2Q8TA

Crystal structure of the cc chemokine ccl14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'PYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL14
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
molecule tags Cytokine
total genus 12
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8tA00
2B2UA 4QUCA 1PFNA 5EQ0A 1DOKA 1ML0D 1MSGA 3N52A 1EL0A 3DEOA 4X3SA 1WTQA 2L9HA 2R3ZA 2SDFA 3Q6SA 4MHEA 2B2WA 4XT1B 2MJ8A 2MGSA 5COYA 2HCCA 1NCVA 4IUTA 3IFDA 2N55A 4OIJA 1U4PA 2NZ1D 2EPBA 3QO2A 4UAIA 1AZPA 1IKMA 4ZK9B 3UI2A 4HEDA 5EPLA 4U68A 2JP1A 4QUFA 4RA8A 1RJTA 3I8ZA 4IUUA 5CMDA 5CBEE 1WTWA 1G6ZA 1NR2A 1ESRA 1HA6A 2DY7A 1WTVA 1G91A 1F9RA 2X6GA 2L1BA 5JJZA 1O7ZA 1BF4A 3LWEA 3TN2A 1RODA 1J8IA 1WVLA 2Q8RE 3F2UA 2KEDA 3DM1A 1JICA 1WTXA 1BNZA 1BO0A 2IL8A 2B2VC 3ONAB 5AFWA 3FPUB 4HSVA 4XDXA 2J7ZA 4R8IA 1JE4A 4CJ0B 1S4ZA 2HDMA 2DY8A 2B2VA 4ZAIA 1RTOA 1ILPA 4IUQA 5D65A 2B2TC 1GUWA 5T1GA 1IL8A 3H91A 3I3CA 1AZQA 1TVXA 2K05A 1G2SA 1XYIA 3D6WA 1B2TA 2K03A 1KNEA 1VMCA 2B2TA 1F9PA 1PFBA 1SDFA 2FMMA 1EOTA 2KVMA 2L11A 2RSOA 3MWYW 4CJ1B 1ILQA 1CA6A 1RTNA 1AP0A 3G7LA 1CA5A 2B2YC 3GV6A 1U4RA 3TZDA 1BBXC 1MI2A 2FINB 2NWGA 1MGSA 1EQTA 1RHPA 2FHTA 2HCIA 3I90A 5DNFA 5EPJA 5E4XA 1HHVA 2B2YA 4OIKA 1F9SA 1Q3LA 1KNAA 4IUVA 4X3UA 1WTOA 1QE6A 5EKIA 1A15A 4X3TA 2K28A 4X3KA 1HUMA 2NYZD 1X3PA 2KECA 3IL8A 1WTPA 2VXWA 3KUPA 1ICWA 1WTRA 5CORA 2X6LA 4CJ2C 2RA4A 3DEPA 4NW2A 2K01A 1PLFA 1X3QA 1ZXTA 4ZKBB 4ZKCB 1E0BA 5D14A 1G2TA 2B2UC 2JYOA 1PFMA 5EJWA 5CBAE 2EOTA 2RVLA 1EIHA 1SAPA 2K1BA 2MPMA 1EIGA 2L12A 4LMQD 5E4WC 1HFGA 2Q8TA 1X32A 4MN3A 4ZLTF 4RAUC 1DOLA 2B2WC 2RSNA 1J9OA 3HP3A 1CM9A 1NAPA 2D9UA 2EE1A 3R93A 1WD0A 4O42A 2FFKB 2HDLA 5T1IA 1M8AA 1F2LA 1HFNA 4HCSA 1B53A 4RWSC 3GV3A 4IURA 2KEEA 5EPKA 1XX8A 1WD1A 2KOLA 4XT3B 2CVRA 1F9QA 1DZ1A 1HUNA 2N88A 2M2LA 4DN4M 1O80A 1QG7A 3FDTA 1U4MA 1B3AA 1QNKA 3MTSA 2HUGA 2FJ2A 4IUPA 1IKLA 3SVMA 2BDNA 2K04A 1HRJA 3KBXA 4HAEA 1O7YA 3I91A 1C8CA 2MP1A 3P7JA 1U4LA 1SSOA 1MSHA 1DOMA 1B4OA 2L4NA 4R9WA 2KUMA 1DONA 1VMPA 1LV9A 2X69A 1PDQA 1NR4A 2H1EA 2XIWA 1B50A
