2Q8TA

Crystal structure of the cc chemokine ccl14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
PYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL14
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
molecule tags Cytokine
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8tA00
3QO2A 1X3PA 4XT3B 3TZDA 2FHTA 1ILPA 1WD0A 1WVLA 2FFKB 2B2YC 1B3AA 2MGSA 2NZ1D 1B53A 3FPUB 2B2VA 4OIJA 5CMDA 1M8AA 1X32A 1ML0D 2K05A 2K28A 5E4WC 1F9QA 1B4OA 2L9HA 3FDTA 5EPKA 1XYIA 2L11A 1RTNA 4OIKA 4ZKCB 2X6GA 2B2WA 1EQTA 2KVMA 1CA5A 2B2VC 1Q3LA 1ESRA 1DOMA 4RAUC 4XT1B 3DEOA 1O7ZA 4CJ0B 2B2WC 1TVXA 1XX8A 2HCIA 4UAIA 1G2SA 1RTOA 1ZXTA 2IL8A 1HUMA 5D65A 5E4XA 2FMMA 1WTWA 1AZQA 2NYZD 1NR2A 2MPMA 1PFBA 4QUCA 1HRJA 3H91A 3TN2A 1MI2A 2Q8RE 3I90A 2K01A 2KEDA 4HCSA 4IUPA 1IL8A 1HFNA 2L1BA 2MP1A 1G91A 4QUFA 3GV3A 3Q6SA 4MN3A 1EL0A 3G7LA 3F2UA 4R8IA 4R9WA 4ZKBB 1DOKA 2D9UA 1BF4A 2DY8A 2RSNA 2RVLA 2EPBA 2R3ZA 3I8ZA 1VMCA 1AP0A 1G2TA 1J8IA 1HHVA 4IUTA 1BBXC 3N52A 1HA6A 2KEEA 2NWGA 4X3KA 1DOLA 3UI2A 4HEDA 2EOTA 1AZPA 3IFDA 3SVMA 2L4NA 2MJ8A 2KUMA 2X69A 1E0BA 2N88A 2B2UA 4IUQA 4RA8A 3MTSA 1F9SA 2RA4A 2JP1A 1PDQA 1S4ZA 2K04A 2M2LA 1EIGA 4HAEA 2JYOA 1O80A 1ILQA 1VMPA 5EPLA 1DZ1A 1G6ZA 1WTQA 2B2UC 1EIHA 4CJ1B 1WTRA 1U4MA 1ICWA 5T1IA 4IUUA 2Q8TA 4XDXA 2CVRA 1GUWA 1WD1A 1U4LA 1JICA 3DM1A 5JJZA 1WTVA 1F9RA 2BDNA 5CORA 4NW2A 3HP3A 2RSOA 2X6LA 2J7ZA 4X3TA 1PLFA 2SDFA 2HCCA 1J9OA 1RHPA 4U68A 4X3SA 2H1EA 1QE6A 3LWEA 3MWYW 2K03A 3KUPA 3P7JA 3IL8A 3R93A 5CBEE 3D6WA 1X3QA 2DY7A 4ZAIA 1PFMA 1O7YA 2L12A 4HSVA 1BO0A 5EQ0A 2B2TA 2FINB 3I91A 5T1GA 5DNFA 1NAPA 5D14A 1CM9A 1HFGA 1U4PA 1EOTA 2EE1A 1RODA 1PFNA 2B2TC 5EPJA 4ZLTF 1HUNA 4ZK9B 1NR4A 1SSOA 1A15A 2HUGA 2VXWA 4RWSC 1JE4A 1MGSA 2XIWA 3ONAB 5AFWA 2N55A 2KECA 1QNKA 5COYA 4LMQD 1WTXA 1B2TA 1NCVA 3I3CA 4DN4M 2KOLA 1BNZA 1LV9A 1MSGA 1IKMA 1F2LA 2HDMA 4O42A 1F9PA 3GV6A 3DEPA 1MSHA 5EKIA 1C8CA 4X3UA 1WTOA 5CBAE 1WTPA 1U4RA 3KBXA 1CA6A 4IUVA 2FJ2A 1SAPA 4CJ2C 1SDFA 1KNAA 1RJTA 2B2YA 4IURA 2HDLA 2K1BA 5EJWA 1IKLA 1DONA 1QG7A 4MHEA 1B50A 1KNEA
chains in the Genus database with same CATH superfamily
1WI5A 1ILPA 1NJIC 3FPUB 2L9HA 5EPKA 4AQYL 3CC4A 2X6GA 3CXCA 1STYA 5K36H 4DK1A 3GTJB 1D6EC 3N6RA 2YU9H 3DM3A 1MJCA 2IL8A 4H0LC 2UUCL 3BJUA 1F2YA 5ELFA 3E6ZX 3BU2A 2CH4W 4RKBA 1R4PB 2JN4A 4P72A 2KEDA 2VB2X 2TMPA 2JEBI 2UU9Q 4RG1A 1UEBA 1ESFA 2NTTA 5IP9G 4LF5L 3KK7A 4UY8C 3R8BA 1N34L 1S3OA 1BBWA 1HXYD 2PCFB 1RDPD 4G7HC 3W2DA 1X3GA 1EWCA 2X69A 2SEBD 1HZAA 5M5WH 3PO3G 2UUBL 1SMYC 4M1UB 2R93G 2GVBA 3I4NB 1BQQT 3GP7A 4XYOA 3AFQA 4NXNQ 3P20A 4DXFA 3GTJH 2VQFQ 1WTVA 3TP7A 1XJVA 2IX1A 1HH2P 5M3FH 4DV3Q 1I6HB 1M1KC 4RCNA 3CU7A 4DR7Q 1JJ2A 1YITA 2RF4A 3KFUA 4KTAA 1YNJD 1KQSA 3M7GA 4JI5L 4DUZL 1N8RC 4UHVA 1STBA 1S5DD 4WJ4A 4BY1B 2XRSD 2UXDL 3S2HB 4NKLA 3ONAB 4NPSA 1MJEA 2LFNA 3T51B 4QIWE 2L5TA 1IL2A 4N8X1 4DUYL 3F1ZA 3M85A 3EN2A 3FP9A 1U5KA 3I4NH 2NN6H 1EY0A 2EDGA 4OWXB 5AJ3Q 1Q8KA 1J5EL 5BN5A 2GVAA 2R6GA 3UDIA 4GS3A 1PH2A 4LWCA 1I6HH 4GN4B 4B3SL 5FO7B 4HJ9A 2VB3X 3VR3A 4O2DA 1CKMA 1KL9A 2G9DA 2QKIC 4DR5Q 2WACA 2AWNA 5C0XJ 4DFAA 2FMMA 4FXGC 4IO9A 1MBYA 4UP7A 4NB3A 5IOCA 1RIPA 1HTPA 4LFCL 2D2CC 3C2PA 4A3EG 1HNXQ 4BY1H 3HOUB 3S16B 1VQCA 5KNCA 5FLXE 4PZ7A 3RN5A 5I6YA 1KIXA 2K14A 4ZUIA 5K5PA 2D5DA 3C3LA 2LY7A 4BXXG 2R3ZA 3CCSA 2FMCA 4LF4L 4ZUJA 4LFBQ 4LW1A 1BBXC 3PIOA 2NWGA 3MC0B 4X3KA 4CBVA 1CSQA 4IPDA 5KIXA 2IW3A 2JA8G 1SLJA 4MTKA 2MJ8A 2B8FA 2ZM6Q 1D5XC 1VQ8A 4LJZC 3PO2B 1XPRA 3OOCA 3Q0AA 3CKIB 4A3JB 1ET9A 3OW7A 5LMUL 3QOLA 2E75C 2WKCA 3J80i 5C3EB 1PH3A 1SMXA 3U9OA 2Z6BA 5EBDA 2EXZA 1I6VC 1EUJA 4X3TA 5C5MA 1RL2A 1Y1WB 1N9WA 4CDDC 3JAMc 4A93G 2IPKD 4LF6L 3P7JA 1I4QA 3S16H 1SYBA 2QCPX 2FINB 5BR8L 3I55A 1JB3A 1R4QB 1JWMD 2F0QA 4KN4C 1AH9A 2EYPA 2GA4B 4JI8Q 2MNAA 3AMUA 1U0LA 4FF2A 1T5EA 4GKJL 1XMOL 3E0JA 3T16A 2K5WA 1D1KA 4DK3C 1A3VA 5COYA 3L3OC 4HJ8A 2B3GA 4ILWA 2EY2A 4IPGA 3PO2H 1F9PA 4X62Q 2IHFA 4KHVA 1CQVA 3S1NB 4CJ2C 1EYCA 4A3JH 3Q23A 3K6OA 2K1BA 4HCEA 4KV6A 5EKKA 4FNFA 5CV9A 5M3MG 5C3EH 4KKSA 4C3JB 2RDFA 2B2VA 2K05A 2HT1A 3L0OA 1KHIA 1LTAD 1Y1WH 1CA5A 3OWFA 1LUZA 2VQEL 4A3FB 4BY7B 2WV6D 1YNXA 2WB1G 3DEOA 4QY7A 5DEHA 3D4RA 1XX8A 1LTID 4ME3A 1N33Q 3CPFA 2Z6KA 4HJ7A 5IYDH 1Q1BA 1Q12A 3D0FA 5ELNA 1MI2A 3HOYG 4JC0A 2CW0D 1MD2D 2CH4A 1DGSA 1HNZL 2XTIA 3OIQA 4QUFA 3GV3A 2PNRC 1I4RA 1WTHA 4DPGA 3J7YW 2Z0SA 1G2TA 2JA6G 4IUTA 3N52A 5IT9E 2EIFA 1G6PA 3S1NH 3S17B 2RHSB 4QQBX 2KCCA 3GTMB 1AZPA 1AW7A 3KLRA 4DV7Q 2DUDA 3SDZA 3KBGA 2JYOA 2F4IA 2J4XA 4A3FH 5G3LD 4BY7H 3SK5A 4KK7A 3OMCA 1SE8A 1FD7D 3D4WA 4XQNA 3ZYYX 5IWAL 3SK8A 3RZDB 3T56B 1EIYB 2XWBB 1SE4A 2H1EA 1D2BA 2K03A 1P8LA 3KUPA 4F88A 4KMUC 3HKZE 3TP5A 4K0KQ 2JQOA 1A6XA 3PV0A 2L12A 2CCZA 1STNA 4P74A 3ND8A 5CGKA 5D14A 1NBWA 1JOKA 3VDYA 3GTGH 1TT2A 1TWHB 3S17H 4RCOA 3KF8B 4JI4L 1VQHA 1S72A 3GTMH 4BA2I 4KHZA 1BVSA 1C0AA 1F2LA 4ME5A 1TXYA 1LTSD 1SNMA 3FVQA 1DJRD 2MFIA 1Q86C 3WWVA 4HMJA 3TEHB 1ZYRC 1JWUD 1B9NA 1D1IA 2F0DA 1PTOC 3BG3A 3H3VI 1VQMA 3DHQA 2IHEA 4TSSA 3T1HQ 3V2TA 1PTOH 2N78A 1IYJB 5CMDA 2L15A 5CV8A 3C46A 3VR4A 1RF2D 3VR5A 2L11A 3RZDH 2EYHA 4CDCC 5IY0A 3FHWA 1YZ6A 1BR9A 2A69D 4DV5L 3QOJA 1O7ZA 4OONA 2XNAC 2B2WC 1RTOA 2V4DA 1ONLA 3KF6B 1Y69U 3CCQA 5HGQA 4QUCA 2C5CA 1ASYA 4R8NA 4A3CG 1TWHH 2VUMH 1M90C 1H9MA 3ERQA 4C2MB 1I50B 1F2MA 1UAPA 3FKIB 4R9WA 4F7XA 1FGUA 1OXTA 2RSNA 4JVZA 3BS1A 4C3HG 3OW2A 1IYVA 1TS4A 2I5MX 3H0GH 4J6HA 3ERSX 3L9AX 1UE7A 3S14B 1XMQL 1EFID 3KF8A 3K81C 5FJ8G 2ZT9C 5IE8A 1E7ZA 4O1NA 3BDOA 2NVYB 3A5UA 3EFXD 3DUZA 5A35A 3D31A 3A54A 4JCVE 2PI2A 1YEZA 1PHJA 1LTTD 1EZ6A 4IN3A 1IHZA 4DR2L 3EBEA 3S1QB 5D3IB 4Y7NB 4H7BA 4EQNA 2HHHL 2JXMB 5ELBA 1EQRA 5CBEE 5M9OA 3RD4A 2O5IC 2R7DA 3URYA 3K7UC 4DGZA 4C2MH 1I50H 4CDEC 2XGTA 3FKIH 1C9OA 3H09A 2BH2A 3I4MG 3KF6A 4JV5L 5JEAG 1N32Q 3I2ZA 3Q24A 5KGUA 2R61A 3BVMA 2HDMA 3B6YA 1PH8A 3P1HA 3D3RA 1VDZA 2NVYH 2RDGA 3M9BA 2B2YA 4QMGA 3MXNB 1KNEA 4HIKA 3G71A 1QJOA 5I6WA 5M5XB 3S1QH 4Y7NH 1W2BA 4JYAL 3M4PA 2AUJD 2A73B 4DNRB 3HG9A 1TWAB 4YHHL 5E4XA 1H9SB 5C44B 1S5CD 2NYZD 3I70A 2R7FA 2E8GA 5C4XG 2PW7A 2UXCQ 1BCPF 2JA5G 2YTXA 4ZKBB 1Y1VG 4KHPL 4WFN3 4ALPA 4HTHA 3J81i 1VQAA 1WOCA 1OXVA 2KJXA 3U50C 4FF4A 1FJGL 1DOLA 1Q46A 1LT5D 2E76C 3K0YA 4K14A 4DR3Q 1SYFA 3GTQB 4GNXC 2OTLA 1HCZA 3CCMA 4K5WA 1LABA 1EWHA 1L2FA 3NTKA 3PUVA 4RA8A 5M5XH 4KKTA 3FPPA 4N8FA 4X66L 1O7LA 2R7ZG 3CHBD 5HGTA 5D3DA 2A5HA 1L1OB 2CVRA 4JI0Q 3NENA 1SYGA 3MXNA 4OX9L 4F8MA 2SNMA 1C4QA 1TWGB 2ZXRA 4M8AA 1QE6A 2G9HD 1TQOA 4CKEA 2SNSA 4A3IG 1PRTB 2R93B 5A2QL 4F87A 1H9JA 2B2TA 4MTNA 2B29A 4EQ5A 5NUCA 1LTGD 2AKWB 2F0NA 1CM9A 5IGGA 1H9SA 1SNPA 1G51A 3PMFA 2UUAL 2JEAI 4XYQA 1SSOA 3I73A 4ULLA 2CHBD 3JAME 1JE4A 3GTQH 3HOZG 4POFA 3A7AB 3WDNA 1IKMA 3WOFA 3H94A 1HZBA 3PCOB 3SE0A 3M4YA 1NSNS 4OWTB 3LNNA 1TWFB 3CF5A 5FO9B 1QB5D 4A3KB 3RNUA 2I46A 5IP9H 1B50A 3F2DA 1EYDA 4ZCKA 5J22A 1AFPA 3PGZA 1B53A 3J7AF 1H9KA 1M8AA 1K8GA 1ML0D 2K28A 1HZCA 5IYCG 3KJOA 1TWGH 5C4JB 1OXXK 1RCVD 1W3SA 1I94L 2BA0A 4JI3Q 4OHJA 1IBML 1JQYD 1X56A 2A68D 1JT8A 4AQYQ 2R93H 1G2SA 1L1OA 4IFDH 4GN3B 4H13C 1SYDA 2KCMA 2PZTA 5C4ZA 1UEAB 5GAHC 2LKVA 1H95A 3I4OA 2UUCQ 1LM0A 1STHA 2RBMA 5FOBB 1PRTF 3SK6A 3F2UA 4KN7C 2EJMA 3RLNA 2AUKA 4GLVB 4DV6L 1GUGA 1EQVA 1TWFH 5ELCA 2A74C 1Q82C 4A3KH 4GLAC 1CSPA 3RMHA 4BBRH 2XRQD 3HKZG 4OEMB 4A3EB 5IYBG 1L0WA 1N34Q 4KY6A 2Q2IA 2JJQA 3DWQA 2RA4A 4DAVA 5C4JH 1AE3A 2F0TA 4FF1A 2EY5A 2H4OA 1U4MA 5T1IA 3A8JE 4LF7L 4XDXA 5I9OA 2EZVA 2UUBQ 1NTGA 1YBYA 3BVGA 5JJZA 1F2ZA 2RDHA 4PQXA 3J80c 1HZ9A 2JA8B 2EY6A 2F0HA 1IBKL 1J9OA 3HOVG 4A3DG 3QR8A 4X3SA 3CPWA 2RKSA 1FYCA 1LT6D 1SXTA 2BOSA 4C1NK 1ZEQX 2HIXA 3S15B 3K5OA 5EPJA 2A1AA 1A15A 1YIJA 4DUZQ 2KECA 1E1TA 1NCVA 2KOLA 1BNZA 5IT9L 3HOWG 3BDCA 4TRDA 2UXDQ 1LO5D 4E6IA 1S5BD 1SMYD 3RZOB 4ZYSA 4PV1C 1B9MA 3K5LA 5EJWA 4C3IB 4B3RQ 3PIP3 2LXJA 4BXXH 1A3TA 2G5DA 3BZCA 3J7A5 3BYTB 1WD0A 3CD6A 2A19A 3K59A 1BDOA 2JA8H 1XYIA 3FMCA 3IRBA 4WORA 4BWGB 3CAMA 3PSIA 4XT1B 1PYWD 1ZKOA 2WAQG 3MAQA 2E74C 1TVXA 4UAIA 1WTWA 2K52A 3K7AB 1VQNA 2QILA 5IIFA 5K36G 3NBIA 1FR3A 2K5HA 3S15H 5M3MB 3G6EA 3MZ5A 2K01A 2K5QA 2Y0SE 4MZ9A 1HFNA 1J6QA 3RLOA 1SE2A 1UE6A 5JPNC 2HIVA 4A3MG 4XXEA 4LFCQ 1SFOB 1EYGA 1BF4A 1SR3A 2F0JA 1PH4A 2WB1B 2GN5A 3RZOH 1J8IA 2NVTB 3A8KE 4DV2L 1O7IA 4HEDA 4C3IH 1KTKA 2DN8A 1T9HA 4LF4Q 1VQBA 2N88A 3HOYB 2BE5C 2PMZB 2B2UA 2I07B 4L5TA 2OT2A 4HAEA 4JI2Q 1DZ1A 2RHQB 3S2HH 2YV5A 3TP8A 1HNWL 3E9IA 1WTRA 