2Q8TA

Crystal structure of the cc chemokine ccl14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
PYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL14
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
molecule tags Cytokine
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8tA00
2NZ1D 3R93A 3IFDA 3MWYW 1WTRA 1IKLA 1SDFA 1JICA 1EIGA 1BBXC 4U68A 2SDFA 4QUFA 2Q8TA 4MN3A 1NCVA 2B2YC 1U4PA 5EPJA 1BO0A 2KECA 1MGSA 1AZPA 3D6WA 4IUQA 3GV6A 1S4ZA 4X3UA 1XX8A 1WTQA 2NYZD 1G2TA 1G91A 1WTVA 1ZXTA 4X3SA 1C8CA 1HUMA 3H91A 5DNFA 3SVMA 2H1EA 2RVLA 2FJ2A 2L9HA 4IURA 1GUWA 2D9UA 5D14A 1X3QA 4RA8A 4ZK9B 1M8AA 2K28A 1CM9A 1HFGA 1O7ZA 1PFMA 2EOTA 2KOLA 2KUMA 5EQ0A 2HDMA 4X3TA 4XDXA 1MI2A 2KEDA 5CORA 1LV9A 4RWSC 5AFWA 3P7JA 2B2YA 2KVMA 2N88A 2L4NA 5EJWA 4OIJA 2FMMA 2MPMA 2NWGA 1CA6A 4HCSA 4UAIA 2RSOA 1U4RA 1F2LA 1B3AA 2EPBA 4R8IA 1HRJA 1WD1A 3LWEA 2B2TC 2RA4A 1AP0A 3I90A 1HUNA 2J7ZA 5EPLA 4MHEA 1U4LA 2IL8A 3DEOA 3HP3A 1Q3LA 1ML0D 1HA6A 2DY7A 2MJ8A 5CBAE 1CA5A 1X32A 2CVRA 1XYIA 1G6ZA 1BNZA 4O42A 4IUUA 1F9PA 2B2WC 1JE4A 2B2VC 4IUPA 4XT1B 4LMQD 4DN4M 5COYA 2M2LA 3IL8A 1IKMA 2L11A 4IUVA 1VMCA 2B2TA 3GV3A 1ILPA 3FPUB 1RTNA 1HHVA 2HCCA 4CJ1B 1QE6A 1TVXA 5E4XA 2N55A 3KBXA 3ONAB 4HEDA 2L1BA 1WTWA 1ICWA 1NAPA 1EOTA 2K03A 2HDLA 1RJTA 4QUCA 4ZKBB 3KUPA 4ZKCB 1WTPA 1DOLA 1NR4A 2B2UC 4OIKA 2B2WA 2B2VA 4R9WA 1B2TA 1U4MA 1RHPA 2FFKB 1DOKA 3UI2A 3TZDA 1O80A 1PDQA 3N52A 1J8IA 4IUTA 1QG7A 1E0BA 1B53A 1PFBA 1PFNA 5CBEE 2X6LA 1QNKA 1SSOA 4CJ0B 1NR2A 2K05A 1DOMA 2EE1A 2K01A 1ESRA 3DM1A 1J9OA 5T1GA 3G7LA 1KNEA 4ZLTF 2HUGA 3I91A 2FINB 5T1IA 1X3PA 1EQTA 2MP1A 4HSVA 1RTOA 2JP1A 3I3CA 1A15A 1ILQA 2Q8RE 1SAPA 2VXWA 5EKIA 3FDTA 4ZAIA 2B2UA 4X3KA 3TN2A 3MTSA 1HFNA 1PLFA 2K1BA 1G2SA 5EPKA 2HCIA 1F9RA 1VMPA 1EL0A 4CJ2C 3Q6SA 1KNAA 2MGSA 4XT3B 1WTOA 2R3ZA 2K04A 2X6GA 5E4WC 2X69A 2RSNA 5CMDA 5JJZA 1F9QA 2XIWA 4NW2A 4RAUC 1DONA 2KEEA 1IL8A 3I8ZA 3QO2A 5D65A 1AZQA 1WVLA 4HAEA 1MSHA 1F9SA 1B50A 3DEPA 2FHTA 2DY8A 1DZ1A 1B4OA 1MSGA 2BDNA 2JYOA 1EIHA 1O7YA 1WTXA 1BF4A 1RODA 2L12A 1WD0A 3F2UA
chains in the Genus database with same CATH superfamily
4PQXA 3R93A 1V43A 4DAVA 2LXJA 2RKSA 4I7AA 1VDZA 1MKHA 5BR8Q 1QWYA 3QWNA 1BBXC 2F0SA 2EYOA 2K50A 1GJXA 3N6RA 4X62L 5K5PA 4RG1A 1JORA 4KKTA 3V2TA 1XX8A 3I70A 1F77A 2F0UA 4JBKA 2JA7G 4IJLA 5ISRA 4DV0Q 3L2PA 2A8VA 3A5UA 3P75A 4HMIA 2K28A 2AQ1B 4GNXB 4BBSB 4X66L 4N9PA 1LV9A 1G291 4DV1L 2DNCA 2F3VA 2PW7A 2L4NA 4DV6L 3K7UC 4DV7Q 4GNXC 1GOZA 2RSOA 1B7YB 4X66Q 1RD9D 2JEAI 3FHWA 3H0GG 1KXLA 2F0JA 1FR3A 2E2DC 4LFCL 1HUNA 4K0KL 4DV6Q 5EPLA 4C2MH 2EIFA 4RGMA 1PYWD 4ZUJA 1CKNB 4DV3Q 3PV0A 3HOVH 2PNHA 3I56A 1PH1A 5JEAG 1BNZA 4IUUA 2QILA 1SMYC 2LXKA 4LMQD 2JQOA 4QMGA 4IUVA 4BY1B 4UP9A 2MUYA 3PIOA 5FLXL 4BBRH 2LMCB 3M4OB 5I9OA 4HTHA 1HHVA 4CJ1B 4DKAC 5E4XA 4DR7Q 3VR5A 1UAPA 4TRDA 3S2HB 4LK1C 4R9WA 1VQAA 2E75C 2FFKB 4FVMA 1LTSD 5FK9C 4LNQA 1R4QB 2Q8IB 5CBEE 2NVQH 3NELA 2F4VQ 2D62A 2O5JC 1I6HH 1ET9A 3DWAA 1VQ7A 5M3FB 4BA1I 1XXGA 4TVAB 4HSVA 4IFDG 2L15A 3ND8A 2EY1A 2MNAA 3FDTA 4X3KA 4DV5L 2K5HA 3D31A 3EBEA 1M90C 4A3MH 5A35A 3RN5A 4GN3B 5IYBG 2X69A 1EY0A 2ZTDA 1L1OC 2N3SA 3ICEA 3MXNB 4IO9A 1Q81C 4DV5Q 4LFBL 2BE5C 4R1JA 1A0IA 1JT8A 2Z0SA 1K3RA 3PMFA 5J3BA 3BS1A 2VUMB 2FHTA 4F7XA 4GKKL 4CGYB 1D8LA 3SDZA 3KJOA 4QF4A 5E7NA 4JYAL 4LFBQ 3WOEA 3KF8B 4TKOB 3C46A 1TR5A 2NZ1D 1AW7A 2J4XA 4GKKQ 4JYAQ 4OO1I 3OHXC 3MFYA 3HOUG 2WAQB 2QDLA 1YHBA 2A68D 1GM5A 5IY0A 1SE4A 1FVIA 5EKLA 4J8QA 3PUWA 1C8CA 3J81E 1HZCA 3L9AX 2XGTA 3S1QH 1S5FD 4CKBA 5LMNL 4KHZA 5CYUA 1EIYB 1B70B 5AFWA 1TQOA 1SBBB 1V1PA 4U673 2I0QA 2EJFC 5EJWA 1SNPA 5IT9L 4AYBG 5LMNQ 1EZ6A 3GTPB 2ATWA 3NBHB 2ES2A 5HURA 3A56A 1UNSA 4A3KB 3J81c 5M5YB 1I4XA 1QZHA 3TS2A 2BH8A 5CBAE 1H95A 1X6OA 4G7HC 3OSOA 2B2VC 4LF5L 4GNXA 2LY7A 1PTOF 2L11A 1IYUA 2NZHA 4EQOA 2A69C 3EQLC 3GTMH 2RDGA 2TMPA 2M9VA 2QEJC 1X3FA 2ALYB 1K9MC 2F3IA 4LF5Q 2IX0A 3ONAB 1PVOA 3UDGA 1DOLA 1YJ9A 4F88A 3TP6A 3TZDA 1T5EA 3OIQA 5I6WA 4QQBX 2K05A 3MVVA 2A6EC 3PIP3 3KK7A 3QB3A 3V05A 3S1NH 4OWTB 1LO5D 4DV4L 2Q2UA 2K1BA 4KV6A 4CJ2C 2A5HA 2KJXA 5GAEC 2JA5B 1HA5A 1I4GA 2KHIA 5J1ZA 2RSNA 5CC4A 5JJZA 4DV4Q 2K14A 1CSQA 3NTHA 4UP7A 3HOZG 1KLGD 1GXDC 1IBKL 5C3EB 2R7ZH 1L1OA 1LT6D 1YHAA 3HOXH 1R9TB 3GTKH 4DR3L 1EOVA 2I5MX 1IBKQ 2A6HD 4U68A 1KL9A 3BVZA 2Q8TA 1H9SB 3MXNA 3GDEA 4DR3Q 4A3FH 3J7YW 2VL6A 1CKMA 3J80L 1CKOA 3NTKA 1E3PA 3SVMA 2K6AA 2FJ2A 1PRTF 4RA8A 1O7ZA 1PFMA 3S1MB 4YCUA 1EY7A 2EJMA 5C4XG 2TSSA 1GUTA 1I50H 3OTOL 4AQYL 4GN4B 1DGSA 1KIXA 2UXDL 3OPOA 1BCPC 5HY6A 3STBD 4DK3C 3OTOQ 3A55A 4AQYQ 1ASZA 1HA6A 3V96A 3PQIA 2MJ8A 3K59A 2UXDQ 1TY0A 2ZXOA 4O42A 1F9PA 1HQMC 4CKEA 2CHBD 1VQLA 1S3OA 4FNFA 1QOHA 2G9HD 1TVXA 4IPDA 3PIPA 4C2MB 4FXDA 4C56C 1NAPA 3CC7A 3HOVB 3NBHA 1IBLL 2B2VA 1P8LA 5DM63 3HEJA 4WJ4A 2EYLA 4FF4A 4ODGA 2GVBA 4DNRB 3KYHC 4BBRB 1DOMA 4RMFA 3G7LA 1IBLQ 1LTRD 2AUKA 2K33A 1RCVD 5E1FA 4HJAA 4A3LH 1V1OA 1CUKA 1LABA 2WAQE 3M85A 2R92H 2YTVA 1KC8C 3OIPA 3S1RH 4X6AH 2G9DA 2X6GA 2NVQB 1PH7A 3T4AC 1I6HB 4JI1Q 5FKAC 4ABNA 1YITA 2WINB 5LMNW 2JYOA 2N78A 5KNBA 4A3MB 3FEWX 2HD3A 3GTOH 2GN5A 2Y0SB 4RKBA 5IGFA 3MFGA 1S5DD 1O7IA 2XWJB 3PGZA 4QB4A 4DFAA 1JMCA 1XNRL 2BDOA 3AFPA 2NVTH 4FO2A 1QNUA 4GOPB 4MN3A 3NQTA 2OCEA 1FNUA 3I4LA 3JAMi 4JK1C 3D4DA 1RIPA 1XNRQ 4UHVA 3W1GA 1NBWA 1TU2B 4GOPC 4A3EH 1GUWA 3OW2A 1LTLA 4C3JG 2JA6H 4X3TA 3D0FA 2VS1A 3SXHA 2ZT9C 4AH6A 3CCRA 5IYCH 4LUVA 5J39A 4NKLA 3X3NA 1X9NA 1HRJA 1H9SA 1PZID 3S1QB 1A6XA 2IWHA 1EQQA 1Q90A 1G51A 3HP3A 5NUCA 3K80C 4UPAA 4CBVA 5ELBA 4YCVA 1E1TA 3CRLC 4ZRZA 2F0LA 2WACA 4KKUA 1S5ED 1CTMA 1E2VA 1Y1VH 1UE5A 2NN6G 2B63H 1JOOA 1EU3A 5K36H 3B6YA 1CZWA 3LX0A 4CDEC 2F0WA 2Q2IA 1KD1C 1U4MA 4LF8L 1CHPD 3IFTA 5I4DA 1GVPA 3PO3G 3GTMB 4P74A 4H7BA 4KHPL 1SYGA 3DM1A 1STEA 3TEHB 4ULLA 1FGBD 1KDAA 1X3PA 4LF8Q 4L63B 1D5ZC 2WKDA 4ZAIA 3R3OA 2A6HC 1HTLD 1EEFD 4UP8A 2ZXRA 1SE2A 3PCOB 5JVG3 2YV5A 5E4WC 3MEFA 1NY4A 3F2DA 4A3CG 3T53B 2CKZB 1SEBD 2SEBD 1STAA 4LWCA 3HG9A 3T1YL 3S1NB 3M4QA 3PUVA 1JCKB 3U58A 1CQFA 4RCOA 1K0RA 3T1YQ 2A19A 3PO2G 2VW9A 2RCFA 2JA7H 3DUZA 1X65A 1F2YA 5A2QE 3TRZA 1JICA 1N33L 3STBC 3CCVA 4OX9L 1L0XB 3ERSX 1BO0A 2E2JB 1A8VA 4IUQA 5C4JH 4IOCA 1ENAA 2KENA 1N33Q 2R7ZB 2E2HH 3H91A 3RUZA 5KYLA 3RMHA 2L9HA 3HOXB 4OX9Q 3H0GH 3GTKB 5CV5A 1QUQA 1JJ2A 1LACA 2HDMA 5CORA 4CDFC 4RWSC 1SFOH 1VQDA 4DR6L 5JEAH 1GUGA 2NWGA 2PZUA 1I4RA 4KJOA 4A3FB 1SJHD 1YZ6A 2VQFL 5E3FA 3R2TA 4GOPA 1WD1A 3S17H 4R4OA 4DR6Q 1E22A 2PQAB 4A3JG 1UE7A 2A73B 3KLRA 2WB1B 1GKHA 1EUJA 2BE5D 2F1MA 1I50B 5ELFA 3CD6A 2AMCB 3NTIA 4XT1B 1JWSD 3S15H 3M7NA 4BY7G 1VQOA 1LTAD 4HCEA 5IP7G 1Q46A 4JBMA 5JOBA 1JB3A 5C6AA 1XMQQ 1I94L 4A93G 1ASYA 4JI7Q 2NTSA 4IFDH 4DUZL 3I4MG 2JJQA 2DJGC 1K8MA 1RDPD 1I94Q 3H3VC 2F0FA 4K5XA 2Y0SE 1CI3M 1H9JA 1TWFH 5IYBH 1X56A 1UEAB 4IUNA 4PZ8A 1YIJA 1EU4A 4JI4L 4G4KA 1W6JA 2KCNA 4ME3A 3A8KE 4YWLA 1EFID 4BXXG 3TN2A 3M4PA 4G7OC 1IYVA 4EGVA 3K8AA 2JXMB 1WTOA 2NBFA 2KCMA 1DCZA 1SNDA 4KY7A 2DN8A 3HFZB 1LT4D 4L6TB 1LT5D 3J80i 1WYDA 3HKZB 5HGQA 4DPGA 1TIID 4DXGA 1U5KA 1HTPA 1Q12A 1STBA 3A7LA 1IZ6A 2R92B 3K5NA 2EYPA 4XQQA 1XNQL 3S1RB 1EIFA 3KF6B 2JA8G 3BG3A 3L7ZC 3VYRA 1JJGA 1X55A 3AMUA 1PRTD 1II3A 2A69D 2SDFA 1I4PA 4WORA 3MZ5A 5L37A 4P2CB 2KECA 2OF1A 4JOIC 4X3UA 3GTOB 4JBWA 2F0GA 2AWNA 2FXQA 2K4KA 4A3DG 1PH4A 2GA4B 3NHHA 2A74C 2EOTA 1EYAA 1GO3E 3J7AV 2NVTB 4B3MQ 4XQNA 4IPGA 4YIJA 2A6ED 3OWEB 5EKKA 3OW7A 1V1PB 4K8IA 2V4DA 5DM73 1E2ZA 4FDBA 2AQ3B 1EY9A 3LWEA 2XSCA 4A3EB 4QIWB 1AP0A 3I90A 2YTXA 1SROA 1SJED 1OO9B 3SR1A 2JA6B 3CAMA 3BYTB 5M9OA 5JPMC 4K2KA 1JE4A 3J7AF 2EZVA 1TXYA 4X62Q 3RLNA 2RF4A 3IL8A 4GN5A 1BVSA 2YU9H 2L5TA 4FF2A 4DR4L 1QE6A 2RCNA 4OEMB 2L1BA 3I4NG 1EOTA 2ZTCA 3RR5A 4MTKA 3CKIB 1FL0A 1AE2A 4OIKA 1VQ8A 2PQAA 4DV1Q 4FF1A 5BN5A 4P73A 1Z6HA 3JAML 4IUTA 2F4IA 2F3WA 1SSOA 4YWMA 3HOWG 1Y1VB 1MJCA 3Q8DA 2B63B 5FOBB 4LFCQ 2D5DA 4K0KQ 3K58A 5EGTA 1SYDA 4PNYA 3F2BA 2FMCA 2HCIA 2C5CA 3Q23A 1EL0A 2NTTA 4DK1A 1TWGH 5IP9G 2WAQG 3CC2A 3K57A 3OWFA 5C3XA 2XIWA 4XYQA 1LT3D 5DLQE 4N9TA 1N34L 4ZCKA 2QGQA 4OELB 1MJEA 5M3MG 1BCPD 4ZUIA 3CU7A 4I7ZC 1EIHA 1O7YA 3BZDB 4B9WA 2PCFB 4JPBW 1N34Q 4B9XA 1L1OB 5IWAL 2EYHA 3FP9A 2K5NA 2RDHA 1Y1WH 3MXPA 1XTDA 5ELOA 5IIFA 1GHKA 1BUVT 3BZCA 1NCVA 1VQPA 1S40A 2B2YC 3IAYA 3NXWA 5IWAQ 4DUYL 1MGSA 3I7FA 2KHSA 1SLJA 4OWXB 3AEVA 5DNFA 2RVLA 1VQ5A 2JA7B 2VNUD 3CCMA 1CFMA 1VQIA 2CW0C 3KF6A 2VB2X 2N88A 4JOIA 4S3SA 3I72A 1TWHB 3GD7A 4XIGS 5C4JB 