chains in the Genus database with same CATH superfamily
2PW7A 3D3RA 1SMYD 5D3IB 1XPOA 3OPOA 5AJ3L 3DM3A 2I5HA 3K5MA 1JOKA 2N49A 2PI2E 2MJ8A 2MGSA 2ZJRA 1X9NA 4BWGB 4IUTA 4PMCA 5M3FB 1WTHA 5IGCA 3MEHA 1I94L 2PO4A 2AWNA 1PH3A 1J5EL 3I4NH 4A3BH 4K8IA 3SHLA 2BE5D 5CMDA 3U4ZA 4K14A 2A1AA 5LMNW 4B3RL 4CHTB 4GLXA 1RKNA 2RKSA 4KY5A 4DUZL 2F0LA 3PIPA 3A8JE 5KNDA 2VQFL 1M90C 1XNRQ 3HOVB 3H15A 2NTSA 1BO0A 5DEHA 3URYA 1X3FA 3FPUB 2A6EC 3UDGA 1EY4A 4HIKA 1VQ9A 1Q7YC 4J1MA 2F3WA 2UUCL 4JBWA 2CHBD 5K36H 4BBRH 3IAYA 2NN6H 4A3EG 2B2TA 5FLMG 2B29A 3SK8A 1QUQB 1CA6A 3A7AB 4KMUC 4CKEA 4CDCC 4H02A 2M00A 1UWVA 1T9HA 1BKBA 1MGSA 1E22A 2FHTA 2TMPA 3A56A 4OEMB 1GUOA 2EJGC 2KECA 4QGUA 4KN7C 1NE3A 4NW2A 4K5XA 1CFMA 2L0CA 1JR0D 1S3OA 1T5EA 2MPMA 4CDFC 5JJIA 3CPFA 1PH6A 3KOJA 4K5WA 3HOVH 3KF6A 4K5VA 2ZJQA 5ELFA 2O5IC 3R93A 2WIIB 1B7YB 1JJCB 1QILA 2FFKB 2LXKA 4AH6A 1ZYRC 5IT9E 4P72A 4RWSC 4IURA 4DV4Q 1LTID 1XX8A 1AE2A 2EYFA 3M4YA 4G7OC 5HGQA 1T5XD 3GO5A 1CZGA 1FNWA 2IHEA 2F0NA 4GLVB 3L3OC 4HIDA 4LNQA 1A3TA 2JK8A 3I4MH 1DOKA 4DNRB 2B63G 2ZM6L 1I4RA 4JI2Q 2PYKA 3HOWH 2VY3A 1L0YB 4MHEA 5CC4A 3WWVA 3KK7A 3W3AA 1E1TA 1LACA 3KLSX 3WDNA 4IJHA 4ZYSA 4XYOA 3J7ZC 1KABA 3FKIH 4R8NA 2NZ1D 3PUXA 4JYAL 4DV2Q 4L63B 4C2MB 2CWPA 2F52A 4QCLA 2L15A 3JAME 1W3SA 1LUZA 4LFBL 1B70B 1N9WA 2L1BA 2RF4A 4G57A 1XNQQ 3TN2A 1HPCA 1RODA 2EYOA 4HTHA 2EYHA 3NENA 1JE5A 4C3IB 5IT9c 4RKBA 5A2QL 1SYGA 3ONAB 4IFDH 3KF6B 3U4VA 3K7UC 4B3TQ 1YEZA 2R6GA 4IUQA 3ULJA 2HQEA 1IL8A 3MFGA 5BN3A 3K81C 3D6WA 5I6YA 1K9MC 3PO2G 1AEXA 4HJAA 4HJ9A 1EEFD 3FVQA 3IRBA 5C44G 1MJCA 5E7NA 3CQZH 2EYMA 2VQEL 1O7IA 1Y8OB 1IXRA 3BZCA 1PHJA 2Z6KA 2PZTA 4C2MH 2V1CC 3KLSA 4BA1I 1VQFA 4DPGA 4GKJQ 5CORA 2X6LA 3M7NA 4ZKCB 1PTOH 2E76C 4DR6Q 2A69D 1D5XC 4DFAA 3W5OA 2HIVA 4OHJA 4DV1L 3JAMc 1V9PA 1X32A 3A8KE 2A74C 5JEAH 5CYUA 4C3IH 1TU2B 5FLXE 1NAPA 1TWGB 1ENAA 3T1YQ 3A74A 3GV3A 5EPKA 3V2TA 2E5LL 2WP8J 3PF4A 1K3RA 2PNRC 3I73A 1N33Q 1SSOA 1C0AA 1GO3E 3U9OA 3PUWA 4QB4A 1R9TH 1TWFB 3D4DA 4RKLA 1WCMB 3GQBA 2F0GA 