1UNSA 2FXQA 2MHVA 4G4KA 1VQJA 4XTCS 3EROA 2JA6B 1F9RA 1K28A 2YYZA 4A3LH 1Q1EA 3P75A 1PZJD 4K2LA 3A5ZB 3GDEA 1K83B 2F0OA 4CGYB 5LMUQ 4L5SA 5M3MH 3QG1A 1OXUA 4ODGA 3D6WA 5M3FG 4QJFA 5HURA 1OO9B 1O7YA 5EBCA 3C1FA 4P73A 5KNBA 5T1GA 4B3TQ 1SFOH 4LF6Q 1CTMA 2F3VA 4DR5L 1U4PA 1QZGA 2CKZB 4ZK9B 2NVTH 5BR8Q 1LYLA 2F3WA 3V96A 1IBLL 1KAWA 2OEOA 3W3AA 1CHPD 1EYAA 2WP8J 5C0XH 3HOYH 1X6OA 5FK9C 1XMOQ 4DAYB 1Y8NB 1U4RA 4DV4L 3HOUH 3GTKB 1VQGA 4IURA 4GOPB 3CQZB 3TZDA 3NXWA 4DK6C 2MUYA 3KJPA 1PH5A 4POGA 2JA6H 3FEWX 2E2IB 1NE3A 1SBBB 4YIJA 2KQ3A 4K2KA 1K83H 2JE6I 2ZM6L 1A2TA 2B2VC 3HZXA 1DOMA 1B3QA 3MHBA 3CW2C 3UDGA 5JVG3 4KJNA 1BKBA 4LF8Q 4A4IA 2VQEQ 2B63G 2AHOB 1QUQB 3TQYA 1PFBA 4DR1Q 1V1PB 2KBNA 2ZTEA 1WFQA 2Z6KC 4LK1C 1SN8A 2EJFC 1D5MC 2F52A 4APVA 1A63A 3G7LA 2HQEA 2K6AA 4O0AA 1HNZQ 1HA6A 1Q8IA 2EOTA 3GTKH 1I3QB 3CQZH 4JI8L 1XTDA 5JJKA 3LX0A 4OL7A 1BUVT 2F0KA 2E2IH 3MTSA 1E1OA 1GOZA 3UDXA 1S4ZA 2K04A 4DAYA 1CZGA 4PMWA 1A3UA 1ICWA 2Q8TA 4C3HB 5LL6S 1U4LA 3DM1A 2CQOA 4GOPA 2NTSA 3PUYA 4FXKC 5DM63 1XNRL 1KDAA 1VF7A 3OTOQ 1SYCA 2H5XA 4U673 4JG2A 1D5ZC 2F0UA 2OTJA 4EQPA 3UDFA 4C3JH 2DJGC 3NEMA 4HIOA 2JA7B 4IZ8A 1B70B 4DXGA 1QUQA 4AH6A 1K3BC 4B9WA 1V1PA 1S40A 2CFMA 3E9HA 1I3QH 5C3XA 5JPMC 1B2TA 5FLMH 2K32A 3DEPA 4A3CH 4JI4Q 3IFTA 2F3IA 1UWVA 2EVBA 1CA6A 3DWPA 2MO1A 4XQJA 4L63B 5EAYA 2HDLA 3NHHA 3K5MA 5KRUA 4MHEA 1VQFA 3RN2A 4JI7L 5JEAJ 3SGIA 4C3HH 5KEEA 3T13A 2FFKB 3F2BA 1VQ6A 5G3LF 2A6HC 4NP5A 3DXJC 1PYSB 4GN5A 4DV7L 4H02A 2XVSA 3BZDB 1SNDA 1TIID 4CJ0B 1EQQA 2HCIA 4C1NI 3I7FA 4KD3A 4DAMA 2A6HD 1QVCA 2JA7H 5J39A 2Q8RE 1RD9D 2PZUA 4BBSG 3NTHA 2ZTDA 3R2IA 4LF9Q 1EEFD 2MP1A 5IYDG 1SNOA 4KY7A 2ICEC 2YTVA 4FYDA 4XIGS 3SR1A 3NK9A 1DOKA 2LXKA 4DKAC 2Z4HA 1NMFA 2F0PA 3J81c 4DR6L 1ZYRD 3DLLA 4YCWA 1PTOD 3S2DB 3CP0A 4X65L 3SHLA 5L37A 3S24A 3VA5A 4RGMA 1CFMA 2ZTCA 1KRTA 4JPBW 1EU4A 2F0SA 4DV0L 5IODA 1G6ZA 2ATWA 1TY0A 2Q2TA 1XMQQ 5EPLA 3GTLB 2NVQB 4CJ1B 4HN7A 4JW0A 4OO1H 1GUWA 4AIMA 1MIUA 1WCMB 1D7QA 1FNVA 4A3FG 2SDFA 4BY7G 1U9RA 3LWEA 1HQRD 2EYMA 3IL8A 1SE3A 1GHJA 1SROA 1SJHD 1X3QA 2DY7A 4FVMA 2E2HB 2HHHQ 3A55A 4P71A 5EQ0A 1DM0B 5C6AA 3STBC 2DNCA 3D8GA 4IPHA 4G57A 3J80E 2F0GA 3GD7A 4IALA 2EE1A 4OELB 3J81j 3SK4A 1JJGA 3U58A 3E0EA 1PH6A 4HIMA 3H3VH 3EJIA 4JI1Q 2EYJA 1CQFA 5JJIA 3GV6A 1Z6HA 4A3IB 1A0IA 1KLGD 1BCPB 3QB3A 4B9XA 2VL6A 4I7AA 3GTLH 2NVQH 1I4XA 4YY3L 4WRDA 2Y0SG 2B2YC 2EQSA 2MGSA 4DV1Q 1WCMH 4JI6L 2VZAA 1X9NA 1QCBD 3A56A 3FDTA 3HOZB 1LTRD 4XQQA 1NMGA 4ZKCB 1VQ9A 1GVPA 3PIPA 3TRZA 4DR4Q 1GXDC 1Q3LA 4C56C 4DNTB 5IP7G 3GTPB 2WKDA 1Z47A 3A8IE 4J1MA 3S14H 2E2HH 4S3SA 2L55A 4AYBB 4JYAQ 3G4SA 5JVH3 1VF5C 1NR2A 1CUKA 1LT3D 5C4HA 1F77A 2CQAA 3I90A 4UP8A 2ZJRA 4QL5A 5HY6A 1VCIA 3ER0A 3CRKC 4GZYC 3D6CA 4R8IA 1DYQA 3F2CA 3HOXG 5JOBA 2QDLA 3ULJA 4A76A 2VUMG 1TWCB 4PMCA 4A3IH 4ID6A 3IAYA 1YJNA 1KLUD 2NBFA 2OWOA 2Z8LA 4KHPQ 5KNDA 5LHY1 1N32L 2VS1A 2VY3A 3H0GG 3NPPA 1XWEA 1UUPA 3U4ZA 3HOZH 1XNQL 1GO3E 4V0BA 1BOSA 2AWOA 2OQ0A 5JAVA 4YWMA 1WD1A 1I5FA 3W1BA 1GKHA 4X66Q 5CORA 5E1FA 1K8OA 3MEFA 4JOIA 4CKCA 1L0XB 3EIVA 1PZKD 4X64Q 2F4VL 3HKZB 1Q81C 3R93A 4B3ML 4IUNA 1EY6A 3O13A 4IOCA 4MIUA 1HR0L 1TU2B 4FP5D 1NAPA 4Q0FA 1YJ9A 1YHAA 1TKWB 1B7YB 2B2TC 4P75A 3AB9A 4LFAL 2HUGA 1FL0A 5AFWA 1TWAH 4R1JA 3HOVB 1TS5A 5C44H 3ND9A 2UUAQ 4O42A 3NELA 5GQOA 2UXCL 3TZUA 4JBMA 4X3UA 1WTOA 1WTPA 5DAUA 2CWPA 3PO3B 2FJ2A 1JJCB 1QG7A 3T1YQ 5GROA 1ENFA 2UXBQ 3NUCA 5FLXL 1CK1A 4IPCA 2O4XA 4IFDI 4N9TA 1VQKA 1WTQA 1X32A 5ISRA 4LUVA 1B4OA 4A3GG 1RTNA 2O2LD 1EQTA 3HOWB 1GD7A 2D0OA 1TR5A 3F8TA 3CCVA 5LMNL 4ZQ3A 1UE1A 4A75A 1LTBD 1I94Q 1FVIA 1IBMQ 4NXML 1ICFB 1STGA 3H91A 2AQ3B 1VQIA 1HRJA 2PMZE 1L1OC 4K6DA 3R2TA 4HCSA 4RGOS 3MXUA 3KLSA 4QB4A 5IGBA 4Q5VA 5ELEA 1KD1C 2R92G 3HOVH 3CMEA 1JR0D 2F0LA 2D9UA 2EYOA 4QF4A 2PZWA 1TS3A 5IGDA 4A3BG 2WAQB 5H1SE 3OMGA 4KLKA 3G48A 2IX0A 1PRTC 3NWSA 1BBUA 3PO3H 3J7AV 4HJAA 5ELOA 2BH8A 1II3A 3S9WA 3BDLA 4V190 1VQEA 4DV6Q 1OTCA 2YU9B 1E2VA 2ID0A 2PQEA 4R4QA 3SEBA 1F9SA 1PH9A 2Z1CA 4NDXA 4A3MB 1SNCA 4OXPA 4K8IA 4HJ5A 3HOWH 4K8JA 2QEJC 3MEHA 1FNUA 1N36L 1L0YB 1GUTA 3I72A 5KYIA 2BDNA 2SOBA 1PZID 2J7ZA 3V05A 2HCCA 4RGNA 4LF7Q 3VYSA 4DK0A 4G7ZC 1Y8PB 1QOHA 4LF5Q 1IZ6A 4PZ8A 1VQOA 3DMUA 5TSSA 5M5WB 1R9TB 3GTOB 1X3FA 1LT4D 1Q90A 2KCNA 4JI3L 1Q7YC 1HFGA 1X55A 3A7LA 2E5LL 1YJWA 1CHQD 4GLXA 1HUNA 5I2XA 1CKOA 4YWKA 3ZJYC 5F2DA 2OQKA 2QEXA 3PF4A 1XPOA 1QNKA 4GKKL 2RCNA 1ENAA 4KJOA 3OYYA 4UP9A 1WTXA 3I4LA 1HTLD 3A74A 3E3XA 1A2UA 2QF7A 2JK8A 4TKOB 3GQBA 1E24A 5M3FB 1K8MA 4RH6A 3CC7A 2J0TD 3MXGA 1KDBA 1GHKA 4A3MH 1DONA 1IKLA 2Q2HA 1G91A 5CV7A 3QO2A 4XT3B 5FKAC 1WYDA 1B3AA 2ZXPA 1DCZA 4LUOA 1F9QA 3OSOA 1MKHA 2NN6I 3RLFA 4OIKA 1DXMA 2KHIA 3TMEA 1MHWC 3JC66 4JI5Q 4QCLA 1EOVA 3AYHB 4A93B 1ZXTA 4A3EH 2K7VA 1H9RA 1R9TH 3GTOH 1X3EA 2BCOA 2UU9L 1O78A 4DUYQ 4IFDG 4KD4A 2L1BA 3PUXA 1YNJC 3Q6SA 1PVOA 4ZRZA 1J5EQ 4DA2A 1EWIA 3BZKA 2EPBA 4H44C 1OXSC 4DAPA 1HHVA 1K73C 3UI2A 4B08A 2B63B 4B3SQ 4DU9A 4NXNL 1X65A 1YI2A 4DV2Q 2VQFL 4IQZA 4A3KG 4HSPA 4BBRG 1VMPA 4DV3L 2B2UC 3QWNA 2VW9A 4OWWB 4X6AH 3J81E 3TS2A 3KDFB 4DR7L 1EFWA 1JB7A 4A93H 4FO2A 3L7ZC 1M4VA 1V9PA 3ITPA 1HNWQ 4B3RL 2AMCB 1SJED 3CCUA 5LL6X 3W5OA 3MWYW 4BS9A 3K8AA 1E2WA 5C0XI 1HR0W 5FO8B 2B8GA 1Y14B 1QVFA 1K0RA 4DF7A 5IGEA 2RCFA 1WVLA 4RWSC 1MGSA 1AN8A 3TS0A 3KLSX 2B63H 4K5XA 3K7AH 3I3CA 3M4QA 5AJ3L 1EY7A 2QDBA 4L5QA 4ABNA 2BE5D 5J3BA 3PQIA 4RMFA 5CBAE 1IBLQ 3EA6A 5A2QE 2PI2E 2XN9C 2V1CC 1BXTA 3K58A 1VQLA 2ZXOA 1GUOA 3MFYA 5C5LA 1V8QA 3KOJA 4DV4Q 2D0PA 4JK1C 3AFPA 2JA9A 5E4WC 5I2YA 4G7OC 1Z9FA 3RUZA 4RAUC 3T4AC 3SXHA 3ULPA 1Y8OB 1JCKB 4HR7B 4GKJQ 1HNXL 5D65A 4JI2L 4FDBA 3U4VA 5LMNW 3KDFA 3M3YB 1NUCA 1VQDA 2MPMA 1IXRA 2F0EA 2NUCA 3HEJA 2K75A 3VYRA 1RKNA 2IJ0A 4LFBL 3J80L 4LAAA 3I4NG 2NN6G 2EXDA 1JORA 4L6TB 3I8ZA 1AP0A 3TSSA 2F0MA 1G291 5CYUA 3UE1A 3Q22A 1QILA 4RHSA 4B3TL 2NB0A 1PXUA 2O5JC 5E7NA 3HFZB 2L4NA 2EJGC 2KUMA 1QVGA 2HQLA 1W6JA 1C48A 4BBSB 3NBHB 4C3IG 2ES2A 3NTIA 2M2LA 1S5ED 2ENBA 3VR2A 2I0QA 2A8VA 1KDCA 3G6JB 3TP6A 1UE5A 1EIHA 2DNEA 2OXPA 4IJHA 5EGTA 5JJLA 1FNWA 5BN4A 2JSOA 4BY1G 1VQ4A 4EVOA 1QNUA 4N9PA 3K57A 4RKLA 3M3YH 3X3NA 1K0SA 4GOPC 5CC4A 3IKJA 4UDUC 2C35B 4A3LG 1XNRQ 3NSWA 3J7ZC 3FRPB 3MVVA 3I91A 1PYBA 2PQAB 4TVAB 3GO5A 4R4CA 1PH1A 2CW0C 2ASBA 4X62L 3X3MA 4LF8L 4EX5A 2XIWA 1KC8C 2QA4A 4DR1L 2K33A 1LV9A 1SEBD 4BBSH 4AYBE 2CWAA 5DLQE 1I4HA 1TS2A 2K50A 4JBWA 1B44D 1EIFA 2N49A 3HS0C 2F0VA 1SAPA 5EKLA 5IWAQ 2Q2UA 1RJTA 5C0XG 5CV5A 2A6EC 1XXGA 4RGTA 3HOUG 3S1MB 3BYYB 1ET6A 1EY8A 3NQTA 2BDOA 2BA1A 2F0IA 3NBHA 4JI7Q 1NNXA 1N33L 3GTGB 1ESRA 1GJXA 1HQMC 2IY5B 4R4OA 4QIWB 1XTCD 2A6ED 5IGFA 4PZ6A 4P2CB 2EYFA 1P16A 3LGJA 2IT1A 3TN2A 2Y0SB 3PO2G 2K5DA 2C9OA 4JBJA 2E2JB 3TBIB 3I4MB 4A3JG 2KHJA 2M00A 4JBKA 1PTOB 3OTOL 2I5LX 3AQQA 4CDFC 3A0JA 3HRZC 5C3EG 1I4PA 2QGQA 2PQAA 2E2DC 2KA7A 2XWJB 5FJ8H 2LMCB 4KI0A 3KLWA 4OO1I 1EY4A 3IFDA 2NVXB 3SVMA 2ZJPA 1Y1WG 3CMAA 3L2PA 1E0BA 5I9PA 2Z4IA 1VQPA 2B39A 2P5ZX 3S1MH 4DR6Q 4DV5Q 2IWHA 3VYTA 4J8QA 1EIGA 1O80A 1YHBA 2N3SA 4WJWA 4X65Q 3HOXB 2VUMB 5GAEC 1JICA 4DV0Q 3JAML 4K0KL 3HP3A 1YNNC 2X6LA 1SNQA 3JAMi 1KRSA 1JC7A 2A69C 3ICEA 4K5VA 3PF5A 3H0GB 3PUZA 4ZAIA 2E2JH 3I4MH 1TY2A 4HSVA 2EY1A 2XSCA 5JEAH 5C4XB 2JA5B 2D62A 1AEXA 5DNFA 1G8ZD 1E2ZA 5IP7H 1C7YA 1YVCA 1YNND 1EOTA 3CCRA 1HA5A 1RODA 4ZLTF 3E5SA 4C3JG 1ASZA 1Y1VB 3PUWA 2N55A 4LMQD 3C1EA 3MXPA 2NVXH 2KENA 1QWYA 3D4DA 1PTOF 1WJJA 4LF9L 1DD2A 5EKIA 3T1HL 4L8JA 1C8CA 5I4DA 1CT1D 3ULLA 4DR2Q 4RHRA 4IUVA 5FLMG 1KNAA 1A62A 2HD3A 1JOQA 2Z9HA 2PW5A 1VQ5A 1HJPA 3HOXH 2R7ZB 1FGBD 3NE5B 4KY5A 2NZ1D 4OIJA 4NMZA 3OWEB 5M5YB 4I65A 2M9VA 4YY3Q 1EZ8A 2B2WA 2KVMA 5FLXc 3H3VC 1T5XD 2WAQE 3QJYA 3S2DH 4JI6Q 4JV5Q 5CV6A 1HUMA 5C4XH 3HGBA 2JA5H 3STBD 4DNIA 2NZHA 2N8NA 4L5RC 1LTLA 4TQUS 1Y1VH 1V1OA 4IUPA 3Q8DA 1IL8A 1IYUA 1HPCA 3PIO3 4A3GB 3U9SA 2Q8IB 2LSSA 2QW7A 4UPAA 1EY9A 4MN3A 3K5NA 2JA7G 1EL0A 2LS01 2RVLA 3W1GA 2PPBC 3I56A 3CRLC 2F1MA 2KEEA 2AQ2B 3VYUA 2L0CA 3CCLA 4FF3A 1GM5A 2DGYA 2R7ZH 3VR6A 2WFWA 3OPOA 4CHTB 4IUQA 1QZHA 2WINB 5M5YH 4YHHQ 1PDQA 4PG3A 1V43A 4JI1L 2R92B 3UE0A 3AU7A 4J15A 4IUUA 1X54A 4A3BB 1B1ZA 5J1ZA 1CI3M 3K0XA 1XNQQ 5BN3A 1BCPC 2IX3A 1VS0A 1PLFA 3WOEA 4OO1G 4KKUA 1RHPA 4QGUA 3S1RB 4DV1L 4OGQC 1CKNB 2MO0A 3H6MA 1S5FD 2F0WA 4JOIC 5ELDA 1PFMA 4A3GH 1KABA 1FJGQ 3TDQA 2F4VQ 4DR4L 4GNXB 4B3MQ 3R3OA 1W6KA 1E3PA 1BCPD 4YCUA 4I7ZC 2ALYB 3H15A 5E3FA 1HR0Q 3GTPH 4EQOA 1NR4A 2VXWA 4R4IA 2KCTA 4RFBA 4K6LA 3RR5A 3OIPA 4LUZA 3M7NA 4LFAQ 1MSHA 4Y52H 4WJ3M 1GUSA 1JWSD 3KBXA 1LACA 4OX9Q 2R92H 3NWTA 5IYCH 1PV4A 3CC2A 1X3PA 2ICIA 4A3BH 1EY5A 2FHTA 1IW7C 4HIDA 4IJLA 4IOAA 3LWUA 1GUNA 2ZJQA 3J81L 1PH7A 1TWCH 1A8VA 1PFSA 1CZWA 4Z9CB 1EEID 3FKIG 3S1RH 1WCMG 4FXDA 4A3DB 5C3WA 1AZQA 2F0FA 3M4OB 1IW7D 3MFGA 5GAGC 3CCEA 3KYHC 3MA2B 5IT9c 2WIIB 5LMNQ 2PO4A 3OHXC 1PA6A 3EVQA 5IGCA 1JOOA 1Z7TA 4PNYA 1K9MC 4LNQA 1LLRD 1I4GA 3NQIA 2PNHA 1CKNA 2K4KA 3DWAA 1STAA 4X64L 5GADC 4NXMQ 4YWLA 1JE5A 4DR3L 1D8LA 2DY8A 1AE2A 1VMCA 4MNOA 2RQXA 4HMIA 4GNXA 4PMBA 2WB1E 5IYBH 3EQLC 1VQ7A 2VNUD 3BVZA 1KXLA 4YCVA 4R4TA 1PMRA 2DJFC 4IFDJ 2YTYA 2I5HA 3AEVA 3T53B 1V1QA 4BA1I 4JI0L 1XPUA 2TSSA 2JP1A 1ENCA 1ILQA 2AQ1B 2PYKA 2MQHA 2OCEA 1JMCA 1YHQA 2K5NA 4A3DH 4NW2A 1K3RA 1SRUA 2RSOA 2KHSA 3M4OH 3T1YL 3QIAA 4U68A 2K5VA 1N36Q 2UXBL 4AYBG 1E22A 1STEA 2A68C 4EGVA 3CCJA 1BO0A 4BBRB 5CV4A 2EYLA 3HKSA 2NZOA 5DM73 1PFNA 4CKBA 1PRTD 3K80C 1SYEA 1K8AC 3VA7A 3TREA 1B8AA 2E5LQ 4DN4M 1MSGA 5CR3A 3NP8A 1NY4A 1KAAA 4GKKQ 2F03A 5KYLA 1EU3A 2OF1A 1SDFA 5C44G 1IBKQ