1Q1EA 4UAIA 2Q2TA 3TS0A 1U4RA 5LL6S 2E2HB 3RNUA 1H9RA 5AJ3L 3VR2A 3H0GB 3LGJA 1U4LA 3AYHB 1SFOB 4GLVB 4EQNA 5AJ3Q 1TT2A 1I5FA 2LFNA 2B2WC 4IUPA 3W1BA 1Y69U 4DN4M 2M2LA 1YJWA 1ZYRD 2ZJQA 3P20A 3GV3A 5CR3A 1JC7A 3T16A 3S17B 3CPWA 4JV5L 4HEDA 4POFA 3MA2B 4UDUC 2OXPA 1RJTA 2QCPX 1HPCA 1A62A 1SYFA 1QG7A 3S15B 1IBML 1NR2A 1PRTB 4LF6L 3A8JE 2NVXH 3VYTA 1PMRA 1SNMA 2B8FA 2HUGA 3I91A 1A3VA 1SN8A 5KGUA 2Q8RE 5D3DA 1PZJD 2OQKA 1IBMQ 1PRTC 3GTGH 1G2SA 4LF6Q 5CV7A 1EWHA 2MGSA 3VYSA 3DM3A 3G4SA 1F2ZA 4L5TA 1TWFB 5FLMG 2EY2A 2AKWB 3Q0AA 1QB5D 2F0DA 5FJ8G 3WOFA 4HAEA 2R7FA 1VQ4A 2L12A 4A3IG 4JW0A 3LNNA 4JCVE 1IW7C 1JOKA 2HIXA 4I65A 3T13A 2PQEA 5IOCA 4FXKC 3SK4A 4C3JH 4LW1A 4P75A 5EPJA 2BH2A 4A3BG 5C44H 2NYZD 1QVCA 2K7VA 5C0XI 4C3IG 1K8AC 3CCUA 1QCBD 2D9UA 3H3VI 1A3TA 3QOLA 1E1OA 1SE3A 2F0VA 4R4QA 1MD2D 3ITPA 4DAMA 2EQSA 1HQRD 3D4WA 2B2YA 2QF7A 1LTGD 2FMMA 3IRBA 4DNIA 2I46A 4AYBB 1F2LA 1UEBA 4R8IA 3EJIA 1S5CD 4JG2A 2JSOA 2NN6H 2E8GA 4QCLA 1S5BD 1YEZA 2XRQD 1X32A 4H0LC 2I5LX 4C3HG 3VR4A 3BDLA 4IZ8A 4R4IA 3J81j 1BCPB 1CQVA 2KCTA 2B2WA 1ZKOA 2AWOA 5C0XH 3SHLA 1G8ZD 1RHPA 3EFXD 2R7DA 1DM0B 5I2XA 1CZGA 3H3VH 3KLSX 3BDCA 2R93G 4NDXA 3U4ZA 2Y0SG 4JI5L 4QY7A 2MP1A 3X3MA 2VXWA 3CCQA 4L5RC 4ID6A 3BJUA 3J7A5 3G48A 4K6LA 4JI5Q 4XT3B 3MXGA 5C3WA 1HXYD 5G3LD 3M3YH 2IHFA 2IPKD 5J22A 3PO2H 2WKCA 1I4QA 1QZGA 1O78A 1WVLA 4A76A 3H94A 2PMZB 2PZTA 3K0XA 2SOBA 2O5IC 5ELNA 5CV8A 3QOJA 3HOYG 2MO0A 1KHIA 1TWGB 2F03A 4A3GG 5CGKA 5KNDA 4V190 3GTQH 3RZDH 2K52A 3IFDA 1WTRA 2PI2A 2AUJD 1IKLA 4B3TL 2G5DA 2IW3A 3DXJC 3ULLA 4B3RL 2CH4W 2QEXA 3A8IE 3QR8A 2Z8LA 3AQQA 4GLAC 2R61A 2BCOA 2DNEA 3D6WA 1WTQA 1JR0D 1VQMA 4B3TQ 2EYJA 1WOCA 4RGNA 4ALPA 2H1EA 4DK6C 4B3RQ 1ZYRC 5D14A 1X3QA 2BOSA 1Y1WB 4MTNA 1Q8KA 4A3JH 4XDXA 1MI2A 1QUQB 4K8JA 3QIAA 2KVMA 3E0JA 4RCNA 4YCWA 1L0YB 5FLXE 1KDCA 2Q2HA 4LUZA 1WCMG 1STHA 4BY7H 1NSNS 5IP7H 3BVMA 4MHEA 3CMAA 4K14A 4A93H 1SE8A 3K6OA 4OO1G 3HRZC 1CA5A 2NB0A 3E0EA 3I4MH 3E6ZX 1K73C 5JJIA 4BWGB 5KYIA 5FLXc 2F0IA 1PYBA 3FPUB 3VA7A 1B44D 3K0YA 4IFDJ 1HZAA 5EBDA 3SK5A 1YNXA 1WTWA 1ONLA 3S14H 2UU9L 3KOJA 4BS9A 1ICFB 4BXXH 3E9HA 2KHJA 3A0JA 4L5QA 3UI2A 4LAAA 3K7AH 4KI0A 1F2MA 2X6LA 1P16A 2UU9Q 1L0WA 2EE1A 1XMOL 4M1UB 1E7ZA 1UUPA 3K5MA 2HQLA 5T1IA 3CQZH 2J0TD 1KQSA 1HR0W 1ILQA 3FMCA 4DR5L 4BA2I 3ND9A 2RQXA 1Q8IA 4QJFA 2MFIA 1XMOQ 4J6HA 1G6PA 1LTID 3FKIG 1DD2A 2Z6BA 2EY5A 3VDYA 2IJ0A 1MBYA 5IGGA 3DMUA 1V9PA 4DR5Q 2NVXB 2JA8H 1DONA 1IL8A 4WRDA 1EY4A 2ZJPA 1B3QA 3RZOH 1EQRA 5F2DA 3C2PA 3GTGB 2VY3A 1WTXA 3NUCA 2YTYA 3DWQA 3F8TA 4HMJA 2K32A 1B8AA 1N36L 1M1KC 3PUXA 4A3DH 4KHPQ 5HGTA 1D2BA 1M4VA 1PTOH 4KLKA 3R8BA 3VYUA 5IT9E 2XNAC 1U4PA 5GROA 4O1NA 4CKCA 4KJNA 1AZPA 3GV6A 2ZJRA 1ENFA 4HIKA 1OXVA 4Y52H 1HUMA 4IOAA 1D5XC 3ER0A 2ASBA 3KBGA 1BBUA 1X3EA 3OMGA 4HSPA 3CCEA 3H15A 4POGA 3D6CA 4Z9CB 4C3JB 1OXUA 3P7JA 5LMUL 1KAWA 3VR3A 3RD4A 1NJIC 5C44B 5IT9c 1VQGA 1FJGL 1B3AA 5GAGC 4LUOA 4EVOA 4GKJL 5I9PA 2J7ZA 3J81L 4IFDI 1XWEA 4KN7C 5IGCA 1AEXA 4KKSA 1FJGQ 2CVRA 3T51B 3I4NH 4P71A 1OTCA 1JJCB 1JB7A 1EEID 4ILWA 4B3SL 1OXXK 3D8GA 3NK9A 5BN3A 5GQOA 2JA9A 3HOWH 4DXFA 2N55A 3C1EA 3CXCA 2K03A 1PH9A 4ZKCB 4C1NK 4DA2A 5IGDA 1PTOD 3N52A 3AU7A 1ENCA 1B9NA 2JE6I 1E0BA 2HQEA 1K3BC 1N32L 3U50C 4ME5A 2VQFQ 1J9OA 2L55A 4XYOA 4YHHL 4V0BA 1EQTA 2JEBI 3EA6A 4E6IA 2JP1A 3I3CA 3F1ZA 4DAYB 5M3MH 2PZWA 2CW0D 4YHHQ 1EYDA 2K04A 2F0PA 4NPSA 5CMDA 2CWPA 4WJ3M 4NW2A 5FO9B 3NWTA 2KEEA 1E24A 1BR9A 5ELEA 2PPBC 3GTLH 4Y7NH 4O0AA 3DEPA 4DUZQ 3J80E 3I2ZA 5M5WH 3UDXA 1QVFA 4OONA 2EDGA 3M3YB 3PO2B 3T56B 2K5DA 4CDCC 3MWYW 1EIGA 4A3EG 4JI4Q 4CDDC 2LKVA 2VQEL 4RHRA 3J80c 1HNXL 3GTQB 3RZDB 3BU2A 2Z9HA 3HOUH 5ELDA 3PUYA 3E3XA 4BBSG 4L8JA 2KUMA 2DGYA 3ULPA 5EQ0A 1TKWB 3T1HL 2VQEQ 3ERQA 1CHQD 3A74A 1HNXQ 1PH5A 4RHSA 5D3IB 4OIJA 1YJNA 2E2IH 2K75A 1CA6A 3U4VA 1C4QA 1HNWL 1LUZA 3VR6A 4DGZA 2B29A 1XNQQ 3T1HQ 2EPBA 2NZOA 2ICEC 2B2TC 1STYA 1HZ9A 1R4PB 2VZAA 3D3RA 2NVYH 1W6KA 2XTIA 3PIO3 4KY6A 4A3JB 1ML0D 1VQCA 2K5WA 4XTCS 3M9BA 3S2DH 4IN3A 5EBCA 1XYIA 5JJLA 5BN4A 1G6ZA 5CV4A 4MNOA 4LF4L 1SNCA 4BY1G 1IKMA 2ZXPA 2MHVA 1N8RC 4BY7B 1HH2P 2WP8J 4G57A 4A93B 4LF4Q 1VQJA 1IW7D 1Z47A 1WJJA 5IYDG 4MIUA 1W2BA 2P5ZX 4TSSA 3I4MB 1JWMD 3CHBD 3C3LA 2GVAA 5KIXA 1D1KA 2IX3A 3NPPA 2F0QA 1VF7A 1SYEA 5BR8L 4DK0A 1Y8OB 5M3FG 5FLMH 2UXCL 3EIVA 2XWBB 4LF9L 5FJ8H 5EKIA 3S14B 2F0NA 2B39A 2DUDA 5EPKA 1CK1A 2UXCQ 3E5SA 3S1MH 1MHWC 3K7AB 4LF9Q 3FRPB 4DV0L 4A3IH 5C5LA 1GUNA 1YBYA 3K5OA 5DEHA 3E9IA 4JVZA 4DR4Q 3Q24A 4OHJA 3CQZB 1XPOA 2VUMG 1MSHA 1STNA 5IGEA 4DV7L 1VQEA 2BDNA 3FVQA 4FP5D 1BF4A 1KRTA 4A3BH 1RODA 1EWIA 3F2UA 2CWAA 3FPPA 1HZBA 1K8OA 4LFAL 1PYSB 4DAYA 4RGTA 4C3IH 2JA8B 3HOZH 1SDFA 1A63A 2BA0A 4J1MA 4DV3L 1ZEQX 1SRUA 4PMCA 3IKJA 3RZOB 4OGQC 4QUFA 4XXEA 3CMEA 2O2LD 4KK7A 1DYQA 4LFAQ 1PFSA 1IHZA 2JN4A 1QILA 2OTLA 1RF2D 3NEMA 2ZTEA 4KHVA 1ZXTA 4R4TA 3TQYA 3GTJH 5M5XH 4DR7L 4A3DB 1SNQA 4PMWA 1PTOB 1FYCA 4IPHA 3RN2A 1SYCA 5FO7B 2Z6KC 4OL7A 1D1IA 4RGOS 2MPMA 3BDOA 4C3HH 4MZ9A 1EYGA 2F4VL 5CV6A 1PTOC 3W3AA 4KY5A 2WB1E 1TWCH 4IQZA 4A3KG 4JC0A 4H02A 2E74C 3DEOA 5C4XH 1XPUA 2EXZA 1YHQA 4K5WA 3K5LA 1U9RA 1YVCA 2DY7A 3EN2A 1U0LA 4F8MA 4RKLA 3NP8A 4DUYQ 3SGIA 4GS3A 2B2TA 2EY6A 1I4HA 4JI0L 2UUCL 3TP5A 2R93H 1CSPA 4PV1C 3L0OA 2XN9C 1Y8NB 3TSSA 1ICWA 1TWAH 2RHSB 3I4NB 2N49A 5C0XJ 4JI0Q 1I3QH 2C9OA 2UUCQ 1JE5A 1AFPA 3LWUA 4OXPA 5KNCA 2SNMA 1Q1BA 1UWVA 1ESRA 3HOWB 2L0CA 2CFMA 5IE8A 1EZ8A 3M7GA 2OQ0A 5IODA 3J7ZC 4Q0FA 3HOYH 2H5XA 1STGA 4PMBA 2JA5G 4A3GH 1B1ZA 3W2DA 4G7ZC 2UUBL 2R6GA 1FD7D 2IY5B 3HKZE 3M4YA 3HZXA 4CHTB 1RL2A 1KAAA 3QO2A 5D65A 1PHJA 1VCIA 2UUBQ 4JV5Q 4DNTB 5LL6X 4KN4C 5M3MB 5C3EG 3KLSA 1FGUA 4R8NA 2ZM6L 4NB3A 2IHEA 3TMEA 2RHQB 2EVBA 2Z4IA 3KJPA 1V1QA 3OOCA 2DJFC 2ZM6Q 3DLLA 3GTLB 4Y7NB 3WWVA 3CF5A 4KTAA 1IL2A 1GD7A 5M5WB 5I2YA 3J81i 3KLWA 3S16H 3URYA 2AQ2B 1S4ZA 5EAYA 1H9MA 3PF5A 1VQKA 4IURA 1WCMH 2NN6I 2RBMA 3G6JB 2KOLA 1GUOA 3DHQA 4QL5A 5A2QL 1NMGA 4OO1H 1X54A 1N9WA 1AH9A 1E2WA 1HR0L 1KDBA 4QIWE 2K5QA 4A4IA 4AIMA 2UXBL 5JVH3 2RA4A 1UE6A 3SK6A 3HOUB 4JI3L 1VQ6A 4DV2L 1CKNA 1HR0Q 5ELCA 3KDFB 5JJKA 2WFWA 2Z6KA 2UXBQ 1LYLA 2E2IB 4JI3Q 4DV2Q 1SNOA 4R4CA 2NVYB 3BVGA 3K81C 1ESFA 2SNSA 1XTCD 3HOVG 2QKIC 3S2DB 2HDLA 1WFQA 4QUCA 4JI2L 3TBIB 1H9KA 2OT2A 2HHHL 1TS3A 4WFN3 4DF7A 1DOKA 1PDQA 3FKIH 2XRSD 1FNWA 2PW5A 4H44C 4BBRG 4HJ7A 2OWOA 4JI2Q 2E2JH 2HHHQ 2MQHA 2BA1A 2XVSA 3NBIA 3HKSA 3EVQA 1KABA 4LJZC 4EQ5A 2E76C 1SAPA 3HGBA 3HS0C 3PO3H 3U9SA 1A2TA 2AHOB 2F0HA 2F0OA 1Q7YC 1JWUD 2JK8A 1D7QA 2EXDA 4X64L 1F9SA 5KEEA 1Y1WG 2YU9B 4EQPA 1CT1D 4HJ9A 1Y8PB 2QDBA 3KF8A 4A3MG 1EFWA 4A3CH 1LLRD 2UUAL 2E5LL 1VQFA 4A3IB 2V1CC 3QJYA 4X64Q 5H1SE 3NWSA 2HIVA 2UUAQ 2E5LQ 1B9MA 1SYBA 3R2IA 4K2LA 4QGUA 3H6MA 1GHJA 4A3BB 1G2TA 1G91A 1I6VC 1WTVA 1GUSA 4O2DA 2EYMA 2YYZA 1L2FA 4RFBA 3HOZB 1BDOA 4C3IB 1C48A 1HFGA 1MIUA 5JAVA 2I07B 2KEDA 3UDFA 5C4ZA 4DR1L 3MHBA 2KQ3A 4JBJA 3AB9A 1QJOA 1O7LA 2KBNA 4B08A 4JI6L 3W5OA 1TS4A 1WTHA 1PXUA 4DR1Q 3GTJB 4DR2L 5M5XB 5LHY1 4NXML 1OXSC 1PH2A 5C5MA 2IL8A 4JI6Q 2D0PA 2KCCA 3JAME 1KTKA 5KRUA 4DR2Q 4NXMQ 4C3HB 5COYA 1VMCA 3CRKC 1VF5C 2IT1A 2N8NA 4WJWA 4JI1L 1EY8A 1TY2A 1PA6A 1TWCB 1RTNA 2WV6D 5JEAJ 2A68C 1VQNA 5C4XB 1S72A 3KUPA 1HJPA 4FXGC 4DU9A 1YNND 1B2TA 3NQIA 1NE3A 1O80A 3JAMc 1DJRD 1B53A 3KDFA 1QNKA 2K01A 1EWCA 2QA4A 5T1GA 4ZLTF 3L3OC 1KNEA 3TP7A 2R93B 5I6YA 2FINB 4Q5VA 1PZKD 2PI2E 1TWAB 2CH4A 1AN8A 1AE3A 3MTSA 1JQYD 1HFNA 1IYJB 1I3QB 1F9RA 1BCPF 2RDFA 1FNVA 2LSSA 3Q6SA 1KLUD 1K83H 1EY6A 2F0TA 4RH6A 3DWPA 2A1AA 4C1NI 1Z7TA 1AZQA 4PG3A 1YNJD 2DY8A 4P72A 1MSGA 4GLXA 1A3UA 3HOYB 4HJ5A 4A3GB 1ET6A 1BBWA 3A7AB 4F87A 3CPFA 2Z4HA 5C44G 2M00A 3CC4A 1TS2A 4N8FA 3TDQA 2K5VA 4BBSH 1BXTA 3NE5B 1V8QA 1SR3A 1Q82C 2F0EA 1T9HA 1SXTA 1EY5A 2F52A 2F0KA 3CW2C 2R7ZG 1NMFA 4X3SA 1J6QA 1VQHA 3HOXG 1PH8A 1RKNA 1PV4A 1M8AA 2B8GA 1SMXA 3UE0A 2CCZA 2D2CC 3CCLA 1Y14B 4AYBE 3OYYA 2CQAA 4HR7B 5GADC 2ID0A 4A3FG 3S16B 1KRSA 4HCSA 4BY1H 1LM0A 3M4OH 1WCMB 3MEHA 1BKBA 3VA5A 1N36Q 4KMUC 2WB1G 4HJ8A 4NXNL 4H13C 3BYYB 1Q86C 5IYDH 1UE1A 4OWWB 3S2HH 4LF7L 1T5XD 3CCSA 2B3GA 3ZJYC 4NXNQ 1K0SA 1ILPA 1LTBD 5C0XG 3S24A 5CV9A 3SE0A 2ICIA 3MXUA 5M3FH 4LF7Q 3KBXA 3GP7A 4HIMA 2I5HA 4ZKBB 1PH6A 2B2UC 1HNZL 1C7YA 3TREA 1D5MC 1NNXA 5LMUQ 1J8IA 3PUZA 1NTGA 3OMCA 3PF4A 3D4RA 3GO5A 3AFQA 4K6DA 3NENA 1W3SA 2IX1A 4CJ0B 3QG1A 3G71A 3S9WA 1HNZQ 2HT1A 1JOQA 3O13A 4GKJQ 2D0OA 1RTOA 3I73A 1A15A 1XPRA 2VUMH 3CCJA 1PH3A 3P1HA 3JC66 4XQJA 1SMYD 3RLOA 4IJHA 3RLFA 1KNAA 3FKIB 3ULJA 3MC0B 2PMZE 4HIDA 1BQQT 1F9QA 1TWHH 4B3SQ 2H4OA 3SEBA 1YI2A 3I8ZA 3HKZG 4A3LG 5IP9H 1A2UA 4IALA 1B50A 1EQVA 2R92G 1B4OA 3PO3B 3GQBA 2ENBA 2VB3X 2C35B 3F2CA 1K8GA 1DXMA 5IGBA 4NMZA 1Z9FA 1D6EC 1K28A 1N32Q 4N8X1 1HCZA 3PSIA 3G6EA 3EROA 1LTTD 1EYCA 1NUCA 4ZYSA 2WIIB 4EX5A 4K5VA 3KFUA 3UE1A 4DAPA 3GTPH 1C0AA 4KD4A 4PZ6A 1XMQL 4ZK9B 4A3KH 4JI7L 4JI8L 1CM9A 2EJGC 5M5YH 3UDIA 3A54A 4YY3L 1BOSA 3C1FA 4HIOA 2OEOA 1VQ9A 5TSSA 4JI8Q 1J5EL 4NP5A 2LS01 3Q22A 1YNNC 1XJVA 5JPNC 4YY3Q 5GAHC 2JA6G 1WI5A 1Q3LA 2NUCA 1J5EQ 4YWKA 3U9OA 5C4HA 3NSWA 5IYCG 1OXTA 3CP0A 2EYFA 1IXRA 2MO1A 4TQUS 1VQBA 2HCCA 2F0MA 4KD3A 3ZYYX 2OTJA 3TZUA 2PNRC 4J15A 1WTPA 1NR4A 3H09A 1YNJC 1C9OA 3TP8A 3I55A 1PFBA 1PFNA 1VS0A 3BZKA 2JA5H 1HNWQ 1Y1VG 5G3LF 3SK8A 2B63G 4L5SA 5K36G 2O4XA 4FYDA 3I4OA 4X65L 3A5ZB 1X3GA 2B2UA 5DAUA 1PLFA 5C3EH 1VMPA 1TS5A 2QW7A 2R3ZA 1QVGA 5FO8B 2PYKA 4X65Q 4UY8C 4ZQ3A 1R9TH 4APVA 4IPCA 2Z1CA 4RAUC 4B3ML 4A75A 4M8AA 4GZYC 4FF3A 3MAQA 1DZ1A 2KA7A 2PO4A 4PZ7A 1WD0A 1K83B 3WDNA 4HN7A 2CQOA