5G3LF 1W6KA 2SDFA 1HNWQ 3I70A 3BZDB 1GUNA 1CHPD 3R8BA 4ILWA 1PA6A 4ZK9B 1QOHA 3BG3A 2ZTDA 4DR5Q 1K73C 4LF6L 2CW0D 2KBNA 3NWSA 1LLRD 3L2PA 1Y1VG 2X6GA 2F0KA 3S16H 4TKOB 1LYLA 5FLXc 2UUAL 1VQDA 3KBGA 5HY6A 1TWCB 1Q82C 5LMNL 1SE3A 2IT1A 2OEOA 4UPAA 4DV5Q 1BBUA 4IQZA 5GQOA 4TRDA 1EOVA 4CJ0B 2PQEA 5ELBA 1ZKOA 1BQQT 4BY7G 1TWFH 3G48A 1VQNA 4OL7A 3MWYW 1EYCA 4LFCL 4A3DH 2NUCA 4I65A 1RTNA 3A0JA 3G4SA 3ULPA 4B3MQ 2VS1A 4R4OA 3VR4A 1SFOH 1BOSA 4DV0Q 3T4AC 4AYBG 2CWAA 2WINB 1VCIA 1BBXC 2VNUD 1F9SA 3CP0A 2QEXA 1A15A 4EQNA 4RGOS 3MA2B 1YNXA 3PQIA 2R61A 4X62Q 1PLFA 1NY4A 2Z4IA 2RDHA 1SNCA 1Y1WH 3O13A 2JA5H 1HNXQ 1EIHA 2Q2HA 2SNSA 3K0XA 3MZ5A 1SJHD 3STBC 3HOUG 3HKZG 1LT4D 4A3FB 4NXNQ 3H3VH 1V1PA 1CM9A 1PYWD 5H1SE 4O42A 1QZHA 4JPBW 1XNRL 3J7AV 2R92G 4HCSA 1NMFA 1WOCA 4I7ZC 2EZVA 4C56C 3OHXC 1CHQD 2M2LA 3CCJA 2F4VQ 4IUPA 3MTSA 1LM0A 3RLOA 4RCOA 3BDOA 2NVXB 4GZYC 1VQHA 4PZ8A 2R7ZB 1N34Q 5C4JH 1EU4A 1LO5D 4UP8A 1BBWA 3HOYG 4R9WA 1Y1VH 4L6TB 2H1EA 1CA5A 1I4GA 4ID6A 2B2UA 2DJFC 3HGBA 3I56A 2PCFB 2EJFC 2XRSD 1OXTA 2LFNA 4GLAC 1HZAA 4TVAB 4XT1B 2EXDA 1TT2A 2PPBC 1STBA 2HCCA 2K7VA 1PVOA 3TP7A 3I4LA 1KAWA 2MHVA 4A3FH 3HOZG 3GTPB 1KAAA 3RZDB 5C4XH 1I3QH 1OXUA 5KNBA 3LWUA 1QVCA 3S2HB 1G91A 3K7AH 1G8ZD 3ERSX 2JA6G 2Q8RE 5BR8Q 2JEAI 1X54A 2K52A 3H0GG 4X65Q 4Y7NH 4R8IA 1JE4A 1ICFB 1S4ZA 3J81E 3BDLA 4QQBX 1HH2P 4PQXA 2H5XA 2KENA 4C1NK 1Q81C 5FOBB 1HR0Q 3M3YB 2YTVA 3S1MB 1B2TA 1YHQA 1STNA 4ABNA 3Q22A 1Y14B 3GTQB 4ME5A 3A5ZB 1OXXK 2JA8G 3TZDA 2HCIA 1PTOF 4R1JA 4JI2L 2NVTB 1B3QA 4OO1I 1HA5A 4UHVA 1S72A 1O7LA 3NPPA 3AFPA 1BCPC 2E2JB 4OO1G 1ICWA 3GTPH 4A3CG 2MFIA 1G2TA 4DV2L 1IBMQ 4N9TA 2B2UC 1Z6HA 2LY7A 4JI0L 4A75A 3BU2A 4DUYQ 1B44D 3Q23A 1VQMA 1XNQL 4B3SL 5T1IA 1M8AA 1FGBD 4JI5Q 1B53A 1DZ1A 1GVPA 3AEVA 4KV6A 4WRDA 3T53B 1YVCA 3MC0B 3J81c 4HAEA 4BS9A 4HIOA 4B3TL 1GJXA 2HT1A 2JA7G 3CMEA 3A54A 1F77A 3GTQH 1DONA 3I90A 4GN3B 3M4OB 1B50A 3RZOB 3SDZA 1VQCA 3S14B 1EIFA 3S1NB 4X3SA 4DR3Q 4YWKA 2LSSA 3CAMA 2E2JH 2OQ0A 3KLWA 1G6PA 5COYA 1GUSA 1I5FA 4PZ6A 1RDPD 1UE5A 3K80C 2BA0A 