chains in the Genus database with same CATH topology
1ILPA 3FPUB 2L9HA 5EPKA 2X6GA 1STYA 5K36H 4DK1A 3GTJB 1D6EC 3N6RA 2IL8A 4H0LC 1F2YA 5ELFA 3E6ZX 4RKBA 1R4PB 2KEDA 2VB2X 2TMPA 2JEBI 1ESFA 2NTTA 3KK7A 3R8BA 1HXYD 2PCFB 1RDPD 4G7HC 3W2DA 1EWCA 2X69A 2SEBD 1SMYC 4M1UB 3I4NB 1BQQT 3GP7A 4XYOA 3P20A 4DXFA 1WTVA 3TP7A 2IX1A 1I6HB 4RCNA 3CU7A 4KTAA 1YNJD 3M7GA 1STBA 1S5DD 4BY1B 2XRSD 3S2HB 4NKLA 3ONAB 2LFNA 3T51B 2L5TA 3M85A 2NN6H 1EY0A 2EDGA 5BN5A 2R6GA 5FO7B 2VB3X 3VR3A 2G9DA 2QKIC 2WACA 2AWNA 5C0XJ 4DFAA 2FMMA 4FXGC 1MBYA 5IOCA 1HTPA 2D2CC 3C2PA 3HOUB 3S16B 5KNCA 5FLXE 5I6YA 4ZUIA 5K5PA 2D5DA 3C3LA 2LY7A 2R3ZA 2FMCA 4ZUJA 1BBXC 2NWGA 3MC0B 4X3KA 4CBVA 5KIXA 2IW3A 2MJ8A 2B8FA 1D5XC 4LJZC 3PO2B 3OOCA 3Q0AA 3CKIB 4A3JB 1ET9A 3OW7A 3QOLA 2E75C 2WKCA 5C3EB 3U9OA 5EBDA 2EXZA 1I6VC 4X3TA 5C5MA 1Y1WB 2IPKD 3P7JA 1I4QA 1SYBA 2QCPX 2FINB 1JB3A 1R4QB 1JWMD 2F0QA 4KN4C 2EYPA 2GA4B 3AMUA 4FF2A 1T5EA 3E0JA 3T16A 2K5WA 1D1KA 1A3VA 5COYA 3L3OC 4ILWA 2EY2A 1F9PA 4KHVA 1CQVA 3S1NB 4CJ2C 1EYCA 3Q23A 3K6OA 2K1BA 4HCEA 4KV6A 5EKKA 4FNFA 5CV9A 4KKSA 4C3JB 2RDFA 2B2VA 2K05A 1LTAD 1CA5A 3OWFA 4A3FB 4BY7B 2WV6D 3DEOA 5DEHA 3D4RA 1XX8A 1LTID 1Q1BA 1Q12A 1MI2A 2CW0D 1MD2D 3OIQA 4QUFA 3GV3A 2PNRC 1I4RA 3J7YW 1G2TA 4IUTA 3N52A 5IT9E 3S17B 2KCCA 3GTMB 1AZPA 1AW7A 3KLRA 3SDZA 3KBGA 2JYOA 2F4IA 2J4XA 5G3LD 3SK5A 4KK7A 3OMCA 1FD7D 3D4WA 4XQNA 3ZYYX 3SK8A 3RZDB 3T56B 2XWBB 1SE4A 2H1EA 1D2BA 2K03A 3KUPA 4F88A 4KMUC 3TP5A 1A6XA 3PV0A 2L12A 1STNA 5CGKA 3ND8A 5D14A 1JOKA 1TT2A 1TWHB 4RCOA 4BA2I 4KHZA 1F2LA 4ME5A 1LTSD 1SNMA 3FVQA 1DJRD 4HMJA 1ZYRC 1JWUD 1B9NA 1D1IA 2F0DA 1PTOC 3BG3A 3DHQA 4TSSA 3V2TA 1PTOH 5CMDA 5CV8A 3C46A 3VR4A 1RF2D 3VR5A 2L11A 2EYHA 1BR9A 2A69D 3QOJA 1O7ZA 2XNAC 2B2WC 1RTOA 2V4DA 1ONLA 1Y69U 4QUCA 2C5CA 4R8NA 1H9MA 3ERQA 4C2MB 1I50B 1F2MA 1UAPA 3FKIB 4R9WA 4F7XA 2RSNA 1OXTA 3BS1A 4C3HG 1IYVA 1TS4A 4J6HA 3L9AX 3S14B 1EFID 3KF8A 2ZT9C 4O1NA 3BDOA 2NVYB 3EFXD 3DUZA 5A35A 3D31A 3A54A 1LTTD 1EZ6A 4IN3A 1IHZA 3S1QB 5D3IB 4Y7NB 4H7BA 4EQNA 2JXMB 5ELBA 5CBEE 5M9OA 3RD4A 2O5IC 3URYA 4DGZA 3H09A 5JEAG 3Q24A 5KGUA 2R61A 3BVMA 2HDMA 3P1HA 3D3RA 1VDZA 2RDGA 2B2YA 4QMGA 1KNEA 1QJOA 5I6WA 5M5XB 2AUJD 2A73B 4DNRB 3HG9A 1TWAB 5E4XA 1H9SB 5C44B 1S5CD 2NYZD 3I70A 2PW7A 1BCPF 4ZKBB 4WFN3 4HTHA 1OXVA 2KJXA 4FF4A 1DOLA 2E76C 1LT5D 3K0YA 4K14A 3GTQB 1SYFA 1HCZA 4K5WA 1LABA 1EWHA 3NTKA 3PUVA 4RA8A 4KKTA 3FPPA 1O7LA 3CHBD 5HGTA 5D3DA 2A5HA 2CVRA 1SYGA 3MXNA 4F8MA 2SNMA 1C4QA 1TWGB 2ZXRA 4M8AA 1QE6A 2G9HD 1TQOA 4CKEA 2SNSA 1PRTB 2R93B 5A2QL 4F87A 1H9JA 2B2TA 5NUCA 1LTGD 2F0NA 1CM9A 5IGGA 1H9SA 1SNPA 3PMFA 2JEAI 4XYQA 1SSOA 3I73A 4ULLA 2CHBD 3JAME 1JE4A 3A7AB 3WDNA 1IKMA 3WOFA 3H94A 3SE0A 3M4YA 1NSNS 3LNNA 1TWFB 5FO9B 1QB5D 4A3KB 2I46A 1B50A 1EYDA 5J22A 1AFPA 1B53A 3J7AF 1H9KA 1M8AA 1ML0D 2K28A 5C4JB 1OXXK 1RCVD 2BA0A 4OHJA 1JQYD 2A68D 1G2SA 4IFDH 4H13C 1SYDA 2PZTA 5C4ZA 1UEAB 2LKVA 1STHA 2RBMA 5FOBB 1PRTF 3SK6A 3F2UA 4KN7C 2EJMA 2AUKA 1GUGA 1EQVA 5ELCA 2A74C 3RMHA 2XRQD 4A3EB 4KY6A 3DWQA 2RA4A 4DAVA 4FF1A 2F0TA 2EY5A 2H4OA 1U4MA 5T1IA 3A8JE 4XDXA 5I9OA 2EZVA 3BVGA 5JJZA 1F2ZA 2RDHA 4PQXA 2JA8B 2EY6A 2F0HA 1J9OA 4X3SA 2RKSA 1FYCA 1LT6D 1SXTA 2BOSA 4C1NK 1ZEQX 3S15B 3K5OA 5EPJA 1A15A 2KECA 1NCVA 2KOLA 1BNZA 5IT9L 3BDCA 4TRDA 1LO5D 4E6IA 1S5BD 1SMYD 3RZOB 4ZYSA 4PV1C 1B9MA 3K5LA 5EJWA 4C3IB 3PIP3 1A3TA 3BYTB 1WD0A 3K59A 1BDOA 1XYIA 3FMCA 4WORA 4BWGB 4XT1B 1PYWD 1ZKOA 3MAQA 2E74C 1TVXA 4UAIA 1WTWA 3K7AB 2QILA 5IIFA 5K36G 3NBIA 1FR3A 5M3MB 3MZ5A 2K01A 2K5QA 1HFNA 1SE2A 5JPNC 4XXEA 1SFOB 1BF4A 2F0JA 2WB1B 1J8IA 2NVTB 3A8KE 4HEDA 1KTKA 2DN8A 2N88A 3HOYB 2BE5C 2PMZB 2B2UA 2I07B 2OT2A 4HAEA 1DZ1A 3TP8A 1WTRA 1UNSA 2MHVA 4G4KA 4XTCS 2JA6B 3EROA 1F9RA 2YYZA 1Q1EA 3P75A 1PZJD 4K2LA 4CGYB 1K83B 2F0OA 3QG1A 1OXUA 4ODGA 3D6WA 5HURA 1OO9B 1O7YA 5EBCA 3C1FA 5KNBA 5T1GA 1CTMA 2F3VA 1U4PA 4ZK9B 2F3WA 3V96A 2OEOA 3W3AA 1CHPD 1EYAA 2WP8J 5C0XH 5FK9C 1Y8NB 1U4RA 3GTKB 4IURA 3CQZB 3TZDA 3NXWA 2MUYA 3FEWX 2E2IB 1SBBB 4YIJA 2KQ3A 4K2KA 2JE6I 1A2TA 2B2VC 3HZXA 1DOMA 3MHBA 5JVG3 4KJNA 1PFBA 1V1PB 4LK1C 2EJFC 1D5MC 3G7LA 2HQEA 2K6AA 1HA6A 1Q8IA 2EOTA 1I3QB 3LX0A 4OL7A 1BUVT 2F0KA 3MTSA 1GOZA 1S4ZA 2K04A 4DAYA 1CZGA 4PMWA 1A3UA 1ICWA 2Q8TA 4C3HB 5LL6S 1U4LA 3DM1A 2NTSA 3PUYA 4FXKC 5DM63 1KDAA 1VF7A 1SYCA 4U673 1D5ZC 2F0UA 4EQPA 2JA7B 4IZ8A 4DXGA 4B9WA 1V1PA 5C3XA 5JPMC 1B2TA 2K32A 3DEPA 3IFTA 2EVBA 1CA6A 3DWPA 4XQJA 4L63B 2HDLA 3NHHA 3K5MA 5KRUA 4MHEA 5JEAJ 5KEEA 3T13A 2FFKB 5G3LF 2A6HC 4NP5A 3DXJC 2XVSA 3BZDB 1SNDA 1TIID 4CJ0B 2HCIA 4C1NI 4KD3A 2A6HD 5J39A 2Q8RE 1RD9D 2PZUA 3NTHA 3R2IA 1EEFD 2MP1A 1SNOA 4KY7A 2ICEC 4FYDA 4XIGS 3SR1A 3NK9A 1DOKA 2Z4HA 2F0PA 1ZYRD 1PTOD 3S2DB 3SHLA 3VA5A 4RGMA 1CFMA 1EU4A 2F0SA 5IODA 1G6ZA 1TY0A 5EPLA 3GTLB 2NVQB 4CJ1B 4HN7A 4OO1H 1GUWA 1WCMB 1FNVA 2SDFA 1U9RA 3LWEA 1HQRD 2EYMA 3IL8A 1SE3A 1GHJA 1X3QA 1SJHD 2DY7A 4FVMA 2E2HB 3A55A 5EQ0A 1DM0B 5C6AA 2DNCA 3D8GA 4G57A 3J80E 2F0GA 3GD7A 4IALA 2EE1A 3SK4A 3EJIA 2EYJA 1CQFA 3GV6A 1Z6HA 4A3IB 1KLGD 1BCPB 3QB3A 4B9XA 1I4XA 4WRDA 2B2YC 2MGSA 1QCBD 3A56A 3FDTA 3HOZB 1LTRD 4XQQA 4ZKCB 1GXDC 1Q3LA 4C56C 4DNTB 3GTPB 2WKDA 1Z47A 3A8IE 4J1MA 4S3SA 2L55A 4AYBB 5JVH3 1VF5C 1NR2A 1LT3D 5C4HA 1F77A 2CQAA 3I90A 1VCIA 3CRKC 4GZYC 3D6CA 4R8IA 1DYQA 5JOBA 1TWCB 4PMCA 4ID6A 3IAYA 1KLUD 2NBFA 2Z8LA 5KNDA 5LHY1 3NPPA 1XWEA 1UUPA 4V0BA 1BOSA 2AWOA 5JAVA 1WD1A 5CORA 5E1FA 1K8OA 4CKCA 1L0XB 1PZKD 3HKZB 3R93A 4IUNA 1EY6A 3O13A 4MIUA 1TU2B 4FP5D 1NAPA 4Q0FA 1TKWB 2B2TC 3AB9A 2HUGA 5AFWA 3HOVB 1TS5A 3ND9A 4O42A 3TZUA 4X3UA 1WTOA 1WTPA 5DAUA 3PO3B 2FJ2A 1QG7A 1ENFA 3NUCA 5FLXL 1CK1A 4IFDI 2O4XA 4N9TA 1WTQA 1X32A 5ISRA 1B4OA 1RTNA 2O2LD 1EQTA 3HOWB 1TR5A 4ZQ3A 1LTBD 1HRJA 1STGA 3H91A 2AQ3B 4K6DA 3R2TA 4HCSA 4RGOS 3MXUA 3KLSA 4QB4A 5IGBA 4Q5VA 5ELEA 1JR0D 2F0LA 2D9UA 2EYOA 4QF4A 2PZWA 1TS3A 5IGDA 2WAQB 3OMGA 2IX0A 1PRTC 3NWSA 3J7AV 1II3A 3S9WA 3BDLA 4V190 2YU9B 1E2VA 2ID0A 2PQEA 3SEBA 1F9SA 2Z1CA 4NDXA 4A3MB 1SNCA 4K8IA 4K8JA 2QEJC 3MEHA 1FNUA 1L0YB 1GUTA 3I72A 5KYIA 2BDNA 2SOBA 1PZID 2J7ZA 3V05A 2HCCA 4RGNA 3VYSA 4DK0A 4G7ZC 1Y8PB 1QOHA 3DMUA 5TSSA 5M5WB 1R9TB 3GTOB 1LT4D 1Q90A 2KCNA 1HFGA 3A7LA 1CHQD 1HUNA 5I2XA 5F2DA 1QNKA 1ENAA 4KJOA 1WTXA 3I4LA 1HTLD 1A2UA 2QF7A 4TKOB 3GQBA 5M3FB 1K8MA 4RH6A 2J0TD 3MXGA 1KDBA 1GHKA 1DONA 1IKLA 1G91A 5CV7A 3QO2A 4XT3B 5FKAC 1B3AA 2ZXPA 1DCZA 1F9QA 3OSOA 2NN6I 3RLFA 4OIKA 1DXMA 3TMEA 4QCLA 4A93B 1ZXTA 2K7VA 1H9RA 2BCOA 1O78A 4IFDG 4KD4A 2L1BA 3PUXA 1YNJC 3Q6SA 4ZRZA 4DA2A 2EPBA 4H44C 1OXSC 4DAPA 1HHVA 3UI2A 4B08A 2B63B 4DU9A 4IQZA 4HSPA 1VMPA 2B2UC 3QWNA 3J81E 4FO2A 3L7ZC 1M4VA 3ITPA 1SJED 5LL6X 3MWYW 4BS9A 1E2WA 5C0XI 5FO8B 2B8GA 4DF7A 5IGEA 1WVLA 4RWSC 1MGSA 1AN8A 3KLSX 4K5XA 3I3CA 1EY7A 2QDBA 4ABNA 2BE5D 5CBAE 3EA6A 5A2QE 2XN9C 1BXTA 3K58A 2ZXOA 1GUOA 3MFYA 5C5LA 1V8QA 4JK1C 5E4WC 5I2YA 4G7OC 3RUZA 4RAUC 3T4AC 3SXHA 1Y8OB 1JCKB 4HR7B 5D65A 3M3YB 1NUCA 2MPMA 3HEJA 2F0EA 2NUCA 3VYRA 1RKNA 2IJ0A 3J80L 4LAAA 2NN6G 1JORA 4L6TB 3I8ZA 1AP0A 3TSSA 2F0MA 1G291 5CYUA 3Q22A 1QILA 4RHSA 2NB0A 1PXUA 2O5JC 2L4NA 2EJGC 2KUMA 1W6JA 1C48A 4BBSB 4C3IG 3NTIA 2M2LA 1S5ED 2ENBA 3VR2A 1KDCA 3G6JB 3TP6A 1EIHA 2DNEA 2OXPA 5EGTA 1FNWA 5BN4A 2JSOA 4EVOA 1QNUA 4N9PA 3K57A 4RKLA 3X3NA 5CC4A 3IKJA 4UDUC 3NSWA 3FRPB 3MVVA 3I91A 3GO5A 2CW0C 3X3MA 