2Q8TA

Crystal structure of the cc chemokine ccl14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
PYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
molecule tags Cytokine
molecule keywords CCL14
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8tA00
2L9HA 4XT1B 5AFWA 4ZAIA 1HFGA 2MGSA 2JYOA 2NYZD 1WTRA 3MTSA 1CA5A 1G6ZA 1G2TA 3TN2A 1PLFA 2KEEA 4HCSA 5D14A 1ZXTA 4QUCA 1JICA 1HHVA 3QO2A 1EOTA 1F2LA 1S4ZA 3Q6SA 4IURA 4UAIA 2H1EA 1QNKA 2DY8A 1G91A 1MGSA 1VMPA 4CJ0B 4LMQD 1WTQA 2X6GA 5COYA 2B2VA 3I3CA 2K1BA 3P7JA 4IUVA 5JJZA 4U68A 5T1IA 1RJTA 2KOLA 1BNZA 2K01A 1Q3LA 4X3UA 1F9QA 1KNEA 5E4WC 1TVXA 1WD1A 5EPJA 4XDXA 1U4LA 1HFNA 1WTOA 1B2TA 4R8IA 2B2YA 2FHTA 3MWYW 5EPKA 5CBAE 3GV6A 3DEOA 1DOKA 1DOLA 1A15A 4HSVA 1MSHA 2K03A 2HUGA 2MPMA 2NZ1D 3H91A 5T1GA 4CJ2C 2K28A 1RTNA 2N88A 3HP3A 5EPLA 1WTPA 2FINB 1HUMA 4O42A 2L12A 3I90A 1WD0A 1SAPA 5EJWA 1KNAA 2HCCA 2B2UC 1M8AA 3KUPA 1O7ZA 3KBXA 2HCIA 2B2UA 1NCVA 1MI2A 2RVLA 4ZK9B 1ILQA 1ML0D 4QUFA 1U4PA 1HRJA 2B2YC 2N55A 2L4NA 1B53A 1JE4A 1VMCA 3I91A 4ZKBB 1X3QA 4HEDA 1WTVA 4X3SA 1AZPA 4MHEA 1HUNA 1F9RA 1SDFA 1DOMA 4XT3B 4IUTA 3R93A 1WTXA 1MSGA 1BF4A 2R3ZA 1J9OA 1EIHA 2MJ8A 3DM1A 1PFNA 2KEDA 1PFBA 2B2VC 1B4OA 1PFMA 2M2LA 2FMMA 1NR4A 3ONAB 2K05A 2KECA 5DNFA 5CORA 1B50A 1X3PA 1NR2A 2RA4A 1IKMA 4R9WA 3TZDA 1QG7A 4CJ1B 2HDMA 4OIJA 1CA6A 1AZQA 1O7YA 2Q8RE 5E4XA 4RA8A 2L1BA 1WTWA 3IL8A 1B3AA 2EOTA 5EKIA 4ZKCB 1O80A 3I8ZA 1EL0A 2JP1A 2CVRA 3LWEA 1RODA 3F2UA 1U4MA 2SDFA 1WVLA 2Q8TA 1BO0A 2X69A 5CBEE 5CMDA 2L11A 2K04A 2KUMA 4ZLTF 1RTOA 1X32A 2HDLA 1F9SA 1CM9A 3N52A 1DZ1A 1ICWA 2RSOA 2RSNA 1EIGA 1J8IA 1DONA 3FPUB 4HAEA 1SSOA 2KVMA 3IFDA 1QE6A 4RAUC 4RWSC 2B2WA 2EPBA 5EQ0A 4OIKA 1ESRA 1XX8A 3G7LA 1BBXC 1IKLA 2FJ2A 4IUPA 4X3KA 2BDNA 1EQTA 1AP0A 2MP1A 3GV3A 2IL8A 1HA6A 1U4RA 2DY7A 1E0BA 2J7ZA 2B2WC 3DEPA 4IUUA 4X3TA 1F9PA 1LV9A 2X6LA 4MN3A 3UI2A 1ILPA 1PDQA 3FDTA 5D65A 2EE1A 4DN4M 1IL8A 2B2TA 3SVMA 2D9UA 1RHPA 2FFKB 2VXWA 2B2TC 1GUWA 1C8CA 1XYIA 2XIWA 1G2SA 4IUQA 1NAPA 3D6WA 2NWGA 4NW2A
chains in the Genus database with same CATH superfamily
4LF4Q 1EFID 2NYZD 2N8NA 1BR9A 1TQOA 4DR6Q 2NTTA 3S16H 1IW7C 2AQ1B 1ZXTA 4A3KH 2Z8LA 4LF8Q 4BBSB 3HKZB 3QO2A 1Q1BA 4A3BH 5LMNQ 1BKBA 1PZKD 3TZUA 4ME3A 4P75A 3WDNA 3J81c 1LTSD 2QDLA 3GTOH 3B6YA 1QZHA 3J81E 1RJTA 5IWAL 4JYAQ 3CAMA 4Q0FA 1I4QA 4XDXA 4DR5L 5IP7G 2ASBA 4C3HG 3GV6A 2NB0A 1DOKA 4HSVA 4BXXH 2HQEA 5EPLA 3OW7A 5IP7H 3KBXA 1CQFA 5C3EB 1CKNA 1MI2A 1G51A 1ML0D 1U4PA 3KBGA 4GLXA 1WCMG 1X3QA 3H0GB 4CDEC 4HJ7A 2OTLA 4K2LA 1Y8OB 1EIHA 1J9OA 4MTNA 3DM3A 1CSQA 4IFDI 3SK6A 3DWQA 4XQNA 1H9SA 1KD1C 2M2LA 3ONAB 1PH9A 3SK8A 3T1HQ 3HOUH 1EYGA 1KRTA 1CA6A 3GTPB 1JOOA 1T5EA 4BS9A 4FNFA 3RZDB 3DXJC 3K5LA 3J7AV 3BVZA 1X6OA 3EBEA 5M3FH 1SYCA 2R93G 1JWUD 5ISRA 4OO1H 1EL0A 3LWEA 3BDLA 3X3MA 4A3FG 4DR1L 2XRSD 2X69A 2QILA 5K36G 1EEID 4DK1A 2DNCA 5KIXA 1A6XA 4DUZL 3RLFA 1HTLD 1H9KA 1J8IA 4RAUC 2Z4IA 1N36L 1KLGD 4A3CH 2KBNA 2ZTEA 4WJWA 1PHJA 1HA6A 2ZJPA 4K2KA 1V8QA 5HY6A 3FPPA 1LV9A 4UHVA 1LT5D 5CV5A 2QKIC 2K7VA 2ES2A 3FDTA 4X66L 1BUVT 1W6KA 3NWTA 1K8MA 1EQVA 3MXGA 4G7ZC 4F87A 1QOHA 1XYIA 2PMZE 1VF7A 3QJYA 2JQOA 2RCFA 4DR4Q 2F0IA 3TREA 5D14A 1MJCA 3P1HA 3S1RB 5JOBA 1S4ZA 2VL6A 3F2BA 4A3MG 1UEAB 2ICIA 4Y52H 4PMWA 1G91A 1A0IA 4RHRA 5C4JB 3HOXG 3S1NB 3P7JA 3U50C 1FNVA 2SOBA 3EN2A 2H5XA 1SMXA 2UU9L 4BY7H 2CQOA 1Y8PB 1HFNA 2FHTA 2E5LL 2NZHA 3O13A 4R4TA 3C2PA 1SYEA 1Y1VB 3SXHA 4A3MB 4K8JA 3GP7A 1SE2A 1OXXK 3E3XA 4QUFA 3A55A 1GJXA 4KJNA 1Y8NB 1VMCA 2EQSA 4KKTA 4ZKBB 3PIO3 1HJPA 3EJIA 1XNQQ 2AKWB 4DF7A 2KEDA 4C3JB 4K14A 4LF5Q 1K73C 3GQBA 2B63H 4LF5L 2N3SA 3Q8DA 2QCPX 4OEMB 3NK9A 1AEXA 1XPOA 3HOUG 2V4DA 4KKUA 3ULPA 4OIJA 1CKNB 4PZ7A 5E4XA 3U4ZA 5KNDA 1WFQA 3FKIG 1F2ZA 2CH4A 2GVBA 1O80A 3OTOQ 4HTHA 3LNNA 5I2YA 3U58A 3CC7A 1X32A 3CQZH 1UUPA 1YITA 5M5XH 3MVVA 5C5MA 4C3JG 3NPPA 2Z0SA 4G7HC 3H3VH 4HR7B 2MFIA 5I4DA 5IP9H 3J80L 4JI5Q 4V190 1BCPD 4WORA 2CW0D 2K5NA 3FEWX 1PA6A 3G4SA 1TWHH 2AWOA 3JAME 1ILPA 5HURA 2SEBD 3NWSA 2I0QA 1GVPA 2DNEA 5FO8B 3PO3G 4DK3C 2F0GA 2VNUD 3HFZB 4IUQA 1EY8A 3T4AC 2ZTCA 1SXTA 2ICEC 1STNA 3MTSA 4YCUA 3HKZE 1ICFB 1D8LA 3G48A 4JPBW 2BA1A 4KD4A 4QUCA 3BG3A 5IYBG 1EY5A 1QNKA 3G6EA 1G291 2K5VA 3BZDB 4DR2Q 3CCSA 1XNRQ 2OF1A 2NBFA 4LF7L 3QOLA 5ELOA 3HOYG 3CCJA 4YHHL 1YHAA 5T1IA 5GAHC 5C44G 1JJGA 4RKLA 3EQLC 1YVCA 4O1NA 1HZCA 5IIFA 4KJOA 2VUMH 1BVSA 4RG1A 3HOZH 1NNXA 4FXGC 1FR3A 2B2YA 1PXUA 3MWYW 1ENCA 1PYSB 2K03A 1VQKA 2NZ1D 3J81L 4ZYSA 1CT1D 1L0XB 2A19A 3CRLC 4LW1A 4BBSG 5JJLA 4K0KQ 1BCPF 4ILWA 1V1PB 4AIMA 1KQSA 3R93A 5C0XG 4FF2A 5IGDA 1RIPA 1I3QH 3CP0A 2NVTB 4A3IB 3PCOB 3CMAA 3A5UA 5ELNA 3TP8A 5JEAJ 3TEHB 2RA4A 4FXDA 4BY1B 1EWHA 3R2TA 4IFDH 2HDMA 4PG3A 1O7YA 3EA6A 4AYBG 1SR3A 4PV1C 3PF5A 1AH9A 4LF8L 4JV5Q 1BCPB 1TWFH 1RL2A 1YI2A 1IBMQ 1A3UA 1E2WA 1DXMA 2JXMB 2ZM6L 4CDDC 4LWCA 4JVZA 3C46A 4KHPL 5JAVA 1LTBD 1CK1A 2A69C 3K0YA 3F8TA 3HOVG 3I4NG 4DR5Q 3VR2A 1S5DD 5I6YA 2WACA 1A3VA 1JT8A 4BBRG 2B2WC 3ULLA 1Z47A 3MXPA 1Y1WH 1YJ9A 1PH2A 3HG9A 1FNUA 1QILA 5D65A 2JEAI 3E9IA 4K5WA 2R93B 3SGIA 4JI7Q 2KHIA 2WB1E 1UE7A 1M4VA 5CYUA 3RD4A 1NAPA 1G2TA 2GN5A 1HZ9A 1WTRA 2RDHA 3S15B 1N33L 1STBA 4HMIA 4B3RL 2DUDA 2DJGC 2JJQA 4PQXA 2Y0SE 3BVMA 4IURA 3GTMB 1B1ZA 3NE5B 4NXML 5NUCA 5GADC 1VQJA 1K0SA 4XYOA 3CW2C 2XSCA 3I7FA 4U68A 1X3FA 1I4RA 2GVAA 4NDXA 1KNEA 4H02A 4HMJA 4B3TQ 1X3GA 2QW7A 1K83H 1KDCA 2E76C 1SNQA 5FO7B 1W6JA 2B29A 2R7DA 2HUGA 4KY5A 2FINB 4FF4A 3HOVH 3I4NH 2C5CA 3PIP3 3F1ZA 4FO2A 4DV4Q 3ULJA 2F4VQ 4A3BB 4JI1L 2VQFL 3CCLA 3I56A 3HOXB 3J7AF 1XXGA 2OTJA 2F0DA 1Z9FA 1WTXA 3TS2A 1EZ6A 1EIFA 2PYKA 4DUZQ 1TT2A 2WV6D 4G4KA 1EIYB 4POFA 1HXYD 3OYYA 5BN3A 1X3PA 1X3EA 5GAEC 4AQYL 5CV7A 3TZDA 2CWAA 4DV6Q 5IP9G 5JPNC 4DR2L 2LXJA 5I2XA 1N34Q 3T16A 2EXDA 4X65L 3H6MA 5FOBB 4LF4L 4ZRZA 4QJFA 3HGBA 1VQEA 2R6GA 5C0XH 1RODA 1GUTA 3VR3A 2UXDL 3IKJA 5E3FA 3H0GH 3SK5A 1ASZA 5FJ8G 1P16A 4EX5A 2PI2A 4LUOA 4A3LG 2BE5C 2NUCA 1R9TB 1EIGA 1A3TA 4QQBX 4IOAA 2EPBA 1KLUD 3G7LA 2E2HH 2JA8G 1VQ4A 3HOUB 5CGKA 4JC0A 4R4CA 4DXFA 4PZ6A 1EYAA 4JI5L 3L7ZC 3KDFB 4Y7NB 3W1GA 3UE0A 2FFKB 4GKJL 4UP9A 3D0FA 3GTLB 1C8CA 3JAMi 3HOYH 1L1OC 5DEHA 3HOWH 1JJ2A 1YIJA 2KEEA 4HCSA 3V2TA 1Y14B 1O78A 4JYAL 5H1SE 5A2QE 4DV3L 1KDBA 1EWCA 5ELEA 4DUYL 1VMPA 4CJ0B 3OWFA 2UXBQ 4IUVA 3E6ZX 4RGNA 1LYLA 4KI0A 4PMCA 3S14H 3MZ5A 2O2LD 3M3YH 4A3LH 2F52A 2E2DC 4DAPA 1S3OA 5EPKA 4IOCA 3CKIB 1EY7A 1H95A 1HUMA 4XYQA 4CDFC 4X62L 1U9RA 1VQGA 3S1RH 1O7ZA 2HT1A 4HN7A 1S40A 2HIVA 4A3EG 4A3JH 3MAQA 1EOVA 3JAML 2YTYA 2PCFB 2V1CC 2VB3X 1PRTD 1IYVA 2JA9A 4R4OA 3K81C 5C4JH 3WWVA 1WTVA 1F9RA 1PFSA 1MSGA 1AW7A 2F0WA 1DM0B 2K33A 3A56A 4FVMA 4C56C 3M3YB 3K7UC 2M9VA 4DFAA 4DR3Q 4IALA 4EGVA 3SHLA 3D31A 1JWSD 5M9OA 4NMZA 4RA8A 2B63G 4LFBQ 3PGZA 1VDZA 1N9WA 2A6EC 1RD9D 4A3JB 2CWPA 1N34L 3E9HA 1DD2A 4UP7A 1PRTB 4B08A 4GOPB 2Z6KC 1STGA 3MXNA 1VF5C 2OQKA 2E74C 3HOYB 4HAEA 4X66Q 1GO3E 3NQIA 1ESRA 1I4HA 1XTDA 5J22A 1H9MA 2CQAA 3EROA 5C6AA 1GUOA 1E0BA 1ZEQX 4RKBA 2NVQB 1DCZA 1K8OA 1OXVA 4DV6L 4K0KL 2EY6A 1WYDA 3K58A 1PH3A 5LMUL 1YJNA 1NMFA 2Z6KA 4JBMA 2Q8IB 4S3SA 4KHVA 2A5HA 5FLXc 5A2QL 2RCNA 2EYJA 1STYA 2EZVA 4QIWB 3K5NA 3S16B 1WCMB 3H0GG 1GD7A 1BDOA 2JA7H 1IYUA 5COYA 3K59A 1TWHB 1U0LA 1SRUA 1JOQA 2KOLA 2UXDQ 4B3ML 4TVAB 2DJFC 1KDAA 4R4IA 3OHXC 3NTIA 1TVXA 5E4WC 4LF6Q 5EPJA 4JV5L 5C4HA 3S15H 2NTSA 3A7LA 1B2TA 4DV1Q 2SNSA 1KTKA 2MNAA 1D6EC 3VR5A 1O7LA 3NTHA 2Y0SG 2N88A 4JI7L 1QNUA 1KABA 2L12A 1X9NA 3AB9A 1L2FA 1M8AA 2VB2X 1UE1A 2E2JH 1PTOC 2FMCA 3G71A 4A3EB 4DR1Q 1X55A 4N8X1 1SDFA 4XT3B 1Q12A 1JWMD 2BDOA 2MQHA 1K83B 3RN5A 2VY3A 4OL7A 4K5VA 2B2VC 2JA6H 3RLNA 5JJKA 5J3BA 3AYHB 1XNRL 3TBIB 5IYDG 1JB3A 1MKHA 4N8FA 5CV4A 1GUNA 3PO2H 4C3IG 3GD7A 1II3A 2ZTDA 4F7XA 2IT1A 1B3AA 5EKIA 2AWNA 5FLXL 3I8ZA 4YWKA 5IYDH 1B9NA 4OWXB 3L9AX 2CHBD 3PUXA 1GHKA 1BO0A 1YHQA 4JI1Q 2KJXA 4DV5L 3FPUB 2KVMA 1ONLA 4LJZC 2ALYB 4QIWE 1O7IA 1OXSC 3D4DA 1AP0A 1LTLA 2K5QA 2PZTA 2XNAC 5F2DA 1W3SA 4HJAA 1XMQQ 2Q2IA 5DM73 4LFCQ 3PO2B 4WJ4A 3FKIB 1IL8A 2JA8B 2F0EA 2F1MA 1S5BD 2VS1A 2EDGA 4M8AA 5M3MB 3CCEA 1Y1VG 4HJ8A 2XIWA 3D6CA 4K6DA 4AYBB 1CA5A 2NN6H 3NEMA 3A0JA 4KMUC 2PZWA 2E2IB 1PH6A 1LM0A 1NY4A 3Q6SA 3RZDH 1L1OB 1MGSA 1SMYC 2RQXA 4O0AA 2JA7G 4LMQD 2G9DA 3A74A 4IO9A 5BN5A 1RKNA 5KGUA 2A68D 3GTJB 3BVGA 4ZCKA 3MHBA 5FO9B 1FNWA 3U9OA 4X3UA 4JI2L 1CZGA 2VQEL 1SLJA 3TS0A 1TU2B 4L5QA 3GDEA 2IX0A 3LX0A 4LF9Q 3H15A 1MSHA 2R7FA 4LUVA 1QWYA 