1IKMA 4PV1C 2A68D 1PRTF 1IBKQ 4K0KQ 1AW7A 2LXJA 5JVG3 4DR6L 1MKHA 4E6IA 5M5XB 2DY7A 2R93G 1DCZA 1BF4A 3RNUA 4A3GG 1SYCA 4KY6A 3T1YL 5IGFA 3OIPA 4HSVA 4FF2A 4RG1A 2ZT9C 3S1QB 5C5LA 1UUPA 2F3VA 3NQTA 4GNXC 1N33L 1ZEQX 3OWEB 3M4OH 1SYBA 3T51B 4X6AH 4IPGA 2RSOA 3NXWA 3K57A 2L11A 3NBIA 4HJ8A 2HQLA 3S1NH 3CCRA 4HR7B 2QDBA 1A8VA 4M8AA 2OT2A 4OIKA 5LL6S 1HNWL 1YNJD 2BH8A 3P1HA 2A5HA 2BDOA 4YY3Q 4A3IB 2JA7H 3KUPA 1SNPA 3EVQA 4O1NA 3G6JB 5IYBH 3K59A 5CBAE 3X3NA 4HJ5A 2I07B 4DR5L 2L12A 1Y8PB 1WFQA 2AHOB 4A93G 3RMHA 1OO9B 4J6HA 3Q24A 5ELNA 4J8QA 4M1UB 3VA5A 3FRPB 5KYIA 1YJWA 3MVVA 1XMOQ 3DWAA 1P8LA 4K2KA 2N88A 4DV5L 2J0TD 4G7ZC 3FDTA 4FXGC 3SXHA 1YJ9A 2NZOA 4CKCA 1KDAA 2H4OA 5M3MH 4IZ8A 2R93H 3QOJA 5G3LD 4JI6Q 3K5OA 4A3GH 5EQ0A 3I4NB 4B3ML 2DJGC 4A3BB 4EGVA 4DV0L 4DV7Q 1AH9A 4JK1C 3S24A 3TP6A 1D7QA 1L1OA 2Q2TA 2BOSA 3ERQA 3QO2A 3HFZB 1JC7A 5J3BA 5EPLA 4X62L 1A63A 4OGQC 1AFPA 1MHWC 1NR2A 2K14A 4BBRB 2DUDA 2F0IA 2QGQA 3DHQA 4DXGA 1J8IA 4NXNL 3DUZA 3KDFA 1H9KA 4DV3Q 5AFWA 2CQOA 5CGKA 5M3FG 4A3MG 4DAVA 5J39A 1SMYC 4DAYA 2N3SA 1VQ5A 2F4VL 3CCSA 1KXLA 4DR7Q 5C4ZA 3SR1A 5T1GA 3H91A 4OXPA 4OWTB 1VF5C 4DXFA 1FNVA 1G2SA 4XIGS 5C3EH 1N34L 1NBWA 1VQBA 4DR4Q 1KNEA 4A3LG 4PG3A 1EOTA 2JXMB 3U58A 2NVYB 1ENFA 2NTTA 1X55A 3E5SA 3GV6A 3OSOA 1B1ZA 4OWXB 4KN4C 2QF7A 1EQTA 3G71A 3W1GA 4F88A 4DR2Q 2BE5C 2LKVA 1QB5D 5JVH3 1X3PA 2EY5A 3KYHC 5EBDA 3DEPA 2UXBQ 3TP5A 1UAPA 2XWBB 4DNIA 3F8TA 1HJPA 1LT3D 1L1OB 1XJVA 4LMQD 2GVAA 1HFGA 4OWWB 4ZLTF 1JJGA 1F2YA 4DK0A 1PZID 2WKCA 4KJNA 5I9OA 4K2LA 4H44C 5BR8L 1L1OC 5IGBA 1F2LA 5BN5A 3I4MB 4UP9A 4L5SA 5HURA 2KOLA 4MTNA 2QILA 1K0RA 1B3AA 4DGZA 4LW1A 2FJ2A 3KDFB 3HOWB 3JAMi 3KBXA 4QL5A 4KJOA 3G6EA 1IYJB 4UDUC 2NVYH 4B9XA 1Z47A 1HR0L 1U0LA 3FKIB 4DAYB 1I4QA 1MD2D 3KF8A 3QR8A 1E3PA 3DWPA 3CCVA 1N36L 3TMEA 1VQ8A 2K50A 1L0WA 2R7FA 1PH8A 1IL2A 2ICEC 2BH2A 1FVIA 1EL0A 1XPUA 3GTKB 4A3MH 3R2TA 1IZ6A 5DLQE 3UE0A 3VA7A 5F2DA 1SNQA 2N78A 1EY9A 4YCUA 1QNUA 3J81j 2VUMG 3I2ZA 1XTDA 4L5RC 4LUVA 3NHHA 1JWMD 1VQEA 2JE6I 4IOAA 1ZYRD 1IBML 1Z9FA 3PUYA 