2XIWA 2K33A 1LV9A 1SEBD 1I4HA 1TS2A 4JBWA 1B44D 3HS0C 2F0VA 1SAPA 5EKLA 1RJTA 5C0XG 5CV5A 2A6EC 1XXGA 4RGTA 3S1MB 3BYYB 1ET6A 1EY8A 3NQTA 2BDOA 2BA1A 2F0IA 3NBHA 3GTGB 1ESRA 1GJXA 1HQMC 4QIWB 1XTCD 2A6ED 5IGFA 4P2CB 2EYFA 2IT1A 3TN2A 2Y0SB 2K5DA 2C9OA 2E2JB 3TBIB 3I4MB 2M00A 1PTOB 3HRZC 1I4PA 2E2DC 2KA7A 2XWJB 2LMCB 4KI0A 4OO1I 1EY4A 3IFDA 2NVXB 3SVMA 1E0BA 5I9PA 2Z4IA 2B39A 2IWHA 3VYTA 4J8QA 1EIGA 1O80A 4WJWA 3HOXB 2VUMB 1JICA 3JAML 3HP3A 1YNNC 2X6LA 1SNQA 1JC7A 2A69C 4K5VA 3H0GB 3PUZA 4ZAIA 1TY2A 4HSVA 2EY1A 2XSCA 5JEAH 5C4XB 2JA5B 2D62A 1AEXA 5DNFA 1G8ZD 1E2ZA 1YNND 1EOTA 1HA5A 1RODA 4ZLTF 3E5SA 4C3JG 1Y1VB 3PUWA 2N55A 4LMQD 3C1EA 3MXPA 1QWYA 3D4DA 1PTOF 1DD2A 5EKIA 4L8JA 1C8CA 5I4DA 1CT1D 4RHRA 4IUVA 1KNAA 1JOQA 2PW5A 2R7ZB 1FGBD 3NE5B 4KY5A 2NZ1D 4OIJA 4NMZA 3OWEB 5M5YB 4I65A 2M9VA 1EZ8A 2B2WA 2KVMA 3H3VC 1T5XD 3QJYA 5CV6A 1HUMA 3HGBA 4TQUS 1V1OA 4IUPA 1IL8A 1IYUA 1HPCA 3PIO3 4A3GB 3U9SA 2Q8IB 3K5NA 1EY9A 4MN3A 1EL0A 2LS01 2RVLA 2PPBC 3CRLC 2F1MA 2KEEA 2AQ2B 3VYUA 2L0CA 4FF3A 3VR6A 3OPOA 4CHTB 4IUQA 2WINB 1PDQA 1V43A 2R92B 3AU7A 4IUUA 4A3BB 1B1ZA 5J1ZA 1CI3M 5BN3A 1BCPC 2IX3A 1PLFA 3WOEA 4OO1G 4KKUA 1RHPA 3S1RB 4OGQC 3H6MA 1S5FD 2F0WA 5ELDA 1PFMA 1KABA 3TDQA 3R3OA 1W6KA 1BCPD 4I7ZC 5E3FA 4EQOA 1NR4A 2VXWA 4RFBA 4K6LA 3OIPA 3M7NA 1MSHA 1GUSA 1JWSD 3KBXA 1LACA 3NWTA 1X3PA 2ICIA 1EY5A 2FHTA 1IW7C 3LWUA 1GUNA 3J81L 4Z9CB 1CZWA 1EEID 4FXDA 4A3DB 5C3WA 1AZQA 2F0FA 3M4OB 1IW7D 3MFGA 3MA2B 2WIIB 2PO4A 3OHXC 3EVQA 5IGCA 1JOOA 1Z7TA 4PNYA 1LLRD 1I4GA 3NQIA 3DWAA 1STAA 2DY8A 1VMCA 2RQXA 4HMIA 4PMBA 3EQLC 2VNUD 3BVZA 1PMRA 4IFDJ 3T53B 4BA1I 2TSSA 2JP1A 1ENCA 1ILQA 2AQ1B 2PYKA 4NW2A 2RSOA 2KHSA 3QIAA 4U68A 1STEA 2A68C 4EGVA 1BO0A 4BBRB 5CV4A 2EYLA 5DM73 1PFNA 4CKBA 1PRTD 1SYEA 3VA7A 4DN4M 1MSGA 5CR3A 3NP8A 1KAAA 2F03A 5KYLA 1EU3A 2OF1A 1SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO2 A;  1X3P A;  4XT3 B;  3TZD A;  2FHT A;  1ILP A;  1WD0 A;  1WVL A;  2FFK B;  2B2Y C;  1B3A A;  2MGS A;  2NZ1 D;  1B53 A;  3FPU B;  2B2V A;  4OIJ A;  5CMD A;  1M8A A;  1X32 A;  1ML0 D;  2K05 A;  2K28 A;  5E4W C;  1F9Q A;  1B4O A;  2L9H A;  3FDT A;  5EPK A;  1XYI A;  2L11 A;  1RTN A;  4OIK A;  4ZKC B;  2X6G A;  2B2W A;  1EQT A;  2KVM A;  1CA5 A;  2B2V C;  1Q3L A;  1ESR A;  1DOM A;  4RAU C;  4XT1 B;  3DEO A;  1O7Z A;  4CJ0 B;  2B2W C;  1TVX A;  1XX8 A;  2HCI A;  4UAI A;  1G2S A;  1RTO A;  1ZXT A;  2IL8 A;  1HUM A;  5D65 A;  5E4X A;  2FMM A;  1WTW A;  1AZQ A;  2NYZ D;  1NR2 A;  2MPM A;  1PFB A;  4QUC A;  1HRJ A;  3H91 A;  3TN2 A;  1MI2 A;  2Q8R E;  3I90 A;  2K01 A;  2KED A;  4HCS A;  4IUP A;  1IL8 A;  1HFN A;  2L1B A;  2MP1 A;  1G91 A;  4QUF A;  3GV3 A;  3Q6S A;  4MN3 A;  1EL0 A;  3G7L A;  3F2U A;  4R8I A;  4R9W A;  4ZKB B;  1DOK A;  2D9U A;  1BF4 A;  2DY8 A;  2RSN A;  2RVL A;  2EPB A;  2R3Z A;  3I8Z A;  1VMC A;  1AP0 A;  1G2T A;  1J8I A;  1HHV A;  4IUT A;  1BBX C;  3N52 A;  1HA6 A;  2KEE A;  2NWG A;  4X3K A;  1DOL A;  3UI2 A;  4HED A;  2EOT A;  1AZP A;  3IFD A;  3SVM A;  2L4N A;  2MJ8 A;  2KUM A;  2X69 A;  1E0B A;  2N88 A;  2B2U A;  4IUQ A;  4RA8 A;  3MTS A;  1F9S A;  2RA4 A;  2JP1 A;  1PDQ A;  1S4Z A;  2K04 A;  2M2L A;  1EIG A;  4HAE A;  2JYO A;  1O80 A;  1ILQ A;  1VMP A;  5EPL A;  1DZ1 A;  1G6Z A;  1WTQ A;  2B2U C;  1EIH A;  4CJ1 B;  1WTR A;  1U4M A;  1ICW A;  5T1I A;  4IUU A;  2Q8T A;  4XDX A;  2CVR A;  1GUW A;  1WD1 A;  1U4L A;  1JIC A;  3DM1 A;  5JJZ A;  1WTV A;  1F9R A;  2BDN A;  5COR A;  4NW2 A;  3HP3 A;  2RSO A;  2X6L A;  2J7Z A;  4X3T A;  1PLF A;  2SDF A;  2HCC A;  1J9O A;  1RHP A;  4U68 A;  4X3S A;  2H1E A;  1QE6 A;  3LWE A;  3MWY W;  2K03 A;  3KUP A;  3P7J A;  3IL8 A;  3R93 A;  5CBE E;  3D6W A;  1X3Q A;  2DY7 A;  4ZAI A;  1PFM A;  1O7Y A;  2L12 A;  4HSV A;  1BO0 A;  5EQ0 A;  2B2T A;  2FIN B;  3I91 A;  5T1G A;  5DNF A;  1NAP A;  5D14 A;  1CM9 A;  1HFG A;  1U4P A;  1EOT A;  2EE1 A;  1ROD A;  1PFN A;  2B2T C;  5EPJ A;  4ZLT F;  1HUN A;  4ZK9 B;  1NR4 A;  1SSO A;  1A15 A;  2HUG A;  2VXW A;  4RWS C;  1JE4 A;  1MGS A;  2XIW A;  3ONA B;  5AFW A;  2N55 A;  2KEC A;  1QNK A;  5COY A;  4LMQ D;  1WTX A;  1B2T A;  1NCV A;  3I3C A;  4DN4 M;  2KOL A;  1BNZ A;  1LV9 A;  1MSG A;  1IKM A;  1F2L A;  2HDM A;  4O42 A;  1F9P A;  3GV6 A;  3DEP A;  1MSH A;  5EKI A;  1C8C A;  4X3U A;  1WTO A;  5CBA E;  1WTP A;  1U4R A;  3KBX A;  1CA6 A;  4IUV A;  2FJ2 A;  1SAP A;  4CJ2 C;  1SDF A;  1KNA A;  1RJT A;  2B2Y A;  4IUR A;  2HDL A;  2K1B A;  5EJW A;  1IKL A;  1DON A;  1QG7 A;  4MHE A;  1B50 A;  1KNE A; 
#chains in the Genus database with same CATH topology
 1WI5 A;  1ILP A;  1NJI C;  3FPU B;  2L9H A;  5EPK A;  4AQY L;  3CC4 A;  2X6G A;  3CXC A;  1STY A;  5K36 H;  4DK1 A;  3GTJ B;  1D6E C;  3N6R A;  2YU9 H;  3DM3 A;  1MJC A;  2IL8 A;  4H0L C;  2UUC L;  3BJU A;  1F2Y A;  5ELF A;  3E6Z X;  3BU2 A;  2CH4 W;  4RKB A;  1R4P B;  2JN4 A;  4P72 A;  2KED A;  2VB2 X;  2TMP A;  2JEB I;  2UU9 Q;  4RG1 A;  1UEB A;  1ESF A;  2NTT A;  5IP9 G;  4LF5 L;  3KK7 A;  4UY8 C;  3R8B A;  1N34 L;  1S3O A;  1BBW A;  1HXY D;  2PCF B;  1RDP D;  4G7H C;  3W2D A;  1X3G A;  1EWC A;  2X69 A;  2SEB D;  1HZA A;  5M5W H;  3PO3 G;  2UUB L;  1SMY C;  4M1U B;  2R93 G;  2GVB A;  3I4N B;  1BQQ T;  3GP7 A;  4XYO A;  3AFQ A;  4NXN Q;  3P20 A;  4DXF A;  3GTJ H;  2VQF Q;  1WTV A;  3TP7 A;  1XJV A;  2IX1 A;  1HH2 P;  5M3F H;  4DV3 Q;  1I6H B;  1M1K C;  4RCN A;  3CU7 A;  4DR7 Q;  1JJ2 A;  1YIT A;  2RF4 A;  3KFU A;  4KTA A;  1YNJ D;  1KQS A;  3M7G A;  4JI5 L;  4DUZ L;  1N8R C;  4UHV A;  1STB A;  1S5D D;  4WJ4 A;  4BY1 B;  2XRS D;  2UXD L;  3S2H B;  4NKL A;  3ONA B;  4NPS A;  1MJE A;  2LFN A;  3T51 B;  4QIW E;  2L5T A;  1IL2 A;  4N8X 1;  4DUY L;  3F1Z A;  3M85 A;  3EN2 A;  3FP9 A;  1U5K A;  3I4N H;  2NN6 H;  1EY0 A;  2EDG A;  4OWX B;  5AJ3 Q;  1Q8K A;  1J5E L;  5BN5 A;  2GVA A;  2R6G A;  3UDI A;  4GS3 A;  1PH2 A;  4LWC A;  1I6H H;  4GN4 B;  4B3S L;  5FO7 B;  4HJ9 A;  2VB3 X;  3VR3 A;  4O2D A;  1CKM A;  1KL9 A;  2G9D A;  2QKI C;  4DR5 Q;  2WAC A;  2AWN A;  5C0X J;  4DFA A;  2FMM A;  4FXG C;  4IO9 A;  1MBY A;  4UP7 A;  4NB3 A;  5IOC A;  1RIP A;  1HTP A;  4LFC L;  2D2C C;  3C2P A;  4A3E G;  1HNX Q;  4BY1 H;  3HOU B;  3S16 B;  1VQC A;  5KNC A;  5FLX E;  4PZ7 A;  3RN5 A;  5I6Y A;  1KIX A;  2K14 A;  4ZUI A;  5K5P A;  2D5D A;  3C3L A;  2LY7 A;  4BXX G;  2R3Z A;  3CCS A;  2FMC A;  4LF4 L;  4ZUJ A;  4LFB Q;  4LW1 A;  1BBX C;  3PIO A;  2NWG A;  3MC0 B;  4X3K A;  4CBV A;  1CSQ A;  4IPD A;  5KIX A;  2IW3 A;  2JA8 G;  1SLJ A;  4MTK A;  2MJ8 A;  2B8F A;  2ZM6 Q;  1D5X C;  1VQ8 A;  4LJZ C;  3PO2 B;  1XPR A;  3OOC A;  3Q0A A;  3CKI B;  4A3J B;  1ET9 A;  3OW7 A;  5LMU L;  3QOL A;  2E75 C;  2WKC A;  3J80 i;  5C3E B;  1PH3 A;  1SMX A;  3U9O A;  2Z6B A;  5EBD A;  2EXZ A;  1I6V C;  1EUJ A;  4X3T A;  5C5M A;  1RL2 A;  1Y1W B;  1N9W A;  4CDD C;  3JAM c;  4A93 G;  2IPK D;  4LF6 L;  3P7J A;  1I4Q A;  3S16 H;  1SYB A;  2QCP X;  2FIN B;  5BR8 L;  3I55 A;  1JB3 A;  1R4Q B;  1JWM D;  2F0Q A;  4KN4 C;  1AH9 A;  2EYP A;  2GA4 B;  4JI8 Q;  2MNA A;  3AMU A;  1U0L A;  4FF2 A;  1T5E A;  4GKJ L;  1XMO L;  3E0J A;  3T16 A;  2K5W A;  1D1K A;  4DK3 C;  1A3V A;  5COY A;  3L3O C;  4HJ8 A;  2B3G A;  4ILW A;  2EY2 A;  4IPG A;  3PO2 H;  1F9P A;  4X62 Q;  2IHF A;  4KHV A;  1CQV A;  3S1N B;  4CJ2 C;  1EYC A;  4A3J H;  3Q23 A;  3K6O A;  2K1B A;  4HCE A;  4KV6 A;  5EKK A;  4FNF A;  5CV9 A;  5M3M G;  5C3E H;  4KKS A;  4C3J B;  2RDF A;  2B2V A;  2K05 A;  2HT1 A;  3L0O A;  1KHI A;  1LTA D;  1Y1W H;  1CA5 A;  3OWF A;  1LUZ A;  2VQE L;  4A3F B;  4BY7 B;  2WV6 D;  1YNX A;  2WB1 G;  3DEO A;  4QY7 A;  5DEH A;  3D4R A;  1XX8 A;  1LTI D;  4ME3 A;  1N33 Q;  3CPF A;  2Z6K A;  4HJ7 A;  5IYD H;  1Q1B A;  1Q12 A;  3D0F A;  5ELN A;  1MI2 A;  3HOY G;  4JC0 A;  2CW0 D;  1MD2 D;  2CH4 A;  1DGS A;  1HNZ L;  2XTI A;  3OIQ A;  4QUF A;  3GV3 A;  2PNR C;  1I4R A;  1WTH A;  4DPG A;  3J7Y W;  2Z0S A;  1G2T A;  2JA6 G;  4IUT A;  3N52 A;  5IT9 E;  2EIF A;  1G6P A;  3S1N H;  3S17 B;  2RHS B;  4QQB X;  2KCC A;  3GTM B;  1AZP A;  1AW7 A;  3KLR A;  4DV7 Q;  2DUD A;  3SDZ A;  3KBG A;  2JYO A;  2F4I A;  2J4X A;  4A3F H;  5G3L D;  4BY7 H;  3SK5 A;  4KK7 A;  3OMC A;  1SE8 A;  1FD7 D;  3D4W A;  4XQN A;  3ZYY X;  5IWA L;  3SK8 A;  3RZD B;  3T56 B;  1EIY B;  2XWB B;  1SE4 A;  2H1E A;  1D2B A;  2K03 A;  1P8L A;  3KUP A;  4F88 A;  