chains in the Genus database with same CATH topology
4PQXA 3R93A 1V43A 4DAVA 2RKSA 1VDZA 1QWYA 3QWNA 1BBXC 2F0SA 2EYOA 1GJXA 3N6RA 5K5PA 1JORA 4KKTA 3V2TA 1XX8A 3I70A 1F77A 2F0UA 5ISRA 3P75A 4HMIA 2K28A 2AQ1B 4BBSB 4N9PA 1LV9A 1G291 2DNCA 2F3VA 2PW7A 2L4NA 1GOZA 2RSOA 1RD9D 2JEAI 2F0JA 1FR3A 2E2DC 1HUNA 5EPLA 4RGMA 1PYWD 4ZUJA 3PV0A 5JEAG 1BNZA 4IUUA 2QILA 1SMYC 4LMQD 4QMGA 4IUVA 4BY1B 2MUYA 5FLXL 3M4OB 2LMCB 5I9OA 4HTHA 1HHVA 4CJ1B 5E4XA 3VR5A 1UAPA 4TRDA 3S2HB 4LK1C 4R9WA 2E75C 2FFKB 4FVMA 1LTSD 5FK9C 1R4QB 2Q8IB 5CBEE 2D62A 2O5JC 1ET9A 3DWAA 5M3FB 4BA1I 1XXGA 4HSVA 4IFDG 3ND8A 2EY1A 3FDTA 4X3KA 3D31A 5A35A 2X69A 1EY0A 2BE5C 3PMFA 3BS1A 2VUMB 2FHTA 4F7XA 4CGYB 3SDZA 4QF4A 3WOEA 4TKOB 3C46A 1TR5A 2NZ1D 1AW7A 2J4XA 4OO1I 3OHXC 3MFYA 2WAQB 2A68D 1SE4A 5EKLA 4J8QA 3PUWA 1C8CA 3J81E 3L9AX 1S5FD 4CKBA 4KHZA 5CYUA 5AFWA 1TQOA 1SBBB 1V1PA 4U673 2EJFC 5EJWA 1SNPA 5IT9L 1EZ6A 3GTPB 5HURA 3A56A 1UNSA 4A3KB 5M5YB 1I4XA 5CBAE 4G7HC 3OSOA 2B2VC 2LY7A 1PTOF 2L11A 1IYUA 4EQOA 2A69C 3EQLC 2RDGA 2TMPA 2M9VA 2QEJC 2IX0A 3ONAB 1DOLA 4F88A 3TP6A 3TZDA 1T5EA 3OIQA 5I6WA 2K05A 3MVVA 2A6EC 3PIP3 3KK7A 3QB3A 3V05A 1LO5D 2K1BA 4KV6A 4CJ2C 2A5HA 2KJXA 2JA5B 1HA5A 1I4GA 5J1ZA 2RSNA 5CC4A 5JJZA 3NTHA 1KLGD 1GXDC 5C3EB 1LT6D 1R9TB 2A6HD 4U68A 3BVZA 2Q8TA 1H9SB 3MXNA 3J7YW 3J80L 3NTKA 3SVMA 2K6AA 2FJ2A 1PRTF 4RA8A 1O7ZA 1PFMA 3S1MB 1EY7A 2EJMA 2TSSA 1GUTA 3OPOA 1BCPC 3A55A 1HA6A 3V96A 2MJ8A 3K59A 1TY0A 2ZXOA 4O42A 1F9PA 1HQMC 4CKEA 2CHBD 4FNFA 1QOHA 2G9HD 1TVXA 4C2MB 4FXDA 4C56C 1NAPA 3HOVB 3NBHA 2B2VA 5DM63 3HEJA 2EYLA 4FF4A 4ODGA 4DNRB 4BBRB 1DOMA 3G7LA 1LTRD 2AUKA 2K33A 1RCVD 5E1FA 1V1OA 1LABA 3M85A 3OIPA 2G9DA 2X6GA 2NVQB 3T4AC 1I6HB 5FKAC 4ABNA 2WINB 2JYOA 5KNBA 4A3MB 3FEWX 2Y0SB 4RKBA 5IGFA 3MFGA 1S5DD 2XWJB 4QB4A 4DFAA 2BDOA 4FO2A 1QNUA 4MN3A 3NQTA 1FNUA 3I4LA 4JK1C 3D4DA 1TU2B 1GUWA 4C3JG 4X3TA 3SXHA 2ZT9C 5J39A 4NKLA 3X3NA 1HRJA 1H9SA 1PZID 3S1QB 1A6XA 2IWHA 1Q90A 5NUCA 3HP3A 4CBVA 5ELBA 3CRLC 4ZRZA 2F0LA 2WACA 4KKUA 1S5ED 1CTMA 1E2VA 2NN6G 1JOOA 1EU3A 5K36H 1CZWA 3LX0A 2F0WA 1U4MA 1CHPD 3IFTA 5I4DA 3GTMB 4H7BA 1SYGA 3DM1A 1STEA 4ULLA 1FGBD 1KDAA 1X3PA 4L63B 1D5ZC 2WKDA 4ZAIA 3R3OA 2A6HC 1HTLD 1EEFD 2ZXRA 1SE2A 5JVG3 5E4WC 3T53B 1SEBD 2SEBD 1STAA 3HG9A 3S1NB 3PUVA 1JCKB 1CQFA 4RCOA 3DUZA 1F2YA 5A2QE 1JICA 1L0XB 1BO0A 2E2JB 4IUQA 1ENAA 2R7ZB 3H91A 3RUZA 5KYLA 3RMHA 2L9HA 3HOXB 3GTKB 5CV5A 1LACA 2HDMA 5CORA 4RWSC 5JEAH 1GUGA 2NWGA 2PZUA 1I4RA 4KJOA 4A3FB 1SJHD 5E3FA 3R2TA 1WD1A 2A73B 3KLRA 2WB1B 2BE5D 2F1MA 1I50B 5ELFA 3NTIA 4XT1B 1JWSD 3M7NA 1LTAD 4HCEA 5JOBA 1JB3A 5C6AA 2NTSA 4IFDH 1K8MA 1RDPD 3H3VC 2F0FA 4K5XA 1CI3M 1H9JA 1UEAB 4IUNA 1EU4A 4G4KA 1W6JA 2KCNA 3A8KE 1EFID 3TN2A 4G7OC 1IYVA 4EGVA 2JXMB 1WTOA 2NBFA 1DCZA 1SNDA 4KY7A 2DN8A 1LT4D 4L6TB 1LT5D 3HKZB 1TIID 4DXGA 1STBA 1HTPA 1Q12A 3A7LA 2R92B 3K5NA 2EYPA 4XQQA 3S1RB 3BG3A 3L7ZC 3VYRA 3AMUA 1PRTD 1II3A 4WORA 2A69D 1I4PA 2SDFA 3MZ5A 4P2CB 2KECA 2OF1A 4X3UA 3GTOB 4JBWA 2F0GA 2AWNA 2GA4B 3NHHA 2A74C 2EOTA 1EYAA 3J7AV 2NVTB 4XQNA 4YIJA 2A6ED 3OWEB 5EKKA 3OW7A 1V1PB 4K8IA 2V4DA 5DM73 1E2ZA 2AQ3B 1EY9A 3LWEA 2XSCA 4A3EB 4QIWB 1AP0A 3I90A 1SJED 1OO9B 3SR1A 2JA6B 3BYTB 5M9OA 5JPMC 4K2KA 1JE4A 3J7AF 2EZVA 3IL8A 2L5TA 4FF2A 1QE6A 2L1BA 1EOTA 3CKIB 4OIKA 4FF1A 5BN5A 3JAML 1Z6HA 4IUTA 2F4IA 2F3WA 1SSOA 1Y1VB 2B63B 5FOBB 2D5DA 3K58A 5EGTA 1SYDA 4PNYA 2FMCA 2HCIA 2C5CA 3Q23A 1EL0A 2NTTA 4DK1A 3K57A 3OWFA 5C3XA 2XIWA 4XYQA 1LT3D 4N9TA 1BCPD 4ZUIA 3CU7A 4I7ZC 1EIHA 1O7YA 3BZDB 4B9WA 2PCFB 4B9XA 2EYHA 2RDHA 3MXPA 5IIFA 1GHKA 1BUVT 1NCVA 2B2YC 3IAYA 3NXWA 1MGSA 2KHSA 5DNFA 2RVLA 2JA7B 2VNUD 1CFMA 2CW0C 2VB2X 2N88A 4S3SA 3I72A 1TWHB 3GD7A 4XIGS 5C4JB 1Q1EA 4UAIA 1U4RA 5LL6S 2E2HB 1H9RA 3VR2A 3H0GB 1U4LA 1SFOB 4EQNA 1TT2A 2LFNA 2B2WC 4IUPA 1Y69U 4DN4M 2M2LA 1ZYRD 3P20A 3GV3A 5CR3A 1JC7A 3T16A 3S17B 4HEDA 3MA2B 4UDUC 2OXPA 1RJTA 2QCPX 1HPCA 1SYFA 1QG7A 3S15B 1NR2A 1PRTB 3A8JE 3VYTA 1PMRA 1SNMA 2B8FA 2HUGA 3I91A 1A3VA 5KGUA 2Q8RE 5D3DA 1PZJD 1PRTC 1G2SA 5CV7A 1EWHA 2MGSA 3VYSA 1F2ZA 1TWFB 2EY2A 3Q0AA 1QB5D 2F0DA 3WOFA 4HAEA 2L12A 3LNNA 1IW7C 1JOKA 4I65A 3T13A 2PQEA 5IOCA 4FXKC 3SK4A 5EPJA 2NYZD 2K7VA 5C0XI 4C3IG 1QCBD 2D9UA 1A3TA 3QOLA 1SE3A 2F0VA 1MD2D 3ITPA 1HQRD 3D4WA 2B2YA 2QF7A 1LTGD 2FMMA 2I46A 4AYBB 1F2LA 4R8IA 3EJIA 1S5CD 2JSOA 2NN6H 4QCLA 1S5BD 2XRQD 1X32A 4H0LC 4C3HG 3VR4A 3BDLA 4IZ8A 1BCPB 1CQVA 2B2WA 1ZKOA 2AWOA 5C0XH 3SHLA 1G8ZD 1RHPA 3EFXD 1DM0B 5I2XA 1CZGA 3KLSX 3BDCA 4NDXA 2MP1A 3X3MA 2VXWA 4ID6A 4K6LA 4XT3B 3MXGA 5C3WA 1HXYD 5G3LD 2IPKD 5J22A 2WKCA 1I4QA 1O78A 1WVLA 3H94A 2PMZB 2PZTA 2SOBA 2O5IC 5CV8A 3QOJA 2F03A 1TWGB 5CGKA 5KNDA 4V190 3IFDA 1WTRA 2AUJD 1IKLA 2IW3A 3DXJC 3A8IE 2Z8LA 2R61A 2BCOA 2DNEA 3D6WA 1WTQA 1JR0D 2EYJA 4RGNA 2H1EA 1ZYRC 5D14A 1X3QA 2BOSA 1Y1WB 4XDXA 1MI2A 4K8JA 3QIAA 2KVMA 3E0JA 4RCNA 1L0YB 5FLXE 1KDCA 1STHA 1NSNS 3BVMA 4MHEA 4K14A 3K6OA 4OO1G 3HRZC 1CA5A 2NB0A 3E6ZX 4BWGB 5KYIA 2F0IA 3FPUB 3VA7A 1B44D 3K0YA 4IFDJ 5EBDA 3SK5A 1WTWA 1ONLA 4BS9A 3UI2A 4LAAA 4KI0A 1F2MA 2X6LA 2EE1A 4M1UB 1UUPA 3K5MA 5T1IA 2J0TD 1ILQA 3FMCA 4BA2I 3ND9A 2RQXA 1Q8IA 4J6HA 1LTID 1DD2A 2EY5A 2IJ0A 1MBYA 5IGGA 3DMUA 2NVXB 1DONA 1IL8A 4WRDA 1EY4A 5F2DA 3C2PA 3GTGB 1WTXA 3NUCA 3DWQA 4HMJA 2K32A 3PUXA 5HGTA 1D2BA 1M4VA 1PTOH 3R8BA 3VYUA 5IT9E 2XNAC 1U4PA 4O1NA 4CKCA 4KJNA 1AZPA 3GV6A 1ENFA 1OXVA 1HUMA 1D5XC 3KBGA 3OMGA 4HSPA 3D6CA 4Z9CB 4C3JB 1OXUA 3P7JA 3VR3A 3RD4A 5C44B 1B3AA 4EVOA 5I9PA 2J7ZA 3J81L 4IFDI 1XWEA 4KN7C 5IGCA 1AEXA 4KKSA 2CVRA 3T51B 1EEID 4ILWA 1OXXK 3D8GA 3NK9A 5BN3A 4DXFA 2N55A 3C1EA 2K03A 4ZKCB 4C1NK 4DA2A 5IGDA 1PTOD 3N52A 3AU7A 1ENCA 1B9NA 2JE6I 1E0BA 2HQEA 4ME5A 1J9OA 2L55A 4XYOA 4V0BA 1EQTA 2JEBI 3EA6A 4E6IA 2JP1A 3I3CA 2PZWA 2CW0D 1EYDA 2K04A 2F0PA 5CMDA 4NW2A 5FO9B 3NWTA 2KEEA 1BR9A 5ELEA 2PPBC 3DEPA 3J80E 2EDGA 3M3YB 3PO2B 3T56B 2K5DA 3MWYW 1EIGA 2LKVA 4RHRA 3GTQB 3RZDB 5ELDA 3PUYA 4L8JA 2KUMA 5EQ0A 1TKWB 3ERQA 1CHQD 4RHSA 5D3IB 4OIJA 1CA6A 1C4QA 3VR6A 4DGZA 2EPBA 2ICEC 2B2TC 1STYA 1R4PB 3D3RA 1W6KA 3PIO3 4KY6A 4A3JB 1ML0D 2K5WA 4XTCS 4IN3A 5EBCA 1XYIA 1G6ZA 5BN4A 5CV4A 1SNCA 1IKMA 2ZXPA 2MHVA 4BY7B 4G57A 2WP8J 4A93B 1IW7D 1Z47A 4MIUA 4TSSA 3I4MB 1JWMD 3CHBD 3C3LA 5KIXA 1D1KA 2IX3A 3NPPA 2F0QA 1VF7A 1SYEA 4DK0A 1Y8OB 2XWBB 5EKIA 3S14B 2F0NA 2B39A 5EPKA 1CK1A 3E5SA 3K7AB 3FRPB 5C5LA 1GUNA 3K5OA 5DEHA 3Q24A 4OHJA 3CQZB 1MSHA 1STNA 5IGEA 2BDNA 3FVQA 4FP5D 1BF4A 1RODA 3F2UA 3FPPA 1K8OA 4DAYA 4RGTA 2JA8B 1SDFA 2BA0A 4J1MA 1ZEQX 4PMCA 3IKJA 3RZOB 4OGQC 4QUFA 4XXEA 2O2LD 4KK7A 1DYQA 1IHZA 1QILA 1RF2D 4KHVA 1ZXTA 4A3DB 1SNQA 4PMWA 1PTOB 1FYCA 1SYCA 5FO7B 4OL7A 1D1IA 4RGOS 2MPMA 3BDOA 5CV6A 1PTOC 3W3AA 4KY5A 4IQZA 2E74C 3DEOA 2EXZA 4K5WA 3K5LA 1U9RA 2DY7A 4F8MA 3NP8A 2B2TA 2EY6A 1I4HA 3TP5A 4PV1C 2XN9C 1Y8NB 3TSSA 1ICWA 3I4NB 5C0XJ 2C9OA 1AFPA 3LWUA 5KNCA 2SNMA 1Q1BA 1ESRA 3HOWB 2L0CA 1EZ8A 3M7GA 5IODA 4Q0FA 1STGA 4PMBA 1B1ZA 3W2DA 4G7ZC 2R6GA 1FD7D 3M4YA 3HZXA 4CHTB 1KAAA 3QO2A 5D65A 1VCIA 4DNTB 5LL6X 4KN4C 5M3MB 3KLSA 4R8NA 3TMEA 2EVBA 2Z4IA 3OOCA 3GTLB 4Y7NB 4KTAA 5M5WB 5I2YA 3URYA 2AQ2B 1S4ZA 1H9MA 4IURA 2NN6I 2RBMA 3G6JB 2KOLA 1GUOA 3DHQA 5A2QL 4OO1H 1E2WA 1KDBA 2K5QA 5JVH3 2RA4A 3SK6A 3HOUB 5ELCA 4HN7A 2E2IB 1SNOA 2NVYB 3BVGA 1ESFA 2SNSA 1XTCD 2QKIC 3S2DB 2HDLA 4QUCA 3TBIB 1H9KA 2OT2A 