2L15A 3I2ZA 1PH4A 2E2IH 1RCVD 4J1MA 4JI6L 4UY8C 4ZK9B 4OX9L 5LMUQ 4E6IA 2XWJB 5C5LA 5C44B 2EY2A 3BYTB 3A54A 1OO9B 4IJHA 1SNCA 2GA4B 2I07B 3BU2A 4JOIA 5E1FA 3Q23A 3H3VI 3QG1A 2A73B 1C48A 2G9HD 3IRBA 5IYBH 4BA2I 1SJHD 1B4OA 1E1OA 1C7YA 4DKAC 4IJLA 4XQJA 2LS01 3NBHA 4R9WA 1YNJD 3I4MG 3M7GA 1I4XA 1WTWA 5ELCA 4CHTB 2IJ0A 5ELFA 1E3PA 3UDFA 1TKWB 2F0FA 1PTOD 2L11A 5M5WB 3TSSA 4BA1I 3VA7A 1RTOA 2ZXRA 1H9SB 3KF6A 4P74A 4NXNQ 2F0UA 2JE6I 4C1NK 1D2BA 1VQBA 4OIKA 4I7ZC 5JVH3 3CHBD 5KNBA 2F0OA 4RH6A 4IUUA 1B9MA 4X3TA 2X6LA 5IGEA 4CDCC 2PNHA 4DAMA 3I4MH 5L37A 3R2IA 2EE1A 1XPRA 2QEXA 5LL6S 1JORA 2VXWA 2B2TC 4NXNL 1BQQT 3TRZA 4F88A 4C3IH 3K8AA 3SE0A 4GKKQ 4NW2A 2MGSA 2JYOA 2QA4A 3NHHA 1SYDA 5GAGC 2WINB 4ULLA 2K75A 1JMCA 3G6JB 5LMNW 1S72A 1JICA 3SDZA 1EOTA 4GOPA 4A93G 3URYA 4JI3L 1CQVA 1K9MC 1W2BA 3GTPH 3TP7A 2CFMA 2JN4A 3L3OC 1I94L 5EKKA 2YU9H 4CKCA 4KTAA 5C44H 5IT9c 4N9PA 3QOJA 1HQMC 2K50A 5K36H 2ZJQA 3JAMc 3NENA 4YCWA 2K28A 1RTNA 2EY1A 4IN3A 1NUCA 1SAPA 1KL9A 3Q22A 4OELB 3TMEA 3K5OA 4UPAA 4GKJQ 2AUJD 4OWTB 4DAYB 4OHJA 5JPMC 2Z1CA 5IT9L 3OMGA 3DM1A 4POGA 3HKZG 4O2DA 3S2DB 1KXLA 1XMOL 3TQYA 4JI2Q 2A8VA 1PFMA 2PO4A 5LHY1 2E2HB 3KLWA 1GOZA 3I55A 3F2DA 1CHQD 1DGSA 2MHVA 1K28A 1IKMA 1GUSA 3KFUA 1AZQA 3C1FA 1K8AC 4TSSA 1LACA 1Q8IA 3A8JE 1K8GA 3AQQA 3BDCA 4UP8A 4LNQA 1LLRD 2HD3A 1R9TH 2TSSA 1TWCB 2PI2E 1UAPA 2MUYA 1EQQA 4IQZA 2OT2A 4GNXB 4A3DG 1DZ1A 1ICWA 3IFDA 2EYHA 5LMNL 5KYIA 4L5RC 4RGOS 2Y0SB 3AU7A 1R4QB 4IUPA 1V1QA 3VYUA 4DR7L 1PYWD 3A7AB 4PNYA 2XWBB 3AFPA 2B39A 4A3BG 4KHPQ 1TY0A 1UE6A 4DV7L 2JA5G 3W1BA 4HIOA 2UUAQ 4HIMA 4FYDA 1GKHA 5EKLA 1N32L 4JI0Q 4X62Q 2MO1A 4JI0L 2NVTH 2O5IC 3WOFA 3VYSA 3ITPA 1YNNC 1QUQA 4GN5A 3TN2A 1Q90A 2RDFA 3K57A 4DR7Q 3DHQA 4GN3B 3QR8A 1VQDA 3A5ZB 1EY9A 1IBLL 4GLAC 3K5MA 4GLVB 1L0WA 2B2VA 1EUJA 1Q7YC 3W2DA 4YHHQ 1SE8A 4DV0L 5JJZA 3L0OA 1XMQL 2CH4W 1A2UA 4BBRB 2KENA 3T1YL 5D3IB 4XIGS 3NTKA 5M5XB 4MTKA 3RNUA 3K6OA 4V0BA 5GROA 3DMUA 1A2TA 1TS5A 1PZJD 1EY6A 2G5DA 4A3GG 2F4VL 4IPCA 1I4PA 4YY3Q 4RFBA 2A6HC 4BXXG 1NJIC 2D5DA 5JVG3 2YYZA 4GNXC 1RDPD 1XPUA 4KY7A 3RR5A 3S2HH 1XJVA 3STBD 1Y1WB 1YBYA 1Q1EA 5HGQA 4N9TA 3Q0AA 1HRJA 4OO1I 3VYTA 4P72A 2L4NA 3MA2B 5DM63 1IBKL 1JE4A 2K5WA 2N78A 3ZYYX 1E7ZA 3DLLA 2R92B 1DOMA 3UDIA 2EJFC 5GQOA 2B63B 3QIAA 4YWLA 1TS4A 5ELBA 4HIDA 2K5DA 5J39A 3CD6A 5DLQE 5G3LD 1CSPA 3DWAA 4DNRB 2EVBA 1SFOB 1SYFA 2WAQE 4A3CG 2LSSA 1UE5A 5AJ3L 5CV9A 5IYCG 1JB7A 1IHZA 4H13C 2JP1A 5KYLA 4GZYC 1WVLA 2K04A 2KUMA 2HDLA 1CM9A 1HNZL 3JC66 2OXPA 2Q2UA 4A3IG 1STEA 2RSNA 1D5XC 3P75A 3OWEB 2A68C 3W3AA 4CGYB 2F0LA 1QJOA 2NVXH 5BR8L 1G8ZD 3H3VC 4LK1C 3I72A 2JA5B 4DN4M 2R7ZG 3PIOA 1KAWA 1JOKA 3MXNB 2QDBA 4EQOA 2I5MX 3ER0A 3MFGA 3M4QA 3TDQA 4MIUA 3KF8B 1EWIA 1G2SA 4BBRH 3OMCA 3J7YW 4DUYQ 1HNWQ 5AFWA 1V9PA 4KK7A 4QCLA 4U673 2WKDA 4UDUC 2KHSA 1EYDA 1HPCA 3OOCA 4MZ9A 2H1EA 2DY8A 3J81j 4QGUA 1Q82C 4ODGA 4RCNA 4AYBE 4EQ5A 2RF4A 2PZUA 4A3JG 1Q81C 1VQMA 2R7ZB 1NMGA 4FDBA 3QWNA 5C0XJ 2UUAL 3RZOB 4XXEA 2LFNA 4OXPA 4B3RQ 1KRSA 1WD1A 1DJRD 4WRDA 3K80C 3ND9A 1P8LA 3I4OA 1TWAB 4O42A 2FXQA 3H09A 5EJWA 5M3MG 4B3SQ 2HCIA 4B3SL 1XTCD 4RGTA 2ATWA 1ILQA 2SNMA 2F0TA 1B53A 4Y7NH 3S1QB 3I91A 3HRZC 4JCVE 1YEZA 2K14A 2K52A 1Y69U 3GTLH 4X6AH 3S17B 4IFDJ 2R93H 2A74C 5EGTA 1TWCH 1CKMA 3CCQA 3KLSA 3MXUA 5CORA 1K3RA 5CV6A 1J5EL 5C4ZA 1CI3M 1UNSA 1IL2A 1SBBB 2A69D 1FJGL 4CJ1B 2PQAA 1EZ8A 4DXGA 1PH8A 2F0KA 5C4XB 4ZKCB 2UUCL 1KIXA 3C3LA 1LTRD 2Z6BA 4QB4A 1PH1A 4A4IA 5IGBA 2EYMA 1VQFA 4J6HA 3TP6A 5FLMG 3PUVA 1D7QA 5C3EG 1F9SA 3BZCA 1PYBA 2RSOA 4YY3L 4RWSC 1SSOA 3NP8A 4A3DH 5FJ8H 1BBXC 3M4OB 3KF8A 2MP1A 2ZJRA 2J0TD 5KRUA 4RHSA 3J7ZC 1L1OA 4CBVA 1JE5A 4C2MB 1KAAA 1EEFD 4IPHA 3UE1A 4I7AA 3M85A 2B8FA 1GXDC 2D9UA 3H94A 2F0QA 4PMBA 2E5LQ 3CMEA 3E0EA 2L9HA 3PO3H 2EIFA 1VQIA 1RF2D 4OGQC 3ZJYC 3FRPB 2VQEQ 2RBMA 4OONA 3KLSX 5KEEA 3KJPA 4B3MQ 1KHIA 1DYQA 1NE3A 4LF6L 3I70A 3MC0B 5M5YB 3S2HB 1WTQA 1X56A 2E2JB 3I3CA 3I4LA 2YV5A 1Q86C 4IFDG 1BOSA 2DN8A 1V1PA 4Z9CB 1MIUA 1D5ZC 3CCUA 3LWUA 2KQ3A 1I6VC 5ELDA 5J1ZA 3I73A 1L0YB 2VUMB 5FLMH 4C3IB 1DOLA 1SN8A 3T56B 5EBDA 4BY1G 1VQPA 3H91A 3I4NB 3HOVB 3I90A 4JK1C 2OCEA 1HTPA 1BBUA 1C9OA 1A8VA 1JCKB 2WKCA 4IUNA 3SR1A 1NCVA 3PO2G 3E0JA 1F77A 3PV0A 1G6PA 2AQ2B 3HKSA 1KC8C 3X3NA 2JA6G 4HJ5A 4DV0Q 2FMMA 1NR4A 1TS3A 4WJ3M 4AH6A 2WB1B 3PQIA 3ERQA 2UXBL 3HZXA 3PF4A 4JG2A 4TQUS 4A3FB 2MO0A 4H0LC 1I94Q 1HR0W 2K32A 1QG7A 3D4WA 3M4OH 3L2PA 3VR4A 3MEHA 1NSNS 2NVXB 4DGZA 5I6WA 4JW0A 4QY7A 2CVRA 2D0PA 1U4MA 1PH5A 4XQQA 4FXKC 2F0PA 4DK0A 3C1EA 1C0AA 1DONA 2NVYB 1SYGA 2B2WA 1Q8KA 4B9WA 1Y1VH 5CR3A 1XWEA 4M1UB 1SFOH 2L0CA 1IKLA 2BDNA 2F0JA 1A62A 4A3EH 4IPDA 1MJEA 3U9SA 3PUYA 2F03A 2R92H 5C3WA 2PW5A 1RHPA 1T5XD 1M90C 2BCOA 1VQ8A 1HZBA 3SEBA 4P71A 1FGBD 3GTKB 1TIID 1R4PB 3HOWB 1HFGA 3STBC 4MNOA 2YTXA 2RHSB 2BH2A 4BBSH 4Q5VA 1F2MA 4APVA 1HHVA 2YTVA 1FGUA 1ASYA 2ZT9C 2X6GA 4PZ8A 1E2VA 5DAUA 2WAQG 2BE5D 1TWGB 2IPKD 2K01A 3J80i 3SK4A 1E22A 4ZQ3A 3MFYA 2IWHA 1MBYA 5CBAE 3A8KE 1S5FD 4B9XA 2IHEA 3KLRA 4A3FH 5K5PA 3CC4A 3D3RA 2BA0A 2C35B 3IAYA 4OX9Q 2OEOA 4IPGA 5IE8A 1HR0Q 1WTHA 1N32Q 2B2UC 2K4KA 4ME5A 2XGTA 4OWWB 1CHPD 1I6HH 2B2YC 5BR8Q 1VQ9A 4HEDA 4LUZA 1IBML 5E7NA 3HOXH 1IW7D 3S2DH 1X54A 4QMGA 3KYHC 1LUZA 2TMPA 3S24A 5DNFA 1YHBA 5JEAG 1NBWA 4H7BA 3KF6B 4JI8Q 1K3BC 3NBIA 3GTQH 2XN9C 1LT4D 1QVGA 1WI5A 3RN2A 3D8GA 3S17H 3RZOH 4C2MH 1S5CD 1LTID 4DA2A 1FVIA 5C3XA 5JEAH 5EBCA 1N8RC 1ET6A 3K0XA 3BS1A 1IBLQ 1QE6A 1SROA 5EQ0A 1YNND 2DY7A 2OQ0A 1ET9A 4K6LA 5IOCA 4TRDA 4MN3A 4R1JA 1PTOH 1PDQA 5EAYA 2VQFQ 3SVMA 4DV5Q 1SEBD 2PW7A 2JA6B 2NWGA 1PRTC 2J4XA 4EVOA 4KN4C 4BY1H 4H44C 1G6ZA 2KCCA 2WP8J 1MHWC 3WOEA 1PV4A 4LAAA 3S1MH 2F0HA 1MD2D 1F2LA 4CKEA 2NN6G 4ZUJA 4C1NI 1LABA 1LT3D 4KN7C 3A8IE 2K1BA 3M7NA 2F0MA 2AHOB 4BY7G 2PNRC 1I50B 2OWOA 1PTOB 1TWFB 2Q2HA 2F0SA 2YU9B 4RCOA 2HHHQ 1OTCA 1LTTD 2HHHL 4HJ9A 4JBJA 3DEOA 1VCIA 4L5SA 2N49A 3CCVA 1T9HA 3ND8A 1CUKA 4AQYQ 4A3MH 4CKBA 2R92G 1WD0A 4F8MA 1YNXA 2WIIB 3KUPA 4FP5D 2B2UA 2L55A 2NZOA 2D62A 3OPOA 2LKVA 4KKSA 4EQPA 1IXRA 4BY7B 3ICEA 2QF7A 2R7ZH 2R3ZA 1D1KA 5FK9C 1PFNA 1HQRD 2UUBQ 3PUWA 3ERSX 2QEJC 1PMRA 4ABNA 5FKAC 1OXUA 1WOCA 4KV6A 1Q46A 2F3VA 2F0VA 4GN4B 1PH7A 2L1BA 1N33Q 3N6RA 1UEBA 2AUKA 1B3QA 3RMHA 4JI8L 1SNMA 2O5JC 4TKOB 4K5XA 1LTAD 4DAVA 4HCEA 1SNPA 5M3FG 1K0RA 1LO5D 2E8GA 2F3WA 5FLXE 1PVOA 2LXKA 4A93B 1BCPC 1TY2A 2J7ZA 1Z7TA 1VQAA 3DEPA 5G3LF 5IGGA 2I5HA 1EY4A 2A6HD 2JA5H 3UI2A 3EVQA 3VYRA 3HS0C 1IYJB 3T13A 5C4XH 4ALPA 2F0NA 1EYCA 1N36Q 2LY7A 2I5LX 2EY5A 3TP5A 3OTOL 1EU3A 3J7A5 1D5MC 1CTMA 5IT9E 1LT6D 1PLFA 3QB3A 4DPGA 1ZYRD 3CRKC 2M00A 5D3DA 1SE3A 3OW2A 1JC7A 2IX3A 3K7AH 1WCMH 3KK7A 3T51B 1E1TA 2RDGA 2JA7B 1VQHA 4KHZA 4WFN3 4X64L 1FD7D 1BNZA 2QGQA 2Z9HA 1Q3LA 5IGFA 3BYYB 2Q2TA 1QVCA 3EIVA 1X65A 2NVYH 1WTOA 3S9WA 1IZ6A 3PMFA 3V05A 1A15A 5T1GA 1QZGA 1B7YB 1KNAA 3UDGA 3CC2A 1I5FA 2H4OA 1SJED 2F4IA 4DV2L 3K7AB 1AN8A 2RVLA 4GOPC 3S1QH 2RHQB 2N55A 2R61A 4LFAQ 4HIKA 2IY5B 3S1NH 1V43A 1VS0A 3OSOA 4FF1A 1I3QB 4X65Q 2CCZA 2I46A 1PTOF 4DR3L 3HOWG 3RUZA 4JI4L 3M9BA 1NTGA 2K05A 1VQ5A 3OIQA 1EU4A 1SNDA 4R4QA 1STAA 3NQTA 3HOZG 4R8NA 4LFAL 2VUMG 1AFPA 1PRTF 5BN4A 2ZXOA 2WAQB 1F2YA 4DR6L 2EYFA 2A1AA 2JEBI 1SMYD 1Y1WG 2Q8TA 1HNWL 2EJGC 5CMDA 2ID0A 2PQEA 3OIPA 1A63A 3EFXD 1VQOA 4L6TB 3F2CA 1TXYA 2E75C 1SNOA 2HQLA 3BJUA 1B44D 2FJ2A 4YWMA 1EQTA 3S1MB 5IWAQ 3GV3A 2IL8A 1CFMA 1I6HB 1XNQL 3VR6A 1B70B 2XTIA 3FVQA 4A75A 1ENFA 3VDYA 3GTOB 2B2TA 2EYOA 2WB1G 4NKLA 3PIPA 2XRQD 2PPBC 3D6WA 5IODA 1HZAA 4XT1B 3CPWA 4DV1L 1ESFA 2B8GA 2CW0C 2KA7A 3HEJA 1TR5A 5I9OA 1YJWA 3GTQB 3FP9A 4QL5A 3RLOA 2PMZB 1VQLA 3CXCA 1GUGA 4K8IA 3GTJH 1S5ED 3Q24A 2IW3A 3E5SA 3CU7A 1F9QA 1LTGD 3W5OA 1BXTA 2P5ZX 4C3JH 3M4PA 1U4LA 4DR4L 2K5HA 4A3KB 5CV8A 4L5TA 1FJGQ 4YIJA 5C4XG 4CJ2C 5CC4A 2VW9A 1YZ6A 2NVQH 1FYCA 4DU9A 3J81i 2HCCA 3D4RA 1HA5A 4KY6A 4L8JA 4JI3Q 2WFWA 2L5TA 1EQRA 4JOIC 4MHEA 1HUNA 3DWPA 2UXCQ 4IUTA 1SE4A 1BF4A 3AEVA 2K6AA 4QF4A 3KJOA 3UDXA 3J80c 1PFBA 1AE2A 3BZKA 2Z4HA 3FHWA 2KECA 1B50A 2DGYA 3DUZA 1XMOQ 2KCNA 1NR2A 1TS2A 4I65A 3NSWA 2Q8RE 4P2CB 4LFCL 3NELA 2O4XA 1I4GA 3CPFA 4LFBL 3GO5A 2EOTA 2UXCL 2A6ED 3LGJA 5M5WH 1M1KC 4ID6A 3PUZA 1GHJA 1Z6HA 4DNTB 1J6QA 4JBWA 1ENAA 2JSOA 1HR0L 1TWAH 1QVFA 3NXWA 1H9RA 3NBHB 1VQNA 4LF9L 2UUBL 4KD3A 2BH8A 2EJMA 5M3FB 4G7OC 1CKOA 5TSSA 3I4MB 2ENBA 5M5YH 1VQCA 4BWGB 1HNZQ 4J8QA 1H9JA 4YCVA 3R8BA 3GTGH 3BDOA 2AQ3B 3FKIH 3HOZB 3U4VA 1GUWA 1V1OA 3GTKH 5A35A 4JI4Q 2EYLA 4ZAIA 3T53B 3CCMA 4A93H 4DK6C 3T1HL 3KDFA 4UAIA 1JR0D 4JI6Q 2EYPA 1FL0A 4GNXA 2IX1A 3M4YA 1JJCB 1BBWA 1C4QA 4DV3Q 1HH2P 4JBKA 4A3IH 1OXTA 1QUQB 2C9OA 1WJJA 4R8IA 4A3DB 1PZID 2VZAA 1AE3A 4J15A 1CZWA 4EQNA 5HGTA 3J80E 4HSPA 4A3GB 2MPMA 1WTPA 4OO1G 2NN6I 5I9PA 2ZM6Q 3HP3A 4GKKL 5IYCH 3CCRA 5IY0A 3AMUA 1HCZA 4DV7Q 3CF5A 1QB5D 3KOJA 2KCMA 1JQYD 1SYBA 2JA8H 2KCTA 3S14B 4X3SA 1AZPA 5M3MH 3T1YQ 1I50H 2ZXPA 2MJ8A 3PO3B 5KNCA 1HNXQ 3CQZB 4NXMQ 1HNXL 3MEFA 4FF3A 1J5EQ 5JJIA 2AMCB 4GS3A 4LF7Q 4A3GH 3FMCA 2BOSA 1VQ6A 3IFTA 1E2ZA 2B3GA 4IZ8A 3IL8A 3GTGB 5C3EH 5AJ3Q 1EY0A 5LL6X 2EXZA 3F2UA 2SDFA 4NP5A 2IHFA 4RGMA 5CBEE 2KHJA 3NUCA 1ZYRC 4C3HH 4ZLTF 4X64Q 4DV2Q 1STHA 2D2CC 4RMFA 3N52A 4L63B 1EFWA 4NB3A 2F3IA 2LMCB 3R3OA 2CKZB 5C0XI 4A3KG 1YNJC 4P73A 1XX8A 4B3TL 3GTMH 3AFQA 4DAYA 1GM5A 4X3KA 1E24A 1B8AA 4NPSA 2UUCQ 3P20A 4KLKA 1U4RA 1UWVA 2D0OA 3VA5A 1QCBD 1D1IA 1IBKQ 2JK8A 1F9PA 5IGCA 2UU9Q 2XVSA 4A76A 4ZUIA 4DNIA 1TWGH 1ZKOA 2RKSA 3PSIA 4DV4L 3V96A 1VQ7A 2HIXA 4G57A 2PQAB 4XTCS 1U5KA 4C3HB