4KMU C;  3HKZ E;  3TP5 A;  4K0K Q;  2JQO A;  1A6X A;  3PV0 A;  2L12 A;  2CCZ A;  1STN A;  4P74 A;  3ND8 A;  5CGK A;  5D14 A;  1NBW A;  1JOK A;  3VDY A;  3GTG H;  1TT2 A;  1TWH B;  3S17 H;  4RCO A;  3KF8 B;  4JI4 L;  1VQH A;  1S72 A;  3GTM H;  4BA2 I;  4KHZ A;  1BVS A;  1C0A A;  1F2L A;  4ME5 A;  1TXY A;  1LTS D;  1SNM A;  3FVQ A;  1DJR D;  2MFI A;  1Q86 C;  3WWV A;  4HMJ A;  3TEH B;  1ZYR C;  1JWU D;  1B9N A;  1D1I A;  2F0D A;  1PTO C;  3BG3 A;  3H3V I;  1VQM A;  3DHQ A;  2IHE A;  4TSS A;  3T1H Q;  3V2T A;  1PTO H;  2N78 A;  1IYJ B;  5CMD A;  2L15 A;  5CV8 A;  3C46 A;  3VR4 A;  1RF2 D;  3VR5 A;  2L11 A;  3RZD H;  2EYH A;  4CDC C;  5IY0 A;  3FHW A;  1YZ6 A;  1BR9 A;  2A69 D;  4DV5 L;  3QOJ A;  1O7Z A;  4OON A;  2XNA C;  2B2W C;  1RTO A;  2V4D A;  1ONL A;  3KF6 B;  1Y69 U;  3CCQ A;  5HGQ A;  4QUC A;  2C5C A;  1ASY A;  4R8N A;  4A3C G;  1TWH H;  2VUM H;  1M90 C;  1H9M A;  3ERQ A;  4C2M B;  1I50 B;  1F2M A;  1UAP A;  3FKI B;  4R9W A;  4F7X A;  1FGU A;  1OXT A;  2RSN A;  4JVZ A;  3BS1 A;  4C3H G;  3OW2 A;  1IYV A;  1TS4 A;  2I5M X;  3H0G H;  4J6H A;  3ERS X;  3L9A X;  1UE7 A;  3S14 B;  1XMQ L;  1EFI D;  3KF8 A;  3K81 C;  5FJ8 G;  2ZT9 C;  5IE8 A;  1E7Z A;  4O1N A;  3BDO A;  2NVY B;  3A5U A;  3EFX D;  3DUZ A;  5A35 A;  3D31 A;  3A54 A;  4JCV E;  2PI2 A;  1YEZ A;  1PHJ A;  1LTT D;  1EZ6 A;  4IN3 A;  1IHZ A;  4DR2 L;  3EBE A;  3S1Q B;  5D3I B;  4Y7N B;  4H7B A;  4EQN A;  2HHH L;  2JXM B;  5ELB A;  1EQR A;  5CBE E;  5M9O A;  3RD4 A;  2O5I C;  2R7D A;  3URY A;  3K7U C;  4DGZ A;  4C2M H;  1I50 H;  4CDE C;  2XGT A;  3FKI H;  1C9O A;  3H09 A;  2BH2 A;  3I4M G;  3KF6 A;  4JV5 L;  5JEA G;  1N32 Q;  3I2Z A;  3Q24 A;  5KGU A;  2R61 A;  3BVM A;  2HDM A;  3B6Y A;  1PH8 A;  3P1H A;  3D3R A;  1VDZ A;  2NVY H;  2RDG A;  3M9B A;  2B2Y A;  4QMG A;  3MXN B;  1KNE A;  4HIK A;  3G71 A;  1QJO A;  5I6W A;  5M5X B;  3S1Q H;  4Y7N H;  1W2B A;  4JYA L;  3M4P A;  2AUJ D;  2A73 B;  4DNR B;  3HG9 A;  1TWA B;  4YHH L;  5E4X A;  1H9S B;  5C44 B;  1S5C D;  2NYZ D;  3I70 A;  2R7F A;  2E8G A;  5C4X G;  2PW7 A;  2UXC Q;  1BCP F;  2JA5 G;  2YTX A;  4ZKB B;  1Y1V G;  4KHP L;  4WFN 3;  4ALP A;  4HTH A;  3J81 i;  1VQA A;  1WOC A;  1OXV A;  2KJX A;  3U50 C;  4FF4 A;  1FJG L;  1DOL A;  1Q46 A;  1LT5 D;  2E76 C;  3K0Y A;  4K14 A;  4DR3 Q;  1SYF A;  3GTQ B;  4GNX C;  2OTL A;  1HCZ A;  3CCM A;  4K5W A;  1LAB A;  1EWH A;  1L2F A;  3NTK A;  3PUV A;  4RA8 A;  5M5X H;  4KKT A;  3FPP A;  4N8F A;  4X66 L;  1O7L A;  2R7Z G;  3CHB D;  5HGT A;  5D3D A;  2A5H A;  1L1O B;  2CVR A;  4JI0 Q;  3NEN A;  1SYG A;  3MXN A;  4OX9 L;  4F8M A;  2SNM A;  1C4Q A;  1TWG B;  2ZXR A;  4M8A A;  1QE6 A;  2G9H D;  1TQO A;  4CKE A;  2SNS A;  4A3I G;  1PRT B;  2R93 B;  5A2Q L;  4F87 A;  1H9J A;  2B2T A;  4MTN A;  2B29 A;  4EQ5 A;  5NUC A;  1LTG D;  2AKW B;  2F0N A;  1CM9 A;  5IGG A;  1H9S A;  1SNP A;  1G51 A;  3PMF A;  2UUA L;  2JEA I;  4XYQ A;  1SSO A;  3I73 A;  4ULL A;  2CHB D;  3JAM E;  1JE4 A;  3GTQ H;  3HOZ G;  4POF A;  3A7A B;  3WDN A;  1IKM A;  3WOF A;  3H94 A;  1HZB A;  3PCO B;  3SE0 A;  3M4Y A;  1NSN S;  4OWT B;  3LNN A;  1TWF B;  3CF5 A;  5FO9 B;  1QB5 D;  4A3K B;  3RNU A;  2I46 A;  5IP9 H;  1B50 A;  3F2D A;  1EYD A;  4ZCK A;  5J22 A;  1AFP A;  3PGZ A;  1B53 A;  3J7A F;  1H9K A;  1M8A A;  1K8G A;  1ML0 D;  2K28 A;  1HZC A;  5IYC G;  3KJO A;  1TWG H;  5C4J B;  1OXX K;  1RCV D;  1W3S A;  1I94 L;  2BA0 A;  4JI3 Q;  4OHJ A;  1IBM L;  1JQY D;  1X56 A;  2A68 D;  1JT8 A;  4AQY Q;  2R93 H;  1G2S A;  1L1O A;  4IFD H;  4GN3 B;  4H13 C;  1SYD A;  2KCM A;  2PZT A;  5C4Z A;  1UEA B;  5GAH C;  2LKV A;  1H95 A;  3I4O A;  2UUC Q;  1LM0 A;  1STH A;  2RBM A;  5FOB B;  1PRT F;  3SK6 A;  3F2U A;  4KN7 C;  2EJM A;  3RLN A;  2AUK A;  4GLV B;  4DV6 L;  1GUG A;  1EQV A;  1TWF H;  5ELC A;  2A74 C;  1Q82 C;  4A3K H;  4GLA C;  1CSP A;  3RMH A;  4BBR H;  2XRQ D;  3HKZ G;  4OEM B;  4A3E B;  5IYB G;  1L0W A;  1N34 Q;  4KY6 A;  2Q2I A;  2JJQ A;  3DWQ A;  2RA4 A;  4DAV A;  5C4J H;  1AE3 A;  2F0T A;  4FF1 A;  2EY5 A;  2H4O A;  1U4M A;  5T1I A;  3A8J E;  4LF7 L;  4XDX A;  5I9O A;  2EZV A;  2UUB Q;  1NTG A;  1YBY A;  3BVG A;  5JJZ A;  1F2Z A;  2RDH A;  4PQX A;  3J80 c;  1HZ9 A;  2JA8 B;  2EY6 A;  2F0H A;  1IBK L;  1J9O A;  3HOV G;  4A3D G;  3QR8 A;  4X3S A;  3CPW A;  2RKS A;  1FYC A;  1LT6 D;  1SXT A;  2BOS A;  4C1N K;  1ZEQ X;  2HIX A;  3S15 B;  3K5O A;  5EPJ A;  2A1A A;  1A15 A;  1YIJ A;  4DUZ Q;  2KEC A;  1E1T A;  1NCV A;  2KOL A;  1BNZ A;  5IT9 L;  3HOW G;  3BDC A;  4TRD A;  2UXD Q;  1LO5 D;  4E6I A;  1S5B D;  1SMY D;  3RZO B;  4ZYS A;  4PV1 C;  1B9M A;  3K5L A;  5EJW A;  4C3I B;  4B3R Q;  3PIP 3;  2LXJ A;  4BXX H;  1A3T A;  2G5D A;  3BZC A;  3J7A 5;  3BYT B;  1WD0 A;  3CD6 A;  2A19 A;  3K59 A;  1BDO A;  2JA8 H;  1XYI A;  3FMC A;  3IRB A;  4WOR A;  4BWG B;  3CAM A;  3PSI A;  4XT1 B;  1PYW D;  1ZKO A;  2WAQ G;  3MAQ A;  2E74 C;  1TVX A;  4UAI A;  1WTW A;  2K52 A;  3K7A B;  1VQN A;  2QIL A;  5IIF A;  5K36 G;  3NBI A;  1FR3 A;  2K5H A;  3S15 H;  5M3M B;  3G6E A;  3MZ5 A;  2K01 A;  2K5Q A;  2Y0S E;  4MZ9 A;  1HFN A;  1J6Q A;  3RLO A;  1SE2 A;  1UE6 A;  5JPN C;  2HIV A;  4A3M G;  4XXE A;  4LFC Q;  1SFO B;  1EYG A;  1BF4 A;  1SR3 A;  2F0J A;  1PH4 A;  2WB1 B;  2GN5 A;  3RZO H;  1J8I A;  2NVT B;  3A8K E;  4DV2 L;  1O7I A;  4HED A;  4C3I H;  1KTK A;  2DN8 A;  1T9H A;  4LF4 Q;  1VQB A;  2N88 A;  3HOY B;  2BE5 C;  2PMZ B;  2B2U A;  2I07 B;  4L5T A;  2OT2 A;  4HAE A;  4JI2 Q;  1DZ1 A;  2RHQ B;  3S2H H;  2YV5 A;  3TP8 A;  1HNW L;  3E9I A;  1WTR A;  1UNS A;  2FXQ A;  2MHV A;  4G4K A;  1VQJ A;  4XTC S;  3ERO A;  2JA6 B;  1F9R A;  1K28 A;  2YYZ A;  4A3L H;  1Q1E A;  3P75 A;  1PZJ D;  4K2L A;  3A5Z B;  3GDE A;  1K83 B;  2F0O A;  4CGY B;  5LMU Q;  4L5S A;  5M3M H;  3QG1 A;  1OXU A;  4ODG A;  3D6W A;  5M3F G;  4QJF A;  5HUR A;  1OO9 B;  1O7Y A;  5EBC A;  3C1F A;  4P73 A;  5KNB A;  5T1G A;  4B3T Q;  1SFO H;  4LF6 Q;  1CTM A;  2F3V A;  4DR5 L;  1U4P A;  1QZG A;  2CKZ B;  4ZK9 B;  2NVT H;  5BR8 Q;  1LYL A;  2F3W A;  3V96 A;  1IBL L;  1KAW A;  2OEO A;  3W3A A;  1CHP D;  1EYA A;  2WP8 J;  5C0X H;  3HOY H;  1X6O A;  5FK9 C;  1XMO Q;  4DAY B;  1Y8N B;  1U4R A;  4DV4 L;  3HOU H;  3GTK B;  1VQG A;  4IUR A;  4GOP B;  3CQZ B;  3TZD A;  3NXW A;  4DK6 C;  2MUY A;  3KJP A;  1PH5 A;  4POG A;  2JA6 H;  3FEW X;  2E2I B;  1NE3 A;  1SBB B;  4YIJ A;  2KQ3 A;  4K2K A;  1K83 H;  2JE6 I;  2ZM6 L;  1A2T A;  2B2V C;  3HZX A;  1DOM A;  1B3Q A;  3MHB A;  3CW2 C;  3UDG A;  5JVG 3;  4KJN A;  1BKB A;  4LF8 Q;  4A4I A;  2VQE Q;  2B63 G;  2AHO B;  1QUQ B;  3TQY A;  1PFB A;  4DR1 Q;  1V1P B;  2KBN A;  2ZTE A;  1WFQ A;  2Z6K C;  4LK1 C;  1SN8 A;  2EJF C;  1D5M C;  2F52 A;  4APV A;  1A63 A;  3G7L A;  2HQE A;  2K6A A;  4O0A A;  1HNZ Q;  1HA6 A;  1Q8I A;  2EOT A;  3GTK H;  1I3Q B;  3CQZ H;  4JI8 L;  1XTD A;  5JJK A;  3LX0 A;  4OL7 A;  1BUV T;  2F0K A;  2E2I H;  3MTS A;  1E1O A;  1GOZ A;  3UDX A;  1S4Z A;  2K04 A;  4DAY A;  1CZG A;  4PMW A;  1A3U A;  1ICW A;  2Q8T A;  4C3H B;  5LL6 S;  1U4L A;  3DM1 A;  2CQO A;  4GOP A;  2NTS A;  3PUY A;  4FXK C;  5DM6 3;  1XNR L;  1KDA A;  1VF7 A;  3OTO Q;  1SYC A;  2H5X A;  4U67 3;  4JG2 A;  1D5Z C;  2F0U A;  2OTJ A;  4EQP A;  3UDF A;  4C3J H;  2DJG C;  3NEM A;  4HIO A;  2JA7 B;  4IZ8 A;  1B70 B;  4DXG A;  1QUQ A;  4AH6 A;  1K3B C;  4B9W A;  1V1P A;  1S40 A;  2CFM A;  3E9H A;  1I3Q H;  5C3X A;  5JPM C;  1B2T A;  5FLM H;  2K32 A;  3DEP A;  4A3C H;  4JI4 Q;  3IFT A;  2F3I A;  1UWV A;  2EVB A;  1CA6 A;  3DWP A;  2MO1 A;  4XQJ A;  4L63 B;  5EAY A;  2HDL A;  3NHH A;  3K5M A;  5KRU A;  4MHE A;  1VQF A;  3RN2 A;  4JI7 L;  5JEA J;  3SGI A;  4C3H H;  5KEE A;  3T13 A;  2FFK B;  3F2B A;  1VQ6 A;  5G3L F;  2A6H C;  4NP5 A;  3DXJ C;  1PYS B;  4GN5 A;  4DV7 L;  4H02 A;  2XVS A;  3BZD B;  1SND A;  1TII D;  4CJ0 B;  1EQQ A;  2HCI A;  4C1N I;  3I7F A;  4KD3 A;  4DAM A;  2A6H D;  1QVC A;  2JA7 H;  5J39 A;  2Q8R E;  1RD9 D;  2PZU A;  4BBS G;  3NTH A;  2ZTD A;  3R2I A;  4LF9 Q;  1EEF D;  2MP1 A;  5IYD G;  1SNO A;  4KY7 A;  2ICE C;  2YTV A;  4FYD A;  4XIG S;  3SR1 A;  3NK9 A;  1DOK A;  2LXK A;  4DKA C;  2Z4H A;  1NMF A;  2F0P A;  3J81 c;  4DR6 L;  1ZYR D;  3DLL A;  4YCW A;  1PTO D;  3S2D B;  3CP0 A;  4X65 L;  3SHL A;  5L37 A;  3S24 A;  3VA5 A;  4RGM A;  1CFM A;  2ZTC A;  1KRT A;  4JPB W;  1EU4 