1TS3A 4WFN3 4DF7A 1DOKA 1PDQA 2XRSD 1FNWA 2PW5A 4H44C 2BA1A 2XVSA 3NBIA 3EVQA 1KABA 4LJZC 2E76C 1SAPA 3HGBA 3HS0C 3U9SA 1A2TA 2F0HA 2F0OA 1JWUD 1F9SA 5KEEA 2YU9B 4EQPA 1CT1D 1Y8PB 2QDBA 3KF8A 1LLRD 4A3IB 3QJYA 3NWSA 1B9MA 1SYBA 3R2IA 4K2LA 3H6MA 1GHJA 4A3BB 1G2TA 1G91A 1I6VC 1WTVA 1GUSA 2EYMA 2YYZA 4RFBA 3HOZB 1BDOA 4C3IB 1C48A 1HFGA 5JAVA 2I07B 2KEDA 5C4ZA 3MHBA 2KQ3A 3AB9A 1QJOA 1O7LA 4B08A 1TS4A 1PXUA 3GTJB 5M5XB 5LHY1 1OXSC 5C5MA 2IL8A 2KCCA 3JAME 1KTKA 5KRUA 4C3HB 5COYA 1VMCA 2IT1A 1VF5C 3CRKC 4WJWA 1EY8A 1TY2A 1TWCB 1RTNA 2WV6D 5JEAJ 2A68C 5C4XB 3KUPA 4FXGC 4DU9A 1YNND 1B2TA 3NQIA 1O80A 1DJRD 1B53A 1QNKA 2K01A 1EWCA 5T1GA 4ZLTF 3L3OC 1KNEA 3TP7A 2R93B 5I6YA 2FINB 4Q5VA 1PZKD 1TWAB 1AN8A 3MTSA 1JQYD 1HFNA 1I3QB 1F9RA 1BCPF 2RDFA 1FNVA 3Q6SA 1KLUD 1EY6A 2F0TA 4RH6A 3DWPA 4C1NI 1Z7TA 1AZQA 1YNJD 2DY8A 1MSGA 1A3UA 3HOYB 4A3GB 1ET6A 3A7AB 4F87A 2Z4HA 2M00A 1TS2A 3TDQA 1BXTA 3NE5B 1V8QA 2F0EA 1SXTA 1EY5A 2F0KA 4X3SA 1RKNA 1M8AA 2B8GA 2D2CC 2CQAA 4HR7B 2ID0A 3S16B 4HCSA 1WCMB 3MEHA 3VA5A 4KMUC 4H13C 3BYYB 1T5XD 1ILPA 1LTBD 5C0XG 5CV9A 3SE0A 2ICIA 3MXUA 3KBXA 3GP7A 4ZKBB 2B2UC 1D5MC 1J8IA 3PUZA 3OMCA 3D4RA 3GO5A 4K6DA 2IX1A 4CJ0B 3QG1A 3S9WA 1JOQA 3O13A 1RTOA 3I73A 1A15A 3P1HA 4XQJA 1SMYD 3RLFA 1KNAA 3FKIB 3MC0B 1BQQT 1F9QA 2H4OA 3SEBA 3I8ZA 1A2UA 4IALA 1B50A 1EQVA 1B4OA 3PO3B 3GQBA 2ENBA 2VB3X 1DXMA 5IGBA 4NMZA 1D6EC 1HCZA 3EROA 1LTTD 1EYCA 1NUCA 4ZYSA 2WIIB 4K5VA 4DAPA 4KD4A 4ZK9B 1CM9A 2EJGC 3A54A 1BOSA 3C1FA 2OEOA 5TSSA 4NP5A 2LS01 3Q22A 1YNNC 5JPNC 1Q3LA 2NUCA 3U9OA 5C4HA 3NSWA 1OXTA 2EYFA 4TQUS 2HCCA 2F0MA 4KD3A 3ZYYX 3TZUA 2PNRC 1WTPA 1NR4A 3H09A 1YNJC 3TP8A 1PFBA 1PFNA 5G3LF 3SK8A 5K36G 2O4XA 4FYDA 2B2UA 5DAUA 1PLFA 1VMPA 1TS5A 2R3ZA 5FO8B 2PYKA 4ZQ3A 2Z1CA 4RAUC 4M8AA 4GZYC 4FF3A 3MAQA 1DZ1A 2KA7A 2PO4A 1WD0A 1K83B 3WDNA 4RKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ1 D;  3R93 A;  3IFD A;  3MWY W;  1WTR A;  1IKL A;  1SDF A;  1JIC A;  1EIG A;  1BBX C;  4U68 A;  2SDF A;  4QUF A;  2Q8T A;  4MN3 A;  1NCV A;  2B2Y C;  1U4P A;  5EPJ A;  1BO0 A;  2KEC A;  1MGS A;  1AZP A;  3D6W A;  4IUQ A;  3GV6 A;  1S4Z A;  4X3U A;  1XX8 A;  1WTQ A;  2NYZ D;  1G2T A;  1G91 A;  1WTV A;  1ZXT A;  4X3S A;  1C8C A;  1HUM A;  3H91 A;  5DNF A;  3SVM A;  2H1E A;  2RVL A;  2FJ2 A;  2L9H A;  4IUR A;  1GUW A;  2D9U A;  5D14 A;  1X3Q A;  4RA8 A;  4ZK9 B;  1M8A A;  2K28 A;  1CM9 A;  1HFG A;  1O7Z A;  1PFM A;  2EOT A;  2KOL A;  2KUM A;  5EQ0 A;  2HDM A;  4X3T A;  4XDX A;  1MI2 A;  2KED A;  5COR A;  1LV9 A;  4RWS C;  5AFW A;  3P7J A;  2B2Y A;  2KVM A;  2N88 A;  2L4N A;  5EJW A;  4OIJ A;  2FMM A;  2MPM A;  2NWG A;  1CA6 A;  4HCS A;  4UAI A;  2RSO A;  1U4R A;  1F2L A;  1B3A A;  2EPB A;  4R8I A;  1HRJ A;  1WD1 A;  3LWE A;  2B2T C;  2RA4 A;  1AP0 A;  3I90 A;  1HUN A;  2J7Z A;  5EPL A;  4MHE A;  1U4L A;  2IL8 A;  3DEO A;  3HP3 A;  1Q3L A;  1ML0 D;  1HA6 A;  2DY7 A;  2MJ8 A;  5CBA E;  1CA5 A;  1X32 A;  2CVR A;  1XYI A;  1G6Z A;  1BNZ A;  4O42 A;  4IUU A;  1F9P A;  2B2W C;  1JE4 A;  2B2V C;  4IUP A;  4XT1 B;  4LMQ D;  4DN4 M;  5COY A;  2M2L A;  3IL8 A;  1IKM A;  2L11 A;  4IUV A;  1VMC A;  2B2T A;  3GV3 A;  1ILP A;  3FPU B;  1RTN A;  1HHV A;  2HCC A;  4CJ1 B;  1QE6 A;  1TVX A;  5E4X A;  2N55 A;  3KBX A;  3ONA B;  4HED A;  2L1B A;  1WTW A;  1ICW A;  1NAP A;  1EOT A;  2K03 A;  2HDL A;  1RJT A;  4QUC A;  4ZKB B;  3KUP A;  4ZKC B;  1WTP A;  1DOL A;  1NR4 A;  2B2U C;  4OIK A;  2B2W A;  2B2V A;  4R9W A;  1B2T A;  1U4M A;  1RHP A;  2FFK B;  1DOK A;  3UI2 A;  3TZD A;  1O80 A;  1PDQ A;  3N52 A;  1J8I A;  4IUT A;  1QG7 A;  1E0B A;  1B53 A;  1PFB A;  1PFN A;  5CBE E;  2X6L A;  1QNK A;  1SSO A;  4CJ0 B;  1NR2 A;  2K05 A;  1DOM A;  2EE1 A;  2K01 A;  1ESR A;  3DM1 A;  1J9O A;  5T1G A;  3G7L A;  1KNE A;  4ZLT F;  2HUG A;  3I91 A;  2FIN B;  5T1I A;  1X3P A;  1EQT A;  2MP1 A;  4HSV A;  1RTO A;  2JP1 A;  3I3C A;  1A15 A;  1ILQ A;  2Q8R E;  1SAP A;  2VXW A;  5EKI A;  3FDT A;  4ZAI A;  2B2U A;  4X3K A;  3TN2 A;  3MTS A;  1HFN A;  1PLF A;  2K1B A;  1G2S A;  5EPK A;  2HCI A;  1F9R A;  1VMP A;  1EL0 A;  4CJ2 C;  3Q6S A;  1KNA A;  2MGS A;  4XT3 B;  1WTO A;  2R3Z A;  2K04 A;  2X6G A;  5E4W C;  2X69 A;  2RSN A;  5CMD A;  5JJZ A;  1F9Q A;  2XIW A;  4NW2 A;  4RAU C;  1DON A;  2KEE A;  1IL8 A;  3I8Z A;  3QO2 A;  5D65 A;  1AZQ A;  1WVL A;  4HAE A;  1MSH A;  1F9S A;  1B50 A;  3DEP A;  2FHT A;  2DY8 A;  1DZ1 A;  1B4O A;  1MSG A;  2BDN A;  2JYO A;  1EIH A;  1O7Y A;  1WTX A;  1BF4 A;  1ROD A;  2L12 A;  1WD0 A;  3F2U A; 
#chains in the Genus database with same CATH topology
 4PQX A;  3R93 A;  1V43 A;  4DAV A;  2LXJ A;  2RKS A;  4I7A A;  1VDZ A;  1MKH A;  5BR8 Q;  1QWY A;  3QWN A;  1BBX C;  2F0S A;  2EYO A;  2K50 A;  1GJX A;  3N6R A;  4X62 L;  5K5P A;  4RG1 A;  1JOR A;  4KKT A;  3V2T A;  1XX8 A;  3I70 A;  1F77 A;  2F0U A;  4JBK A;  2JA7 G;  4IJL A;  5ISR A;  4DV0 Q;  3L2P A;  2A8V A;  3A5U A;  3P75 A;  4HMI A;  2K28 A;  2AQ1 B;  4GNX B;  4BBS B;  4X66 L;  4N9P A;  1LV9 A;  1G29 1;  4DV1 L;  2DNC A;  2F3V A;  2PW7 A;  2L4N A;  4DV6 L;  3K7U C;  4DV7 Q;  4GNX C;  1GOZ A;  2RSO A;  1B7Y B;  4X66 Q;  1RD9 D;  2JEA I;  3FHW A;  3H0G G;  1KXL A;  2F0J A;  1FR3 A;  2E2D C;  4LFC L;  1HUN A;  4K0K L;  4DV6 Q;  5EPL A;  4C2M H;  2EIF A;  4RGM A;  1PYW D;  4ZUJ A;  1CKN B;  4DV3 Q;  3PV0 A;  3HOV H;  2PNH A;  3I56 A;  1PH1 A;  5JEA G;  1BNZ A;  4IUU A;  2QIL A;  1SMY C;  2LXK A;  4LMQ D;  2JQO A;  4QMG A;  4IUV A;  4BY1 B;  4UP9 A;  2MUY A;  3PIO A;  5FLX L;  4BBR H;  2LMC B;  3M4O B;  5I9O A;  4HTH A;  1HHV A;  4CJ1 B;  4DKA C;  5E4X A;  4DR7 Q;  3VR5 A;  1UAP A;  4TRD A;  3S2H B;  4LK1 C;  4R9W A;  1VQA A;  2E75 C;  2FFK B;  4FVM A;  1LTS D;  5FK9 C;  4LNQ A;  1R4Q B;  2Q8I B;  5CBE E;  2NVQ H;  3NEL A;  2F4V Q;  2D62 A;  2O5J C;  1I6H H;  1ET9 A;  3DWA A;  1VQ7 A;  5M3F B;  4BA1 I;  1XXG A;  4TVA B;  4HSV A;  4IFD G;  2L15 A;  3ND8 A;  2EY1 A;  2MNA A;  3FDT A;  4X3K A;  4DV5 L;  2K5H A;  3D31 A;  3EBE A;  1M90 C;  4A3M H;  5A35 A;  3RN5 A;  4GN3 B;  5IYB G;  2X69 A;  1EY0 A;  2ZTD A;  1L1O C;  2N3S A;  3ICE A;  3MXN B;  4IO9 A;  1Q81 C;  4DV5 Q;  4LFB L;  2BE5 C;  4R1J A;  1A0I A;  1JT8 A;  2Z0S A;  1K3R A;  3PMF A;  5J3B A;  3BS1 A;  2VUM B;  2FHT A;  4F7X A;  4GKK L;  4CGY B;  1D8L A;  3SDZ A;  3KJO A;  4QF4 A;  5E7N A;  4JYA L;  4LFB Q;  3WOE A;  3KF8 B;  4TKO B;  3C46 A;  1TR5 A;  2NZ1 D;  1AW7 A;  2J4X A;  4GKK Q;  4JYA Q;  4OO1 I;  3OHX C;  3MFY A;  3HOU G;  2WAQ B;  2QDL A;  1YHB A;  2A68 D;  1GM5 A;  5IY0 A;  1SE4 A;  1FVI A;  5EKL A;  4J8Q A;  3PUW A;  1C8C A;  3J81 E;  1HZC A;  3L9A X;  2XGT A;  3S1Q H;  1S5F D;  4CKB A;  5LMN L;  4KHZ A;  5CYU A;  1EIY B;  1B70 B;  5AFW A;  1TQO A;  1SBB B;  1V1P A;  4U67 3;  2I0Q A;  2EJF C;  5EJW A;  1SNP A;  5IT9 L;  4AYB G;  5LMN Q;  1EZ6 A;  3GTP B;  2ATW A;  3NBH B;  2ES2 A;  5HUR A;  3A56 A;  1UNS A;  4A3K B;  3J81 c;  5M5Y B;  1I4X A;  1QZH A;  3TS2 A;  2BH8 A;  5CBA E;  1H95 A;  1X6O A;  4G7H C;  3OSO A;  2B2V C;  4LF5 L;  4GNX A;  2LY7 A;  1PTO F;  2L11 A;  1IYU A;  2NZH A;  4EQO A;  2A69 C;  3EQL C;  3GTM H;  2RDG A;  2TMP A;  2M9V A;  2QEJ C;  1X3F A;  2ALY B;  1K9M C;  2F3I A;  4LF5 Q;  2IX0 A;  3ONA B;  1PVO A;  3UDG A;  1DOL A;  1YJ9 A;  4F88 A;  3TP6 A;  3TZD A;  1T5E A;  3OIQ A;  5I6W A;  4QQB X;  2K05 A;  3MVV A;  2A6E C;  3PIP 3;  3KK7 A;  3QB3 A;  3V05 A;  3S1N H;  4OWT B;  1LO5 D;  4DV4 L;  2Q2U A;  2K1B A;  4KV6 A;  4CJ2 C;  2A5H A;  2KJX A;  5GAE C;  2JA5 B;  1HA5 A;  1I4G A;  2KHI A;  5J1Z A;  2RSN A;  5CC4 A;  5JJZ A;  4DV4 Q;  2K14 A;  1CSQ A;  3NTH A;  4UP7 A;  3HOZ G;  1KLG D;  1GXD C;  1IBK L;  5C3E B;  2R7Z H;  1L1O A;  1LT6 D;  1YHA A;  3HOX H;  1R9T B;  3GTK H;  4DR3 L;  1EOV A;  2I5M X;  1IBK Q;  2A6H D;  4U68 A;  1KL9 A;  3BVZ A;  2Q8T A;  1H9S B;  3MXN A;  3GDE A;  4DR3 Q;  4A3F H;  3J7Y W;  2VL6 A;  1CKM A;  3J80 L;  1CKO A;  3NTK A;  1E3P A;  3SVM A;  2K6A A;  2FJ2 A;  1PRT F;  4RA8 A;  1O7Z A;  1PFM A;  3S1M B;  4YCU A;  1EY7 A;  2EJM A;  5C4X G;  2TSS A;  1GUT A;  1I50 H;  3OTO L;  4AQY L;  4GN4 B;  1DGS A;  1KIX A;  2UXD L;  3OPO A;  1BCP C;  5HY6 A;  3STB D;  4DK3 C;  3OTO Q;  3A55 A;  4AQY Q;  1ASZ A;  1HA6 A;  3V96 A;  3PQI A;  2MJ8 A;  3K59 A;  2UXD Q;  1TY0 A;  2ZXO A;  4O42 A;  1F9P A;  1HQM C;  4CKE A;  2CHB D;  1VQL A;  1S3O A;  