B;  3Q24 A;  4QF4 A;  3HOU B;  1Z47 A;  2LFN A;  4HMJ A;  4H44 C;  1F77 A;  4Z9C B;  3PUV A;  3SK8 A;  4ZUI A;  3A56 A;  3P7J A;  4RKB A;  2CW0 D;  1PRT B;  1ZYR C;  1QOH A;  3HGB A;  4C2M B;  3VR6 A;  1JIC A;  4ZKC B;  2K03 A;  3VYT A;  2B2U A;  1DD2 A;  1VMP A;  2K6A A;  1ILP A;  2IJ0 A;  1SBB B;  3H09 A;  3E5S A;  1II3 A;  5EKK A;  5E3F A;  1LT4 D;  4XT1 B;  1QWY A;  2XNA C;  2L9H A;  1JWM D;  1JCK B;  2H4O A;  2AQ3 B;  2OXP A;  4QMG A;  1EY6 A;  3PIO 3;  1KLU D;  4K5V A;  5JVH 3;  3JAM L;  1JC7 A;  4ODG A;  1Y8P B;  5BN5 A;  2VNU D;  1A2U A;  1CA6 A;  3I8Z A;  5BN4 A;  1I6V C;  3HOY B;  3NE5 B;  3VYU A;  3HOZ B;  2EXZ A;  1GUO A;  3NP8 A;  1G29 1;  2LKV A;  1SSO A;  1SAP A;  1Q1B A;  2Z4I A;  3H3V C;  3BDL A;  2KED A;  2X6L A;  3LWU A;  3PUW A;  4KY5 A;  1EOT A;  2K32 A;  5A2Q E;  3ZYY X;  5DEH A;  4KN7 C;  2DNE A;  3P75 A;  4IN3 A;  1QB5 D;  4OIJ A;  2K01 A;  5M5Y B;  2A74 C;  3MWY W;  4DAP A;  1SJE D;  1Q12 A;  5JPM C;  3RZO B;  5G3L F;  1PFB A;  1EY4 A;  4FF1 A;  1SMY C;  3MC0 B;  1EIG A;  1XXG A;  3QWN A;  4BBR B;  1PTO D;  5A2Q L;  4HN7 A;  2RDG A;  2IPK D;  2XWB B;  1TU2 B;  2Z8L A;  1IYV A;  4CGY B;  1BBX C;  3R8B A;  2B2V A;  1DOM A;  3V2T A;  5EBD A;  1Q3L A;  2F0F A;  2Q8R E;  5DAU A;  5JEA H;  5C4Z A;  4KKU A;  3MEH A;  1F2M A;  2D9U A;  4PQX A;  1I6H B;  2CQA A;  2XRS D;  1LLR D;  2DY7 A;  5EKL A;  3ND9 A;  1F2Z A;  2PPB C;  2EY1 A;  5C4H A;  2K05 A;  4EQO A;  1GXD C;  4QUC A;  3M7G A;  4ZK9 B;  3SK6 A;  2EYH A;  2KCN A;  2B39 A;  3QO2 A;  2JA8 B;  4FXK C;  3TP7 A;  3D6W A;  5K5P A;  3MA2 B;  1A15 A;  4FXD A;  4RGT A;  2X6G A;  4DK0 A;  4KI0 A;  3Q6S A;  1EEI D;  2KEE A;  1IKL A;  1XTC D;  3R2T A;  2MHV A;  1V1P B;  4G7H C;  5M3M B;  1YNN D;  3SVM A;  4RGM A;  4IZ8 A;  2ZXR A;  4J8Q A;  1ENC A;  1KAA A;  5M5X B;  2NB0 A;  4J1M A;  1V1P A;  4GZY C;  5DM7 3;  5TSS A;  4RHR A;  3S9W A;  2F0T A;  4WOR A;  4RCN A;  4K14 A;  1GOZ A;  3MXN A;  1JE4 A;  1PDQ A;  2K7V A;  1NSN S;  1RCV D;  5HUR A;  3W2D A;  3HG9 A;  3IL8 A;  3O13 A;  4NMZ A;  3X3M A;  3AB9 A;  1I4R A;  3BDC A;  2AWO A;  4K6L A;  3QB3 A;  3NPP A;  4X3U A;  3MZ5 A;  2A69 C;  5HGT A;  1E2W A;  4G57 A;  4KJO A;  1GUW A;  4FYD A;  5D14 A;  4PMW A;  1XX8 A;  2OT2 A;  4V0B A;  1MI2 A;  2BDN A;  2DN8 A;  2WAQ B;  1LTT D;  4XQJ A;  1A3V A;  2WV6 D;  4C1N I;  1B1Z A;  3NBI A;  2JA6 B;  