A;  2F0S A;  4DV0 L;  5IOD A;  1G6Z A;  2ATW A;  1TY0 A;  2Q2T A;  1XMQ Q;  5EPL A;  3GTL B;  2NVQ B;  4CJ1 B;  4HN7 A;  4JW0 A;  4OO1 H;  1GUW A;  4AIM A;  1MIU A;  1WCM B;  1D7Q A;  1FNV A;  4A3F G;  2SDF A;  4BY7 G;  1U9R A;  3LWE A;  1HQR D;  2EYM A;  3IL8 A;  1SE3 A;  1GHJ A;  1SRO A;  1SJH D;  1X3Q A;  2DY7 A;  4FVM A;  2E2H B;  2HHH Q;  3A55 A;  4P71 A;  5EQ0 A;  1DM0 B;  5C6A A;  3STB C;  2DNC A;  3D8G A;  4IPH A;  4G57 A;  3J80 E;  2F0G A;  3GD7 A;  4IAL A;  2EE1 A;  4OEL B;  3J81 j;  3SK4 A;  1JJG A;  3U58 A;  3E0E A;  1PH6 A;  4HIM A;  3H3V H;  3EJI A;  4JI1 Q;  2EYJ A;  1CQF A;  5JJI A;  3GV6 A;  1Z6H A;  4A3I B;  1A0I A;  1KLG D;  1BCP B;  3QB3 A;  4B9X A;  2VL6 A;  4I7A A;  3GTL H;  2NVQ H;  1I4X A;  4YY3 L;  4WRD A;  2Y0S G;  2B2Y C;  2EQS A;  2MGS A;  4DV1 Q;  1WCM H;  4JI6 L;  2VZA A;  1X9N A;  1QCB D;  3A56 A;  3FDT A;  3HOZ B;  1LTR D;  4XQQ A;  1NMG A;  4ZKC B;  1VQ9 A;  1GVP A;  3PIP A;  3TRZ A;  4DR4 Q;  1GXD C;  1Q3L A;  4C56 C;  4DNT B;  5IP7 G;  3GTP B;  2WKD A;  1Z47 A;  3A8I E;  4J1M A;  3S14 H;  2E2H H;  4S3S A;  2L55 A;  4AYB B;  4JYA Q;  3G4S A;  5JVH 3;  1VF5 C;  1NR2 A;  1CUK A;  1LT3 D;  5C4H A;  1F77 A;  2CQA A;  3I90 A;  4UP8 A;  2ZJR A;  4QL5 A;  5HY6 A;  1VCI A;  3ER0 A;  3CRK C;  4GZY C;  3D6C A;  4R8I A;  1DYQ A;  3F2C A;  3HOX G;  5JOB A;  2QDL A;  3ULJ A;  4A76 A;  2VUM G;  1TWC B;  4PMC A;  4A3I H;  4ID6 A;  3IAY A;  1YJN A;  1KLU D;  2NBF A;  2OWO A;  2Z8L A;  4KHP Q;  5KND A;  5LHY 1;  1N32 L;  2VS1 A;  2VY3 A;  3H0G G;  3NPP A;  1XWE A;  1UUP A;  3U4Z A;  3HOZ H;  1XNQ L;  1GO3 E;  4V0B A;  1BOS A;  2AWO A;  2OQ0 A;  5JAV A;  4YWM A;  1WD1 A;  1I5F A;  3W1B A;  1GKH A;  4X66 Q;  5COR A;  5E1F A;  1K8O A;  3MEF A;  4JOI A;  4CKC A;  1L0X B;  3EIV A;  1PZK D;  4X64 Q;  2F4V L;  3HKZ B;  1Q81 C;  3R93 A;  4B3M L;  4IUN A;  1EY6 A;  3O13 A;  4IOC A;  4MIU A;  1HR0 L;  1TU2 B;  4FP5 D;  1NAP A;  4Q0F A;  1YJ9 A;  1YHA A;  1TKW B;  1B7Y B;  2B2T C;  4P75 A;  3AB9 A;  4LFA L;  2HUG A;  1FL0 A;  5AFW A;  1TWA H;  4R1J A;  3HOV B;  1TS5 A;  5C44 H;  3ND9 A;  2UUA Q;  4O42 A;  3NEL A;  5GQO A;  2UXC L;  3TZU A;  4JBM A;  4X3U A;  1WTO A;  1WTP A;  5DAU A;  2CWP A;  3PO3 B;  2FJ2 A;  1JJC B;  1QG7 A;  3T1Y Q;  5GRO A;  1ENF A;  2UXB Q;  3NUC A;  5FLX L;  1CK1 A;  4IPC A;  2O4X A;  4IFD I;  4N9T A;  1VQK A;  1WTQ A;  1X32 A;  5ISR A;  4LUV A;  1B4O A;  4A3G G;  1RTN A;  2O2L D;  1EQT A;  3HOW B;  1GD7 A;  2D0O A;  1TR5 A;  3F8T A;  3CCV A;  5LMN L;  4ZQ3 A;  1UE1 A;  4A75 A;  1LTB D;  1I94 Q;  1FVI A;  1IBM Q;  4NXM L;  1ICF B;  1STG A;  3H91 A;  2AQ3 B;  1VQI A;  1HRJ A;  2PMZ E;  1L1O C;  4K6D A;  3R2T A;  4HCS A;  4RGO S;  3MXU A;  3KLS A;  4QB4 A;  5IGB A;  4Q5V A;  5ELE A;  1KD1 C;  2R92 G;  3HOV H;  3CME A;  1JR0 D;  2F0L A;  2D9U A;  2EYO A;  4QF4 A;  2PZW A;  1TS3 A;  5IGD A;  4A3B G;  2WAQ B;  5H1S E;  3OMG A;  4KLK A;  3G48 A;  2IX0 A;  1PRT C;  3NWS A;  1BBU A;  3PO3 H;  3J7A V;  4HJA A;  5ELO A;  2BH8 A;  1II3 A;  3S9W A;  3BDL A;  4V19 0;  1VQE A;  4DV6 Q;  1OTC A;  2YU9 B;  1E2V A;  2ID0 A;  2PQE A;  4R4Q A;  3SEB A;  1F9S A;  1PH9 A;  2Z1C A;  4NDX A;  4A3M B;  1SNC A;  4OXP A;  4K8I A;  4HJ5 A;  3HOW H;  4K8J A;  2QEJ C;  3MEH A;  1FNU A;  1N36 L;  1L0Y B;  1GUT A;  3I72 A;  5KYI A;  2BDN A;  2SOB A;  1PZI D;  2J7Z A;  3V05 A;  2HCC A;  4RGN A;  4LF7 Q;  3VYS A;  4DK0 A;  4G7Z C;  1Y8P B;  1QOH A;  4LF5 Q;  1IZ6 A;  4PZ8 A;  1VQO A;  3DMU A;  5TSS A;  5M5W B;  1R9T B;  3GTO B;  1X3F A;  1LT4 D;  1Q90 A;  2KCN A;  4JI3 L;  1Q7Y C;  1HFG A;  1X55 A;  3A7L A;  2E5L L;  1YJW A;  1CHQ D;  4GLX A;  1HUN A;  5I2X A;  1CKO A;  4YWK A;  3ZJY C;  5F2D A;  2OQK A;  2QEX A;  3PF4 A;  1XPO A;  1QNK A;  4GKK L;  2RCN A;  1ENA A;  4KJO A;  3OYY A;  4UP9 A;  1WTX A;  3I4L A;  1HTL D;  3A74 A;  3E3X A;  1A2U A;  2QF7 A;  2JK8 A;  4TKO B;  3GQB A;  1E24 A;  5M3F B;  1K8M A;  4RH6 A;  3CC7 A;  2J0T D;  3MXG A;  1KDB A;  1GHK A;  4A3M H;  1DON A;  1IKL A;  2Q2H A;  1G91 A;  5CV7 A;  3QO2 A;  4XT3 B;  5FKA C;  1WYD A;  1B3A A;  2ZXP A;  1DCZ A;  4LUO A;  1F9Q A;  3OSO A;  1MKH A;  2NN6 I;  3RLF A;  4OIK A;  1DXM A;  2KHI A;  3TME A;  1MHW C;  3JC6 6;  4JI5 Q;  4QCL A;  1EOV A;  3AYH B;  4A93 B;  1ZXT A;  4A3E H;  2K7V A;  1H9R A;  1R9T H;  3GTO H;  1X3E A;  2BCO A;  2UU9 L;  1O78 A;  4DUY Q;  4IFD G;  4KD4 A;  2L1B A;  3PUX A;  1YNJ C;  3Q6S A;  1PVO A;  4ZRZ A;  1J5E Q;  4DA2 A;  1EWI A;  3BZK A;  2EPB A;  4H44 C;  1OXS C;  4DAP A;  1HHV A;  1K73 C;  3UI2 A;  4B08 A;  2B63 B;  4B3S Q;  4DU9 A;  4NXN L;  1X65 A;  1YI2 A;  4DV2 Q;  2VQF L;  4IQZ A;  4A3K G;  4HSP A;  4BBR G;  1VMP A;  4DV3 L;  2B2U C;  3QWN A;  2VW9 A;  4OWW B;  4X6A H;  3J81 E;  3TS2 A;  3KDF B;  4DR7 L;  1EFW A;  1JB7 A;  4A93 H;  4FO2 A;  3L7Z C;  1M4V A;  1V9P A;  3ITP A;  1HNW Q;  4B3R L;  2AMC B;  1SJE D;  3CCU A;  5LL6 X;  3W5O A;  3MWY W;  4BS9 A;  3K8A A;  1E2W A;  5C0X I;  1HR0 W;  5FO8 B;  2B8G A;  1Y14 B;  1QVF A;  1K0R A;  4DF7 A;  5IGE A;  2RCF A;  1WVL A;  4RWS C;  1MGS A;  1AN8 A;  3TS0 A;  3KLS X;  2B63 H;  4K5X A;  3K7A H;  3I3C A;  3M4Q A;  5AJ3 L;  1EY7 A;  2QDB A;  4L5Q A;  4ABN A;  2BE5 D;  5J3B A;  3PQI A;  4RMF A;  5CBA E;  1IBL Q;  3EA6 A;  5A2Q E;  2PI2 E;  2XN9 C;  2V1C C;  1BXT A;  3K58 A;  1VQL A;  2ZXO A;  1GUO A;  3MFY A;  5C5L A;  1V8Q A;  3KOJ A;  4DV4 Q;  2D0P A;  4JK1 C;  3AFP A;  2JA9 A;  5E4W C;  5I2Y A;  4G7O C;  1Z9F A;  3RUZ A;  4RAU C;  3T4A C;  3SXH A;  3ULP A;  1Y8O B;  1JCK B;  4HR7 B;  4GKJ Q;  1HNX L;  5D65 A;  4JI2 L;  4FDB A;  3U4V A;  5LMN W;  3KDF A;  3M3Y B;  1NUC A;  1VQD A;  2MPM A;  1IXR A;  2F0E A;  2NUC A;  3HEJ A;  2K75 A;  3VYR A;  1RKN A;  2IJ0 A;  4LFB L;  3J80 L;  4LAA A;  3I4N G;  2NN6 G;  2EXD A;  1JOR A;  4L6T B;  3I8Z A;  1AP0 A;  3TSS A;  2F0M A;  1G29 1;  5CYU A;  3UE1 A;  3Q22 A;  1QIL A;  4RHS A;  4B3T L;  2NB0 A;  1PXU A;  2O5J C;  5E7N A;  3HFZ B;  2L4N A;  2EJG C;  2KUM A;  1QVG A;  2HQL A;  1W6J A;  1C48 A;  4BBS B;  3NBH B;  4C3I G;  2ES2 A;  3NTI A;  2M2L A;  1S5E D;  2ENB A;  3VR2 A;  2I0Q A;  2A8V A;  1KDC A;  3G6J B;  3TP6 A;  1UE5 A;  1EIH A;  2DNE A;  2OXP A;  4IJH A;  5EGT A;  5JJL A;  1FNW A;  5BN4 A;  2JSO A;  4BY1 G;  1VQ4 A;  4EVO A;  1QNU A;  4N9P A;  3K57 A;  4RKL A;  3M3Y H;  3X3N A;  1K0S A;  4GOP C;  5CC4 A;  3IKJ A;  4UDU C;  2C35 B;  4A3L G;  1XNR Q;  3NSW A;  3J7Z C;  3FRP B;  3MVV A;  3I91 A;  1PYB A;  2PQA B;  4TVA B;  3GO5 A;  4R4C A;  1PH1 A;  2CW0 C;  2ASB A;  4X62 L;  3X3M A;  4LF8 L;  4EX5 A;  2XIW A;  1KC8 C;  2QA4 A;  4DR1 L;  2K33 A;  1LV9 A;  1SEB D;  4BBS H;  4AYB E;  2CWA A;  5DLQ E;  1I4H A;  1TS2 A;  2K50 A;  4JBW A;  1B44 D;  1EIF A;  2N49 A;  3HS0 C;  2F0V A;  1SAP A;  5EKL A;  5IWA Q;  2Q2U A;  1RJT A;  5C0X G;  5CV5 A;  2A6E C;  1XXG A;  4RGT A;  3HOU G;  3S1M B;  3BYY B;  1ET6 A;  1EY8 A;  3NQT A;  2BDO A;  2BA1 A;  2F0I A;  3NBH A;  4JI7 Q;  1NNX A;  1N33 L;  3GTG B;  1ESR A;  1GJX A;  1HQM C;  2IY5 B;  4R4O A;  4QIW B;  1XTC D;  2A6E D;  5IGF A;  4PZ6 A;  4P2C B;  2EYF A;  1P16 A;  3LGJ A;  2IT1 A;  3TN2 A;  2Y0S B;  3PO2 G;  2K5D A;  2C9O A;  4JBJ A;  2E2J B;  3TBI B;  3I4M B;  4A3J G;  2KHJ A;  2M00 A;  4JBK A;  1PTO B;  3OTO L;  2I5L X;  3AQQ A;  4CDF C;  3A0J A;  3HRZ C;  5C3E G;  1I4P A;  2QGQ A;  2PQA A;  2E2D C;  2KA7 A;  2XWJ B;  5FJ8 H;  2LMC B;  4KI0 A;  3KLW A;  4OO1 I;  1EY4 A;  3IFD A;  2NVX B;  3SVM A;  2ZJP A;  1Y1W G;  3CMA A;  3L2P A;  1E0B A;  5I9P A;  2Z4I A;  1VQP A;  2B39 A;  2P5Z X;  3S1M H;  4DR6 Q;  4DV5 Q;  2IWH A;  3VYT A;  4J8Q A;  1EIG A;  1O80 A;  1YHB A;  2N3S A;  4WJW A;  4X65 Q;  3HOX B;  2VUM B;  5GAE C;  1JIC A;  4DV0 Q;  3JAM L;  4K0K L;  3HP3 A;  1YNN C;  2X6L A;  1SNQ A;  3JAM i;  1KRS A;  1JC7 A;  2A69 C;  3ICE A;  4K5V A;  3PF5 A;  3H0G B;  3PUZ A;  4ZAI A;  2E2J H;  3I4M H;  1TY2 A;  4HSV A;  2EY1 A;  2XSC A;  5JEA H;  5C4X B;  2JA5 B;  2D62 A;  1AEX A;  5DNF A;  1G8Z D;  1E2Z A;  5IP7 H;  1C7Y A;  1YVC A;  1YNN D;  1EOT A;  3CCR A;  1HA5 A;  1ROD A;  4ZLT F;  3E5S A;  4C3J G;  1ASZ A;  1Y1V B;  3PUW A;  2N55 A;  4LMQ D;  3C1E A;  3MXP A;  2NVX H;  2KEN A;  1QWY A;  3D4D A;  1PTO F;  1WJJ A;  4LF9 L;  1DD2 A;  5EKI A;  3T1H L;  4L8J A;  1C8C A;  5I4D A;  1CT1 D;  3ULL A;  4DR2 Q;  4RHR A;  4IUV A;  5FLM G;  