4FNF A;  1QOH A;  2G9H D;  1TVX A;  4IPD A;  3PIP A;  4C2M B;  4FXD A;  4C56 C;  1NAP A;  3CC7 A;  3HOV B;  3NBH A;  1IBL L;  2B2V A;  1P8L A;  5DM6 3;  3HEJ A;  4WJ4 A;  2EYL A;  4FF4 A;  4ODG A;  2GVB A;  4DNR B;  3KYH C;  4BBR B;  1DOM A;  4RMF A;  3G7L A;  1IBL Q;  1LTR D;  2AUK A;  2K33 A;  1RCV D;  5E1F A;  4HJA A;  4A3L H;  1V1O A;  1CUK A;  1LAB A;  2WAQ E;  3M85 A;  2R92 H;  2YTV A;  1KC8 C;  3OIP A;  3S1R H;  4X6A H;  2G9D A;  2X6G A;  2NVQ B;  1PH7 A;  3T4A C;  1I6H B;  4JI1 Q;  5FKA C;  4ABN A;  1YIT A;  2WIN B;  5LMN W;  2JYO A;  2N78 A;  5KNB A;  4A3M B;  3FEW X;  2HD3 A;  3GTO H;  2GN5 A;  2Y0S B;  4RKB A;  5IGF A;  3MFG A;  1S5D D;  1O7I A;  2XWJ B;  3PGZ A;  4QB4 A;  4DFA A;  1JMC A;  1XNR L;  2BDO A;  3AFP A;  2NVT H;  4FO2 A;  1QNU A;  4GOP B;  4MN3 A;  3NQT A;  2OCE A;  1FNU A;  3I4L A;  3JAM i;  4JK1 C;  3D4D A;  1RIP A;  1XNR Q;  4UHV A;  3W1G A;  1NBW A;  1TU2 B;  4GOP C;  4A3E H;  1GUW A;  3OW2 A;  1LTL A;  4C3J G;  2JA6 H;  4X3T A;  3D0F A;  2VS1 A;  3SXH A;  2ZT9 C;  4AH6 A;  3CCR A;  5IYC H;  4LUV A;  5J39 A;  4NKL A;  3X3N A;  1X9N A;  1HRJ A;  1H9S A;  1PZI D;  3S1Q B;  1A6X A;  2IWH A;  1EQQ A;  1Q90 A;  1G51 A;  3HP3 A;  5NUC A;  3K80 C;  4UPA A;  4CBV A;  5ELB A;  4YCV A;  1E1T A;  3CRL C;  4ZRZ A;  2F0L A;  2WAC A;  4KKU A;  1S5E D;  1CTM A;  1E2V A;  1Y1V H;  1UE5 A;  2NN6 G;  2B63 H;  1JOO A;  1EU3 A;  5K36 H;  3B6Y A;  1CZW A;  3LX0 A;  4CDE C;  2F0W A;  2Q2I A;  1KD1 C;  1U4M A;  4LF8 L;  1CHP D;  3IFT A;  5I4D A;  1GVP A;  3PO3 G;  3GTM B;  4P74 A;  4H7B A;  4KHP L;  1SYG A;  3DM1 A;  1STE A;  3TEH B;  4ULL A;  1FGB D;  1KDA A;  1X3P A;  4LF8 Q;  4L63 B;  1D5Z C;  2WKD A;  4ZAI A;  3R3O A;  2A6H C;  1HTL D;  1EEF D;  4UP8 A;  2ZXR A;  1SE2 A;  3PCO B;  5JVG 3;  2YV5 A;  5E4W C;  3MEF A;  1NY4 A;  3F2D A;  4A3C G;  3T53 B;  2CKZ B;  1SEB D;  2SEB D;  1STA A;  4LWC A;  3HG9 A;  3T1Y L;  3S1N B;  3M4Q A;  3PUV A;  1JCK B;  3U58 A;  1CQF A;  4RCO A;  1K0R A;  3T1Y Q;  2A19 A;  3PO2 G;  2VW9 A;  2RCF A;  2JA7 H;  3DUZ A;  1X65 A;  1F2Y A;  5A2Q E;  3TRZ A;  1JIC A;  1N33 L;  3STB C;  3CCV A;  4OX9 L;  1L0X B;  3ERS X;  1BO0 A;  2E2J B;  1A8V A;  4IUQ A;  5C4J H;  4IOC A;  1ENA A;  2KEN A;  1N33 Q;  2R7Z B;  2E2H H;  3H91 A;  3RUZ A;  5KYL A;  3RMH A;  2L9H A;  3HOX B;  4OX9 Q;  3H0G H;  3GTK B;  5CV5 A;  1QUQ A;  1JJ2 A;  1LAC A;  2HDM A;  5COR A;  4CDF C;  4RWS C;  1SFO H;  1VQD A;  4DR6 L;  5JEA H;  1GUG A;  2NWG A;  2PZU A;  1I4R A;  4KJO A;  4A3F B;  1SJH D;  1YZ6 A;  2VQF L;  5E3F A;  3R2T A;  4GOP A;  1WD1 A;  3S17 H;  4R4O A;  4DR6 Q;  1E22 A;  2PQA B;  4A3J G;  1UE7 A;  2A73 B;  3KLR A;  2WB1 B;  1GKH A;  1EUJ A;  2BE5 D;  2F1M A;  1I50 B;  5ELF A;  3CD6 A;  2AMC B;  3NTI A;  4XT1 B;  1JWS D;  3S15 H;  3M7N A;  4BY7 G;  1VQO A;  1LTA D;  4HCE A;  5IP7 G;  1Q46 A;  4JBM A;  5JOB A;  1JB3 A;  5C6A A;  1XMQ Q;  1I94 L;  4A93 G;  1ASY A;  4JI7 Q;  2NTS A;  4IFD H;  4DUZ L;  3I4M G;  2JJQ A;  2DJG C;  1K8M A;  1RDP D;  1I94 Q;  3H3V C;  2F0F A;  4K5X A;  2Y0S E;  1CI3 M;  1H9J A;  1TWF H;  5IYB H;  1X56 A;  1UEA B;  4IUN A;  4PZ8 A;  1YIJ A;  1EU4 A;  4JI4 L;  4G4K A;  1W6J A;  2KCN A;  4ME3 A;  3A8K E;  4YWL A;  1EFI D;  4BXX G;  3TN2 A;  3M4P A;  4G7O C;  1IYV A;  4EGV A;  3K8A A;  2JXM B;  1WTO A;  2NBF A;  2KCM A;  1DCZ A;  1SND A;  4KY7 A;  2DN8 A;  3HFZ B;  1LT4 D;  4L6T B;  1LT5 D;  3J80 i;  1WYD A;  3HKZ B;  5HGQ A;  4DPG A;  1TII D;  4DXG A;  1U5K A;  1HTP A;  1Q12 A;  1STB A;  3A7L A;  1IZ6 A;  2R92 B;  3K5N A;  2EYP A;  4XQQ A;  1XNQ L;  3S1R B;  1EIF A;  3KF6 B;  2JA8 G;  3BG3 A;  3L7Z C;  3VYR A;  1JJG A;  1X55 A;  3AMU A;  1PRT D;  1II3 A;  2A69 D;  2SDF A;  1I4P A;  4WOR A;  3MZ5 A;  5L37 A;  4P2C B;  2KEC A;  2OF1 A;  4JOI C;  4X3U A;  3GTO B;  4JBW A;  2F0G A;  2AWN A;  2FXQ A;  2K4K A;  4A3D G;  1PH4 A;  2GA4 B;  3NHH A;  2A74 C;  2EOT A;  1EYA A;  1GO3 E;  3J7A V;  2NVT B;  4B3M Q;  4XQN A;  4IPG A;  4YIJ A;  2A6E D;  3OWE B;  5EKK A;  3OW7 A;  1V1P B;  4K8I A;  2V4D A;  5DM7 3;  1E2Z A;  4FDB A;  2AQ3 B;  1EY9 A;  3LWE A;  2XSC A;  4A3E B;  4QIW B;  1AP0 A;  3I90 A;  2YTX A;  1SRO A;  1SJE D;  1OO9 B;  3SR1 A;  2JA6 B;  3CAM A;  3BYT B;  5M9O A;  5JPM C;  4K2K A;  1JE4 A;  3J7A F;  2EZV A;  1TXY A;  4X62 Q;  3RLN A;  2RF4 A;  3IL8 A;  4GN5 A;  1BVS A;  2YU9 H;  2L5T A;  4FF2 A;  4DR4 L;  1QE6 A;  2RCN A;  4OEM B;  2L1B A;  3I4N G;  1EOT A;  2ZTC A;  3RR5 A;  4MTK A;  3CKI B;  1FL0 A;  1AE2 A;  4OIK A;  1VQ8 A;  2PQA A;  4DV1 Q;  4FF1 A;  5BN5 A;  4P73 A;  1Z6H A;  3JAM L;  4IUT A;  2F4I A;  2F3W A;  1SSO A;  4YWM A;  3HOW G;  1Y1V B;  1MJC A;  3Q8D A;  2B63 B;  5FOB B;  4LFC Q;  2D5D A;  4K0K Q;  3K58 A;  5EGT A;  1SYD A;  4PNY A;  3F2B A;  2FMC A;  2HCI A;  2C5C A;  3Q23 A;  1EL0 A;  2NTT A;  4DK1 A;  1TWG H;  5IP9 G;  2WAQ G;  3CC2 A;  3K57 A;  3OWF A;  5C3X A;  2XIW A;  4XYQ A;  1LT3 D;  5DLQ E;  4N9T A;  1N34 L;  4ZCK A;  2QGQ A;  4OEL B;  1MJE A;  5M3M G;  1BCP D;  4ZUI A;  3CU7 A;  4I7Z C;  1EIH A;  1O7Y A;  3BZD B;  4B9W A;  2PCF B;  4JPB W;  1N34 Q;  4B9X A;  1L1O B;  5IWA L;  2EYH A;  3FP9 A;  2K5N A;  2RDH A;  1Y1W H;  3MXP A;  1XTD A;  5ELO A;  5IIF A;  1GHK A;  1BUV T;  3BZC A;  1NCV A;  1VQP A;  1S40 A;  2B2Y C;  3IAY A;  3NXW A;  5IWA Q;  4DUY L;  1MGS A;  3I7F A;  2KHS A;  1SLJ A;  4OWX B;  3AEV A;  5DNF A;  2RVL A;  1VQ5 A;  2JA7 B;  2VNU D;  3CCM A;  1CFM A;  1VQI A;  2CW0 C;  3KF6 A;  2VB2 X;  2N88 A;  4JOI A;  4S3S A;  3I72 A;  1TWH B;  3GD7 A;  4XIG S;  5C4J B;  1Q1E A;  4UAI A;  2Q2T A;  3TS0 A;  1U4R A;  5LL6 S;  2E2H B;  3RNU A;  1H9R A;  5AJ3 L;  3VR2 A;  3H0G B;  3LGJ A;  1U4L A;  3AYH B;  1SFO B;  4GLV B;  4EQN A;  5AJ3 Q;  1TT2 A;  1I5F A;  2LFN A;  2B2W C;  4IUP A;  3W1B A;  1Y69 U;  4DN4 M;  2M2L A;  1YJW A;  1ZYR D;  2ZJQ A;  3P20 A;  3GV3 A;  5CR3 A;  1JC7 A;  3T16 A;  3S17 B;  3CPW A;  4JV5 L;  4HED A;  4POF A;  3MA2 B;  4UDU C;  2OXP A;  1RJT A;  2QCP X;  1HPC A;  1A62 A;  1SYF A;  1QG7 A;  3S15 B;  1IBM L;  1NR2 A;  1PRT B;  4LF6 L;  3A8J E;  2NVX H;  3VYT A;  1PMR A;  1SNM A;  2B8F A;  2HUG A;  3I91 A;  1A3V A;  1SN8 A;  5KGU A;  2Q8R E;  5D3D A;  1PZJ D;  2OQK A;  1IBM Q;  1PRT C;  3GTG H;  1G2S A;  4LF6 Q;  5CV7 A;  1EWH A;  2MGS A;  3VYS A;  3DM3 A;  3G4S A;  1F2Z A;  4L5T A;  1TWF B;  5FLM G;  2EY2 A;  2AKW B;  3Q0A A;  1QB5 D;  2F0D A;  5FJ8 G;  3WOF A;  4HAE A;  2R7F A;  1VQ4 A;  2L12 A;  4A3I G;  4JW0 A;  3LNN A;  4JCV E;  1IW7 C;  1JOK A;  2HIX A;  4I65 A;  3T13 A;  2PQE A;  5IOC A;  4FXK C;  3SK4 A;  4C3J H;  4LW1 A;  4P75 A;  5EPJ A;  2BH2 A;  4A3B G;  5C44 H;  2NYZ D;  1QVC A;  2K7V A;  5C0X I;  4C3I G;  1K8A C;  3CCU A;  1QCB D;  2D9U A;  3H3V I;  1A3T A;  3QOL A;  1E1O A;  1SE3 A;  2F0V A;  4R4Q A;  1MD2 D;  3ITP A;  4DAM A;  2EQS A;  1HQR D;  3D4W A;  2B2Y A;  2QF7 A;  1LTG D;  2FMM A;  3IRB A;  4DNI A;  2I46 A;  4AYB B;  1F2L A;  1UEB A;  4R8I A;  3EJI A;  1S5C D;  4JG2 A;  2JSO A;  2NN6 H;  2E8G A;  4QCL A;  1S5B D;  1YEZ A;  2XRQ D;  1X32 A;  4H0L C;  2I5L X;  4C3H G;  3VR4 A;  3BDL A;  4IZ8 A;  4R4I A;  3J81 j;  1BCP B;  1CQV A;  2KCT A;  2B2W A;  1ZKO A;  2AWO A;  5C0X H;  3SHL A;  1G8Z D;  1RHP A;  3EFX D;  2R7D A;  1DM0 B;  5I2X A;  1CZG A;  3H3V H;  3KLS X;  3BDC A;  2R93 G;  4NDX A;  3U4Z A;  2Y0S G;  4JI5 L;  4QY7 A;  2MP1 A;  3X3M A;  2VXW A;  3CCQ A;  4L5R C;  4ID6 A;  3BJU A;  3J7A 5;  3G48 A;  4K6L A;  4JI5 Q;  4XT3 B;  3MXG A;  5C3W A;  1HXY D;  5G3L D;  3M3Y H;  2IHF A;  2IPK D;  5J22 A;  3PO2 H;  2WKC A;  1I4Q A;  1QZG A;  1O78 A;  1WVL A;  4A76 A;  3H94 A;  2PMZ B;  2PZT A;  3K0X A;  2SOB A;  2O5I C;  5ELN A;  5CV8 A;  3QOJ A;  3HOY G;  2MO0 A;  1KHI A;  1TWG B;  2F03 A;  4A3G G;  5CGK A;  5KND A;  4V19 0;  3GTQ H;  3RZD H;  2K52 A;  3IFD A;  1WTR A;  2PI2 A;  2AUJ D;  1IKL A;  4B3T L;  2G5D A;  2IW3 A;  3DXJ C;  3ULL A;  4B3R L;  2CH4 W;  2QEX A;  3A8I E;  3QR8 A;  2Z8L A;  3AQQ A;  4GLA C;  2R61 A;  2BCO A;  2DNE A;  3D6W A;  1WTQ A;  1JR0 D;  1VQM A;  4B3T Q;  2EYJ A;  1WOC A;  4RGN A;  4ALP A;  2H1E A;  4DK6 C;  4B3R Q;  1ZYR C;  5D14 A;  1X3Q A;  2BOS A;  1Y1W B;  4MTN A;  1Q8K A;  4A3J H;  4XDX A;  1MI2 A;  1QUQ B;  4K8J A;  3QIA A;  2KVM A;  3E0J A;  4RCN A;  4YCW A;  1L0Y B;  5FLX E;  1KDC A;  2Q2H A;  4LUZ A;  1WCM G;  1STH