3K5L A;  1UNS A;  4QIW B;  5KRU A;  2G9D A;  1CQV A;  1D5X C;  2AUJ D;  2WKC A;  3V05 A;  1F2L A;  2FIN B;  4F7X A;  2RKS A;  1BF4 A;  4BBS B;  4R9W A;  1HXY D;  3J81 E;  2B2T C;  2QDB A;  4G7Z C;  4RGN A;  1HQR D;  4HSV A;  1EQV A;  1YNJ C;  4FNF A;  5CV9 A;  1B4O A;  5EGT A;  1PTO B;  1KLG D;  5A35 A;  3M7N A;  1U4M A;  1MBY A;  3N52 A;  4DN4 M;  2M2L A;  3RMH A;  2A73 B;  2VB2 X;  5C0X J;  3I4N B;  1H9J A;  4H13 C;  1D1K A;  1TWH B;  4FXG C;  3HKZ B;  2BE5 D;  1X32 A;  4A3F B;  4IFD J;  5I6W A;  5C4J B;  1L0X B;  5D3I B;  5ELB A;  4DXG A;  4C3H B;  3OIP A;  1JQY D;  4U67 3;  3LNN A;  3AU7 A;  1BDO A;  2K5W A;  2R7Z B;  3HP3 A;  1TWA B;  1TY0 A;  1D5M C;  2F0M A;  2IW3 A;  3HOW B;  1T5E A;  3DM1 A;  3OHX C;  5C3E B;  2PO4 A;  1SNP A;  2RQX A;  1BNZ A;  2DY8 A;  4RKL A;  3RLF A;  1A3U A;  1SXT A;  3G7L A;  5IOC A;  2B2W A;  3NTK A;  1DXM A;  3VR3 A;  1VDZ A;  1M8A A;  1HRJ A;  4BWG B;  5IGG A;  2EDG A;  2IL8 A;  2EYJ A;  4CJ2 C;  2E76 C;  2F0O A;  3DEP A;  3T16 A;  1O7Z A;  3IFT A;  1BXT A;  4OHJ A;  5DM6 3;  3RUZ A;  3TZD A;  3VYR A;  1LT5 D;  1JOR A;  4TKO B;  4M1U B;  5EPJ A;  3W3A A;  3T56 B;  1EQT A;  1F9S A;  3OW7 A;  4CJ0 B;  1JR0 D;  4KV6 A;  5CV6 A;  4IFD I;  4BA2 I;  5D3D A;  4PV1 C;  1RF2 D;  4L8J A;  1MGS A;  5CGK A;  2B8G A;  4ZKB B;  5T1I A;  1F9P A;  3A8J E;  2EYM A;  2JSO A;  5KGU A;  2AWN A;  1TY2 A;  4IUQ A;  1PZI D;  4S3S A;  3LX0 A;  5KEE A;  1G2T A;  2XRQ D;  2F0L A;  3K5M A;  5JEA G;  1EYD A;  2ZXP A;  1PRT D;  2QF7 A;  2C5C A;  2B63 B;  3C1E A;  1JOO A;  3GTO B;  1BUV T;  1JWS D;  1KTK A;  3IFD A;  1SYG A;  5FK9 C;  1SE2 A;  1PFM A;  1ET6 A;  1OXT A;  2K28 A;  2F0I A;  3I4L A;  2XN9 C;  4CKB A;  1F9Q A;  3MXP A;  1QNU A;  3URY A;  4C56 C;  3WOE A;  1A2T A;  1OXX K;  4IUU A;  5G3L D;  1C48 A;  2XVS A;  1XYI A;  1IW7 D;  3QIA A;  1EY5 A;  1D1I A;  2QIL A;  3K6O A;  2TMP A;  1JOQ A;  4K8I A;  3C2P A;  4ZUJ A;  3F2U A;  4RGO S;  2L55 A;  4ZYS A;  4LJZ C;  4DAY A;  1TS4 A;  3S15 B;  3KBG A;  5FLX L;  3CRL C;  4XIG S;  1CHQ D;  4A3K B;  5JJZ A;  3S1M B;  1C8C A;  1S5D D;  1I50 B;  2BDO A;  3MFY A;  5CYU A;  2JEB I;  5CBA E;  2B2T A;  5T1G A;  1ICW A;  2WB1 B;  1WTR A;  2E75 C;  1DON A;  3HEJ A;  3K58 A;  3MFG A;  3JAM E;  4NP5 A;  2K1B A;  3A54 A;  3ND8 A;  1ILQ A;  3ITP A;  1UAP A;  3TP8 A;  4FF3 A;  1FNW A;  1G2S A;  3H91 A;  5CC4 A;  