1KNA A;  1A62 A;  2HD3 A;  1JOQ A;  2Z9H A;  2PW5 A;  1VQ5 A;  1HJP A;  3HOX H;  2R7Z B;  1FGB D;  3NE5 B;  4KY5 A;  2NZ1 D;  4OIJ A;  4NMZ A;  3OWE B;  5M5Y B;  4I65 A;  2M9V A;  4YY3 Q;  1EZ8 A;  2B2W A;  2KVM A;  5FLX c;  3H3V C;  1T5X D;  2WAQ E;  3QJY A;  3S2D H;  4JI6 Q;  4JV5 Q;  5CV6 A;  1HUM A;  5C4X H;  3HGB A;  2JA5 H;  3STB D;  4DNI A;  2NZH A;  2N8N A;  4L5R C;  1LTL A;  4TQU S;  1Y1V H;  1V1O A;  4IUP A;  3Q8D A;  1IL8 A;  1IYU A;  1HPC A;  3PIO 3;  4A3G B;  3U9S A;  2Q8I B;  2LSS A;  2QW7 A;  4UPA A;  1EY9 A;  4MN3 A;  3K5N A;  2JA7 G;  1EL0 A;  2LS0 1;  2RVL A;  3W1G A;  2PPB C;  3I56 A;  3CRL C;  2F1M A;  2KEE A;  2AQ2 B;  3VYU A;  2L0C A;  3CCL A;  4FF3 A;  1GM5 A;  2DGY A;  2R7Z H;  3VR6 A;  2WFW A;  3OPO A;  4CHT B;  4IUQ A;  1QZH A;  2WIN B;  5M5Y H;  4YHH Q;  1PDQ A;  4PG3 A;  1V43 A;  4JI1 L;  2R92 B;  3UE0 A;  3AU7 A;  4J15 A;  4IUU A;  1X54 A;  4A3B B;  1B1Z A;  5J1Z A;  1CI3 M;  3K0X A;  1XNQ Q;  5BN3 A;  1BCP C;  2IX3 A;  1VS0 A;  1PLF A;  3WOE A;  4OO1 G;  4KKU A;  1RHP A;  4QGU A;  3S1R B;  4DV1 L;  4OGQ C;  1CKN B;  2MO0 A;  3H6M A;  1S5F D;  2F0W A;  4JOI C;  5ELD A;  1PFM A;  4A3G H;  1KAB A;  1FJG Q;  3TDQ A;  2F4V Q;  4DR4 L;  4GNX B;  4B3M Q;  3R3O A;  1W6K A;  1E3P A;  1BCP D;  4YCU A;  4I7Z C;  2ALY B;  3H15 A;  5E3F A;  1HR0 Q;  3GTP H;  4EQO A;  1NR4 A;  2VXW A;  4R4I A;  2KCT A;  4RFB A;  4K6L A;  3RR5 A;  3OIP A;  4LUZ A;  3M7N A;  4LFA Q;  1MSH A;  4Y52 H;  4WJ3 M;  1GUS A;  1JWS D;  3KBX A;  1LAC A;  4OX9 Q;  2R92 H;  3NWT A;  5IYC H;  1PV4 A;  3CC2 A;  1X3P A;  2ICI A;  4A3B H;  1EY5 A;  2FHT A;  1IW7 C;  4HID A;  4IJL A;  4IOA A;  3LWU A;  1GUN A;  2ZJQ A;  3J81 L;  1PH7 A;  1TWC H;  1A8V A;  1PFS A;  1CZW A;  4Z9C B;  1EEI D;  3FKI G;  3S1R H;  1WCM G;  4FXD A;  4A3D B;  5C3W A;  1AZQ A;  2F0F A;  3M4O B;  1IW7 D;  3MFG A;  5GAG C;  3CCE A;  3KYH C;  3MA2 B;  5IT9 c;  2WII B;  5LMN Q;  2PO4 A;  3OHX C;  1PA6 A;  3EVQ A;  5IGC A;  1JOO A;  1Z7T A;  4PNY A;  1K9M C;  4LNQ A;  1LLR D;  1I4G A;  3NQI A;  2PNH A;  1CKN A;  2K4K A;  3DWA A;  1STA A;  4X64 L;  5GAD C;  4NXM Q;  4YWL A;  1JE5 A;  4DR3 L;  1D8L A;  2DY8 A;  1AE2 A;  1VMC A;  4MNO A;  2RQX A;  4HMI A;  4GNX A;  4PMB A;  2WB1 E;  5IYB H;  3EQL C;  1VQ7 A;  2VNU D;  3BVZ A;  1KXL A;  4YCV A;  4R4T A;  1PMR A;  2DJF C;  4IFD J;  2YTY A;  2I5H A;  3AEV A;  3T53 B;  1V1Q A;  4BA1 I;  4JI0 L;  1XPU A;  2TSS A;  2JP1 A;  1ENC A;  1ILQ A;  2AQ1 B;  2PYK A;  2MQH A;  2OCE A;  1JMC A;  1YHQ A;  2K5N A;  4A3D H;  4NW2 A;  1K3R A;  1SRU A;  2RSO A;  2KHS A;  3M4O H;  3T1Y L;  3QIA A;  4U68 A;  2K5V A;  1N36 Q;  2UXB L;  4AYB G;  1E22 A;  1STE A;  2A68 C;  4EGV A;  3CCJ A;  1BO0 A;  4BBR B;  5CV4 A;  2EYL A;  3HKS A;  2NZO A;  5DM7 3;  1PFN A;  4CKB A;  1PRT D;  3K80 C;  1SYE A;  1K8A C;  3VA7 A;  3TRE A;  1B8A A;  2E5L Q;  4DN4 M;  1MSG A;  5CR3 A;  3NP8 A;  1NY4 A;  1KAA A;  4GKK Q;  2F03 A;  5KYL A;  1EU3 A;  2OF1 A;  1SDF A;  5C44 G;  1IBK Q; 
#chains in the Genus database with same CATH homology
 1ILP A;  3FPU B;  2L9H A;  5EPK A;  2X6G A;  1STY A;  5K36 H;  4DK1 A;  3GTJ B;  1D6E C;  3N6R A;  2IL8 A;  4H0L C;  1F2Y A;  5ELF A;  3E6Z X;  4RKB A;  1R4P B;  2KED A;  2VB2 X;  2TMP A;  2JEB I;  1ESF A;  2NTT A;  3KK7 A;  3R8B A;  1HXY D;  2PCF B;  1RDP D;  4G7H C;  3W2D A;  1EWC A;  2X69 A;  2SEB D;  1SMY C;  4M1U B;  3I4N B;  1BQQ T;  3GP7 A;  4XYO A;  3P20 A;  4DXF A;  1WTV A;  3TP7 A;  2IX1 A;  1I6H B;  4RCN A;  3CU7 A;  4KTA A;  1YNJ D;  3M7G A;  1STB A;  1S5D D;  4BY1 B;  2XRS D;  3S2H B;  4NKL A;  3ONA B;  2LFN A;  3T51 B;  2L5T A;  3M85 A;  2NN6 H;  1EY0 A;  2EDG A;  5BN5 A;  2R6G A;  5FO7 B;  2VB3 X;  3VR3 A;  2G9D A;  2QKI C;  2WAC A;  2AWN A;  5C0X J;  4DFA A;  2FMM A;  4FXG C;  1MBY A;  5IOC A;  1HTP A;  2D2C C;  3C2P A;  3HOU B;  3S16 B;  5KNC A;  5FLX E;  5I6Y A;  4ZUI A;  5K5P A;  2D5D A;  3C3L A;  2LY7 A;  2R3Z A;  2FMC A;  4ZUJ A;  1BBX C;  2NWG A;  3MC0 B;  4X3K A;  4CBV A;  5KIX A;  2IW3 A;  2MJ8 A;  2B8F A;  1D5X C;  4LJZ C;  3PO2 B;  3OOC A;  3Q0A A;  3CKI B;  4A3J B;  1ET9 A;  3OW7 A;  3QOL A;  2E75 C;  2WKC A;  5C3E B;  3U9O A;  5EBD A;  2EXZ A;  1I6V C;  4X3T A;  5C5M A;  1Y1W B;  2IPK D;  3P7J A;  1I4Q A;  1SYB A;  2QCP X;  2FIN B;  1JB3 A;  1R4Q B;  1JWM D;  2F0Q A;  4KN4 C;  2EYP A;  2GA4 B;  3AMU A;  4FF2 A;  1T5E A;  3E0J A;  3T16 A;  2K5W A;  1D1K A;  1A3V A;  5COY A;  3L3O C;  4ILW A;  2EY2 A;  1F9P A;  4KHV A;  1CQV A;  3S1N B;  4CJ2 C;  1EYC A;  3Q23 A;  3K6O A;  2K1B A;  4HCE A;  4KV6 A;  5EKK A;  4FNF A;  5CV9 A;  4KKS A;  4C3J B;  2RDF A;  2B2V A;  2K05 A;  1LTA D;  1CA5 A;  3OWF A;  4A3F B;  4BY7 B;  2WV6 D;  3DEO A;  5DEH A;  3D4R A;  1XX8 A;  1LTI D;  1Q1B A;  1Q12 A;  1MI2 A;  2CW0 D;  1MD2 D;  3OIQ A;  4QUF A;  3GV3 A;  2PNR C;  1I4R A;  3J7Y W;  1G2T A;  4IUT A;  3N52 A;  5IT9 E;  3S17 B;  2KCC A;  3GTM B;  1AZP A;  1AW7 A;  3KLR A;  3SDZ A;  3KBG A;  2JYO A;  2F4I A;  2J4X A;  5G3L D;  3SK5 A;  4KK7 A;  3OMC A;  1FD7 D;  3D4W A;  4XQN A;  3ZYY X;  3SK8 A;  3RZD B;  3T56 B;  2XWB B;  1SE4 A;  2H1E A;  1D2B A;  2K03 A;  3KUP A;  4F88 A;  4KMU C;  3TP5 A;  1A6X A;  3PV0 A;  2L12 A;  1STN A;  5CGK A;  3ND8 A;  5D14 A;  1JOK A;  1TT2 A;  1TWH B;  4RCO A;  4BA2 I;  4KHZ A;  1F2L A;  4ME5 A;  1LTS D;  1SNM A;  3FVQ A;  1DJR D;  4HMJ A;  1ZYR C;  1JWU D;  1B9N A;  1D1I A;  2F0D A;  1PTO C;  3BG3 A;  3DHQ A;  4TSS A;  3V2T A;  1PTO H;  5CMD A;  5CV8 A;  3C46 A;  3VR4 A;  1RF2 D;  3VR5 A;  2L11 A;  2EYH A;  1BR9 A;  2A69 D;  3QOJ A;  1O7Z A;  2XNA C;  2B2W C;  1RTO A;  2V4D A;  1ONL A;  1Y69 U;  4QUC A;  2C5C A;  4R8N A;  1H9M A;  3ERQ A;  4C2M B;  1I50 B;  1F2M A;  1UAP A;  3FKI B;  4R9W A;  4F7X A;  2RSN A;  1OXT A;  3BS1 A;  4C3H G;  1IYV A;  1TS4 A;  4J6H A;  3L9A X;  3S14 B;  1EFI D;  3KF8 A;  2ZT9 C;  4O1N A;  3BDO A;  2NVY B;  3EFX D;  3DUZ A;  5A35 A;  3D31 A;  3A54 A;  1LTT D;  1EZ6 A;  4IN3 A;  1IHZ A;  3S1Q B;  5D3I B;  4Y7N B;  4H7B A;  4EQN A;  2JXM B;  5ELB A;  5CBE E;  5M9O A;  3RD4 A;  2O5I C;  3URY A;  4DGZ A;  3H09 A;  5JEA G;  3Q24 A;  5KGU A;  2R61 A;  3BVM A;  2HDM A;  3P1H A;  3D3R A;  1VDZ A;  2RDG A;  2B2Y A;  4QMG A;  1KNE A;  1QJO A;  5I6W A;  5M5X B;  2AUJ D;  2A73 B;  4DNR B;  3HG9 A;  1TWA B;  5E4X A;  1H9S B;  5C44 B;  1S5C D;  2NYZ D;  3I70 A;  2PW7 A;  1BCP F;  4ZKB B;  4WFN 3;  4HTH A;  1OXV A;  2KJX A;  4FF4 A;  1DOL A;  2E76 C;  1LT5 D;  3K0Y A;  4K14 A;  3GTQ B;  1SYF A;  1HCZ A;  4K5W A;  1LAB A;  1EWH A;  3NTK A;  3PUV A;  4RA8 A;  4KKT A;  3FPP A;  1O7L A;  3CHB D;  5HGT A;  5D3D A;  2A5H A;  2CVR A;  1SYG A;  3MXN A;  4F8M A;  2SNM A;  1C4Q A;  1TWG B;  2ZXR A;  4M8A A;  1QE6 A;  2G9H D;  1TQO A;  4CKE A;  2SNS A;  1PRT B;  2R93 B;  5A2Q L;  4F87 A;  1H9J A;  2B2T A;  5NUC A;  1LTG D;  2F0N A;  1CM9 A;  5IGG A;  1H9S A;  1SNP A;  3PMF A;  2JEA I;  4XYQ A;  1SSO A;  3I73 A;  4ULL A;  2CHB D;  3JAM E;  1JE4 A;  3A7A B;  3WDN A;  1IKM A;  3WOF A;  3H94 A;  3SE0 A;  3M4Y A;  1NSN S;  3LNN A;  1TWF B;  5FO9 B;  1QB5 D;  4A3K B;  2I46 A;  1B50 A;  1EYD A;  5J22 A;  1AFP A;  1B53 A;  3J7A F;  1H9K A;  1M8A A;  1ML0 D;  2K28 A;  5C4J B;  1OXX K;  1RCV D;  2BA0 A;  4OHJ A;  1JQY D;  2A68 D;  1G2S A;  4IFD H;  4H13 C;  1SYD A;  2PZT A;  5C4Z A;  1UEA B;  2LKV A;  1STH A;  2RBM A;  5FOB B;  1PRT F;  3SK6 A;  3F2U A;  4KN7 C;  2EJM A;  2AUK A;  1GUG A;  1EQV A;  5ELC A;  2A74 C;  3RMH A;  2XRQ D;  4A3E B;  4KY6 A;  3DWQ A;  2RA4 A;  4DAV A;  4FF1 A;  2F0T A;  2EY5 A;  2H4O A;  1U4M A;  5T1I A;  3A8J E;  4XDX A;  5I9O A;  2EZV A;  3BVG A;  5JJZ A;  1F2Z A;  2RDH A;  4PQX A;  2JA8 B;  2EY6 A;  2F0H A;  1J9O A;  4X3S A;  2RKS A;  1FYC A;  1LT6 D;  1SXT A;  2BOS A;  4C1N K;  1ZEQ X;  3S15 B;  3K5O A;  5EPJ A;  1A15 A;  2KEC A;  1NCV A;  2KOL A;  1BNZ A;  5IT9 L;  3BDC A;  4TRD A;  1LO5 D;  4E6I A;  1S5B D;  1SMY D;  3RZO B;  4ZYS A;  4PV1 C;  1B9M A;  3K5L A;  5EJW A;  4C3I B;  3PIP 3;  1A3T A;  3BYT B;  1WD0 A;  3K59 A;  1BDO A;  1XYI A;  3FMC A;  4WOR A;  4BWG B;  4XT1 B;  1PYW D;  1ZKO A;  3MAQ A;  2E74 C;  1TVX A;  4UAI A;  1WTW A;  3K7A B;  2QIL A;  5IIF A;  5K36 G;  3NBI A;  1FR3 A;  5M3M B;  3MZ5 A;  2K01 A;  2K5Q A;  1HFN A;  1SE2 A;  5JPN C;  4XXE A;  1SFO B;  1BF4 A;  2F0J A;  2WB1 B;  1J8I A;  