2UXDQ 3UDFA 5CBEE 4L8JA 4P71A 5FO8B 1O7ZA 2KCMA 4JI4Q 5IGEA 2Q8IB 3TS2A 3CCEA 3CQZB 4JI5L 4IOCA 4EX5A 1LTAD 1SRUA 4BY1G 1CTMA 4TSSA 3L9AX 3CC2A 1X3GA 5K5PA 2B2TC 4A3EH 5GROA 3VDYA 1KIXA 4DA2A 1XYIA 5FLMH 1FD7D 2FMMA 1TQOA 1PTOD 1N32L 1II3A 3GTKH 1PTOB 3G7LA 3HKSA 4MNOA 2NWGA 1SROA 5IWAQ 4DR3L 1IYUA 3KF8B 1KNAA 1KRTA 1IBLQ 4GKKQ 1PFSA 5JPMC 1WTPA 1KHIA 1JORA 3PIOA 1I50H 1EQQA 4LK1C 5IT9L 4DV6Q 2JYOA 2XNAC 5EKLA 2E2HH 2A73B 2RVLA 3DMUA 4K0KL 2EVBA 4JBJA 3TS0A 3NWTA 4MN3A 2E75C 4LF7Q 2O5JC 2EE1A 4IPCA 5JPNC 4DNTB 1R9TB 2B3GA 4R4QA 1STAA 5C6AA 4A3JG 1D6EC 2XSCA 3OW2A 4BXXG 2MO0A 3GDEA 4PMBA 2EXZA 4H7BA 2HUGA 1YZ6A 2JQOA 4A4IA 1RCVD 5CV6A 1DOMA 2AWOA 2O4XA 1PZKD 1ET6A 2QW7A 3PO2B 3K5LA 1C7YA 2B63H 3VR2A 5CV7A 1JWSD 4A76A 5C44B 4JW0A 2A69C 2BCOA 4CDEC 3S16B 2MNAA 3JAML 1G51A 1PRTD 3Q0AA 4MTKA 4JI1L 1PRTB 2DN8A 2ENBA 3IFTA 1B9MA 4YY3L 4DAPA 1BVSA 1X56A 4HEDA 3ITPA 3CRKC 4RA8A 3I55A 3QG1A 4MIUA 1TXYA 4C3HG 1WCMG 3CF5A 1PH9A 3LWEA 1WVLA 1F2ZA 3C2PA 1A2UA 1JICA 4WORA 3R3OA 4A3DB 4XQNA 1BNZA 5FJ8G 1SFOB 2UUBQ 4A3KG 1XMOL 1D8LA 4B9WA 2GA4B 4LF9Q 5E1FA 2B2VA 1KQSA 2WB1B 4KD4A 1GUWA 1G291 1L2FA 3PO2H 3RLNA 3EIVA 1VQAA 1VMCA 1E2WA 4NKLA 1TWHB 5C44H 4N8X1 1Y1WB 3I72A 4JI6L 2JA5B 3HRZC 2K4KA 1EWHA 1S5BD 4V190 1OXSC 2Z6KC 5FKAC 5EPJA 2CW0C 3CPWA 4DV7L 4FF4A 1Q3LA 1MJEA 3NP8A 1D1IA 5L37A 2ID0A 4YIJA 1EUJA 5FLXL 3D4RA 3H3VC 1ZXTA 3NTKA 1PH4A 2O2LD 1SLJA 1Z7TA 1EIYB 5EGTA 3H94A 5E4WC 1TY2A 2KCCA 3LNNA 3UDXA 5ELEA 5C4JB 1E1OA 2BA1A 1Y1VB 2WAQB 1P16A 3BVZA 5KGUA 3M9BA 2F3IA 5IGGA 2KEEA 1F9QA 5I2XA 5JJKA 2VB3X 1Q1BA 3MAQA 4KTAA 1CKOA 4NPSA 1IKLA 2F1MA 3M7GA 1NUCA 2AQ1B 4RGMA 4C3HH 4DR7L 1TWHH 4LF5Q 1C9OA 5D3DA 3VYUA 5C3WA 1S40A 1LV9A 1PDQA 3CC7A 5ELOA 1I4HA 1MSGA 5C4XB 1I3QB 1LTGD 1DD2A 5I4DA 4LUOA 3J81i 4KK7A 3K7AB 4AYBB 3A5UA 2E8GA 1LTTD 4DR2L 2WFWA 5CV9A 4LF4Q 1YIJA 1U4PA 3L0OA 4UAIA 4Y7NB 4ZUJA 3OIQA 2UXBL 2IWHA 4C3JG 2Z4HA 1VQGA 1A3VA 3CCMA 4BBSG 3D6CA 1EQRA 3LGJA 1WTVA 2IX1A 3AYHB 2WB1E 2P5ZX 3HKZB 3F2UA 1PH7A 1WJJA 3FHWA 1LTSD 1I6HH 1SXTA 4QMGA 4CKBA 