chains in the Genus database with same CATH topology
1EFID 2NYZD 1BR9A 1TQOA 2NTTA 1IW7C 2AQ1B 1ZXTA 2Z8LA 4BBSB 3HKZB 3QO2A 1Q1BA 1PZKD 3TZUA 3WDNA 1LTSD 3J81E 1RJTA 4Q0FA 1I4QA 4XDXA 4C3HG 3GV6A 2NB0A 1DOKA 4HSVA 2HQEA 5EPLA 3OW7A 3KBXA 1CQFA 5C3EB 1MI2A 1ML0D 3KBGA 1U4PA 1X3QA 3H0GB 4K2LA 1Y8OB 1EIHA 1J9OA 4IFDI 3SK6A 3DWQA 4XQNA 1H9SA 2M2LA 3ONAB 3SK8A 1CA6A 3GTPB 1JOOA 1T5EA 4BS9A 4FNFA 3RZDB 3DXJC 3K5LA 3J7AV 3BVZA 1SYCA 1JWUD 5ISRA 4OO1H 1EL0A 3LWEA 3BDLA 3X3MA 2XRSD 2X69A 2QILA 5K36G 1EEID 4DK1A 2DNCA 5KIXA 1A6XA 3RLFA 1HTLD 1H9KA 1J8IA 4RAUC 2Z4IA 1KLGD 4WJWA 1HA6A 4K2KA 1V8QA 3FPPA 1LV9A 1LT5D 5CV5A 2QKIC 2K7VA 3FDTA 1BUVT 1W6KA 3NWTA 1K8MA 1EQVA 3MXGA 4G7ZC 4F87A 1QOHA 1XYIA 1VF7A 3QJYA 2F0IA 5D14A 3P1HA 3S1RB 5JOBA 1S4ZA 1UEAB 2ICIA 4PMWA 1G91A 4RHRA 5C4JB 3S1NB 3P7JA 1FNVA 2SOBA 1Y8PB 1HFNA 2FHTA 3O13A 3C2PA 1SYEA 1Y1VB 3SXHA 4A3MB 4K8JA 3GP7A 1SE2A 1OXXK 4QUFA 3A55A 1GJXA 4KJNA 1Y8NB 1VMCA 4KKTA 4ZKBB 3PIO3 3EJIA 4DF7A 2KEDA 4C3JB 4K14A 3GQBA 2QCPX 3NK9A 1AEXA 2V4DA 4KKUA 4OIJA 5E4XA 5KNDA 1F2ZA 1O80A 4HTHA 3LNNA 5I2YA 1X32A 1UUPA 3MVVA 5C5MA 4C3JG 3NPPA 4G7HC 4HR7B 4V190 5I4DA 3J80L 1BCPD 4WORA 2CW0D 3FEWX 2AWOA 3JAME 1ILPA 5HURA 2SEBD 3NWSA 2DNEA 5FO8B 2F0GA 2VNUD 4IUQA 1EY8A 3T4AC 1SXTA 2ICEC 1STNA 3MTSA 2BA1A 4KD4A 4QUCA 3BG3A 1EY5A 1QNKA 1G291 3BZDB 2OF1A 2NBFA 3QOLA 5T1IA 4RKLA 3EQLC 4O1NA 5IIFA 4KJOA 4FXGC 1FR3A 2B2YA 1PXUA 3MWYW 1ENCA 2K03A 2NZ1D 3J81L 4ZYSA 1CT1D 1L0XB 3CRLC 1BCPF 4ILWA 1V1PB 3R93A 5C0XG 4FF2A 5IGDA 2NVTB 4A3IB 3TP8A 5JEAJ 2RA4A 4FXDA 4BY1B 1EWHA 3R2TA 4IFDH 2HDMA 1O7YA 3EA6A 4PV1C 1BCPB 1A3UA 1E2WA 1DXMA 2JXMB 3C46A 5JAVA 1LTBD 1CK1A 2A69C 3K0YA 3VR2A 1S5DD 5I6YA 2WACA 1A3VA 2B2WC 1Z47A 3MXPA 3HG9A 1FNUA 1QILA 5D65A 2JEAI 4K5WA 2R93B 5CYUA 1M4VA 3RD4A 1NAPA 1G2TA 1WTRA 2RDHA 3S15B 1STBA 4HMIA 4PQXA 3BVMA 4IURA 3GTMB 1B1ZA 3NE5B 5NUCA 4XYOA 2XSCA 4U68A 1I4RA 4NDXA 1KNEA 4HMJA 1KDCA 2E76C 1SNQA 5FO7B 1W6JA 2HUGA 4KY5A 2FINB 4FF4A 2C5CA 3PIP3 4FO2A 4A3BB 3HOXB 3J7AF 1XXGA 2F0DA 1WTXA 1EZ6A 2PYKA 1TT2A 2WV6D 4G4KA 5BN3A 1HXYD 1X3PA 5CV7A 3TZDA 5JPNC 5I2XA 3T16A 3H6MA 5FOBB 4ZRZA 3HGBA 2R6GA 5C0XH 1RODA 1GUTA 3VR3A 3IKJA 5E3FA 3SK5A 2BE5C 2NUCA 1R9TB 1EIGA 1A3TA 2EPBA 1KLUD 3G7LA 3HOUB 5CGKA 4DXFA 1EYAA 3L7ZC 4Y7NB 2FFKB 3GTLB 1C8CA 5DEHA 2KEEA 4HCSA 3V2TA 1O78A 5A2QE 1KDBA 1EWCA 5ELEA 1VMPA 4CJ0B 3OWFA 4IUVA 3E6ZX 4RGNA 4KI0A 4PMCA 3MZ5A 2O2LD 2E2DC 4DAPA 5EPKA 3CKIB 1EY7A 1HUMA 4XYQA 1U9RA 1O7ZA 4HN7A 3MAQA 3JAML 2PCFB 2VB3X 1PRTD 1IYVA 1WTVA 1F9RA 1MSGA 1AW7A 2F0WA 1DM0B 2K33A 3A56A 4FVMA 4C56C 3M3YB 2M9VA 4DFAA 4IALA 4EGVA 3SHLA 3D31A 1JWSD 5M9OA 4NMZA 4RA8A 1VDZA 2A6EC 1RD9D 4A3JB 1DD2A 1PRTB 4B08A 1STGA 3MXNA 1VF5C 2E74C 3HOYB 4HAEA 3NQIA 1ESRA 1I4HA 5J22A 1H9MA 2CQAA 3EROA 5C6AA 1GUOA 1E0BA 1ZEQX 4RKBA 2NVQB 1DCZA 1K8OA 1OXVA 2EY6A 3K58A 2Q8IB 4S3SA 4KHVA 2A5HA 5A2QL 2EYJA 1STYA 2EZVA 4QIWB 3K5NA 3S16B 1WCMB 1BDOA 1IYUA 5COYA 3K59A 1TWHB 1JOQA 2KOLA 1KDAA 3OHXC 3NTIA 1TVXA 5E4WC 5EPJA 5C4HA 2NTSA 3A7LA 1B2TA 2SNSA 1KTKA 1D6EC 3VR5A 1O7LA 3NTHA 2N88A 1QNUA 1KABA 2L12A 3AB9A 1M8AA 2VB2X 1PTOC 2FMCA 4A3EB 1SDFA 4XT3B 1Q12A 1JWMD 2BDOA 1K83B 4OL7A 4K5VA 2B2VC 3TBIB 1JB3A 5CV4A 1GUNA 4C3IG 3GD7A 1II3A 4F7XA 2IT1A 1B3AA 5EKIA 2AWNA 5FLXL 3I8ZA 1B9NA 3L9AX 2CHBD 3PUXA 1GHKA 1BO0A 2KJXA 3FPUB 2KVMA 1ONLA 4LJZC 3D4DA 1OXSC 1AP0A 2K5QA 5F2DA 2PZTA 2XNAC 5DM73 3PO2B 3FKIB 1IL8A 2JA8B 2F0EA 2F1MA 1S5BD 2EDGA 4M8AA 5M3MB 2XIWA 3D6CA 4K6DA 4AYBB 1CA5A 2NN6H 4KMUC 2PZWA 2E2IB 3Q6SA 1MGSA 1SMYC 2RQXA 4LMQD 2G9DA 5BN5A 1RKNA 5KGUA 2A68D 3GTJB 3BVGA 3MHBA 5FO9B 1FNWA 3U9OA 4X3UA 1CZGA 1TU2B 2IX0A 3LX0A 1MSHA 1QWYA 1RCVD 4J1MA 4ZK9B 4E6IA 2XWJB 5C5LA 5C44B 2EY2A 3BYTB 3A54A 1OO9B 1SNCA 2GA4B 2I07B 3Q23A 5E1FA 3QG1A 2A73B 1C48A 2G9HD 4BA2I 1SJHD 1B4OA 4XQJA 2LS01 3NBHA 4R9WA 1YNJD 3M7GA 1I4XA 1WTWA 5ELCA 4CHTB 2IJ0A 5ELFA 1TKWB 2F0FA 1PTOD 5M5WB 2L11A 3TSSA 4BA1I 3VA7A 1RTOA 2ZXRA 1H9SB 2F0UA 2JE6I 4C1NK 1D2BA 4OIKA 4I7ZC 5JVH3 3CHBD 5KNBA 2F0OA 4RH6A 4IUUA 1B9MA 4X3TA 2X6LA 5IGEA 3R2IA 2EE1A 5LL6S 1JORA 2VXWA 2B2TC 1BQQT 4F88A 3SE0A 4NW2A 2MGSA 2JYOA 3NHHA 1SYDA 2WINB 4ULLA 3G6JB 1JICA 3SDZA 1EOTA 3URYA 1CQVA 3TP7A 3L3OC 5EKKA 4CKCA 4KTAA 4N9PA 3QOJA 1HQMC 5K36H 2K28A 1RTNA 2EY1A 4IN3A 1NUCA 1SAPA 3Q22A 3TMEA 3K5OA 2AUJD 4OHJA 5JPMC 2Z1CA 5IT9L 3OMGA 3DM1A 3S2DB 1PFMA 2PO4A 5LHY1 2E2HB 1GOZA 1CHQD 2MHVA 1IKMA 1GUSA 1AZQA 3C1FA 4TSSA 1LACA 1Q8IA 3A8JE 3BDCA 1LLRD 2TSSA 1TWCB 1UAPA 2MUYA 4IQZA 2OT2A 1DZ1A 1ICWA 3IFDA 2EYHA 5KYIA 4RGOS 2Y0SB 3AU7A 1R4QB 4IUPA 3VYUA 1PYWD 3A7AB 4PNYA 2XWBB 2B39A 1TY0A 4FYDA 5EKLA 2O5IC 3WOFA 3VYSA 3ITPA 1YNNC 3TN2A 1Q90A 2RDFA 3K57A 3DHQA 1EY9A 3K5MA 2B2VA 3W2DA 5JJZA 1A2UA 4BBRB 5D3IB 4XIGS 3NTKA 5M5XB 3K6OA 4V0BA 3DMUA 1A2TA 1TS5A 1PZJD 1EY6A 1I4PA 4RFBA 2A6HC 2D5DA 5JVG3 2YYZA 1RDPD 4KY7A 1Y1WB 1Q1EA 4N9TA 3Q0AA 1HRJA 4OO1I 3VYTA 2L4NA 3MA2B 5DM63 1JE4A 2K5WA 3ZYYX 2R92B 1DOMA 2EJFC 2B63B 3QIAA 1TS4A 5ELBA 2K5DA 5J39A 5G3LD 3DWAA 4DNRB 2EVBA 1SFOB 1SYFA 5CV9A 1IHZA 4H13C 2JP1A 5KYLA 4GZYC 1WVLA 2K04A 2KUMA 2HDLA 1CM9A 2OXPA 1STEA 2RSNA 1D5XC 3P75A 3OWEB 2A68C 3W3AA 4CGYB 2F0LA 1QJOA 1G8ZD 3H3VC 4LK1C 3I72A 2JA5B 4DN4M 1JOKA 2QDBA 4EQOA 3MFGA 3TDQA 4MIUA 3J7YW 1G2SA 3OMCA 5AFWA 4KK7A 4QCLA 4U673 2WKDA 4UDUC 2KHSA 1EYDA 1HPCA 3OOCA 2H1EA 2DY8A 4ODGA 4RCNA 2PZUA 2R7ZB 5C0XJ 3QWNA 3RZOB 4XXEA 2LFNA 1WD1A 1DJRD 4WRDA 3ND9A 1TWAB 4O42A 3H09A 5EJWA 2HCIA 1XTCD 4RGTA 1ILQA 2SNMA 2F0TA 1B53A 3S1QB 3I91A 3HRZC 1Y69U 3S17B 4IFDJ 2A74C 5EGTA 3KLSA 3MXUA 5CORA 5CV6A 5C4ZA 1CI3M 1UNSA 1SBBB 2A69D 4CJ1B 1EZ8A 4DXGA 2F0KA 5C4XB 4ZKCB 3C3LA 1LTRD 4QB4A 5IGBA 2EYMA 4J6HA 3TP6A 3PUVA 1F9SA 2RSOA 4RWSC 1SSOA 3NP8A 1BBXC 3M4OB 3KF8A 2MP1A 2J0TD 5KRUA 4RHSA 4CBVA 4C2MB 1KAAA 1EEFD 3M85A 2B8FA 1GXDC 2D9UA 3H94A 2F0QA 4PMBA 2L9HA 1RF2D 4OGQC 3FRPB 2RBMA 3KLSX 5KEEA 1DYQA 3I70A 3MC0B 5M5YB 3S2HB 1WTQA 2E2JB 3I3CA 3I4LA 4IFDG 1BOSA 2DN8A 1V1PA 4Z9CB 1D5ZC 3LWUA 2KQ3A 1I6VC 5ELDA 5J1ZA 3I73A 1L0YB 2VUMB 4C3IB 1DOLA 3T56B 5EBDA 3H91A 3I4NB 3HOVB 3I90A 4JK1C 1HTPA 1JCKB 2WKCA 4IUNA 3SR1A 1NCVA 3E0JA 1F77A 3PV0A 2AQ2B 3X3NA 2FMMA 1NR4A 1TS3A 2WB1B 3ERQA 3HZXA 4TQUS 4A3FB 4H0LC 2K32A 1QG7A 3D4WA 3VR4A 3MEHA 1NSNS 2NVXB 4DGZA 5I6WA 2CVRA 1U4MA 4XQQA 4FXKC 2F0PA 4DK0A 3C1EA 1DONA 2NVYB 1SYGA 2B2WA 4B9WA 5CR3A 1XWEA 4M1UB 2L0CA 1IKLA 2BDNA 2F0JA 3U9SA 3PUYA 2F03A 5C3WA 2PW5A 1RHPA 1T5XD 2BCOA 3SEBA 1FGBD 3GTKB 1TIID 1R4PB 3HOWB 1HFGA 4Q5VA 1F2MA 1HHVA 2ZT9C 2X6GA 1E2VA 5DAUA 2BE5D 1TWGB 2IPKD 2K01A 3SK4A 4ZQ3A 3MFYA 2IWHA 1MBYA 5CBAE 3A8KE 1S5FD 4B9XA 3KLRA 5K5PA 3D3RA 2BA0A 3IAYA 2OEOA 2B2UC 4ME5A 1CHPD 2B2YC 4HEDA 1IW7D 4QMGA 2TMPA 5DNFA 5JEAG 4H7BA 3NBIA 2XN9C 1LT4D 3D8GA 4DA2A 1S5CD 1LTID 5C3XA 5JEAH 5EBCA 1ET6A 3BS1A 1QE6A 5EQ0A 1YNND 2DY7A 1ET9A 4K6LA 5IOCA 4TRDA 4MN3A 1PTOH 1PDQA 3SVMA 1SEBD 2PW7A 2JA6B 2NWGA 1PRTC 2J4XA 4EVOA 4KN4C 4H44C 1G6ZA 2KCCA 2WP8J 3WOEA 4LAAA 2F0HA 1MD2D 1F2LA 4CKEA 2NN6G 4ZUJA 4C1NI 1LABA 1LT3D 4KN7C 3A8IE 2K1BA 3M7NA 2F0MA 2PNRC 1I50B 1PTOB 1TWFB 2F0SA 2YU9B 4RCOA 1LTTD 3DEOA 1VCIA 3ND8A 4CKBA 1WD0A 4F8MA 2WIIB 3KUPA 4FP5D 2B2UA 2L55A 2D62A 3OPOA 2LKVA 4KKSA 4EQPA 4BY7B 2QF7A 2R3ZA 1D1KA 5FK9C 1PFNA 1HQRD 3PUWA 2QEJC 1PMRA 4ABNA 5FKAC 1OXUA 4KV6A 2F3VA 2F0VA 2L1BA 3N6RA 2AUKA 3RMHA 1SNMA 2O5JC 4TKOB 