A;  4BY7 H;  1NSN S;  5IP7 H;  3BVM A;  4MHE A;  3CMA A;  4K14 A;  4A93 H;  1SE8 A;  3K6O A;  4OO1 G;  3HRZ C;  1CA5 A;  2NB0 A;  3E0E A;  3I4M H;  3E6Z X;  1K73 C;  5JJI A;  4BWG B;  5KYI A;  5FLX c;  2F0I A;  1PYB A;  3FPU B;  3VA7 A;  1B44 D;  3K0Y A;  4IFD J;  1HZA A;  5EBD A;  3SK5 A;  1YNX A;  1WTW A;  1ONL A;  3S14 H;  2UU9 L;  3KOJ A;  4BS9 A;  1ICF B;  4BXX H;  3E9H A;  2KHJ A;  3A0J A;  4L5Q A;  3UI2 A;  4LAA A;  3K7A H;  4KI0 A;  1F2M A;  2X6L A;  1P16 A;  2UU9 Q;  1L0W A;  2EE1 A;  1XMO L;  4M1U B;  1E7Z A;  1UUP A;  3K5M A;  2HQL A;  5T1I A;  3CQZ H;  2J0T D;  1KQS A;  1HR0 W;  1ILQ A;  3FMC A;  4DR5 L;  4BA2 I;  3ND9 A;  2RQX A;  1Q8I A;  4QJF A;  2MFI A;  1XMO Q;  4J6H A;  1G6P A;  1LTI D;  3FKI G;  1DD2 A;  2Z6B A;  2EY5 A;  3VDY A;  2IJ0 A;  1MBY A;  5IGG A;  3DMU A;  1V9P A;  4DR5 Q;  2NVX B;  2JA8 H;  1DON A;  1IL8 A;  4WRD A;  1EY4 A;  2ZJP A;  1B3Q A;  3RZO H;  1EQR A;  5F2D A;  3C2P A;  3GTG B;  2VY3 A;  1WTX A;  3NUC A;  2YTY A;  3DWQ A;  3F8T A;  4HMJ A;  2K32 A;  1B8A A;  1N36 L;  1M1K C;  3PUX A;  4A3D H;  4KHP Q;  5HGT A;  1D2B A;  1M4V A;  1PTO H;  4KLK A;  3R8B A;  3VYU A;  5IT9 E;  2XNA C;  1U4P A;  5GRO A;  4O1N A;  4CKC A;  4KJN A;  1AZP A;  3GV6 A;  2ZJR A;  1ENF A;  4HIK A;  1OXV A;  4Y52 H;  1HUM A;  4IOA A;  1D5X C;  3ER0 A;  2ASB A;  3KBG A;  1BBU A;  1X3E A;  3OMG A;  4HSP A;  3CCE A;  3H15 A;  4POG A;  3D6C A;  4Z9C B;  4C3J B;  1OXU A;  3P7J A;  5LMU L;  1KAW A;  3VR3 A;  3RD4 A;  1NJI C;  5C44 B;  5IT9 c;  1VQG A;  1FJG L;  1B3A A;  5GAG C;  4LUO A;  4EVO A;  4GKJ L;  5I9P A;  2J7Z A;  3J81 L;  4IFD I;  1XWE A;  4KN7 C;  5IGC A;  1AEX A;  4KKS A;  1FJG Q;  2CVR A;  3T51 B;  3I4N H;  4P71 A;  1OTC A;  1JJC B;  1JB7 A;  1EEI D;  4ILW A;  4B3S L;  1OXX K;  3D8G A;  3NK9 A;  5BN3 A;  5GQO A;  2JA9 A;  3HOW H;  4DXF A;  2N55 A;  3C1E A;  3CXC A;  2K03 A;  1PH9 A;  4ZKC B;  4C1N K;  4DA2 A;  5IGD A;  1PTO D;  3N52 A;  3AU7 A;  1ENC A;  1B9N A;  2JE6 I;  1E0B A;  2HQE A;  1K3B C;  1N32 L;  3U50 C;  4ME5 A;  2VQF Q;  1J9O A;  2L55 A;  4XYO A;  4YHH L;  4V0B A;  1EQT A;  2JEB I;  3EA6 A;  4E6I A;  2JP1 A;  3I3C A;  3F1Z A;  4DAY B;  5M3M H;  2PZW A;  2CW0 D;  4YHH Q;  1EYD A;  2K04 A;  2F0P A;  4NPS A;  5CMD A;  2CWP A;  4WJ3 M;  4NW2 A;  5FO9 B;  3NWT A;  2KEE A;  1E24 A;  1BR9 A;  5ELE A;  2PPB C;  3GTL H;  4Y7N H;  4O0A A;  3DEP A;  4DUZ Q;  3J80 E;  3I2Z A;  5M5W H;  3UDX A;  1QVF A;  4OON A;  2EDG A;  3M3Y B;  3PO2 B;  3T56 B;  2K5D A;  4CDC C;  3MWY W;  1EIG A;  4A3E G;  4JI4 Q;  4CDD C;  2LKV A;  2VQE L;  4RHR A;  3J80 c;  1HNX L;  3GTQ B;  3RZD B;  3BU2 A;  2Z9H A;  3HOU H;  5ELD A;  3PUY A;  3E3X A;  4BBS G;  4L8J A;  2KUM A;  2DGY A;  3ULP A;  5EQ0 A;  1TKW B;  3T1H L;  2VQE Q;  3ERQ A;  1CHQ D;  3A74 A;  1HNX Q;  1PH5 A;  4RHS A;  5D3I B;  4OIJ A;  1YJN A;  2E2I H;  2K75 A;  1CA6 A;  3U4V A;  1C4Q A;  1HNW L;  1LUZ A;  3VR6 A;  4DGZ A;  2B29 A;  1XNQ Q;  3T1H Q;  2EPB A;  2NZO A;  2ICE C;  2B2T C;  1STY A;  1HZ9 A;  1R4P B;  2VZA A;  3D3R A;  2NVY H;  1W6K A;  2XTI A;  3PIO 3;  4KY6 A;  4A3J B;  1ML0 D;  1VQC A;  2K5W A;  4XTC S;  3M9B A;  3S2D H;  4IN3 A;  5EBC A;  1XYI A;  5JJL A;  5BN4 A;  1G6Z A;  5CV4 A;  4MNO A;  4LF4 L;  1SNC A;  4BY1 G;  1IKM A;  2ZXP A;  2MHV A;  1N8R C;  4BY7 B;  1HH2 P;  2WP8 J;  4G57 A;  4A93 B;  4LF4 Q;  1VQJ A;  1IW7 D;  1Z47 A;  1WJJ A;  5IYD G;  4MIU A;  1W2B A;  2P5Z X;  4TSS A;  3I4M B;  1JWM D;  3CHB D;  3C3L A;  2GVA A;  5KIX A;  1D1K A;  2IX3 A;  3NPP A;  2F0Q A;  1VF7 A;  1SYE A;  5BR8 L;  4DK0 A;  1Y8O B;  5M3F G;  5FLM H;  2UXC L;  3EIV A;  2XWB B;  4LF9 L;  5FJ8 H;  5EKI A;  3S14 B;  2F0N A;  2B39 A;  2DUD A;  5EPK A;  1CK1 A;  2UXC Q;  3E5S A;  3S1M H;  1MHW C;  3K7A B;  4LF9 Q;  3FRP B;  4DV0 L;  4A3I H;  5C5L A;  1GUN A;  1YBY A;  3K5O A;  5DEH A;  3E9I A;  4JVZ A;  4DR4 Q;  3Q24 A;  4OHJ A;  3CQZ B;  1XPO A;  2VUM G;  1MSH A;  1STN A;  5IGE A;  4DV7 L;  1VQE A;  2BDN A;  3FVQ A;  4FP5 D;  1BF4 A;  1KRT A;  4A3B H;  1ROD A;  1EWI A;  3F2U A;  2CWA A;  3FPP A;  1HZB A;  1K8O A;  4LFA L;  1PYS B;  4DAY A;  4RGT A;  4C3I H;  2JA8 B;  3HOZ H;  1SDF A;  1A63 A;  2BA0 A;  4J1M A;  4DV3 L;  1ZEQ X;  1SRU A;  4PMC A;  3IKJ A;  3RZO B;  4OGQ C;  4QUF A;  4XXE A;  3CME A;  2O2L D;  4KK7 A;  1DYQ A;  4LFA Q;  1PFS A;  1IHZ A;  2JN4 A;  1QIL A;  2OTL A;  1RF2 D;  3NEM A;  2ZTE A;  4KHV A;  1ZXT A;  4R4T A;  3TQY A;  3GTJ H;  5M5X H;  4DR7 L;  4A3D B;  1SNQ A;  4PMW A;  1PTO B;  1FYC A;  4IPH A;  3RN2 A;  1SYC A;  5FO7 B;  2Z6K C;  4OL7 A;  1D1I A;  4RGO S;  2MPM A;  3BDO A;  4C3H H;  4MZ9 A;  1EYG A;  2F4V L;  5CV6 A;  1PTO C;  3W3A A;  4KY5 A;  2WB1 E;  1TWC H;  4IQZ A;  4A3K G;  4JC0 A;  4H02 A;  2E74 C;  3DEO A;  5C4X H;  1XPU A;  2EXZ A;  1YHQ A;  4K5W A;  3K5L A;  1U9R A;  1YVC A;  2DY7 A;  3EN2 A;  1U0L A;  4F8M A;  4RKL A;  3NP8 A;  4DUY Q;  3SGI A;  4GS3 A;  2B2T A;  2EY6 A;  1I4H A;  4JI0 L;  2UUC L;  3TP5 A;  2R93 H;  1CSP A;  4PV1 C;  3L0O A;  2XN9 C;  1Y8N B;  3TSS A;  1ICW A;  1TWA H;  2RHS B;  3I4N B;  2N49 A;  5C0X J;  4JI0 Q;  1I3Q H;  2C9O A;  2UUC Q;  1JE5 A;  1AFP A;  3LWU A;  4OXP A;  5KNC A;  2SNM A;  1Q1B A;  1UWV A;  1ESR A;  3HOW B;  2L0C A;  2CFM A;  5IE8 A;  1EZ8 A;  3M7G A;  2OQ0 A;  5IOD A;  3J7Z C;  4Q0F A;  3HOY H;  2H5X A;  1STG A;  4PMB A;  2JA5 G;  4A3G H;  1B1Z A;  3W2D A;  4G7Z C;  2UUB L;  2R6G A;  1FD7 D;  2IY5 B;  3HKZ E;  3M4Y A;  3HZX A;  4CHT B;  1RL2 A;  1KAA A;  3QO2 A;  5D65 A;  1PHJ A;  1VCI A;  2UUB Q;  4JV5 Q;  4DNT B;  5LL6 X;  4KN4 C;  5M3M B;  5C3E G;  3KLS A;  1FGU A;  4R8N A;  2ZM6 L;  4NB3 A;  2IHE A;  3TME A;  2RHQ B;  2EVB A;  2Z4I A;  3KJP A;  1V1Q A;  3OOC A;  2DJF C;  2ZM6 Q;  3DLL A;  3GTL B;  4Y7N B;  3WWV A;  3CF5 A;  4KTA A;  1IL2 A;  1GD7 A;  5M5W B;  5I2Y A;  3J81 i;  3KLW A;  3S16 H;  3URY A;  2AQ2 B;  1S4Z A;  5EAY A;  1H9M A;  3PF5 A;  1VQK A;  4IUR A;  1WCM H;  2NN6 I;  2RBM A;  3G6J B;  2KOL A;  1GUO A;  3DHQ A;  4QL5 A;  5A2Q L;  1NMG A;  4OO1 H;  1X54 A;  1N9W A;  1AH9 A;  1E2W A;  1HR0 L;  1KDB A;  4QIW E;  2K5Q A;  4A4I A;  4AIM A;  2UXB L;  5JVH 3;  2RA4 A;  1UE6 A;  3SK6 A;  3HOU B;  4JI3 L;  1VQ6 A;  4DV2 L;  1CKN A;  1HR0 Q;  5ELC A;  3KDF B;  5JJK A;  2WFW A;  2Z6K A;  2UXB Q;  1LYL A;  2E2I B;  4JI3 Q;  4DV2 Q;  1SNO A;  4R4C A;  2NVY B;  3BVG A;  3K81 C;  1ESF A;  2SNS A;  1XTC D;  3HOV G;  2QKI C;  3S2D B;  2HDL A;  1WFQ A;  4QUC A;  4JI2 L;  3TBI B;  1H9K A;  2OT2 A;  2HHH L;  1TS3 A;  4WFN 3;  4DF7 A;  1DOK A;  1PDQ A;  3FKI H;  2XRS D;  1FNW A;  2PW5 A;  4H44 C;  4BBR G;  4HJ7 A;  2OWO A;  4JI2 Q;  2E2J H;  2HHH Q;  2MQH A;  2BA1 A;  2XVS A;  3NBI A;  3HKS A;  3EVQ A;  1KAB A;  4LJZ C;  4EQ5 A;  2E76 C;  1SAP A;  3HGB A;  3HS0 C;  3PO3 H;  3U9S A;  1A2T A;  2AHO B;  2F0H A;  2F0O A;  1Q7Y C;  1JWU D;  2JK8 A;  1D7Q A;  2EXD A;  4X64 L;  1F9S A;  5KEE A;  1Y1W G;  2YU9 B;  4EQP A;  1CT1 D;  4HJ9 A;  1Y8P B;  2QDB A;  3KF8 A;  4A3M G;  1EFW A;  4A3C H;  1LLR D;  2UUA L;  2E5L L;  1VQF A;  4A3I B;  2V1C C;  3QJY A;  4X64 Q;  5H1S E;  3NWS A;  2HIV A;  2UUA Q;  2E5L Q;  1B9M A;  1SYB A;  3R2I A;  4K2L A;  4QGU A;  3H6M A;  1GHJ A;  4A3B B;  1G2T A;  1G91 A;  1I6V C;  1WTV A;  1GUS A;  4O2D A;  2EYM A;  2YYZ A;  1L2F A;  4RFB A;  3HOZ B;  1BDO A;  4C3I B;  1C48 A;  1HFG A;  1MIU A;  5JAV A;  2I07 B;  2KED A;  3UDF A;  5C4Z A;  4DR1 L;  3MHB A;  2KQ3 A;  4JBJ A;  3AB9 A;  1QJO A;  1O7L A;  2KBN A;  4B08 A;  4JI6 L;  3W5O A;  1TS4 A;  1WTH A;  1PXU A;  4DR1 Q;  3GTJ B;  4DR2 L;  5M5X B;  5LHY 1;  4NXM L;  1OXS C;  1PH2 A;  5C5M A;  2IL8 A;  4JI6 Q;  2D0P A;  2KCC A;  3JAM E;  1KTK A;  5KRU A;  4DR2 Q;  4NXM Q;  4C3H B;  5COY A;  1VMC A;  3CRK C;  1VF5 C;  2IT1 A;  2N8N A;  4WJW A;  4JI1 L;  1EY8 A;  1TY2 A;  1PA6 A;  1TWC B;  1RTN A;  2WV6 D;  5JEA J;  2A68 C;  1VQN A;  5C4X B;  1S72 A;  3KUP A;  1HJP A;  4FXG C;  4DU9 A;  1YNN D;  1B2T A;  3NQI A;  1NE3 A;  1O80 A;  3JAM c;  1DJR D;  1B53 A;  3KDF A;  1QNK A;  2K01 A;  1EWC A;  2QA4 A;  5T1G A;  4ZLT F;  3L3O C;  1KNE A;  3TP7 A;  2R93 B;  5I6Y A;  2FIN B;  4Q5V A;  1PZK D;  2PI2 E;  1TWA B;  2CH4 A;  1AN8 A;  1AE3 A;  3MTS A;  1JQY D;  1HFN A;  1IYJ B;  1I3Q B;  1F9R A;  1BCP F;  2RDF A;  1FNV A;  2LSS A;  3Q6S A;  1KLU D;  1K83 H;  1EY6 A;  2F0T A;  