1SEBD 1AE3A 4JCVE 4K6DA 5NUCA 2R92B 3C46A 3CD6A 2CFMA 3E6ZX 3PCOB 1ILPA 3J80i 2D2CC 4BY7H 2IPKD 3I3CA 3FP9A 4OX9Q 4O2DA 2K05A 4YCWA 4WJ3M 4AQYQ 1F9PA 1KLGD 4B3RQ 3NSWA 2Q2IA 3E9HA 1AP0A 3EFXD 4DR1Q 4KKSA 1GM5A 1VQLA 1VQ7A 5C4HA 2B2YA 3BDCA 4UP7A 2Z8LA 5GADC 3OMGA 4DV4L 1VQOA 2UU9Q 4P73A 1V1QA 2WAQE 1PV4A 1IW7D 2GVBA 2Y0SG 4CJ2C 1X3QA 3S1RH 5A35A 2AUKA 2PW5A 4EQPA 2GN5A 2KHJA 1TS3A 1CSPA 2CQAA 1QWYA 3HOUH 4G4KA 4K6LA 1XPRA 2UXDL 4QY7A 5IP9G 4RAUC 2K32A 4IO9A 1FR3A 2YYZA 5DAUA 2R92H 1FL0A 4JI4L 1QVGA 1WD1A 4G7HC 1RD9D 1EY8A 4Q5VA 1ESFA 1O80A 5ELCA 1QNKA 4HMIA 4BBSH 3HOYH 1XWEA 2YTYA 2L4NA 3ER0A 4QIWB 1C48A 2XIWA 5C0XI 4FNFA 3J80E 4R4IA 3NBHA 3K58A 2PZWA 1H95A 4WJWA 5C0XG 1Q46A 5IY0A 5DM63 3VR6A 5IYCG 1I6VC 5FO7B 5IWAL 2F0MA 4RCNA 4GOPA 1XMQQ 3NTIA 4GKKL 1MIUA 3HKZE 4JOIA 1YBYA 1SJED 5EKKA 3EROA 3HOZH 4U68A 1FJGQ 2JA6H 1STHA 5JJZA 3J81L 3GTJH 2OTLA 4YWMA 2A6HD 3DM1A 1UE1A 2XGTA 3H0GH 3V96A 5IP7G 2UXCQ 5J22A 2D0PA 3NEMA 1Q8IA 3N6RA 3KJOA 1W6JA 4KI0A 3E0EA 3K8AA 4ZRZA 3CHBD 1VQKA 1DGSA 5D65A 3HOXG 1JB3A 4GKJL 3I7FA 1TS2A 2JA7B 2NVQB 1H9SA 5IP9H 4XQJA 4JC0A 1SMXA 2K5NA 3PV0A 1E7ZA 3J80c 2JA8H 5TSSA 3TZUA 2A68C 3TP8A 1SE2A 1TY0A 5EBCA 3SK5A 3WOFA 4FYDA 2DNEA 1YNND 3NBHB 1B9NA 4F87A 4OO1H 4X3TA 4X3KA 3CXCA 4LFAQ 4A3CH 3PO3G 2ZXPA 2RA4A 1O78A 2K01A 4DK6C 5CV5A 2CH4A 2YTXA 3BYTB 4GOPB 3HZXA 2V4DA 1K8AC 2FMCA 1OXVA 1HZBA 5C0XH 1LT5D 2VQEQ 3JC66 2A8VA 5M3MB 2NZHA 4GOPC 2R93B 2D9UA 1WD0A 1KLUD 2F0DA 4JBKA 1YHAA 1DYQA 2DNCA 1PXUA 4JOIC 3VYRA 1HFNA 4CDDC 4A3GB 2VW9A 4A3IG 4Y52H 4JV5Q 1FYCA 4U673 3CMAA 2OCEA 4FVMA 3PIP3 2UUBL 3ND9A 4HSPA 1EY0A 4P2CB 4LF9L 2YU9H 3C1FA 3PUZA 2NVQH 1MSHA 1DXMA 3RN5A 3DXJC 1YNJC 2X69A 1NR4A 1PMRA 4L5QA 1R4PB 1QCBD 3U9SA 2QDLA 4KLKA 4XTCS 1GUTA 1GD7A 1VS0A 1PFNA 1GUGA 3NE5B 2RDGA 1RIPA 1YJNA 3CW2C 4QF4A 1H9SB 3X3MA 4HMJA 4I7AA 1ASYA 3TREA 5KNCA 3MXNA 1R4QB 1E2VA 2RDFA 1H9JA 3F2DA 2HHHQ 5C0XJ 2D5DA 1AZPA 1M4VA 3I4OA 3D4WA 1KDCA 1RJTA 2D62A 3OW7A 1WTWA 3I4NG 2IJ0A 1ESRA 4A3BG 5C3EB 2KEDA 3TDQA 4IJLA 4NB3A 3KLRA 2G9DA 3M4QA 