4K5XA 1LTAD 4DAVA 4HCEA 1SNPA 1LO5D 2F3WA 5FLXE 4A93B 1BCPC 1TY2A 2J7ZA 1Z7TA 3DEPA 5G3LF 5IGGA 1EY4A 2A6HD 3UI2A 3EVQA 3VYRA 3HS0C 3T13A 2F0NA 1EYCA 2LY7A 2EY5A 3TP5A 1EU3A 1D5MC 1CTMA 5IT9E 1LT6D 1PLFA 3QB3A 1ZYRD 3CRKC 2M00A 5D3DA 1SE3A 1JC7A 2IX3A 3KK7A 3T51B 2RDGA 2JA7B 4KHZA 4WFN3 1FD7D 1BNZA 1Q3LA 5IGFA 3BYYB 1WTOA 3S9WA 3PMFA 3V05A 1A15A 5T1GA 1KNAA 2H4OA 1SJED 2F4IA 3K7AB 1AN8A 2RVLA 2N55A 2R61A 1V43A 3OSOA 4FF1A 1I3QB 2I46A 1PTOF 3RUZA 2K05A 3OIQA 1EU4A 1SNDA 1STAA 3NQTA 4R8NA 1AFPA 1PRTF 5BN4A 2ZXOA 2WAQB 1F2YA 2EYFA 2JEBI 1SMYD 2Q8TA 2EJGC 5CMDA 2ID0A 2PQEA 3OIPA 3EFXD 4L6TB 2E75C 1SNOA 1B44D 2FJ2A 1EQTA 3S1MB 3GV3A 2IL8A 1CFMA 1I6HB 3VR6A 3FVQA 1ENFA 3GTOB 2B2TA 2EYOA 4NKLA 2XRQD 2PPBC 3D6WA 5IODA 4XT1B 1ESFA 2B8GA 2CW0C 2KA7A 3HEJA 1TR5A 5I9OA 3GTQB 2PMZB 1GUGA 4K8IA 1S5ED 3Q24A 2IW3A 3E5SA 3CU7A 1F9QA 1LTGD 1BXTA 1U4LA 4A3KB 5CV8A 4YIJA 4CJ2C 5CC4A 1FYCA 4DU9A 2HCCA 3D4RA 1HA5A 4KY6A 4L8JA 2L5TA 4MHEA 1HUNA 3DWPA 4IUTA 1SE4A 1BF4A 2K6AA 4QF4A 1PFBA 2Z4HA 2KECA 1B50A 3DUZA 2KCNA 1NR2A 1TS2A 4I65A 3NSWA 2Q8RE 4P2CB 2O4XA 1I4GA 3GO5A 2EOTA 2A6ED 4ID6A 3PUZA 1GHJA 1Z6HA 4DNTB 4JBWA 1ENAA 2JSOA 3NXWA 1H9RA 4KD3A 2EJMA 5M3FB 4G7OC 5TSSA 3I4MB 2ENBA 4BWGB 4J8QA 1H9JA 3R8BA 3BDOA 2AQ3B 3HOZB 1GUWA 1V1OA 5A35A 2EYLA 4ZAIA 3T53B 4UAIA 1JR0D 2EYPA 2IX1A 3M4YA 1C4QA 1OXTA 2C9OA 4R8IA 4A3DB 1PZID 1CZWA 4EQNA 5HGTA 3J80E 4HSPA 4A3GB 2MPMA 1WTPA 4OO1G 5I9PA 2NN6I 3HP3A 3AMUA 1HCZA 1QB5D 1JQYD 1SYBA 3S14B 4X3SA 1AZPA 2ZXPA 2MJ8A 3PO3B 5KNCA 3CQZB 4FF3A 3FMCA 2BOSA 3IFTA 1E2ZA 4IZ8A 3IL8A 3GTGB 1EY0A 5LL6X 2EXZA 3F2UA 2SDFA 4NP5A 4RGMA 5CBEE 3NUCA 1ZYRC 4ZLTF 1STHA 2D2CC 3N52A 4L63B 2LMCB 3R3OA 5C0XI 1YNJC 1XX8A 4DAYA 4X3KA 3P20A 1U4RA 3VA5A 1QCBD 1D1IA 1F9PA 5IGCA 2XVSA 4ZUIA 1ZKOA 2RKSA 3V96A 4G57A 4XTCS 4C3HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9H A;  4XT1 B;  5AFW A;  4ZAI A;  1HFG A;  2MGS A;  2JYO A;  2NYZ D;  1WTR A;  3MTS A;  1CA5 A;  1G6Z A;  1G2T A;  3TN2 A;  1PLF A;  2KEE A;  4HCS A;  5D14 A;  1ZXT A;  4QUC A;  1JIC A;  1HHV A;  3QO2 A;  1EOT A;  1F2L A;  1S4Z A;  3Q6S A;  4IUR A;  4UAI A;  2H1E A;  1QNK A;  2DY8 A;  1G91 A;  1MGS A;  1VMP A;  4CJ0 B;  4LMQ D;  1WTQ A;  2X6G A;  5COY A;  2B2V A;  3I3C A;  2K1B A;  3P7J A;  4IUV A;  5JJZ A;  4U68 A;  5T1I A;  1RJT A;  2KOL A;  1BNZ A;  2K01 A;  1Q3L A;  4X3U A;  1F9Q A;  1KNE A;  5E4W C;  1TVX A;  1WD1 A;  5EPJ A;  4XDX A;  1U4L A;  1HFN A;  1WTO A;  1B2T A;  4R8I A;  2B2Y A;  2FHT A;  3MWY W;  5EPK A;  5CBA E;  3GV6 A;  3DEO A;  1DOK A;  1DOL A;  1A15 A;  4HSV A;  1MSH A;  2K03 A;  2HUG A;  2MPM A;  2NZ1 D;  3H91 A;  5T1G A;  4CJ2 C;  2K28 A;  1RTN A;  2N88 A;  3HP3 A;  5EPL A;  1WTP A;  2FIN B;  1HUM A;  4O42 A;  2L12 A;  3I90 A;  1WD0 A;  1SAP A;  5EJW A;  1KNA A;  2HCC A;  2B2U C;  1M8A A;  3KUP A;  1O7Z A;  3KBX A;  2HCI A;  2B2U A;  1NCV A;  1MI2 A;  2RVL A;  4ZK9 B;  1ILQ A;  1ML0 D;  4QUF A;  1U4P A;  1HRJ A;  2B2Y C;  2N55 A;  2L4N A;  1B53 A;  1JE4 A;  1VMC A;  3I91 A;  4ZKB B;  1X3Q A;  4HED A;  1WTV A;  4X3S A;  1AZP A;  4MHE A;  1HUN A;  1F9R A;  1SDF A;  1DOM A;  4XT3 B;  4IUT A;  3R93 A;  1WTX A;  1MSG A;  1BF4 A;  2R3Z A;  1J9O A;  1EIH A;  2MJ8 A;  3DM1 A;  1PFN A;  2KED A;  1PFB A;  2B2V C;  1B4O A;  1PFM A;  2M2L A;  2FMM A;  1NR4 A;  3ONA B;  2K05 A;  2KEC A;  5DNF A;  5COR A;  1B50 A;  1X3P A;  1NR2 A;  2RA4 A;  1IKM A;  4R9W A;  3TZD A;  1QG7 A;  4CJ1 B;  2HDM A;  4OIJ A;  1CA6 A;  1AZQ A;  1O7Y A;  2Q8R E;  5E4X A;  4RA8 A;  2L1B A;  1WTW A;  3IL8 A;  1B3A A;  2EOT A;  5EKI A;  4ZKC B;  1O80 A;  3I8Z A;  1EL0 A;  2JP1 A;  2CVR A;  3LWE A;  1ROD A;  3F2U A;  1U4M A;  2SDF A;  1WVL A;  2Q8T A;  1BO0 A;  2X69 A;  5CBE E;  5CMD A;  2L11 A;  2K04 A;  2KUM A;  4ZLT F;  1RTO A;  1X32 A;  2HDL A;  1F9S A;  1CM9 A;  3N52 A;  1DZ1 A;  1ICW A;  2RSO A;  2RSN A;  1EIG A;  1J8I A;  1DON A;  3FPU B;  4HAE A;  1SSO A;  2KVM A;  3IFD A;  1QE6 A;  4RAU C;  4RWS C;  2B2W A;  2EPB A;  5EQ0 A;  4OIK A;  1ESR A;  1XX8 A;  3G7L A;  1BBX C;  1IKL A;  2FJ2 A;  4IUP A;  4X3K A;  2BDN A;  1EQT A;  1AP0 A;  2MP1 A;  3GV3 A;  2IL8 A;  1HA6 A;  1U4R A;  2DY7 A;  1E0B A;  2J7Z A;  2B2W C;  3DEP A;  4IUU A;  4X3T A;  1F9P A;  1LV9 A;  2X6L A;  4MN3 A;  3UI2 A;  1ILP A;  1PDQ A;  3FDT A;  5D65 A;  2EE1 A;  4DN4 M;  1IL8 A;  2B2T A;  3SVM A;  2D9U A;  1RHP A;  2FFK B;  2VXW A;  2B2T C;  1GUW A;  1C8C A;  1XYI A;  2XIW A;  1G2S A;  4IUQ A;  1NAP A;  3D6W A;  2NWG A;  4NW2 A; 
#chains in the Genus database with same CATH topology
 4LF4 Q;  1EFI D;  2NYZ D;  2N8N A;  1BR9 A;  1TQO A;  4DR6 Q;  2NTT A;  3S16 H;  1IW7 C;  2AQ1 B;  1ZXT A;  4A3K H;  2Z8L A;  4LF8 Q;  4BBS B;  3HKZ B;  3QO2 A;  1Q1B A;  4A3B H;  5LMN Q;  1BKB A;  1PZK D;  3TZU A;  4ME3 A;  4P75 A;  3WDN A;  3J81 c;  1LTS D;  2QDL A;  3GTO H;  3B6Y A;  1QZH A;  3J81 E;  1RJT A;  5IWA L;  4JYA Q;  3CAM A;  4Q0F A;  1I4Q A;  4XDX A;  4DR5 L;  5IP7 G;  2ASB A;  4C3H G;  3GV6 A;  2NB0 A;  1DOK A;  4HSV A;  4BXX H;  2HQE A;  5EPL A;  3OW7 A;  5IP7 H;  3KBX A;  1CQF A;  5C3E B;  1CKN A;  1MI2 A;  1G51 A;  1ML0 D;  1U4P A;  3KBG A;  4GLX A;  1WCM G;  1X3Q A;  3H0G B;  4CDE C;  4HJ7 A;  2OTL A;  4K2L A;  1Y8O B;  1EIH A;  1J9O A;  4MTN A;  3DM3 A;  1CSQ A;  4IFD I;  3SK6 A;  3DWQ A;  4XQN A;  1H9S A;  1KD1 C;  2M2L A;  3ONA B;  1PH9 A;  3SK8 A;  3T1H Q;  3HOU H;  1EYG A;  1KRT A;  1CA6 A;  3GTP B;  1JOO A;  1T5E A;  4BS9 A;  4FNF A;  3RZD B;  3DXJ C;  3K5L A;  3J7A V;  3BVZ A;  1X6O A;  3EBE A;  5M3F H;  1SYC A;  2R93 G;  1JWU D;  5ISR A;  4OO1 H;  1EL0 A;  3LWE A;  3BDL A;  3X3M A;  4A3F G;  4DR1 L;  2XRS D;  2X69 A;  2QIL A;  5K36 G;  1EEI D;  4DK1 A;  2DNC A;  5KIX A;  1A6X A;  4DUZ L;  3RLF A;  1HTL D;  1H9K A;  1J8I A;  4RAU C;  2Z4I A;  1N36 L;  1KLG D;  4A3C H;  2KBN A;  2ZTE A;  4WJW A;  1PHJ A;  1HA6 A;  2ZJP A;  4K2K A;  1V8Q A;  5HY6 A;  3FPP A;  1LV9 A;  4UHV A;  1LT5 D;  5CV5 A;  2QKI C;  2K7V A;  2ES2 A;  3FDT A;  4X66 L;  1BUV T;  1W6K A;  3NWT A;  1K8M A;  1EQV A;  3MXG A;  4G7Z C;  4F87 A;  1QOH A;  1XYI A;  2PMZ E;  1VF7 A;  3QJY A;  2JQO A;  2RCF A;  4DR4 Q;  2F0I A;  3TRE A;  5D14 A;  1MJC A;  3P1H A;  3S1R B;  5JOB A;  1S4Z A;  2VL6 A;  3F2B A;  4A3M G;  1UEA B;  2ICI A;  4Y52 H;  4PMW A;  1G91 A;  1A0I A;  4RHR A;  5C4J B;  3HOX G;  3S1N B;  3P7J A;  3U50 C;  1FNV A;  2SOB A;  3EN2 A;  2H5X A;  1SMX A;  2UU9 L;  4BY7 H;  2CQO A;  1Y8P B;  1HFN A;  2FHT A;  2E5L L;  2NZH A;  3O13 A;  4R4T A;  3C2P A;  1SYE A;  1Y1V B;  3SXH A;  4A3M B;  4K8J A;  3GP7 A;  1SE2 A;  1OXX K;  3E3X A;  4QUF A;  3A55 A;  1GJX A;  4KJN A;  1Y8N B;  1VMC A;  2EQS A;  4KKT A;  4ZKB B;  3PIO 3;  1HJP A;  3EJI A;  1XNQ Q;  2AKW B;  4DF7 A;  2KED A;  4C3J B;  4K14 A;  4LF5 Q;  1K73 C;  3GQB A;  2B63 H;  4LF5 L;  2N3S A;  3Q8D A;  2QCP X;  4OEM B;  3NK9 A;  1AEX A;  1XPO A;  3HOU G;  2V4D A;  4KKU A;  3ULP A;  4OIJ A;  1CKN B;  4PZ7 A;  5E4X A;  3U4Z A;  5KND A;  1WFQ A;  3FKI G;  1F2Z A;  2CH4 A;  2GVB A;  1O80 A;  3OTO Q;  4HTH A;  3LNN A;  5I2Y A;  3U58 A;  3CC7 A;  1X32 A;  3CQZ H;  1UUP A;  1YIT A;  5M5X H;  3MVV A;  5C5M A;  4C3J G;  3NPP A;  2Z0S A;  4G7H C;  3H3V H;  4HR7 B;  2MFI A;  5I4D A;  5IP9 H;  3J80 L;  4JI5 Q;  4V19 0;  1BCP D;  4WOR A;  2CW0 D;  2K5N A;  3FEW X;  1PA6 A;  3G4S A;  1TWH H;  2AWO A;  3JAM E;  1ILP A;  5HUR A;  2SEB D;  3NWS A;  2I0Q A;  1GVP A;  2DNE A;  5FO8 B;  3PO3 G;  4DK3 C;  2F0G A;  2VNU D;  3HFZ B;  4IUQ A;  1EY8 A;  3T4A C;  2ZTC A;  1SXT A;  2ICE C;  1STN A;  3MTS A;  4YCU A;  3HKZ E;  1ICF B;  1D8L A;  3G48 A;  4JPB W;  2BA1 A;  4KD4 A;  4QUC A;  3BG3 A;  5IYB G;  1EY5 A;  1QNK A;  3G6E A;  1G29 1;  2K5V A;  3BZD B;  4DR2 Q;  3CCS A;  1XNR Q;  2OF1 A;  2NBF A;  4LF7 L;  3QOL A;  5ELO A;  3HOY G;  3CCJ A;  4YHH L;  1YHA A;  5T1I A;  5GAH C;  5C44 G;  1JJG A;  4RKL A;  3EQL C;  1YVC A;  4O1N A;  1HZC A;  5IIF A;  4KJO A;  2VUM H;  1BVS A;  4RG1 A;  3HOZ H;  1NNX A;  4FXG C;  1FR3 A;  2B2Y A;  1PXU A;  3MWY W;  1ENC A;  1PYS B;  2K03 A;  1VQK A;  2NZ1 D;  3J81 L;  4ZYS A;  1CT1 D;  1L0X B;  2A19 A;  3CRL C;  4LW1 A;  4BBS G;  5JJL A;  4K0K Q;  1BCP F;  4ILW A;  1V1P B;  4AIM A;  1KQS A;  3R93 A;  5C0X G;  4FF2 A;  5IGD A;  1RIP A;  1I3Q H;  3CP0 A;  2NVT B;  4A3I B;  3PCO B;  3CMA A;  3A5U A;  5ELN A;  