4RH6 A;  3DWP A;  2A1A A;  4C1N I;  1Z7T A;  1AZQ A;  4PG3 A;  1YNJ D;  2DY8 A;  4P72 A;  1MSG A;  4GLX A;  1A3U A;  3HOY B;  4HJ5 A;  4A3G B;  1ET6 A;  1BBW A;  3A7A B;  4F87 A;  3CPF A;  2Z4H A;  5C44 G;  2M00 A;  3CC4 A;  1TS2 A;  4N8F A;  3TDQ A;  2K5V A;  4BBS H;  1BXT A;  3NE5 B;  1V8Q A;  1SR3 A;  1Q82 C;  2F0E A;  1T9H A;  1SXT A;  1EY5 A;  2F52 A;  2F0K A;  3CW2 C;  2R7Z G;  1NMF A;  4X3S A;  1J6Q A;  1VQH A;  3HOX G;  1PH8 A;  1RKN A;  1PV4 A;  1M8A A;  2B8G A;  1SMX A;  3UE0 A;  2CCZ A;  2D2C C;  3CCL A;  1Y14 B;  4AYB E;  3OYY A;  2CQA A;  4HR7 B;  5GAD C;  2ID0 A;  4A3F G;  3S16 B;  1KRS A;  4HCS A;  4BY1 H;  1LM0 A;  3M4O H;  1WCM B;  3MEH A;  1BKB A;  3VA5 A;  1N36 Q;  4KMU C;  2WB1 G;  4HJ8 A;  4NXN L;  4H13 C;  3BYY B;  1Q86 C;  5IYD H;  1UE1 A;  4OWW B;  3S2H H;  4LF7 L;  1T5X D;  3CCS A;  2B3G A;  3ZJY C;  4NXN Q;  1K0S A;  1ILP A;  1LTB D;  5C0X G;  3S24 A;  5CV9 A;  3SE0 A;  2ICI A;  3MXU A;  5M3F H;  4LF7 Q;  3KBX A;  3GP7 A;  4HIM A;  2I5H A;  4ZKB B;  1PH6 A;  2B2U C;  1HNZ L;  1C7Y A;  3TRE A;  1D5M C;  1NNX A;  5LMU Q;  1J8I A;  3PUZ A;  1NTG A;  3OMC A;  3PF4 A;  3D4R A;  3GO5 A;  3AFQ A;  4K6D A;  3NEN A;  1W3S A;  2IX1 A;  4CJ0 B;  3QG1 A;  3G71 A;  3S9W A;  1HNZ Q;  2HT1 A;  1JOQ A;  3O13 A;  4GKJ Q;  2D0O A;  1RTO A;  3I73 A;  1A15 A;  1XPR A;  2VUM H;  3CCJ A;  1PH3 A;  3P1H A;  3JC6 6;  4XQJ A;  1SMY D;  3RLO A;  4IJH A;  3RLF A;  1KNA A;  3FKI B;  3ULJ A;  3MC0 B;  2PMZ E;  4HID A;  1BQQ T;  1F9Q A;  1TWH H;  4B3S Q;  2H4O A;  3SEB A;  1YI2 A;  3I8Z A;  3HKZ G;  4A3L G;  5IP9 H;  1A2U A;  4IAL A;  1B50 A;  1EQV A;  2R92 G;  1B4O A;  3PO3 B;  3GQB A;  2ENB A;  2VB3 X;  2C35 B;  3F2C A;  1K8G A;  1DXM A;  5IGB A;  4NMZ A;  1Z9F A;  1D6E C;  1K28 A;  1N32 Q;  4N8X 1;  1HCZ A;  3PSI A;  3G6E A;  3ERO A;  1LTT D;  1EYC A;  1NUC A;  4ZYS A;  2WII B;  4EX5 A;  4K5V A;  3KFU A;  3UE1 A;  4DAP A;  3GTP H;  1C0A A;  4KD4 A;  4PZ6 A;  1XMQ L;  4ZK9 B;  4A3K H;  4JI7 L;  4JI8 L;  1CM9 A;  2EJG C;  5M5Y H;  3UDI A;  3A54 A;  4YY3 L;  1BOS A;  3C1F A;  4HIO A;  2OEO A;  1VQ9 A;  5TSS A;  4JI8 Q;  1J5E L;  4NP5 A;  2LS0 1;  3Q22 A;  1YNN C;  1XJV A;  5JPN C;  4YY3 Q;  5GAH C;  2JA6 G;  1WI5 A;  1Q3L A;  2NUC A;  1J5E Q;  4YWK A;  3U9O A;  5C4H A;  3NSW A;  5IYC G;  1OXT A;  3CP0 A;  2EYF A;  1IXR A;  2MO1 A;  4TQU S;  1VQB A;  2HCC A;  2F0M A;  4KD3 A;  3ZYY X;  2OTJ A;  3TZU A;  2PNR C;  4J15 A;  1WTP A;  1NR4 A;  3H09 A;  1YNJ C;  1C9O A;  3TP8 A;  3I55 A;  1PFB A;  1PFN A;  1VS0 A;  3BZK A;  2JA5 H;  1HNW Q;  1Y1V G;  5G3L F;  3SK8 A;  2B63 G;  4L5S A;  5K36 G;  2O4X A;  4FYD A;  3I4O A;  4X65 L;  3A5Z B;  1X3G A;  2B2U A;  5DAU A;  1PLF A;  5C3E H;  1VMP A;  1TS5 A;  2QW7 A;  2R3Z A;  1QVG A;  5FO8 B;  2PYK A;  4X65 Q;  4UY8 C;  4ZQ3 A;  1R9T H;  4APV A;  4IPC A;  2Z1C A;  4RAU C;  4B3M L;  4A75 A;  4M8A A;  4GZY C;  4FF3 A;  3MAQ A;  1DZ1 A;  2KA7 A;  2PO4 A;  4PZ7 A;  1WD0 A;  1K83 B;  3WDN A;  4HN7 A;  2CQO A; 
#chains in the Genus database with same CATH homology
 4PQX A;  3R93 A;  1V43 A;  4DAV A;  2RKS A;  1VDZ A;  1QWY A;  3QWN A;  1BBX C;  2F0S A;  2EYO A;  1GJX A;  3N6R A;  5K5P A;  1JOR A;  4KKT A;  3V2T A;  1XX8 A;  3I70 A;  1F77 A;  2F0U A;  5ISR A;  3P75 A;  4HMI A;  2K28 A;  2AQ1 B;  4BBS B;  4N9P A;  1LV9 A;  1G29 1;  2DNC A;  2F3V A;  2PW7 A;  2L4N A;  1GOZ A;  2RSO A;  1RD9 D;  2JEA I;  2F0J A;  1FR3 A;  2E2D C;  1HUN A;  5EPL A;  4RGM A;  1PYW D;  4ZUJ A;  3PV0 A;  5JEA G;  1BNZ A;  4IUU A;  2QIL A;  1SMY C;  4LMQ D;  4QMG A;  4IUV A;  4BY1 B;  2MUY A;  5FLX L;  3M4O B;  2LMC B;  5I9O A;  4HTH A;  1HHV A;  4CJ1 B;  5E4X A;  3VR5 A;  1UAP A;  4TRD A;  3S2H B;  4LK1 C;  4R9W A;  2E75 C;  2FFK B;  4FVM A;  1LTS D;  5FK9 C;  1R4Q B;  2Q8I B;  5CBE E;  2D62 A;  2O5J C;  1ET9 A;  3DWA A;  5M3F B;  4BA1 I;  1XXG A;  4HSV A;  4IFD G;  3ND8 A;  2EY1 A;  3FDT A;  4X3K A;  3D31 A;  5A35 A;  2X69 A;  1EY0 A;  2BE5 C;  3PMF A;  3BS1 A;  2VUM B;  2FHT A;  4F7X A;  4CGY B;  3SDZ A;  4QF4 A;  3WOE A;  4TKO B;  3C46 A;  1TR5 A;  2NZ1 D;  1AW7 A;  2J4X A;  4OO1 I;  3OHX C;  3MFY A;  2WAQ B;  2A68 D;  1SE4 A;  5EKL A;  4J8Q A;  3PUW A;  1C8C A;  3J81 E;  3L9A X;  1S5F D;  4CKB A;  4KHZ A;  5CYU A;  5AFW A;  1TQO A;  1SBB B;  1V1P A;  4U67 3;  2EJF C;  5EJW A;  1SNP A;  5IT9 L;  1EZ6 A;  3GTP B;  5HUR A;  3A56 A;  1UNS A;  4A3K B;  5M5Y B;  1I4X A;  5CBA E;  4G7H C;  3OSO A;  2B2V C;  2LY7 A;  1PTO F;  2L11 A;  1IYU A;  4EQO A;  2A69 C;  3EQL C;  2RDG A;  2TMP A;  2M9V A;  2QEJ C;  2IX0 A;  3ONA B;  1DOL A;  4F88 A;  3TP6 A;  3TZD A;  1T5E A;  3OIQ A;  5I6W A;  2K05 A;  3MVV A;  2A6E C;  3PIP 3;  3KK7 A;  3QB3 A;  3V05 A;  1LO5 D;  2K1B A;  4KV6 A;  4CJ2 C;  2A5H A;  2KJX A;  2JA5 B;  1HA5 A;  1I4G A;  5J1Z A;  2RSN A;  5CC4 A;  5JJZ A;  3NTH A;  1KLG D;  1GXD C;  5C3E B;  1LT6 D;  1R9T B;  2A6H D;  4U68 A;  3BVZ A;  2Q8T A;  1H9S B;  3MXN A;  3J7Y W;  3J80 L;  3NTK A;  3SVM A;  2K6A A;  2FJ2 A;  1PRT F;  4RA8 A;  1O7Z A;  1PFM A;  3S1M B;  1EY7 A;  2EJM A;  2TSS A;  1GUT A;  3OPO A;  1BCP C;  3A55 A;  1HA6 A;  3V96 A;  2MJ8 A;  3K59 A;  1TY0 A;  2ZXO A;  4O42 A;  1F9P A;  1HQM C;  4CKE A;  2CHB D;  4FNF A;  1QOH A;  2G9H D;  1TVX A;  4C2M B;  4FXD A;  4C56 C;  1NAP A;  3HOV B;  3NBH A;  2B2V A;  5DM6 3;  3HEJ A;  2EYL A;  4FF4 A;  4ODG A;  4DNR B;  4BBR B;  1DOM A;  3G7L A;  1LTR D;  2AUK A;  2K33 A;  1RCV D;  5E1F A;  1V1O A;  1LAB A;  3M85 A;  3OIP A;  2G9D A;  2X6G A;  2NVQ B;  3T4A C;  1I6H B;  5FKA C;  4ABN A;  2WIN B;  2JYO A;  5KNB A;  4A3M B;  3FEW X;  2Y0S B;  4RKB A;  5IGF A;  3MFG A;  1S5D D;  2XWJ B;  4QB4 A;  4DFA A;  2BDO A;  4FO2 A;  1QNU A;  4MN3 A;  3NQT A;  1FNU A;  3I4L A;  4JK1 C;  3D4D A;  1TU2 B;  1GUW A;  4C3J G;  4X3T A;  3SXH A;  2ZT9 C;  5J39 A;  4NKL A;  3X3N A;  1HRJ A;  1H9S A;  1PZI D;  3S1Q B;  1A6X A;  2IWH A;  1Q90 A;  5NUC A;  3HP3 A;  4CBV A;  5ELB A;  3CRL C;  4ZRZ A;  2F0L A;  2WAC A;  4KKU A;  1S5E D;  1CTM A;  1E2V A;  2NN6 G;  1JOO A;  1EU3 A;  5K36 H;  1CZW A;  3LX0 A;  2F0W A;  1U4M A;  1CHP D;  3IFT A;  5I4D A;  3GTM B;  4H7B A;  1SYG A;  3DM1 A;  1STE A;  4ULL A;  1FGB D;  1KDA A;  1X3P A;  4L63 B;  1D5Z C;  2WKD A;  4ZAI A;  3R3O A;  2A6H C;  1HTL D;  1EEF D;  2ZXR A;  1SE2 A;  5JVG 3;  5E4W C;  3T53 B;  1SEB D;  2SEB D;  1STA A;  3HG9 A;  3S1N B;  3PUV A;  1JCK B;  1CQF A;  4RCO A;  3DUZ A;  1F2Y A;  5A2Q E;  1JIC A;  1L0X B;  1BO0 A;  2E2J B;  4IUQ A;  1ENA A;  2R7Z B;  3H91 A;  3RUZ A;  5KYL A;  3RMH A;  2L9H A;  3HOX B;  3GTK B;  5CV5 A;  1LAC A;  2HDM A;  5COR A;  4RWS C;  5JEA H;  1GUG A;  2NWG A;  2PZU A;  1I4R A;  4KJO A;  4A3F B;  1SJH D;  5E3F A;  3R2T A;  1WD1 A;  2A73 B;  3KLR A;  2WB1 B;  2BE5 D;  2F1M A;  1I50 B;  5ELF A;  3NTI A;  4XT1 B;  1JWS D;  3M7N A;  1LTA D;  4HCE A;  5JOB A;  1JB3 A;  5C6A A;  2NTS A;  4IFD H;  1K8M A;  1RDP D;  3H3V C;  2F0F A;  4K5X A;  1CI3 M;  1H9J A;  1UEA B;  4IUN A;  1EU4 A;  4G4K A;  1W6J A;  2KCN A;  3A8K E;  1EFI D;  3TN2 A;  4G7O C;  1IYV A;  4EGV A;  2JXM B;  1WTO A;  2NBF A;  1DCZ A;  1SND A;  4KY7 A;  2DN8 A;  1LT4 D;  4L6T B;  1LT5 D;  3HKZ B;  1TII D;  4DXG A;  1STB A;  1HTP A;  1Q12 A;  3A7L A;  2R92 B;  3K5N A;  2EYP A;  4XQQ A;  3S1R B;  3BG3 A;  3L7Z C;  3VYR A;  3AMU A;  1PRT D;  1II3 A;  4WOR A;  2A69 D;  1I4P A;  2SDF A;  3MZ5 A;  4P2C B;  2KEC A;  2OF1 A;  4X3U A;  3GTO B;  4JBW A;  2F0G A;  2AWN A;  2GA4 B;  3NHH A;  2A74 C;  2EOT A;  1EYA A;  3J7A V;  2NVT B;  4XQN A;  4YIJ A;  2A6E D;  3OWE B;  5EKK A;  3OW7 A;  1V1P B;  4K8I A;  2V4D A;  5DM7 3;  1E2Z A;  2AQ3 B;  1EY9 A;  3LWE A;  2XSC A;  4A3E B;  4QIW B;  1AP0 A;  3I90 A;  1SJE D;  1OO9 B;  3SR1 A;  2JA6 B;  3BYT B;  5M9O A;  5JPM C;  4K2K A;  1JE4 A;  3J7A F;  2EZV A;  3IL8 A;  2L5T A;  4FF2 A;  1QE6 A;  2L1B A;  1EOT A;  3CKI B;  4OIK A;  4FF1 A;  5BN5 A;  3JAM L;  1Z6H A;  4IUT A;  2F4I A;  2F3W A;  1SSO A;  1Y1V B;  2B63 B;  5FOB B;  2D5D A;  3K58 A;  5EGT A;  1SYD A;  4PNY A;  2FMC A;  2HCI A;  2C5C A;  3Q23 A;  1EL0 A;  2NTT A;  4DK1 A;  3K57 A;  3OWF A;  5C3X A;  2XIW A;  4XYQ A;  1LT3 D;  4N9T A;  1BCP D;  4ZUI A;  3CU7 A;  4I7Z C;  1EIH A;  1O7Y A;  3BZD B;  4B9W A;  2PCF B;  4B9X A;  2EYH A;  2RDH A;  3MXP A;  5IIF A;  1GHK A;  1BUV T;  1NCV A;  2B2Y C;  