2K5QA 1EU3A 2NN6I 1RL2A 2JA9A 1NTGA 3RUZA 4N8FA 2F0FA 1OTCA 5LMUQ 5K36G 3TQYA 4BBRG 4LF5L 1EY5A 2NN6G 4NDXA 3PMFA 1N8RC 4CJ1B 1HNXL 2G9HD 2IX3A 2UUAQ 4O0AA 1K28A 3TSSA 5KRUA 3FEWX 1SE8A 3S2DB 1HZCA 5IODA 4DK1A 2KCNA 1WYDA 3GTMH 1SN8A 3K0YA 1HNZQ 3QB3A 3S17B 2AKWB 2K28A 3E0JA 1I4PA 4LF4L 1LT6D 4H13C 2EY2A 1VQIA 3C1EA 1PFMA 2EOTA 1CQVA 3BVMA 4LFCQ 1Q1EA 5FK9C 4V0BA 3MXNB 2Q8TA 3M85A 4A93H 2RSNA 4AIMA 3OYYA 3T56B 3HOVG 1NJIC 2EDGA 2KJXA 2ZJPA 4KD3A 2HDLA 2EY6A 2VB2X 3W1BA 1EY6A 4YHHQ 2OTJA 5I9PA 4KY7A 4APVA 1V1OA 4DN4M 4KHZA 3QWNA 2E2IH 1U4MA 1V8QA 4A3MB 1HRJA 1V43A 2WV6D 4IPHA 2PNHA 4XYQA 3RN2A 1U4LA 1S5ED 4OX9L 4FP5D 1TS4A 1TWAH 1VMPA 3PIO3 1QVFA 3S2DH 4AQYL 2A6ED 3QIAA 1Y69U 4QUCA 4PNYA 5M9OA 3N52A 3I4MG 4DR1L 3DEOA 3S17H 1VQPA 3K5NA 1GHKA 2B8FA 3TEHB 3HOWG 1J6QA 1E2ZA 4X65L 1FGUA 2SEBD 3KFUA 3IFDA 1D5MC 2UU9L 3F2CA 3FKIG 3T13A 1DM0B 4IUUA 1PH2A 4A3EB 1Q8KA 4RH6A 2R7DA 4IPDA 1CZWA 1Q90A 3CRLC 1K83B 1NMGA 4RGNA 4JI3Q 5M3FH 1BCPF 1H9MA 4EVOA 4IFDI 2Z1CA 4DU9A 1EEID 4IFDG 3BYYB 4ZAIA 4K8JA 2IX0A 1CT1D 2I46A 4HJ7A 3OOCA 4A3LH 3PUVA 1JCKB 5A2QE 1I50B 2E74C 4DUYL 1MBYA 2E2HB 4P75A 1B8AA 1JWUD 3AB9A 4CBVA 4X66Q 1U4RA 5EAYA 5E4XA 1D2BA 2XN9C 1H9RA 4YWLA 3CC4A 1S5FD 4ODGA 1XMQL 2PZUA 1WTRA 2E2DC 5JAVA 2VUMB 4X64Q 1NNXA 1S5DD 5FO9B 1FJGL 1K83H 4XXEA 2RBMA 2KHIA 3EN2A 1KD1C 5JEAG 3M4PA 4C3IG 3UE1A 3EA6A 1E24A 2ZXRA 4POGA 3K6OA 1VQ6A 1X6OA 2UXCL 2B63B 1EQVA 1KDBA 1TIID 2XTIA 1PTOC 4GN5A 2F0OA 3SVMA 3MXPA 1CQFA 4BY1B 1Q12A 1L0XB 3L7ZC 4JI0Q 3P7JA 3P75A 2OWOA 2KUMA 1IBKL 5ISRA 3E9IA 1I4XA 2ASBA 3EJIA 4S3SA 1SR3A 4B3SQ 1SE4A 4DAMA 1GXDC 4C1NI 2WACA 1D5ZC 2IY5B 4RMFA 4P74A 4LAAA 5HGTA 2NB0A 2VUMH 1TR5A 4B08A 2PMZB 1JOOA 3T1HQ 3ICEA 4LFAL 1Q86C 1LTRD 2IHFA 4QUFA 3BJUA 3GTLB 4NXMQ 3J7YW 2AUJD 2I5LX 3HEJA 4HCEA 1CI3M 4LUZA 4JI8Q 2CCZA 4IN3A 4BY1H 2J7ZA 4A3JB 4JV5L 2JJQA 2J4XA 5I2YA 2Z6BA 1YITA 4KHPQ 3A55A 3Q8DA 1U5KA 2M9VA 1A62A 2K03A 1VQJA 3EBEA 1SDFA 2C9OA 5JJLA 3HG9A 2Z0SA 1W2BA 1PRTC 1K8MA 4IFDJ 4A3DG 2F0JA 2EYPA 3SGIA 1MI2A 1VQ4A 1STEA 2VZAA 1XTCD 