3TP8 A;  5JEA J;  3TEH B;  2RA4 A;  4FXD A;  4BY1 B;  1EWH A;  3R2T A;  4IFD H;  2HDM A;  4PG3 A;  1O7Y A;  3EA6 A;  4AYB G;  1SR3 A;  4PV1 C;  3PF5 A;  1AH9 A;  4LF8 L;  4JV5 Q;  1BCP B;  1TWF H;  1RL2 A;  1YI2 A;  1IBM Q;  1A3U A;  1E2W A;  1DXM A;  2JXM B;  2ZM6 L;  4CDD C;  4LWC A;  4JVZ A;  3C46 A;  4KHP L;  5JAV A;  1LTB D;  1CK1 A;  2A69 C;  3K0Y A;  3F8T A;  3HOV G;  3I4N G;  4DR5 Q;  3VR2 A;  1S5D D;  5I6Y A;  2WAC A;  1A3V A;  1JT8 A;  4BBR G;  2B2W C;  3ULL A;  1Z47 A;  3MXP A;  1Y1W H;  1YJ9 A;  1PH2 A;  3HG9 A;  1FNU A;  1QIL A;  5D65 A;  2JEA I;  3E9I A;  4K5W A;  2R93 B;  3SGI A;  4JI7 Q;  2KHI A;  2WB1 E;  1UE7 A;  1M4V A;  5CYU A;  3RD4 A;  1NAP A;  1G2T A;  2GN5 A;  1HZ9 A;  1WTR A;  2RDH A;  3S15 B;  1N33 L;  1STB A;  4HMI A;  4B3R L;  2DUD A;  2DJG C;  2JJQ A;  4PQX A;  2Y0S E;  3BVM A;  4IUR A;  3GTM B;  1B1Z A;  3NE5 B;  4NXM L;  5NUC A;  5GAD C;  1VQJ A;  1K0S A;  4XYO A;  3CW2 C;  2XSC A;  3I7F A;  4U68 A;  1X3F A;  1I4R A;  2GVA A;  4NDX A;  1KNE A;  4H02 A;  4HMJ A;  4B3T Q;  1X3G A;  2QW7 A;  1K83 H;  1KDC A;  2E76 C;  1SNQ A;  5FO7 B;  1W6J A;  2B29 A;  2R7D A;  2HUG A;  4KY5 A;  2FIN B;  4FF4 A;  3HOV H;  3I4N H;  2C5C A;  3PIP 3;  3F1Z A;  4FO2 A;  4DV4 Q;  3ULJ A;  2F4V Q;  4A3B B;  4JI1 L;  2VQF L;  3CCL A;  3I56 A;  3HOX B;  3J7A F;  1XXG A;  2OTJ A;  2F0D A;  1Z9F A;  1WTX A;  3TS2 A;  1EZ6 A;  1EIF A;  2PYK A;  4DUZ Q;  1TT2 A;  2WV6 D;  4G4K A;  1EIY B;  4POF A;  1HXY D;  3OYY A;  5BN3 A;  1X3P A;  1X3E A;  5GAE C;  4AQY L;  5CV7 A;  3TZD A;  2CWA A;  4DV6 Q;  5IP9 G;  5JPN C;  4DR2 L;  2LXJ A;  5I2X A;  1N34 Q;  3T16 A;  2EXD A;  4X65 L;  3H6M A;  5FOB B;  4LF4 L;  4ZRZ A;  4QJF A;  3HGB A;  1VQE A;  2R6G A;  5C0X H;  1ROD A;  1GUT A;  3VR3 A;  2UXD L;  3IKJ A;  5E3F A;  3H0G H;  3SK5 A;  1ASZ A;  5FJ8 G;  1P16 A;  4EX5 A;  2PI2 A;  4LUO A;  4A3L G;  2BE5 C;  2NUC A;  1R9T B;  1EIG A;  1A3T A;  4QQB X;  4IOA A;  2EPB A;  1KLU D;  3G7L A;  2E2H H;  2JA8 G;  1VQ4 A;  3HOU B;  5CGK A;  4JC0 A;  4R4C A;  4DXF A;  4PZ6 A;  1EYA A;  4JI5 L;  3L7Z C;  3KDF B;  4Y7N B;  3W1G A;  3UE0 A;  2FFK B;  4GKJ L;  4UP9 A;  3D0F A;  3GTL B;  1C8C A;  3JAM i;  3HOY H;  1L1O C;  5DEH A;  3HOW H;  1JJ2 A;  1YIJ A;  2KEE A;  4HCS A;  3V2T A;  1Y14 B;  1O78 A;  4JYA L;  5H1S E;  5A2Q E;  4DV3 L;  1KDB A;  1EWC A;  5ELE A;  4DUY L;  1VMP A;  4CJ0 B;  3OWF A;  2UXB Q;  4IUV A;  3E6Z X;  4RGN A;  1LYL A;  4KI0 A;  4PMC A;  3S14 H;  3MZ5 A;  2O2L D;  3M3Y H;  4A3L H;  2F52 A;  2E2D C;  4DAP A;  1S3O A;  5EPK A;  4IOC A;  3CKI B;  1EY7 A;  1H95 A;  1HUM A;  4XYQ A;  4CDF C;  4X62 L;  1U9R A;  1VQG A;  3S1R H;  1O7Z A;  2HT1 A;  4HN7 A;  1S40 A;  2HIV A;  4A3E G;  4A3J H;  3MAQ A;  1EOV A;  3JAM L;  2YTY A;  2PCF B;  2V1C C;  2VB3 X;  1PRT D;  1IYV A;  2JA9 A;  4R4O A;  3K81 C;  5C4J H;  3WWV A;  1WTV A;  1F9R A;  1PFS A;  1MSG A;  1AW7 A;  2F0W A;  1DM0 B;  2K33 A;  3A56 A;  4FVM A;  4C56 C;  3M3Y B;  3K7U C;  2M9V A;  4DFA A;  4DR3 Q;  4IAL A;  4EGV A;  3SHL A;  3D31 A;  1JWS D;  5M9O A;  4NMZ A;  4RA8 A;  2B63 G;  4LFB Q;  3PGZ A;  1VDZ A;  1N9W A;  2A6E C;  1RD9 D;  4A3J B;  2CWP A;  1N34 L;  3E9H A;  1DD2 A;  4UP7 A;  1PRT B;  4B08 A;  4GOP B;  2Z6K C;  1STG A;  3MXN A;  1VF5 C;  2OQK A;  2E74 C;  3HOY B;  4HAE A;  4X66 Q;  1GO3 E;  3NQI A;  1ESR A;  1I4H A;  1XTD A;  5J22 A;  1H9M A;  2CQA A;  3ERO A;  5C6A A;  1GUO A;  1E0B A;  1ZEQ X;  4RKB A;  2NVQ B;  1DCZ A;  1K8O A;  1OXV A;  4DV6 L;  4K0K L;  2EY6 A;  1WYD A;  3K58 A;  1PH3 A;  5LMU L;  1YJN A;  1NMF A;  2Z6K A;  4JBM A;  2Q8I B;  4S3S A;  4KHV A;  2A5H A;  5FLX c;  5A2Q L;  2RCN A;  2EYJ A;  1STY A;  2EZV A;  4QIW B;  3K5N A;  3S16 B;  1WCM B;  3H0G G;  1GD7 A;  1BDO A;  2JA7 H;  1IYU A;  5COY A;  3K59 A;  1TWH B;  1U0L A;  1SRU A;  1JOQ A;  2KOL A;  2UXD Q;  4B3M L;  4TVA B;  2DJF C;  1KDA A;  4R4I A;  3OHX C;  3NTI A;  1TVX A;  5E4W C;  4LF6 Q;  5EPJ A;  4JV5 L;  5C4H A;  3S15 H;  2NTS A;  3A7L A;  1B2T A;  4DV1 Q;  2SNS A;  1KTK A;  2MNA A;  1D6E C;  3VR5 A;  1O7L A;  3NTH A;  2Y0S G;  2N88 A;  4JI7 L;  1QNU A;  1KAB A;  2L12 A;  1X9N A;  3AB9 A;  1L2F A;  1M8A A;  2VB2 X;  1UE1 A;  2E2J H;  1PTO C;  2FMC A;  3G71 A;  4A3E B;  4DR1 Q;  1X55 A;  4N8X 1;  1SDF A;  4XT3 B;  1Q12 A;  1JWM D;  2BDO A;  2MQH A;  1K83 B;  3RN5 A;  2VY3 A;  4OL7 A;  4K5V A;  2B2V C;  2JA6 H;  3RLN A;  5JJK A;  5J3B A;  3AYH B;  1XNR L;  3TBI B;  5IYD G;  1JB3 A;  1MKH A;  4N8F A;  5CV4 A;  1GUN A;  3PO2 H;  4C3I G;  3GD7 A;  1II3 A;  2ZTD A;  4F7X A;  2IT1 A;  1B3A A;  5EKI A;  2AWN A;  5FLX L;  3I8Z A;  4YWK A;  5IYD H;  1B9N A;  4OWX B;  3L9A X;  2CHB D;  3PUX A;  1GHK A;  1BO0 A;  1YHQ A;  4JI1 Q;  2KJX A;  4DV5 L;  3FPU B;  2KVM A;  1ONL A;  4LJZ C;  2ALY B;  4QIW E;  1O7I A;  1OXS C;  3D4D A;  1AP0 A;  1LTL A;  2K5Q A;  2PZT A;  2XNA C;  5F2D A;  1W3S A;  4HJA A;  1XMQ Q;  2Q2I A;  5DM7 3;  4LFC Q;  3PO2 B;  4WJ4 A;  3FKI B;  1IL8 A;  2JA8 B;  2F0E A;  2F1M A;  1S5B D;  2VS1 A;  2EDG A;  4M8A A;  5M3M B;  3CCE A;  1Y1V G;  4HJ8 A;  2XIW A;  3D6C A;  4K6D A;  4AYB B;  1CA5 A;  2NN6 H;  3NEM A;  3A0J A;  4KMU C;  2PZW A;  2E2I B;  1PH6 A;  1LM0 A;  1NY4 A;  3Q6S A;  3RZD H;  1L1O B;  1MGS A;  1SMY C;  2RQX A;  4O0A A;  2JA7 G;  4LMQ D;  2G9D A;  3A74 A;  4IO9 A;  5BN5 A;  1RKN A;  5KGU A;  2A68 D;  3GTJ B;  3BVG A;  4ZCK A;  3MHB A;  5FO9 B;  1FNW A;  3U9O A;  4X3U A;  4JI2 L;  1CZG A;  2VQE L;  1SLJ A;  3TS0 A;  1TU2 B;  4L5Q A;  3GDE A;  2IX0 A;  3LX0 A;  4LF9 Q;  3H15 A;  1MSH A;  2R7F A;  4LUV A;  1QWY A;  2L15 A;  3I2Z A;  1PH4 A;  2E2I H;  1RCV D;  4J1M A;  4JI6 L;  4UY8 C;  4ZK9 B;  4OX9 L;  5LMU Q;  4E6I A;  2XWJ B;  5C5L A;  5C44 B;  2EY2 A;  3BYT B;  3A54 A;  1OO9 B;  4IJH A;  1SNC A;  2GA4 B;  2I07 B;  3BU2 A;  4JOI A;  5E1F A;  3Q23 A;  3H3V I;  3QG1 A;  2A73 B;  1C48 A;  2G9H D;  3IRB A;  5IYB H;  4BA2 I;  1SJH D;  1B4O A;  1E1O A;  1C7Y A;  4DKA C;  4IJL A;  4XQJ A;  2LS0 1;  3NBH A;  4R9W A;  1YNJ D;  3I4M G;  3M7G A;  1I4X A;  1WTW A;  5ELC A;  4CHT B;  2IJ0 A;  5ELF A;  1E3P A;  3UDF A;  1TKW B;  2F0F A;  1PTO D;  2L11 A;  5M5W B;  3TSS A;  4BA1 I;  3VA7 A;  1RTO A;  2ZXR A;  1H9S B;  3KF6 A;  4P74 A;  4NXN Q;  2F0U A;  2JE6 I;  4C1N K;  1D2B A;  1VQB A;  4OIK A;  4I7Z C;  5JVH 3;  3CHB D;  5KNB A;  2F0O A;  4RH6 A;  4IUU A;  1B9M A;  4X3T A;  2X6L A;  5IGE A;  4CDC C;  2PNH A;  4DAM A;  3I4M H;  5L37 A;  3R2I A;  2EE1 A;  1XPR A;  2QEX A;  5LL6 S;  1JOR A;  2VXW A;  2B2T C;  4NXN L;  1BQQ T;  3TRZ A;  4F88 A;  4C3I H;  3K8A A;  3SE0 A;  4GKK Q;  4NW2 A;  2MGS A;  2JYO A;  2QA4 A;  3NHH A;  1SYD A;  5GAG C;  2WIN B;  4ULL A;  2K75 A;  1JMC A;  3G6J B;  5LMN W;  1S72 A;  1JIC A;  3SDZ A;  1EOT A;  4GOP A;  4A93 G;  3URY A;  4JI3 L;  1CQV A;  1K9M C;  1W2B A;  3GTP H;  3TP7 A;  2CFM A;  2JN4 A;  3L3O C;  1I94 L;  5EKK A;  2YU9 H;  4CKC A;  4KTA A;  5C44 H;  5IT9 c;  4N9P A;  3QOJ A;  1HQM C;  2K50 A;  5K36 H;  2ZJQ A;  3JAM c;  3NEN A;  4YCW A;  2K28 A;  1RTN A;  2EY1 A;  4IN3 A;  1NUC A;  1SAP A;  1KL9 A;  3Q22 A;  4OEL B;  3TME A;  3K5O A;  4UPA A;  4GKJ Q;  2AUJ D;  4OWT B;  4DAY B;  4OHJ A;  5JPM C;  2Z1C A;  5IT9 L;  3OMG A;  3DM1 A;  4POG A;  3HKZ G;  4O2D A;  3S2D B;  1KXL A;  1XMO L;  3TQY A;  4JI2 Q;  2A8V A;  1PFM A;  2PO4 A;  5LHY 1;  2E2H B;  3KLW A;  1GOZ A;  3I55 A;  3F2D A;  1CHQ D;  1DGS A;  2MHV A;  1K28 A;  1IKM A;  1GUS A;  3KFU A;  1AZQ A;  3C1F A;  1K8A C;  4TSS A;  1LAC A;  1Q8I A;  3A8J E;  1K8G A;  3AQQ A;  3BDC A;  4UP8 A;  4LNQ A;  1LLR D;  2HD3 A;  1R9T H;  2TSS A;  1TWC B;  2PI2 E;  1UAP A;  2MUY A;  1EQQ A;  4IQZ A;  2OT2 A;  4GNX B;  4A3D G;  1DZ1 A;  1ICW A;  3IFD A;  2EYH A;  5LMN L;  5KYI A;  4L5R C;  4RGO S;  2Y0S B;  3AU7 A;  1R4Q B;  4IUP A;  1V1Q A;  3VYU A;  4DR7 L;  1PYW D;  3A7A B;  4PNY A;  2XWB B;  3AFP A;  2B39 A;  4A3B G;  4KHP Q;  1TY0 A;  1UE6 A;  4DV7 L;  2JA5 G;  3W1B A;  4HIO A;  2UUA Q;  4HIM A;  4FYD A;  1GKH A;  5EKL A;  1N32 L;  4JI0 Q;  4X62 Q;  2MO1 A;  4JI0 L;  2NVT H;  2O5I C;  3WOF A;  3VYS A;  3ITP A;  1YNN C;  1QUQ A;  4GN5 A;  3TN2 A;  1Q90 A;  2RDF A;  3K57 A;  4DR7 Q;  3DHQ A;  4GN3 B;  3QR8 A;  1VQD A;  3A5Z B;  1EY9 A;  1IBL L;  4GLA C;  3K5M A;  4GLV B;  1L0W A;  2B2V A;  1EUJ A;  1Q7Y C;  3W2D A;  4YHH Q;  1SE8 A;  