3DUZ A;  3NTI A;  4UDU C;  4ILW A;  4ID6 A;  1PZJ D;  4G4K A;  3K5N A;  2PW7 A;  1F2Y A;  5KYI A;  4O42 A;  1BCP D;  1ET9 A;  3DXJ C;  1PMR A;  2O5J C;  3VA7 A;  5I6Y A;  2B2W C;  3FPP A;  4F88 A;  4C3I B;  1OXU A;  3DEO A;  3GP7 A;  1IYU A;  2LS0 1;  1S5B D;  2NYZ D;  4I65 A;  5IGF A;  4A3J B;  4Y7N B;  2B8F A;  1LTS D;  4ABN A;  2XWJ B;  2HCI A;  1LAB A;  3WDN A;  3DMU A;  4BY7 B;  4DA2 A;  1WTQ A;  3BVZ A;  1DZ1 A;  4TQU S;  1I4P A;  3QOJ A;  2OEO A;  3D31 A;  3NXW A;  4LMQ D;  2NVY B;  5FKA C;  4A3G B;  4UAI A;  3PUZ A;  3BVM A;  1PFN A;  3BDO A;  1V43 A;  1GUS A;  2BE5 C;  2XIW A;  3DHQ A;  1HA6 A;  2ID0 A;  3I70 A;  2RA4 A;  2NVT B;  5C4X B;  3P20 A;  4KKS A;  2E2I B;  2EJM A;  5ISR A;  5CBE E;  1PTO C;  5M3F B;  5EPK A;  3OMG A;  1HPC A;  4OO1 I;  3KLS A;  5FLX E;  1Y1V B;  1PRT C;  3OWF A;  1EFI D;  2MP1 A;  1RJT A;  3GV3 A;  3BVG A;  1WTW A;  2NBF A;  2L1B A;  5EJW A;  1CZG A;  1V1O A;  3S2H B;  2PZU A;  1HFN A;  2ZT9 C;  4A3D B;  3GTP B;  4IAL A;  1SE3 A;  1ML0 D;  3LWE A;  1NCV A;  5I9O A;  2NN6 I;  3PO3 B;  1DYQ A;  1EWH A;  5LL6 X;  4ZRZ A;  4C3H G;  1QE6 A;  4OL7 A;  1CT1 D;  1HUM A;  2HQE A;  2TSS A;  3ONA B;  2HUG A;  3NK9 A;  4ZQ3 A;  1A3T A;  5EKI A;  4P2C B;  3TDQ A;  4IUV A;  2EVB A;  5EQ0 A;  3U9S A;  4XYO A;  4DNR B;  1BCP C;  3D3R A;  1LT6 D;  2QCP X;  4RHS A;  1H9S B;  1HQM C;  2ENB A;  1EZ6 A;  4QCL A;  1K8M A;  1LV9 A;  1I4Q A;  2JP1 A;  3S1R B;  4KN4 C;  1MSH A;  2L11 A;  5IIF A;  1STY A;  3TBI B;  5JEA J;  3NWT A;  2KJX A;  2M9V A;  4OGQ C;  1HFG A;  1ZEQ X;  2SNS A;  3SK5 A;  2QEJ C;  2D62 A;  4CKE A;  2R93 B;  5CMD A;  4DGZ A;  1BQQ T;  4CHT B;  1STG A;  2GA4 B;  4C1N K;  1RKN A;  3K5O A;  3D8G A;  2EY2 A;  1I4H A;  3K0Y A;  2Y0S B;  1EYA A;  2F03 A;  1S5E D;  2MPM A;  4HAE A;  2EYF A;  3D6C A;  4BY1 B;  1L0Y B;  1B2T A;  4BS9 A;  3WOF A;  1HA5 A;  2X69 A;  2A68 C;  1RTN A;  2RVL A;  1EZ8 A;  1EY9 A;  4N9T A;  1EL0 A;  5IGC A;  1ZXT A;  1UUP A;  2HDL A;  3CKI B;  2EE1 A;  4RA8 A;  1SYF A;  1Z6H A;  3NWS A;  3C46 A;  3OOC A;  2PQE A;  1WTX A;  4K5W A;  2SDF A;  2NZ1 D;  1B9N A;  3SDZ A;  1R4P B;  1RTO A;  3S2D B;  1EY8 A;  2I46 A;  2RSN A;  4PMB A;  3EFX D;  1EWC A;  3IAY A;  1R9T B;  4XTC S;  4A3B B;  4B9W A;  4MHE A;  5IGB A;  3PV0 A;  1STN A;  4HCE A;  1ENF A;  4A3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...