3IAY A;  3NXW A;  1MGS A;  2KHS A;  5DNF A;  2RVL A;  2JA7 B;  2VNU D;  1CFM A;  2CW0 C;  2VB2 X;  2N88 A;  4S3S A;  3I72 A;  1TWH B;  3GD7 A;  4XIG S;  5C4J B;  1Q1E A;  4UAI A;  1U4R A;  5LL6 S;  2E2H B;  1H9R A;  3VR2 A;  3H0G B;  1U4L A;  1SFO B;  4EQN A;  1TT2 A;  2LFN A;  2B2W C;  4IUP A;  1Y69 U;  4DN4 M;  2M2L A;  1ZYR D;  3P20 A;  3GV3 A;  5CR3 A;  1JC7 A;  3T16 A;  3S17 B;  4HED A;  3MA2 B;  4UDU C;  2OXP A;  1RJT A;  2QCP X;  1HPC A;  1SYF A;  1QG7 A;  3S15 B;  1NR2 A;  1PRT B;  3A8J E;  3VYT A;  1PMR A;  1SNM A;  2B8F A;  2HUG A;  3I91 A;  1A3V A;  5KGU A;  2Q8R E;  5D3D A;  1PZJ D;  1PRT C;  1G2S A;  5CV7 A;  1EWH A;  2MGS A;  3VYS A;  1F2Z A;  1TWF B;  2EY2 A;  3Q0A A;  1QB5 D;  2F0D A;  3WOF A;  4HAE A;  2L12 A;  3LNN A;  1IW7 C;  1JOK A;  4I65 A;  3T13 A;  2PQE A;  5IOC A;  4FXK C;  3SK4 A;  5EPJ A;  2NYZ D;  2K7V A;  5C0X I;  4C3I G;  1QCB D;  2D9U A;  1A3T A;  3QOL A;  1SE3 A;  2F0V A;  1MD2 D;  3ITP A;  1HQR D;  3D4W A;  2B2Y A;  2QF7 A;  1LTG D;  2FMM A;  2I46 A;  4AYB B;  1F2L A;  4R8I A;  3EJI A;  1S5C D;  2JSO A;  2NN6 H;  4QCL A;  1S5B D;  2XRQ D;  1X32 A;  4H0L C;  4C3H G;  3VR4 A;  3BDL A;  4IZ8 A;  1BCP B;  1CQV A;  2B2W A;  1ZKO A;  2AWO A;  5C0X H;  3SHL A;  1G8Z D;  1RHP A;  3EFX D;  1DM0 B;  5I2X A;  1CZG A;  3KLS X;  3BDC A;  4NDX A;  2MP1 A;  3X3M A;  2VXW A;  4ID6 A;  4K6L A;  4XT3 B;  3MXG A;  5C3W A;  1HXY D;  5G3L D;  2IPK D;  5J22 A;  2WKC A;  1I4Q A;  1O78 A;  1WVL A;  3H94 A;  2PMZ B;  2PZT A;  2SOB A;  2O5I C;  5CV8 A;  3QOJ A;  2F03 A;  1TWG B;  5CGK A;  5KND A;  4V19 0;  3IFD A;  1WTR A;  2AUJ D;  1IKL A;  2IW3 A;  3DXJ C;  3A8I E;  2Z8L A;  2R61 A;  2BCO A;  2DNE A;  3D6W A;  1WTQ A;  1JR0 D;  2EYJ A;  4RGN A;  2H1E A;  1ZYR C;  5D14 A;  1X3Q A;  2BOS A;  1Y1W B;  4XDX A;  1MI2 A;  4K8J A;  3QIA A;  2KVM A;  3E0J A;  4RCN A;  1L0Y B;  5FLX E;  1KDC A;  1STH A;  1NSN S;  3BVM A;  4MHE A;  4K14 A;  3K6O A;  4OO1 G;  3HRZ C;  1CA5 A;  2NB0 A;  3E6Z X;  4BWG B;  5KYI A;  2F0I A;  3FPU B;  3VA7 A;  1B44 D;  3K0Y A;  4IFD J;  5EBD A;  3SK5 A;  1WTW A;  1ONL A;  4BS9 A;  3UI2 A;  4LAA A;  4KI0 A;  1F2M A;  2X6L A;  2EE1 A;  4M1U B;  1UUP A;  3K5M A;  5T1I A;  2J0T D;  1ILQ A;  3FMC A;  4BA2 I;  3ND9 A;  2RQX A;  1Q8I A;  4J6H A;  1LTI D;  1DD2 A;  2EY5 A;  2IJ0 A;  1MBY A;  5IGG A;  3DMU A;  2NVX B;  1DON A;  1IL8 A;  4WRD A;  1EY4 A;  5F2D A;  3C2P A;  3GTG B;  1WTX A;  3NUC A;  3DWQ A;  4HMJ A;  2K32 A;  3PUX A;  5HGT A;  1D2B A;  1M4V A;  1PTO H;  3R8B A;  3VYU A;  5IT9 E;  2XNA C;  1U4P A;  4O1N A;  4CKC A;  4KJN A;  1AZP A;  3GV6 A;  1ENF A;  1OXV A;  1HUM A;  1D5X C;  3KBG A;  3OMG A;  4HSP A;  3D6C A;  4Z9C B;  4C3J B;  1OXU A;  3P7J A;  3VR3 A;  3RD4 A;  5C44 B;  1B3A A;  4EVO A;  5I9P A;  2J7Z A;  3J81 L;  4IFD I;  1XWE A;  4KN7 C;  5IGC A;  1AEX A;  4KKS A;  2CVR A;  3T51 B;  1EEI D;  4ILW A;  1OXX K;  3D8G A;  3NK9 A;  5BN3 A;  4DXF A;  2N55 A;  3C1E A;  2K03 A;  4ZKC B;  4C1N K;  4DA2 A;  5IGD A;  1PTO D;  3N52 A;  3AU7 A;  1ENC A;  1B9N A;  2JE6 I;  1E0B A;  2HQE A;  4ME5 A;  1J9O A;  2L55 A;  4XYO A;  4V0B A;  1EQT A;  2JEB I;  3EA6 A;  4E6I A;  2JP1 A;  3I3C A;  2PZW A;  2CW0 D;  1EYD A;  2K04 A;  2F0P A;  5CMD A;  4NW2 A;  5FO9 B;  3NWT A;  2KEE A;  1BR9 A;  5ELE A;  2PPB C;  3DEP A;  3J80 E;  2EDG A;  3M3Y B;  3PO2 B;  3T56 B;  2K5D A;  3MWY W;  1EIG A;  2LKV A;  4RHR A;  3GTQ B;  3RZD B;  5ELD A;  3PUY A;  4L8J A;  2KUM A;  5EQ0 A;  1TKW B;  3ERQ A;  1CHQ D;  4RHS A;  5D3I B;  4OIJ A;  1CA6 A;  1C4Q A;  3VR6 A;  4DGZ A;  2EPB A;  2ICE C;  2B2T C;  1STY A;  1R4P B;  3D3R A;  1W6K A;  3PIO 3;  4KY6 A;  4A3J B;  1ML0 D;  2K5W A;  4XTC S;  4IN3 A;  5EBC A;  1XYI A;  1G6Z A;  5BN4 A;  5CV4 A;  1SNC A;  1IKM A;  2ZXP A;  2MHV A;  4BY7 B;  4G57 A;  2WP8 J;  4A93 B;  1IW7 D;  1Z47 A;  4MIU A;  4TSS A;  3I4M B;  1JWM D;  3CHB D;  3C3L A;  5KIX A;  1D1K A;  2IX3 A;  3NPP A;  2F0Q A;  1VF7 A;  1SYE A;  4DK0 A;  1Y8O B;  2XWB B;  5EKI A;  3S14 B;  2F0N A;  2B39 A;  5EPK A;  1CK1 A;  3E5S A;  3K7A B;  3FRP B;  5C5L A;  1GUN A;  3K5O A;  5DEH A;  3Q24 A;  4OHJ A;  3CQZ B;  1MSH A;  1STN A;  5IGE A;  2BDN A;  3FVQ A;  4FP5 D;  1BF4 A;  1ROD A;  3F2U A;  3FPP A;  1K8O A;  4DAY A;  4RGT A;  2JA8 B;  1SDF A;  2BA0 A;  4J1M A;  1ZEQ X;  4PMC A;  3IKJ A;  3RZO B;  4OGQ C;  4QUF A;  4XXE A;  2O2L D;  4KK7 A;  1DYQ A;  1IHZ A;  1QIL A;  1RF2 D;  4KHV A;  1ZXT A;  4A3D B;  1SNQ A;  4PMW A;  1PTO B;  1FYC A;  1SYC A;  5FO7 B;  4OL7 A;  1D1I A;  4RGO S;  2MPM A;  3BDO A;  5CV6 A;  1PTO C;  3W3A A;  4KY5 A;  4IQZ A;  2E74 C;  3DEO A;  2EXZ A;  4K5W A;  3K5L A;  1U9R A;  2DY7 A;  4F8M A;  3NP8 A;  2B2T A;  2EY6 A;  1I4H A;  3TP5 A;  4PV1 C;  2XN9 C;  1Y8N B;  3TSS A;  1ICW A;  3I4N B;  5C0X J;  2C9O A;  1AFP A;  3LWU A;  5KNC A;  2SNM A;  1Q1B A;  1ESR A;  3HOW B;  2L0C A;  1EZ8 A;  3M7G A;  5IOD A;  4Q0F A;  1STG A;  4PMB A;  1B1Z A;  3W2D A;  4G7Z C;  2R6G A;  1FD7 D;  3M4Y A;  3HZX A;  4CHT B;  1KAA A;  3QO2 A;  5D65 A;  1VCI A;  4DNT B;  5LL6 X;  4KN4 C;  5M3M B;  3KLS A;  4R8N A;  3TME A;  2EVB A;  2Z4I A;  3OOC A;  3GTL B;  4Y7N B;  4KTA A;  5M5W B;  5I2Y A;  3URY A;  2AQ2 B;  1S4Z A;  1H9M A;  4IUR A;  2NN6 I;  2RBM A;  3G6J B;  2KOL A;  1GUO A;  3DHQ A;  5A2Q L;  4OO1 H;  1E2W A;  1KDB A;  2K5Q A;  5JVH 3;  2RA4 A;  3SK6 A;  3HOU B;  5ELC A;  4HN7 A;  2E2I B;  1SNO A;  2NVY B;  3BVG A;  1ESF A;  2SNS A;  1XTC D;  2QKI C;  3S2D B;  2HDL A;  4QUC A;  3TBI B;  1H9K A;  2OT2 A;  1TS3 A;  4WFN 3;  4DF7 A;  1DOK A;  1PDQ A;  2XRS D;  1FNW A;  2PW5 A;  4H44 C;  2BA1 A;  2XVS A;  3NBI A;  3EVQ A;  1KAB A;  4LJZ C;  2E76 C;  1SAP A;  3HGB A;  3HS0 C;  3U9S A;  1A2T A;  2F0H A;  2F0O A;  1JWU D;  1F9S A;  5KEE A;  2YU9 B;  4EQP A;  1CT1 D;  1Y8P B;  2QDB A;  3KF8 A;  1LLR D;  4A3I B;  3QJY A;  3NWS A;  1B9M A;  1SYB A;  3R2I A;  4K2L A;  3H6M A;  1GHJ A;  4A3B B;  1G2T A;  1G91 A;  1I6V C;  1WTV A;  1GUS A;  2EYM A;  2YYZ A;  4RFB A;  3HOZ B;  1BDO A;  4C3I B;  1C48 A;  1HFG A;  5JAV A;  2I07 B;  2KED A;  5C4Z A;  3MHB A;  2KQ3 A;  3AB9 A;  1QJO A;  1O7L A;  4B08 A;  1TS4 A;  1PXU A;  3GTJ B;  5M5X B;  5LHY 1;  1OXS C;  5C5M A;  2IL8 A;  2KCC A;  3JAM E;  1KTK A;  5KRU A;  4C3H B;  5COY A;  1VMC A;  2IT1 A;  1VF5 C;  3CRK C;  4WJW A;  1EY8 A;  1TY2 A;  1TWC B;  1RTN A;  2WV6 D;  5JEA J;  2A68 C;  5C4X B;  3KUP A;  4FXG C;  4DU9 A;  1YNN D;  1B2T A;  3NQI A;  1O80 A;  1DJR D;  1B53 A;  1QNK A;  2K01 A;  1EWC A;  5T1G A;  4ZLT F;  3L3O C;  1KNE A;  3TP7 A;  2R93 B;  5I6Y A;  2FIN B;  4Q5V A;  1PZK D;  1TWA B;  1AN8 A;  3MTS A;  1JQY D;  1HFN A;  1I3Q B;  1F9R A;  1BCP F;  2RDF A;  1FNV A;  3Q6S A;  1KLU D;  1EY6 A;  2F0T A;  4RH6 A;  3DWP A;  4C1N I;  1Z7T A;  1AZQ A;  1YNJ D;  2DY8 A;  1MSG A;  1A3U A;  3HOY B;  4A3G B;  1ET6 A;  3A7A B;  4F87 A;  2Z4H A;  2M00 A;  1TS2 A;  3TDQ A;  1BXT A;  3NE5 B;  1V8Q A;  2F0E A;  1SXT A;  1EY5 A;  2F0K A;  4X3S A;  1RKN A;  1M8A A;  2B8G A;  2D2C C;  2CQA A;  4HR7 B;  2ID0 A;  3S16 B;  4HCS A;  1WCM B;  3MEH A;  3VA5 A;  4KMU C;  4H13 C;  3BYY B;  1T5X D;  1ILP A;  1LTB D;  5C0X G;  5CV9 A;  3SE0 A;  2ICI A;  3MXU A;  3KBX A;  3GP7 A;  4ZKB B;  2B2U C;  1D5M C;  1J8I A;  3PUZ A;  3OMC A;  3D4R A;  3GO5 A;  4K6D A;  2IX1 A;  4CJ0 B;  3QG1 A;  3S9W A;  1JOQ A;  3O13 A;  1RTO A;  3I73 A;  1A15 A;  3P1H A;  4XQJ A;  1SMY D;  3RLF A;  1KNA A;  3FKI B;  3MC0 B;  1BQQ T;  1F9Q A;  2H4O A;  3SEB A;  3I8Z A;  1A2U A;  4IAL A;  1B50 A;  1EQV A;  1B4O A;  3PO3 B;  3GQB A;  2ENB A;  2VB3 X;  1DXM A;  5IGB A;  4NMZ A;  1D6E C;  1HCZ A;  3ERO A;  1LTT D;  1EYC A;  1NUC A;  4ZYS A;  2WII B;  4K5V A;  4DAP A;  4KD4 A;  4ZK9 B;  1CM9 A;  2EJG C;  3A54 A;  1BOS A;  3C1F A;  2OEO A;  5TSS A;  4NP5 A;  2LS0 1;  3Q22 A;  1YNN C;  5JPN C;  1Q3L A;  2NUC A;  3U9O A;  5C4H A;  3NSW A;  1OXT A;  2EYF A;  4TQU S;  2HCC A;  2F0M A;  4KD3 A;  3ZYY X;  3TZU A;  2PNR C;  1WTP A;  1NR4 A;  3H09 A;  1YNJ C;  3TP8 A;  1PFB A;  1PFN A;  5G3L F;  3SK8 A;  5K36 G;  2O4X A;  4FYD A;  2B2U A;  5DAU A;  1PLF A;  1VMP A;  1TS5 A;  2R3Z A;  5FO8 B;  2PYK A;  4ZQ3 A;  2Z1C A;  4RAU C;  4M8A A;  4GZY C;  4FF3 A;  3MAQ A;  1DZ1 A;  2KA7 A;  2PO4 A;  1WD0 A;  1K83 B;  3WDN A;  4RKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...