4DV0 L;  5JJZ A;  3L0O A;  1XMQ L;  2CH4 W;  1A2U A;  4BBR B;  2KEN A;  3T1Y L;  5D3I B;  4XIG S;  3NTK A;  5M5X B;  4MTK A;  3RNU A;  3K6O A;  4V0B A;  5GRO A;  3DMU A;  1A2T A;  1TS5 A;  1PZJ D;  1EY6 A;  2G5D A;  4A3G G;  2F4V L;  4IPC A;  1I4P A;  4YY3 Q;  4RFB A;  2A6H C;  4BXX G;  1NJI C;  2D5D A;  5JVG 3;  2YYZ A;  4GNX C;  1RDP D;  1XPU A;  4KY7 A;  3RR5 A;  3S2H H;  1XJV A;  3STB D;  1Y1W B;  1YBY A;  1Q1E A;  5HGQ A;  4N9T A;  3Q0A A;  1HRJ A;  4OO1 I;  3VYT A;  4P72 A;  2L4N A;  3MA2 B;  5DM6 3;  1IBK L;  1JE4 A;  2K5W A;  2N78 A;  3ZYY X;  1E7Z A;  3DLL A;  2R92 B;  1DOM A;  3UDI A;  2EJF C;  5GQO A;  2B63 B;  3QIA A;  4YWL A;  1TS4 A;  5ELB A;  4HID A;  2K5D A;  5J39 A;  3CD6 A;  5DLQ E;  5G3L D;  1CSP A;  3DWA A;  4DNR B;  2EVB A;  1SFO B;  1SYF A;  2WAQ E;  4A3C G;  2LSS A;  1UE5 A;  5AJ3 L;  5CV9 A;  5IYC G;  1JB7 A;  1IHZ A;  4H13 C;  2JP1 A;  5KYL A;  4GZY C;  1WVL A;  2K04 A;  2KUM A;  2HDL A;  1CM9 A;  1HNZ L;  3JC6 6;  2OXP A;  2Q2U A;  4A3I G;  1STE A;  2RSN A;  1D5X C;  3P75 A;  3OWE B;  2A68 C;  3W3A A;  4CGY B;  2F0L A;  1QJO A;  2NVX H;  5BR8 L;  1G8Z D;  3H3V C;  4LK1 C;  3I72 A;  2JA5 B;  4DN4 M;  2R7Z G;  3PIO A;  1KAW A;  1JOK A;  3MXN B;  2QDB A;  4EQO A;  2I5M X;  3ER0 A;  3MFG A;  3M4Q A;  3TDQ A;  4MIU A;  3KF8 B;  1EWI A;  1G2S A;  4BBR H;  3OMC A;  3J7Y W;  4DUY Q;  1HNW Q;  5AFW A;  1V9P A;  4KK7 A;  4QCL A;  4U67 3;  2WKD A;  4UDU C;  2KHS A;  1EYD A;  1HPC A;  3OOC A;  4MZ9 A;  2H1E A;  2DY8 A;  3J81 j;  4QGU A;  1Q82 C;  4ODG A;  4RCN A;  4AYB E;  4EQ5 A;  2RF4 A;  2PZU A;  4A3J G;  1Q81 C;  1VQM A;  2R7Z B;  1NMG A;  4FDB A;  3QWN A;  5C0X J;  2UUA L;  3RZO B;  4XXE A;  2LFN A;  4OXP A;  4B3R Q;  1KRS A;  1WD1 A;  1DJR D;  4WRD A;  3K80 C;  3ND9 A;  1P8L A;  3I4O A;  1TWA B;  4O42 A;  2FXQ A;  3H09 A;  5EJW A;  5M3M G;  4B3S Q;  2HCI A;  4B3S L;  1XTC D;  4RGT A;  2ATW A;  1ILQ A;  2SNM A;  2F0T A;  1B53 A;  4Y7N H;  3S1Q B;  3I91 A;  3HRZ C;  4JCV E;  1YEZ A;  2K14 A;  2K52 A;  1Y69 U;  3GTL H;  4X6A H;  3S17 B;  4IFD J;  2R93 H;  2A74 C;  5EGT A;  1TWC H;  1CKM A;  3CCQ A;  3KLS A;  3MXU A;  5COR A;  1K3R A;  5CV6 A;  1J5E L;  5C4Z A;  1CI3 M;  1UNS A;  1IL2 A;  1SBB B;  2A69 D;  1FJG L;  4CJ1 B;  2PQA A;  1EZ8 A;  4DXG A;  1PH8 A;  2F0K A;  5C4X B;  4ZKC B;  2UUC L;  1KIX A;  3C3L A;  1LTR D;  2Z6B A;  4QB4 A;  1PH1 A;  4A4I A;  5IGB A;  2EYM A;  1VQF A;  4J6H A;  3TP6 A;  5FLM G;  3PUV A;  1D7Q A;  5C3E G;  1F9S A;  3BZC A;  1PYB A;  2RSO A;  4YY3 L;  4RWS C;  1SSO A;  3NP8 A;  4A3D H;  5FJ8 H;  1BBX C;  3M4O B;  3KF8 A;  2MP1 A;  2ZJR A;  2J0T D;  5KRU A;  4RHS A;  3J7Z C;  1L1O A;  4CBV A;  1JE5 A;  4C2M B;  1KAA A;  1EEF D;  4IPH A;  3UE1 A;  4I7A A;  3M85 A;  2B8F A;  1GXD C;  2D9U A;  3H94 A;  2F0Q A;  4PMB A;  2E5L Q;  3CME A;  3E0E A;  2L9H A;  3PO3 H;  2EIF A;  1VQI A;  1RF2 D;  4OGQ C;  3ZJY C;  3FRP B;  2VQE Q;  2RBM A;  4OON A;  3KLS X;  5KEE A;  3KJP A;  4B3M Q;  1KHI A;  1DYQ A;  1NE3 A;  4LF6 L;  3I70 A;  3MC0 B;  5M5Y B;  3S2H B;  1WTQ A;  1X56 A;  2E2J B;  3I3C A;  3I4L A;  2YV5 A;  1Q86 C;  4IFD G;  1BOS A;  2DN8 A;  1V1P A;  4Z9C B;  1MIU A;  1D5Z C;  3CCU A;  3LWU A;  2KQ3 A;  1I6V C;  5ELD A;  5J1Z A;  3I73 A;  1L0Y B;  2VUM B;  5FLM H;  4C3I B;  1DOL A;  1SN8 A;  3T56 B;  5EBD A;  4BY1 G;  1VQP A;  3H91 A;  3I4N B;  3HOV B;  3I90 A;  4JK1 C;  2OCE A;  1HTP A;  1BBU A;  1C9O A;  1A8V A;  1JCK B;  2WKC A;  4IUN A;  3SR1 A;  1NCV A;  3PO2 G;  3E0J A;  1F77 A;  3PV0 A;  1G6P A;  2AQ2 B;  3HKS A;  1KC8 C;  3X3N A;  2JA6 G;  4HJ5 A;  4DV0 Q;  2FMM A;  1NR4 A;  1TS3 A;  4WJ3 M;  4AH6 A;  2WB1 B;  3PQI A;  3ERQ A;  2UXB L;  3HZX A;  3PF4 A;  4JG2 A;  4TQU S;  4A3F B;  2MO0 A;  4H0L C;  1I94 Q;  1HR0 W;  2K32 A;  1QG7 A;  3D4W A;  3M4O H;  3L2P A;  3VR4 A;  3MEH A;  1NSN S;  2NVX B;  4DGZ A;  5I6W A;  4JW0 A;  4QY7 A;  2CVR A;  2D0P A;  1U4M A;  1PH5 A;  4XQQ A;  4FXK C;  2F0P A;  4DK0 A;  3C1E A;  1C0A A;  1DON A;  2NVY B;  1SYG A;  2B2W A;  1Q8K A;  4B9W A;  1Y1V H;  5CR3 A;  1XWE A;  4M1U B;  1SFO H;  2L0C A;  1IKL A;  2BDN A;  2F0J A;  1A62 A;  4A3E H;  4IPD A;  1MJE A;  3U9S A;  3PUY A;  2F03 A;  2R92 H;  5C3W A;  2PW5 A;  1RHP A;  1T5X D;  1M90 C;  2BCO A;  1VQ8 A;  1HZB A;  3SEB A;  4P71 A;  1FGB D;  3GTK B;  1TII D;  1R4P B;  3HOW B;  1HFG A;  3STB C;  4MNO A;  2YTX A;  2RHS B;  2BH2 A;  4BBS H;  4Q5V A;  1F2M A;  4APV A;  1HHV A;  2YTV A;  1FGU A;  1ASY A;  2ZT9 C;  2X6G A;  4PZ8 A;  1E2V A;  5DAU A;  2WAQ G;  2BE5 D;  1TWG B;  2IPK D;  2K01 A;  3J80 i;  3SK4 A;  1E22 A;  4ZQ3 A;  3MFY A;  2IWH A;  1MBY A;  5CBA E;  3A8K E;  1S5F D;  4B9X A;  2IHE A;  3KLR A;  4A3F H;  5K5P A;  3CC4 A;  3D3R A;  2BA0 A;  2C35 B;  3IAY A;  4OX9 Q;  2OEO A;  4IPG A;  5IE8 A;  1HR0 Q;  1WTH A;  1N32 Q;  2B2U C;  2K4K A;  4ME5 A;  2XGT A;  4OWW B;  1CHP D;  1I6H H;  2B2Y C;  5BR8 Q;  1VQ9 A;  4HED A;  4LUZ A;  1IBM L;  5E7N A;  3HOX H;  1IW7 D;  3S2D H;  1X54 A;  4QMG A;  3KYH C;  1LUZ A;  2TMP A;  3S24 A;  5DNF A;  1YHB A;  5JEA G;  1NBW A;  4H7B A;  3KF6 B;  4JI8 Q;  1K3B C;  3NBI A;  3GTQ H;  2XN9 C;  1LT4 D;  1QVG A;  1WI5 A;  3RN2 A;  3D8G A;  3S17 H;  3RZO H;  4C2M H;  1S5C D;  1LTI D;  4DA2 A;  1FVI A;  5C3X A;  5JEA H;  5EBC A;  1N8R C;  1ET6 A;  3K0X A;  3BS1 A;  1IBL Q;  1QE6 A;  1SRO A;  5EQ0 A;  1YNN D;  2DY7 A;  2OQ0 A;  1ET9 A;  4K6L A;  5IOC A;  4TRD A;  4MN3 A;  4R1J A;  1PTO H;  1PDQ A;  5EAY A;  2VQF Q;  3SVM A;  4DV5 Q;  1SEB D;  2PW7 A;  2JA6 B;  2NWG A;  1PRT C;  2J4X A;  4EVO A;  4KN4 C;  4BY1 H;  4H44 C;  1G6Z A;  2KCC A;  2WP8 J;  1MHW C;  3WOE A;  1PV4 A;  4LAA A;  3S1M H;  2F0H A;  1MD2 D;  1F2L A;  4CKE A;  2NN6 G;  4ZUJ A;  4C1N I;  1LAB A;  1LT3 D;  4KN7 C;  3A8I E;  2K1B A;  3M7N A;  2F0M A;  2AHO B;  4BY7 G;  2PNR C;  1I50 B;  2OWO A;  1PTO B;  1TWF B;  2Q2H A;  2F0S A;  2YU9 B;  4RCO A;  2HHH Q;  1OTC A;  1LTT D;  2HHH L;  4HJ9 A;  4JBJ A;  3DEO A;  1VCI A;  4L5S A;  2N49 A;  3CCV A;  1T9H A;  3ND8 A;  1CUK A;  4AQY Q;  4A3M H;  4CKB A;  2R92 G;  1WD0 A;  4F8M A;  1YNX A;  2WII B;  3KUP A;  4FP5 D;  2B2U A;  2L55 A;  2NZO A;  2D62 A;  3OPO A;  2LKV A;  4KKS A;  4EQP A;  1IXR A;  4BY7 B;  3ICE A;  2QF7 A;  2R7Z H;  2R3Z A;  1D1K A;  5FK9 C;  1PFN A;  1HQR D;  2UUB Q;  3PUW A;  3ERS X;  2QEJ C;  1PMR A;  4ABN A;  5FKA C;  1OXU A;  1WOC A;  4KV6 A;  1Q46 A;  2F3V A;  2F0V A;  4GN4 B;  1PH7 A;  2L1B A;  1N33 Q;  3N6R A;  1UEB A;  2AUK A;  1B3Q A;  3RMH A;  4JI8 L;  1SNM A;  2O5J C;  4TKO B;  4K5X A;  1LTA D;  4DAV A;  4HCE A;  1SNP A;  5M3F G;  1K0R A;  1LO5 D;  2E8G A;  2F3W A;  5FLX E;  1PVO A;  2LXK A;  4A93 B;  1BCP C;  1TY2 A;  2J7Z A;  1Z7T A;  1VQA A;  3DEP A;  5G3L F;  5IGG A;  2I5H A;  1EY4 A;  2A6H D;  2JA5 H;  3UI2 A;  3EVQ A;  3VYR A;  3HS0 C;  1IYJ B;  3T13 A;  5C4X H;  4ALP A;  2F0N A;  1EYC A;  1N36 Q;  2LY7 A;  2I5L X;  2EY5 A;  3TP5 A;  3OTO L;  1EU3 A;  3J7A 5;  1D5M C;  1CTM A;  5IT9 E;  1LT6 D;  1PLF A;  3QB3 A;  4DPG A;  1ZYR D;  3CRK C;  2M00 A;  5D3D A;  1SE3 A;  3OW2 A;  1JC7 A;  2IX3 A;  3K7A H;  1WCM H;  3KK7 A;  3T51 B;  1E1T A;  2RDG A;  2JA7 B;  1VQH A;  4KHZ A;  4WFN 3;  4X64 L;  1FD7 D;  1BNZ A;  2QGQ A;  2Z9H A;  1Q3L A;  5IGF A;  3BYY B;  2Q2T A;  1QVC A;  3EIV A;  1X65 A;  2NVY H;  1WTO A;  3S9W A;  1IZ6 A;  3PMF A;  3V05 A;  1A15 A;  5T1G A;  1QZG A;  1B7Y B;  1KNA A;  3UDG A;  3CC2 A;  1I5F A;  2H4O A;  1SJE D;  2F4I A;  4DV2 L;  3K7A B;  1AN8 A;  2RVL A;  4GOP C;  3S1Q H;  2RHQ B;  2N55 A;  2R61 A;  4LFA Q;  4HIK A;  2IY5 B;  3S1N H;  1V43 A;  1VS0 A;  3OSO A;  4FF1 A;  1I3Q B;  4X65 Q;  2CCZ A;  2I46 A;  1PTO F;  4DR3 L;  3HOW G;  3RUZ A;  4JI4 L;  3M9B A;  1NTG A;  2K05 A;  1VQ5 A;  3OIQ A;  1EU4 A;  1SND A;  4R4Q A;  1STA A;  3NQT A;  3HOZ G;  4R8N A;  4LFA L;  2VUM G;  1AFP A;  1PRT F;  5BN4 A;  2ZXO A;  2WAQ B;  1F2Y A;  4DR6 L;  2EYF A;  2A1A A;  2JEB I;  1SMY D;  1Y1W G;  2Q8T A;  1HNW L;  2EJG C;  5CMD A;  2ID0 A;  2PQE A;  3OIP A;  1A63 A;  3EFX D;  1VQO A;  4L6T B;  3F2C A;  1TXY A;  2E75 C;  1SNO A;  2HQL A;  3BJU A;  1B44 D;  2FJ2 A;  4YWM A;  1EQT A;  3S1M B;  5IWA Q;  3GV3 A;  2IL8 A;  1CFM A;  1I6H B;  1XNQ L;  3VR6 A;  1B70 B;  2XTI A;  3FVQ A;  4A75 A;  1ENF A;  3VDY A;  3GTO B;  2B2T A;  2EYO A;  2WB1 G;  4NKL A;  3PIP A;  