2NVT B;  3A8K E;  4HED A;  1KTK A;  2DN8 A;  2N88 A;  3HOY B;  2BE5 C;  2PMZ B;  2B2U A;  2I07 B;  2OT2 A;  4HAE A;  1DZ1 A;  3TP8 A;  1WTR A;  1UNS A;  2MHV A;  4G4K A;  4XTC S;  2JA6 B;  3ERO A;  1F9R A;  2YYZ A;  1Q1E A;  3P75 A;  1PZJ D;  4K2L A;  4CGY B;  1K83 B;  2F0O A;  3QG1 A;  1OXU A;  4ODG A;  3D6W A;  5HUR A;  1OO9 B;  1O7Y A;  5EBC A;  3C1F A;  5KNB A;  5T1G A;  1CTM A;  2F3V A;  1U4P A;  4ZK9 B;  2F3W A;  3V96 A;  2OEO A;  3W3A A;  1CHP D;  1EYA A;  2WP8 J;  5C0X H;  5FK9 C;  1Y8N B;  1U4R A;  3GTK B;  4IUR A;  3CQZ B;  3TZD A;  3NXW A;  2MUY A;  3FEW X;  2E2I B;  1SBB B;  4YIJ A;  2KQ3 A;  4K2K A;  2JE6 I;  1A2T A;  2B2V C;  3HZX A;  1DOM A;  3MHB A;  5JVG 3;  4KJN A;  1PFB A;  1V1P B;  4LK1 C;  2EJF C;  1D5M C;  3G7L A;  2HQE A;  2K6A A;  1HA6 A;  1Q8I A;  2EOT A;  1I3Q B;  3LX0 A;  4OL7 A;  1BUV T;  2F0K A;  3MTS A;  1GOZ A;  1S4Z A;  2K04 A;  4DAY A;  1CZG A;  4PMW A;  1A3U A;  1ICW A;  2Q8T A;  4C3H B;  5LL6 S;  1U4L A;  3DM1 A;  2NTS A;  3PUY A;  4FXK C;  5DM6 3;  1KDA A;  1VF7 A;  1SYC A;  4U67 3;  1D5Z C;  2F0U A;  4EQP A;  2JA7 B;  4IZ8 A;  4DXG A;  4B9W A;  1V1P A;  5C3X A;  5JPM C;  1B2T A;  2K32 A;  3DEP A;  3IFT A;  2EVB A;  1CA6 A;  3DWP A;  4XQJ A;  4L63 B;  2HDL A;  3NHH A;  3K5M A;  5KRU A;  4MHE A;  5JEA J;  5KEE A;  3T13 A;  2FFK B;  5G3L F;  2A6H C;  4NP5 A;  3DXJ C;  2XVS A;  3BZD B;  1SND A;  1TII D;  4CJ0 B;  2HCI A;  4C1N I;  4KD3 A;  2A6H D;  5J39 A;  2Q8R E;  1RD9 D;  2PZU A;  3NTH A;  3R2I A;  1EEF D;  2MP1 A;  1SNO A;  4KY7 A;  2ICE C;  4FYD A;  4XIG S;  3SR1 A;  3NK9 A;  1DOK A;  2Z4H A;  2F0P A;  1ZYR D;  1PTO D;  3S2D B;  3SHL A;  3VA5 A;  4RGM A;  1CFM A;  1EU4 A;  2F0S A;  5IOD A;  1G6Z A;  1TY0 A;  5EPL A;  3GTL B;  2NVQ B;  4CJ1 B;  4HN7 A;  4OO1 H;  1GUW A;  1WCM B;  1FNV A;  2SDF A;  1U9R A;  3LWE A;  1HQR D;  2EYM A;  3IL8 A;  1SE3 A;  1GHJ A;  1X3Q A;  1SJH D;  2DY7 A;  4FVM A;  2E2H B;  3A55 A;  5EQ0 A;  1DM0 B;  5C6A A;  2DNC A;  3D8G A;  4G57 A;  3J80 E;  2F0G A;  3GD7 A;  4IAL A;  2EE1 A;  3SK4 A;  3EJI A;  2EYJ A;  1CQF A;  3GV6 A;  1Z6H A;  4A3I B;  1KLG D;  1BCP B;  3QB3 A;  4B9X A;  1I4X A;  4WRD A;  2B2Y C;  2MGS A;  1QCB D;  3A56 A;  3FDT A;  3HOZ B;  1LTR D;  4XQQ A;  4ZKC B;  1GXD C;  1Q3L A;  4C56 C;  4DNT B;  3GTP B;  2WKD A;  1Z47 A;  3A8I E;  4J1M A;  4S3S A;  2L55 A;  4AYB B;  5JVH 3;  1VF5 C;  1NR2 A;  1LT3 D;  5C4H A;  1F77 A;  2CQA A;  3I90 A;  1VCI A;  3CRK C;  4GZY C;  3D6C A;  4R8I A;  1DYQ A;  5JOB A;  1TWC B;  4PMC A;  4ID6 A;  3IAY A;  1KLU D;  2NBF A;  2Z8L A;  5KND A;  5LHY 1;  3NPP A;  1XWE A;  1UUP A;  4V0B A;  1BOS A;  2AWO A;  5JAV A;  1WD1 A;  5COR A;  5E1F A;  1K8O A;  4CKC A;  1L0X B;  1PZK D;  3HKZ B;  3R93 A;  4IUN A;  1EY6 A;  3O13 A;  4MIU A;  1TU2 B;  4FP5 D;  1NAP A;  4Q0F A;  1TKW B;  2B2T C;  3AB9 A;  2HUG A;  5AFW A;  3HOV B;  1TS5 A;  3ND9 A;  4O42 A;  3TZU A;  4X3U A;  1WTO A;  1WTP A;  5DAU A;  3PO3 B;  2FJ2 A;  1QG7 A;  1ENF A;  3NUC A;  5FLX L;  1CK1 A;  4IFD I;  2O4X A;  4N9T A;  1WTQ A;  1X32 A;  5ISR A;  1B4O A;  1RTN A;  2O2L D;  1EQT A;  3HOW B;  1TR5 A;  4ZQ3 A;  1LTB D;  1HRJ A;  1STG A;  3H91 A;  2AQ3 B;  4K6D A;  3R2T A;  4HCS A;  4RGO S;  3MXU A;  3KLS A;  4QB4 A;  5IGB A;  4Q5V A;  5ELE A;  1JR0 D;  2F0L A;  2D9U A;  2EYO A;  4QF4 A;  2PZW A;  1TS3 A;  5IGD A;  2WAQ B;  3OMG A;  2IX0 A;  1PRT C;  3NWS A;  3J7A V;  1II3 A;  3S9W A;  3BDL A;  4V19 0;  2YU9 B;  1E2V A;  2ID0 A;  2PQE A;  3SEB A;  1F9S A;  2Z1C A;  4NDX A;  4A3M B;  1SNC A;  4K8I A;  4K8J A;  2QEJ C;  3MEH A;  1FNU A;  1L0Y B;  1GUT A;  3I72 A;  5KYI A;  2BDN A;  2SOB A;  1PZI D;  2J7Z A;  3V05 A;  2HCC A;  4RGN A;  3VYS A;  4DK0 A;  4G7Z C;  1Y8P B;  1QOH A;  3DMU A;  5TSS A;  5M5W B;  1R9T B;  3GTO B;  1LT4 D;  1Q90 A;  2KCN A;  1HFG A;  3A7L A;  1CHQ D;  1HUN A;  5I2X A;  5F2D A;  1QNK A;  1ENA A;  4KJO A;  1WTX A;  3I4L A;  1HTL D;  1A2U A;  2QF7 A;  4TKO B;  3GQB A;  5M3F B;  1K8M A;  4RH6 A;  2J0T D;  3MXG A;  1KDB A;  1GHK A;  1DON A;  1IKL A;  1G91 A;  5CV7 A;  3QO2 A;  4XT3 B;  5FKA C;  1B3A A;  2ZXP A;  1DCZ A;  1F9Q A;  3OSO A;  2NN6 I;  3RLF A;  4OIK A;  1DXM A;  3TME A;  4QCL A;  4A93 B;  1ZXT A;  2K7V A;  1H9R A;  2BCO A;  1O78 A;  4IFD G;  4KD4 A;  2L1B A;  3PUX A;  1YNJ C;  3Q6S A;  4ZRZ A;  4DA2 A;  2EPB A;  4H44 C;  1OXS C;  4DAP A;  1HHV A;  3UI2 A;  4B08 A;  2B63 B;  4DU9 A;  4IQZ A;  4HSP A;  1VMP A;  2B2U C;  3QWN A;  3J81 E;  4FO2 A;  3L7Z C;  1M4V A;  3ITP A;  1SJE D;  5LL6 X;  3MWY W;  4BS9 A;  1E2W A;  5C0X I;  5FO8 B;  2B8G A;  4DF7 A;  5IGE A;  1WVL A;  4RWS C;  1MGS A;  1AN8 A;  3KLS X;  4K5X A;  3I3C A;  1EY7 A;  2QDB A;  4ABN A;  2BE5 D;  5CBA E;  3EA6 A;  5A2Q E;  2XN9 C;  1BXT A;  3K58 A;  2ZXO A;  1GUO A;  3MFY A;  5C5L A;  1V8Q A;  4JK1 C;  5E4W C;  5I2Y A;  4G7O C;  3RUZ A;  4RAU C;  3T4A C;  3SXH A;  1Y8O B;  1JCK B;  4HR7 B;  5D65 A;  3M3Y B;  1NUC A;  2MPM A;  3HEJ A;  2F0E A;  2NUC A;  3VYR A;  1RKN A;  2IJ0 A;  3J80 L;  4LAA A;  2NN6 G;  1JOR A;  4L6T B;  3I8Z A;  1AP0 A;  3TSS A;  2F0M A;  1G29 1;  5CYU A;  3Q22 A;  1QIL A;  4RHS A;  2NB0 A;  1PXU A;  2O5J C;  2L4N A;  2EJG C;  2KUM A;  1W6J A;  1C48 A;  4BBS B;  4C3I G;  3NTI A;  2M2L A;  1S5E D;  2ENB A;  3VR2 A;  1KDC A;  3G6J B;  3TP6 A;  1EIH A;  2DNE A;  2OXP A;  5EGT A;  1FNW A;  5BN4 A;  2JSO A;  4EVO A;  1QNU A;  4N9P A;  3K57 A;  4RKL A;  3X3N A;  5CC4 A;  3IKJ A;  4UDU C;  3NSW A;  3FRP B;  3MVV A;  3I91 A;  3GO5 A;  2CW0 C;  3X3M A;  2XIW A;  2K33 A;  1LV9 A;  1SEB D;  1I4H A;  1TS2 A;  4JBW A;  1B44 D;  3HS0 C;  2F0V A;  1SAP A;  5EKL A;  1RJT A;  5C0X G;  5CV5 A;  2A6E C;  1XXG A;  4RGT A;  3S1M B;  3BYY B;  1ET6 A;  1EY8 A;  3NQT A;  2BDO A;  2BA1 A;  2F0I A;  3NBH A;  3GTG B;  1ESR A;  1GJX A;  1HQM C;  4QIW B;  1XTC D;  2A6E D;  5IGF A;  4P2C B;  2EYF A;  2IT1 A;  3TN2 A;  2Y0S B;  2K5D A;  2C9O A;  2E2J B;  3TBI B;  3I4M B;  2M00 A;  1PTO B;  3HRZ C;  1I4P A;  2E2D C;  2KA7 A;  2XWJ B;  2LMC B;  4KI0 A;  4OO1 I;  1EY4 A;  3IFD A;  2NVX B;  3SVM A;  1E0B A;  5I9P A;  2Z4I A;  2B39 A;  2IWH A;  3VYT A;  4J8Q A;  1EIG A;  1O80 A;  4WJW A;  3HOX B;  2VUM B;  1JIC A;  3JAM L;  3HP3 A;  1YNN C;  2X6L A;  1SNQ A;  1JC7 A;  2A69 C;  4K5V A;  3H0G B;  3PUZ A;  4ZAI A;  1TY2 A;  4HSV A;  2EY1 A;  2XSC A;  5JEA H;  5C4X B;  2JA5 B;  2D62 A;  1AEX A;  5DNF A;  1G8Z D;  1E2Z A;  1YNN D;  1EOT A;  1HA5 A;  1ROD A;  4ZLT F;  3E5S A;  4C3J G;  1Y1V B;  3PUW A;  2N55 A;  4LMQ D;  3C1E A;  3MXP A;  1QWY A;  3D4D A;  1PTO F;  1DD2 A;  5EKI A;  4L8J A;  1C8C A;  5I4D A;  1CT1 D;  4RHR A;  4IUV A;  1KNA A;  1JOQ A;  2PW5 A;  2R7Z B;  1FGB D;  3NE5 B;  4KY5 A;  2NZ1 D;  4OIJ A;  4NMZ A;  3OWE B;  5M5Y B;  4I65 A;  2M9V A;  1EZ8 A;  2B2W A;  2KVM A;  3H3V C;  1T5X D;  3QJY A;  5CV6 A;  1HUM A;  3HGB A;  4TQU S;  1V1O A;  4IUP A;  1IL8 A;  1IYU A;  1HPC A;  3PIO 3;  4A3G B;  3U9S A;  2Q8I B;  3K5N A;  1EY9 A;  4MN3 A;  1EL0 A;  2LS0 1;  2RVL A;  2PPB C;  3CRL C;  2F1M A;  2KEE A;  2AQ2 B;  3VYU A;  2L0C A;  4FF3 A;  3VR6 A;  3OPO A;  4CHT B;  4IUQ A;  2WIN B;  1PDQ A;  1V43 A;  2R92 B;  3AU7 A;  4IUU A;  4A3B B;  1B1Z A;  5J1Z A;  1CI3 M;  5BN3 A;  1BCP C;  2IX3 A;  1PLF A;  3WOE A;  4OO1 G;  4KKU A;  1RHP A;  3S1R B;  4OGQ C;  3H6M A;  1S5F D;  2F0W A;  5ELD A;  1PFM A;  1KAB A;  3TDQ A;  3R3O A;  1W6K A;  1BCP D;  4I7Z C;  5E3F A;  4EQO A;  1NR4 A;  2VXW A;  4RFB A;  4K6L A;  3OIP A;  3M7N A;  1MSH A;  1GUS A;  1JWS D;  3KBX A;  1LAC A;  3NWT A;  1X3P A;  2ICI A;  1EY5 A;  2FHT A;  1IW7 C;  3LWU A;  1GUN A;  3J81 L;  4Z9C B;  1CZW A;  1EEI D;  4FXD A;  4A3D B;  5C3W A;  1AZQ A;  2F0F A;  3M4O B;  1IW7 D;  3MFG A;  3MA2 B;  2WII B;  2PO4 A;  3OHX C;  3EVQ A;  5IGC A;  1JOO A;  1Z7T A;  4PNY A;  1LLR D;  1I4G A;  3NQI A;  3DWA A;  1STA A;  2DY8 A;  1VMC A;  2RQX A;  4HMI A;  4PMB A;  3EQL C;  2VNU D;  3BVZ A;  1PMR A;  4IFD J;  3T53 B;  4BA1 I;  2TSS A;  2JP1 A;  1ENC A;  1ILQ A;  2AQ1 B;  2PYK A;  4NW2 A;  2RSO A;  2KHS A;  3QIA A;  4U68 A;  1STE A;  2A68 C;  4EGV A;  1BO0 A;  4BBR B;  5CV4 A;  2EYL A;  5DM7 3;  1PFN A;  4CKB A;  1PRT D;  1SYE A;  3VA7 A;  4DN4 M;  1MSG A;  5CR3 A;  3NP8 A;  1KAA A;  2F03 A;  5KYL A;  1EU3 A;  2OF1 A;  1SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...