2XRQ D;  2PPB C;  3D6W A;  5IOD A;  1HZA A;  4XT1 B;  3CPW A;  4DV1 L;  1ESF A;  2B8G A;  2CW0 C;  2KA7 A;  3HEJ A;  1TR5 A;  5I9O A;  1YJW A;  3GTQ B;  3FP9 A;  4QL5 A;  3RLO A;  2PMZ B;  1VQL A;  3CXC A;  1GUG A;  4K8I A;  3GTJ H;  1S5E D;  3Q24 A;  2IW3 A;  3E5S A;  3CU7 A;  1F9Q A;  1LTG D;  3W5O A;  1BXT A;  2P5Z X;  4C3J H;  3M4P A;  1U4L A;  4DR4 L;  2K5H A;  4A3K B;  5CV8 A;  4L5T A;  1FJG Q;  4YIJ A;  5C4X G;  4CJ2 C;  5CC4 A;  2VW9 A;  1YZ6 A;  2NVQ H;  1FYC A;  4DU9 A;  3J81 i;  2HCC A;  3D4R A;  1HA5 A;  4KY6 A;  4L8J A;  4JI3 Q;  2WFW A;  2L5T A;  1EQR A;  4JOI C;  4MHE A;  1HUN A;  3DWP A;  2UXC Q;  4IUT A;  1SE4 A;  1BF4 A;  3AEV A;  2K6A A;  4QF4 A;  3KJO A;  3UDX A;  3J80 c;  1PFB A;  1AE2 A;  3BZK A;  2Z4H A;  3FHW A;  2KEC A;  1B50 A;  2DGY A;  3DUZ A;  1XMO Q;  2KCN A;  1NR2 A;  1TS2 A;  4I65 A;  3NSW A;  2Q8R E;  4P2C B;  4LFC L;  3NEL A;  2O4X A;  1I4G A;  3CPF A;  4LFB L;  3GO5 A;  2EOT A;  2UXC L;  2A6E D;  3LGJ A;  5M5W H;  1M1K C;  4ID6 A;  3PUZ A;  1GHJ A;  1Z6H A;  4DNT B;  1J6Q A;  4JBW A;  1ENA A;  2JSO A;  1HR0 L;  1TWA H;  1QVF A;  3NXW A;  1H9R A;  3NBH B;  1VQN A;  4LF9 L;  2UUB L;  4KD3 A;  2BH8 A;  2EJM A;  5M3F B;  4G7O C;  1CKO A;  5TSS A;  3I4M B;  2ENB A;  5M5Y H;  1VQC A;  4BWG B;  1HNZ Q;  4J8Q A;  1H9J A;  4YCV A;  3R8B A;  3GTG H;  3BDO A;  2AQ3 B;  3FKI H;  3HOZ B;  3U4V A;  1GUW A;  1V1O A;  3GTK H;  5A35 A;  4JI4 Q;  2EYL A;  4ZAI A;  3T53 B;  3CCM A;  4A93 H;  4DK6 C;  3T1H L;  3KDF A;  4UAI A;  1JR0 D;  4JI6 Q;  2EYP A;  1FL0 A;  4GNX A;  2IX1 A;  3M4Y A;  1JJC B;  1BBW A;  1C4Q A;  4DV3 Q;  1HH2 P;  4JBK A;  4A3I H;  1OXT A;  1QUQ B;  2C9O A;  1WJJ A;  4R8I A;  4A3D B;  1PZI D;  2VZA A;  1AE3 A;  4J15 A;  1CZW A;  4EQN A;  5HGT A;  3J80 E;  4HSP A;  4A3G B;  2MPM A;  1WTP A;  4OO1 G;  2NN6 I;  5I9P A;  2ZM6 Q;  3HP3 A;  4GKK L;  5IYC H;  3CCR A;  5IY0 A;  3AMU A;  1HCZ A;  4DV7 Q;  3CF5 A;  1QB5 D;  3KOJ A;  2KCM A;  1JQY D;  1SYB A;  2JA8 H;  2KCT A;  3S14 B;  4X3S A;  1AZP A;  5M3M H;  3T1Y Q;  1I50 H;  2ZXP A;  2MJ8 A;  3PO3 B;  5KNC A;  1HNX Q;  3CQZ B;  4NXM Q;  1HNX L;  3MEF A;  4FF3 A;  1J5E Q;  5JJI A;  2AMC B;  4GS3 A;  4LF7 Q;  4A3G H;  3FMC A;  2BOS A;  1VQ6 A;  3IFT A;  1E2Z A;  2B3G A;  4IZ8 A;  3IL8 A;  3GTG B;  5C3E H;  5AJ3 Q;  1EY0 A;  5LL6 X;  2EXZ A;  3F2U A;  2SDF A;  4NP5 A;  2IHF A;  4RGM A;  5CBE E;  2KHJ A;  3NUC A;  1ZYR C;  4C3H H;  4ZLT F;  4X64 Q;  4DV2 Q;  1STH A;  2D2C C;  4RMF A;  3N52 A;  4L63 B;  1EFW A;  4NB3 A;  2F3I A;  2LMC B;  3R3O A;  2CKZ B;  5C0X I;  4A3K G;  1YNJ C;  4P73 A;  1XX8 A;  4B3T L;  3GTM H;  3AFQ A;  4DAY A;  1GM5 A;  4X3K A;  1E24 A;  1B8A A;  4NPS A;  2UUC Q;  3P20 A;  4KLK A;  1U4R A;  1UWV A;  2D0O A;  3VA5 A;  1QCB D;  1D1I A;  1IBK Q;  2JK8 A;  1F9P A;  5IGC A;  2UU9 Q;  2XVS A;  4A76 A;  4ZUI A;  4DNI A;  1TWG H;  1ZKO A;  2RKS A;  3PSI A;  4DV4 L;  3V96 A;  1VQ7 A;  2HIX A;  4G57 A;  2PQA B;  4XTC S;  1U5K A;  4C3H B; 
#chains in the Genus database with same CATH homology
 1EFI D;  2NYZ D;  1BR9 A;  1TQO A;  2NTT A;  1IW7 C;  2AQ1 B;  1ZXT A;  2Z8L A;  4BBS B;  3HKZ B;  3QO2 A;  1Q1B A;  1PZK D;  3TZU A;  3WDN A;  1LTS D;  3J81 E;  1RJT A;  4Q0F A;  1I4Q A;  4XDX A;  4C3H G;  3GV6 A;  2NB0 A;  1DOK A;  4HSV A;  2HQE A;  5EPL A;  3OW7 A;  3KBX A;  1CQF A;  5C3E B;  1MI2 A;  1ML0 D;  3KBG A;  1U4P A;  1X3Q A;  3H0G B;  4K2L A;  1Y8O B;  1EIH A;  1J9O A;  4IFD I;  3SK6 A;  3DWQ A;  4XQN A;  1H9S A;  2M2L A;  3ONA B;  3SK8 A;  1CA6 A;  3GTP B;  1JOO A;  1T5E A;  4BS9 A;  4FNF A;  3RZD B;  3DXJ C;  3K5L A;  3J7A V;  3BVZ A;  1SYC A;  1JWU D;  5ISR A;  4OO1 H;  1EL0 A;  3LWE A;  3BDL A;  3X3M A;  2XRS D;  2X69 A;  2QIL A;  5K36 G;  1EEI D;  4DK1 A;  2DNC A;  5KIX A;  1A6X A;  3RLF A;  1HTL D;  1H9K A;  1J8I A;  4RAU C;  2Z4I A;  1KLG D;  4WJW A;  1HA6 A;  4K2K A;  1V8Q A;  3FPP A;  1LV9 A;  1LT5 D;  5CV5 A;  2QKI C;  2K7V A;  3FDT A;  1BUV T;  1W6K A;  3NWT A;  1K8M A;  1EQV A;  3MXG A;  4G7Z C;  4F87 A;  1QOH A;  1XYI A;  1VF7 A;  3QJY A;  2F0I A;  5D14 A;  3P1H A;  3S1R B;  5JOB A;  1S4Z A;  1UEA B;  2ICI A;  4PMW A;  1G91 A;  4RHR A;  5C4J B;  3S1N B;  3P7J A;  1FNV A;  2SOB A;  1Y8P B;  1HFN A;  2FHT A;  3O13 A;  3C2P A;  1SYE A;  1Y1V B;  3SXH A;  4A3M B;  4K8J A;  3GP7 A;  1SE2 A;  1OXX K;  4QUF A;  3A55 A;  1GJX A;  4KJN A;  1Y8N B;  1VMC A;  4KKT A;  4ZKB B;  3PIO 3;  3EJI A;  4DF7 A;  2KED A;  4C3J B;  4K14 A;  3GQB A;  2QCP X;  3NK9 A;  1AEX A;  2V4D A;  4KKU A;  4OIJ A;  5E4X A;  5KND A;  1F2Z A;  1O80 A;  4HTH A;  3LNN A;  5I2Y A;  1X32 A;  1UUP A;  3MVV A;  5C5M A;  4C3J G;  3NPP A;  4G7H C;  4HR7 B;  4V19 0;  5I4D A;  3J80 L;  1BCP D;  4WOR A;  2CW0 D;  3FEW X;  2AWO A;  3JAM E;  1ILP A;  5HUR A;  2SEB D;  3NWS A;  2DNE A;  5FO8 B;  2F0G A;  2VNU D;  4IUQ A;  1EY8 A;  3T4A C;  1SXT A;  2ICE C;  1STN A;  3MTS A;  2BA1 A;  4KD4 A;  4QUC A;  3BG3 A;  1EY5 A;  1QNK A;  1G29 1;  3BZD B;  2OF1 A;  2NBF A;  3QOL A;  5T1I A;  4RKL A;  3EQL C;  4O1N A;  5IIF A;  4KJO A;  4FXG C;  1FR3 A;  2B2Y A;  1PXU A;  3MWY W;  1ENC A;  2K03 A;  2NZ1 D;  3J81 L;  4ZYS A;  1CT1 D;  1L0X B;  3CRL C;  1BCP F;  4ILW A;  1V1P B;  3R93 A;  5C0X G;  4FF2 A;  5IGD A;  2NVT B;  4A3I B;  3TP8 A;  5JEA J;  2RA4 A;  4FXD A;  4BY1 B;  1EWH A;  3R2T A;  4IFD H;  2HDM A;  1O7Y A;  3EA6 A;  4PV1 C;  1BCP B;  1A3U A;  1E2W A;  1DXM A;  2JXM B;  3C46 A;  5JAV A;  1LTB D;  1CK1 A;  2A69 C;  3K0Y A;  3VR2 A;  1S5D D;  5I6Y A;  2WAC A;  1A3V A;  2B2W C;  1Z47 A;  3MXP A;  3HG9 A;  1FNU A;  1QIL A;  5D65 A;  2JEA I;  4K5W A;  2R93 B;  5CYU A;  1M4V A;  3RD4 A;  1NAP A;  1G2T A;  1WTR A;  2RDH A;  3S15 B;  1STB A;  4HMI A;  4PQX A;  3BVM A;  4IUR A;  3GTM B;  1B1Z A;  3NE5 B;  5NUC A;  4XYO A;  2XSC A;  4U68 A;  1I4R A;  4NDX A;  1KNE A;  4HMJ A;  1KDC A;  2E76 C;  1SNQ A;  5FO7 B;  1W6J A;  2HUG A;  4KY5 A;  2FIN B;  4FF4 A;  2C5C A;  3PIP 3;  4FO2 A;  4A3B B;  3HOX B;  3J7A F;  1XXG A;  2F0D A;  1WTX A;  1EZ6 A;  2PYK A;  1TT2 A;  2WV6 D;  4G4K A;  5BN3 A;  1HXY D;  1X3P A;  5CV7 A;  3TZD A;  5JPN C;  5I2X A;  3T16 A;  3H6M A;  5FOB B;  4ZRZ A;  3HGB A;  2R6G A;  5C0X H;  1ROD A;  1GUT A;  3VR3 A;  3IKJ A;  5E3F A;  3SK5 A;  2BE5 C;  2NUC A;  1R9T B;  1EIG A;  1A3T A;  2EPB A;  1KLU D;  3G7L A;  3HOU B;  5CGK A;  4DXF A;  1EYA A;  3L7Z C;  4Y7N B;  2FFK B;  3GTL B;  1C8C A;  5DEH A;  2KEE A;  4HCS A;  3V2T A;  1O78 A;  5A2Q E;  1KDB A;  1EWC A;  5ELE A;  1VMP A;  4CJ0 B;  3OWF A;  4IUV A;  3E6Z X;  4RGN A;  4KI0 A;  4PMC A;  3MZ5 A;  2O2L D;  2E2D C;  4DAP A;  5EPK A;  3CKI B;  1EY7 A;  1HUM A;  4XYQ A;  1U9R A;  1O7Z A;  4HN7 A;  3MAQ A;  3JAM L;  2PCF B;  2VB3 X;  1PRT D;  1IYV A;  1WTV A;  1F9R A;  1MSG A;  1AW7 A;  2F0W A;  1DM0 B;  2K33 A;  3A56 A;  4FVM A;  4C56 C;  3M3Y B;  2M9V A;  4DFA A;  4IAL A;  4EGV A;  3SHL A;  3D31 A;  1JWS D;  5M9O A;  4NMZ A;  4RA8 A;  1VDZ A;  2A6E C;  1RD9 D;  4A3J B;  1DD2 A;  1PRT B;  4B08 A;  1STG A;  3MXN A;  1VF5 C;  2E74 C;  3HOY B;  4HAE A;  3NQI A;  1ESR A;  1I4H A;  5J22 A;  1H9M A;  2CQA A;  3ERO A;  5C6A A;  1GUO A;  1E0B A;  1ZEQ X;  4RKB A;  2NVQ B;  1DCZ A;  1K8O A;  1OXV A;  2EY6 A;  3K58 A;  2Q8I B;  4S3S A;  4KHV A;  2A5H A;  5A2Q L;  2EYJ A;  1STY A;  2EZV A;  4QIW B;  3K5N A;  3S16 B;  1WCM B;  1BDO A;  1IYU A;  5COY A;  3K59 A;  1TWH B;  1JOQ A;  2KOL A;  1KDA A;  3OHX C;  3NTI A;  1TVX A;  5E4W C;  5EPJ A;  5C4H A;  2NTS A;  3A7L A;  1B2T A;  2SNS A;  1KTK A;  1D6E C;  3VR5 A;  1O7L A;  3NTH A;  2N88 A;  1QNU A;  1KAB A;  2L12 A;  3AB9 A;  1M8A A;  2VB2 X;  1PTO C;  2FMC A;  4A3E B;  1SDF A;  4XT3 B;  1Q12 A;  1JWM D;  2BDO A;  1K83 B;  4OL7 A;  4K5V A;  2B2V C;  3TBI B;  1JB3 A;  5CV4 A;  1GUN A;  4C3I G;  3GD7 A;  1II3 A;  4F7X A;  2IT1 A;  1B3A A;  5EKI A;  2AWN A;  5FLX L;  3I8Z A;  1B9N A;  3L9A X;  2CHB D;  3PUX A;  1GHK A;  1BO0 A;  2KJX A;  3FPU B;  2KVM A;  1ONL A;  4LJZ C;  3D4D A;  1OXS C;  1AP0 A;  2K5Q A;  5F2D A;  2PZT A;  2XNA C;  5DM7 3;  3PO2 B;  3FKI B;  1IL8 A;  2JA8 B;  2F0E A;  2F1M A;  1S5B D;  2EDG A;  4M8A A;  5M3M B;  2XIW A;  3D6C A;  4K6D A;  4AYB B;  1CA5 A;  2NN6 H;  4KMU C;  2PZW A;  2E2I B;  3Q6S A;  1MGS A;  1SMY C;  2RQX A;  4LMQ D;  2G9D A;  5BN5 A;  1RKN A;  5KGU A;  2A68 D;  3GTJ B;  3BVG A;  3MHB A;  5FO9 B;  1FNW A;  3U9O A;  4X3U A;  1CZG A;  1TU2 B;  2IX0 A;  3LX0 A;  1MSH A;  1QWY A;  1RCV D;  4J1M A;  4ZK9 B;  4E6I A;  2XWJ B;  5C5L A;  5C44 B;  2EY2 A;  3BYT B;  3A54 A;  1OO9 B;  1SNC A;  2GA4 B;  2I07 B;  3Q23 A;  5E1F A;  3QG1 A;  2A73 B;  1C48 A;  2G9H D;  4BA2 I;  1SJH D;  1B4O A;  4XQJ A;  2LS0 1;  3NBH A;  4R9W A;  1YNJ D;  3M7G A;  1I4X A;  1WTW A;  5ELC A;  4CHT B;  2IJ0 A;  5ELF A;  1TKW B;  2F0F A;  1PTO D;  5M5W B;  2L11 A;  3TSS A;  4BA1 I;  3VA7 A;  1RTO A;  2ZXR A;  1H9S B;  2F0U A;  2JE6 I;  4C1N K;  1D2B A;  4OIK A;  4I7Z C;  5JVH 3;  3CHB D;  5KNB A;  2F0O A;  4RH6 A;  4IUU A;  1B9M A;  4X3T A;  2X6L A;  5IGE A;  3R2I A;  2EE1 A;  5LL6 S;  1JOR A;  2VXW A;  2B2T C;  1BQQ T;  4F88 A;  3SE0 A;  4NW2 A;  2MGS A;  2JYO A;  3NHH A;  1SYD A;  2WIN B;  4ULL A;  3G6J B;  1JIC A;  3SDZ A;  1EOT A;  3URY A;  1CQV A;  3TP7 A;  3L3O C;  5EKK A;  4CKC A;  4KTA A;  4N9P A;  3QOJ A;  1HQM C;  5K36 H;  2K28 A;  1RTN A;  2EY1 A;  4IN3 A;  1NUC A;  1SAP A;  3Q22 A;  3TME A;  3K5O A;  2AUJ D;  4OHJ A;  5JPM C;  2Z1C A;  5IT9 L;  3OMG A;  3DM1 A;  3S2D B;  1PFM A;  2PO4 A;  5LHY 1;  2E2H B;  1GOZ A;  1CHQ D;  2MHV A;  1IKM A;  1GUS A;  1AZQ A;  3C1F A;  4TSS A;  1LAC A;  1Q8I A;  3A8J E;  3BDC A;  1LLR D;  2TSS A;  1TWC B;  1UAP A;  2MUY A;  4IQZ A;  2OT2 A;  1DZ1 A;  1ICW A;  3IFD A;  2EYH A;  5KYI A;  4RGO S;  2Y0S B;  3AU7 A;  1R4Q B;  4IUP A;  3VYU A;  1PYW D;  3A7A B;  4PNY A;  2XWB B;  2B39 A;  1TY0 A;  4FYD A;  5EKL A;  2O5I C;  3WOF A;  3VYS A;  3ITP A;  1YNN C;  3TN2 A;  1Q90 A;  2RDF A;  3K57 A;  3DHQ A;  1EY9 A;  3K5M A;  2B2V A;  3W2D A;  5JJZ A;  1A2U A;  4BBR B;  5D3I B;  4XIG S;  3NTK A;  5M5X B;  3K6O A;  4V0B A;  3DMU A;  1A2T A;  1TS5 A;  1PZJ D;  1EY6 A;  1I4P A;  4RFB A;  2A6H C;  2D5D A;  5JVG 3;  2YYZ A;  1RDP D;  4KY7 A;  1Y1W B;  1Q1E A;  4N9T A;  3Q0A A;  1HRJ A;  4OO1 I;  3VYT A;  2L4N A;  3MA2 B;  5DM6 3;  1JE4 A;  2K5W A;  3ZYY X;  2R92 B;  1DOM A;  2EJF C;  2B63 B;  3QIA A;  1TS4 A;  5ELB A;  2K5D A;  5J39 A;  5G3L D;  3DWA A;  4DNR B;  2EVB A;  1SFO B;  1SYF A;  5CV9 A;  1IHZ A;  4H13 C;  2JP1 A;  5KYL A;  4GZY C;  1WVL A;  2K04 A;  2KUM A;  2HDL A;  1CM9 A;  2OXP A;  1STE A;  2RSN A;  1D5X C;  3P75 A;  3OWE B;  2A68 C;  3W3A A;  4CGY B;  2F0L A;  1QJO A;  1G8Z D;  3H3V C;  4LK1 C;  3I72 A;  2JA5 B;  4DN4 M;  1JOK A;  2QDB A;  4EQO A;  3MFG A;  3TDQ A;  4MIU A;  3J7Y W;  1G2S A;  3OMC A;  5AFW A;  4KK7 A;  4QCL A;  4U67 3;  2WKD A;  4UDU C;  2KHS A;  1EYD A;  1HPC A;  3OOC A;  2H1E A;  2DY8 A;  4ODG A;  4RCN A;  2PZU A;  2R7Z B;  5C0X J;  3QWN A;  3RZO B;  4XXE A;  2LFN A;  1WD1 A;  1DJR D;  4WRD A;  3ND9 A;  1TWA B;  4O42 A;  3H09 A;  5EJW A;  2HCI A;  1XTC D;  4RGT A;  1ILQ A;  2SNM A;  2F0T A;  1B53 A;  3S1Q B;  3I91 A;  3HRZ C;  1Y69 U;  3S17 B;  4IFD J;  2A74 C;  5EGT A;  3KLS A;  3MXU A;  5COR A;  5CV6 A;  5C4Z A;  1CI3 M;  1UNS A;  1SBB B;  2A69 D;  4CJ1 B;  1EZ8 A;  4DXG A;  2F0K A;  5C4X B;  4ZKC B;  3C3L A;  1LTR D;  4QB4 A;  5IGB A;  2EYM A;  4J6H A;  3TP6 A;  3PUV A;  1F9S A;  2RSO A;  4RWS C;  1SSO A;  3NP8 A;  1BBX C;  3M4O B;  3KF8 A;  2MP1 A;  2J0T D;  5KRU A;  4RHS A;  4CBV A;  4C2M B;  1KAA A;  1EEF D;  3M85 A;  2B8F A;  1GXD C;  2D9U A;  3H94 A;  2F0Q A;  4PMB A;  2L9H A;  1RF2 D;  4OGQ C;  3FRP B;  2RBM A;  3KLS X;  5KEE A;  1DYQ A;  3I70 A;  3MC0 B;  5M5Y B;  3S2H B;  1WTQ A;  2E2J B;  3I3C A;  3I4L A;  4IFD G;  1BOS A;  2DN8 A;  1V1P A;  4Z9C B;  1D5Z C;  3LWU A;  2KQ3 A;  1I6V C;  5ELD A;  5J1Z A;  3I73 A;  1L0Y B;  2VUM B;  4C3I B;  1DOL A;  3T56 B;  5EBD A;  3H91 A;  3I4N B;  3HOV B;  3I90 A;  4JK1 C;  1HTP A;  1JCK B;  2WKC A;  4IUN A;  3SR1 A;  1NCV A;  3E0J A;  1F77 A;  3PV0 A;  2AQ2 B;  3X3N A;  2FMM A;  1NR4 A;  1TS3 A;  2WB1 B;  3ERQ A;  3HZX A;  4TQU S;  4A3F B;  4H0L C;  2K32 A;  1QG7 A;  3D4W A;  3VR4 A;  3MEH A;  1NSN S;  2NVX B;  4DGZ A;  5I6W A;  2CVR A;  1U4M A;  4XQQ A;  4FXK C;  2F0P A;  4DK0 A;  3C1E A;  1DON A;  2NVY B;  1SYG A;  2B2W A;  4B9W A;  5CR3 A;  1XWE A;  4M1U B;  2L0C A;  1IKL A;  2BDN A;  2F0J A;  3U9S A;  3PUY A;  2F03 A;  5C3W A;  2PW5 A;  1RHP A;  1T5X D;  2BCO A;  3SEB A;  1FGB D;  3GTK B;  1TII D;  1R4P B;  3HOW B;  1HFG A;  4Q5V A;  1F2M A;  1HHV A;  2ZT9 C;  2X6G A;  1E2V A;  5DAU A;  2BE5 D;  1TWG B;  2IPK D;  2K01 A;  3SK4 A;  4ZQ3 A;  3MFY A;  2IWH A;  1MBY A;  5CBA E;  3A8K E;  1S5F D;  4B9X A;  3KLR A;  5K5P A;  3D3R A;  2BA0 A;  3IAY A;  2OEO A;  2B2U C;  4ME5 A;  1CHP D;  2B2Y C;  4HED A;  1IW7 D;  4QMG A;  2TMP A;  5DNF A;  5JEA G;  4H7B A;  3NBI A;  2XN9 C;  1LT4 D;  3D8G A;  4DA2 A;  1S5C D;  1LTI D;  5C3X A;  5JEA H;  5EBC A;  1ET6 A;  3BS1 A;  1QE6 A;  5EQ0 A;  1YNN D;  2DY7 A;  1ET9 A;  4K6L A;  5IOC A;  4TRD A;  4MN3 A;  1PTO H;  1PDQ A;  3SVM A;  1SEB D;  2PW7 A;  2JA6 B;  2NWG A;  1PRT C;  2J4X A;  4EVO A;  4KN4 C;  4H44 C;  1G6Z A;  2KCC A;  2WP8 J;  3WOE A;  4LAA A;  2F0H A;  1MD2 D;  1F2L A;  4CKE A;  2NN6 G;  4ZUJ A;  4C1N I;  1LAB A;  1LT3 D;  4KN7 C;  3A8I E;  2K1B A;  3M7N A;  2F0M A;  2PNR C;  1I50 B;  1PTO B;  1TWF B;  2F0S A;  2YU9 B;  4RCO A;  1LTT D;  3DEO A;  1VCI A;  3ND8 A;  4CKB A;  1WD0 A;  4F8M A;  2WII B;  3KUP A;  4FP5 D;  2B2U A;  2L55 A;  2D62 A;  3OPO A;  2LKV A;  4KKS A;  4EQP A;  4BY7 B;  2QF7 A;  2R3Z A;  1D1K A;  5FK9 C;  1PFN A;  1HQR D;  3PUW A;  2QEJ C;  1PMR A;  4ABN A;  5FKA C;  1OXU A;  4KV6 A;  2F3V A;  2F0V A;  2L1B A;  3N6R A;  2AUK A;  3RMH A;  1SNM A;  2O5J C;  4TKO B;  4K5X A;  1LTA D;  4DAV A;  4HCE A;  1SNP A;  1LO5 D;  2F3W A;  5FLX E;  4A93 B;  1BCP C;  1TY2 A;  2J7Z A;  1Z7T A;  3DEP A;  5G3L F;  5IGG A;  1EY4 A;  2A6H D;  3UI2 A;  3EVQ A;  3VYR A;  3HS0 C;  3T13 A;  2F0N A;  1EYC A;  2LY7 A;  2EY5 A;  3TP5 A;  1EU3 A;  1D5M C;  1CTM A;  5IT9 E;  1LT6 D;  1PLF A;  3QB3 A;  1ZYR D;  3CRK C;  2M00 A;  5D3D A;  1SE3 A;  1JC7 A;  2IX3 A;  3KK7 A;  3T51 B;  2RDG A;  2JA7 B;  4KHZ A;  4WFN 3;  1FD7 D;  1BNZ A;  1Q3L A;  5IGF A;  3BYY B;  1WTO A;  3S9W A;  3PMF A;  3V05 A;  1A15 A;  5T1G A;  1KNA A;  2H4O A;  1SJE D;  2F4I A;  3K7A B;  1AN8 A;  2RVL A;  2N55 A;  2R61 A;  1V43 A;  3OSO A;  4FF1 A;  1I3Q B;  2I46 A;  1PTO F;  3RUZ A;  2K05 A;  3OIQ A;  1EU4 A;  1SND A;  1STA A;  3NQT A;  4R8N A;  1AFP A;  1PRT F;  5BN4 A;  2ZXO A;  2WAQ B;  1F2Y A;  2EYF A;  2JEB I;  1SMY D;  2Q8T A;  2EJG C;  5CMD A;  2ID0 A;  2PQE A;  3OIP A;  3EFX D;  4L6T B;  2E75 C;  1SNO A;  1B44 D;  2FJ2 A;  1EQT A;  3S1M B;  3GV3 A;  2IL8 A;  1CFM A;  1I6H B;  3VR6 A;  3FVQ A;  1ENF A;  3GTO B;  2B2T A;  2EYO A;  4NKL A;  2XRQ D;  2PPB C;  3D6W A;  5IOD A;  4XT1 B;  1ESF A;  2B8G A;  2CW0 C;  2KA7 A;  3HEJ A;  1TR5 A;  5I9O A;  3GTQ B;  2PMZ B;  1GUG A;  4K8I A;  1S5E D;  3Q24 A;  2IW3 A;  3E5S A;  3CU7 A;  1F9Q A;  1LTG D;  1BXT A;  1U4L A;  4A3K B;  5CV8 A;  4YIJ A;  4CJ2 C;  5CC4 A;  1FYC A;  4DU9 A;  2HCC A;  3D4R A;  1HA5 A;  4KY6 A;  4L8J A;  2L5T A;  4MHE A;  1HUN A;  3DWP A;  4IUT A;  1SE4 A;  1BF4 A;  2K6A A;  4QF4 A;  1PFB A;  2Z4H A;  2KEC A;  1B50 A;  3DUZ A;  2KCN A;  1NR2 A;  1TS2 A;  4I65 A;  3NSW A;  2Q8R E;  4P2C B;  2O4X A;  1I4G A;  3GO5 A;  2EOT A;  2A6E D;  4ID6 A;  3PUZ A;  1GHJ A;  1Z6H A;  4DNT B;  4JBW A;  1ENA A;  2JSO A;  3NXW A;  1H9R A;  4KD3 A;  2EJM A;  5M3F B;  4G7O C;  5TSS A;  3I4M B;  2ENB A;  4BWG B;  4J8Q A;  1H9J A;  3R8B A;  3BDO A;  2AQ3 B;  3HOZ B;  1GUW A;  1V1O A;  5A35 A;  2EYL A;  4ZAI A;  3T53 B;  4UAI A;  1JR0 D;  2EYP A;  2IX1 A;  3M4Y A;  1C4Q A;  1OXT A;  2C9O A;  4R8I A;  4A3D B;  1PZI D;  1CZW A;  4EQN A;  5HGT A;  3J80 E;  4HSP A;  4A3G B;  2MPM A;  1WTP A;  4OO1 G;  5I9P A;  2NN6 I;  3HP3 A;  3AMU A;  1HCZ A;  1QB5 D;  1JQY D;  1SYB A;  3S14 B;  4X3S A;  1AZP A;  2ZXP A;  2MJ8 A;  3PO3 B;  5KNC A;  3CQZ B;  4FF3 A;  3FMC A;  2BOS A;  3IFT A;  1E2Z A;  4IZ8 A;  3IL8 A;  3GTG B;  1EY0 A;  5LL6 X;  2EXZ A;  3F2U A;  2SDF A;  4NP5 A;  4RGM A;  5CBE E;  3NUC A;  1ZYR C;  4ZLT F;  1STH A;  2D2C C;  3N52 A;  4L63 B;  2LMC B;  3R3O A;  5C0X I;  1YNJ C;  1XX8 A;  4DAY A;  4X3K A;  3P20 A;  1U4R A;  3VA5 A;  1QCB D;  1D1I A;  1F9P A;  5IGC A;  2XVS A;  4ZUI A;  1ZKO A;  2RKS A;  3V96 A;  4G57 A;  4XTC S;  4C3H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...