2F0VA 2WB1G 5EKIA 3BVGA 2F4IA 2VXWA 2ZTCA 3SK6A 3GTLH 1UNSA 3RD4A 4EQ5A 2F0SA 2HHHL 4RFBA 1CSQA 4YCVA 1KRSA 1Y1WG 1SYFA 2JA5G 2K1BA 3OTOQ 1PH5A 3H3VI 4C3HB 2L5TA 4FO2A 1DOLA 1FNUA 2C35B 2ZTEA 3D0FA 4XQQA 4A3JH 3H09A 4F8MA 4BXXH 5GAEC 1HUNA 4XT3B 3CKIB 2F0EA 4IUNA 1BXTA 1EFID 5GAHC 4A3KB 4TQUS 5JEAJ 2F0HA 1JB7A 1C8CA 2K5HA 2AQ3B 4OONA 1JOQA 5LMUL 1HTLD 3HS0C 1TWGH 2AQ2B 1ONLA 1XXGA 2PMZE 2EQSA 2WAQG 4Q0FA 5CV4A 3VR5A 2ATWA 1HXYD 2ICIA 2EYJA 1X3EA 3ZYYX 4DV3L 1HNZL 1I6HB 3S9WA 1EY7A 2N55A 1KL9A 2B39A 4R4TA 3CU7A 2KCTA 3UI2A 1WCMH 2XRQD 3I8ZA 3DWQA 5ELDA 1HQRD 2PQAA 1A6XA 2D0OA 4A3FG 2K5VA 4DR4L 4BY7B 3AFQA 5C4XG 5DM73 3NUCA 2F0TA 2B8GA 2LMCB 2LS01 1STGA 4DKAC 3ZJYC 3F2BA 1WTXA 4Z9CB 5FJ8H 1PZJD 2EYLA 4YHHL 4A3KH 2B2VC 2RQXA 4XDXA 2MO1A 4JI7Q 1K8OA 4HN7A 4LF8Q 3STBD 4JBMA 1UE6A 3H6MA 2R7ZG 3AQQA 1CKNA 1PFBA 3EQLC 1TWCH 4ZUIA 4JVZA 2F0QA 1ILQA 5I6WA 3S1RB 2JEBI 5AJ3Q 3S15B 4POFA 3HOUB 1C4QA 2IW3A 3DLLA 1RHPA 4H0LC 5DNFA 1TS5A 3FPPA 3CCQA 4IUVA 1K8GA 1QE6A 3T16A 3GTOB 1HQMC 4QJFA 3IL8A 4ULLA 1I94Q 1JT8A 5M5WB 3ULLA 1NSNS 1E0BA 5D14A 1QJOA 1U9RA 1J5EQ 3C3LA 1YI2A 3QJYA 1SAPA 4ZCKA 4C3JB 4DF7A 1EIGA 3B6YA 3V05A 3SE0A 4BBSB 3HOYB 1UEAB 1CK1A 3FMCA 4DUZQ 1WTOA 2Q2UA 1J9OA 3HP3A 2VQFQ 1ET9A 2RCNA 2PQAB 1LTLA 4JI3L 2OQKA 3QOLA 4FXDA 2CVRA 2UUCQ 3NK9A 2QCPX 2DGYA 3VYSA 1DJRD 1HZ9A 2MP1A 4KKTA 2HIXA 1B4OA 3A8IE 3ND8A 3J7AF 3S15H 3MXUA 1Y8NB 3TRZA 2RHQB 1LABA 1EZ6A 3HOZB 1IW7C 1ML0D 3SK4A 1CKNB 3MFYA 2JA6B 1WTQA 4X66L 3GTOH 3MHBA 1BDOA 3GTJB 3TBIB 2NVXH 1PYBA 1V1PB 1K3BC 1GKHA 5C3XA 5M5WH 2R7ZH 1EWCA 1HCZA 3H0GB 1NCVA 1VF7A 1A2TA 3MXGA 1D1KA 1PH1A 3A7LA 2EPBA 1SYEA 1EYAA 4C3JH 1S5CD 2Y0SB 2KQ3A 4AYBE 4X64L 2K33A 3W2DA 1G6ZA 2OXPA 1N36Q 1A0IA 1F9RA 3MEFA 1BCPD 1ENCA 1SNMA 1BCPB 3VR3A 4F7XA 2JA8B 5IYDG 1AN8A 1IHZA 2EY1A 4LJZC 2F0WA 3P20A 2L55A 2RHSB 1IBLL 4GS3A 1RTOA 3RZDH 4MZ9A 3S2HH 1AZQA 1KC8C 4GNXA 1ASZA 3D8GA 4DV6L 5E3FA 4CGYB 3BZKA 3NQIA 2ZM6Q 4JG2A 1SNDA 2B2YC 4L5TA 4WJ4A 4FF3A 4LF7L 5KIXA 3GTGB 3KJPA 4X3UA 2ZXOA 2K5WA 2ES2A 3M3YH 2FXQA 1HR0W 3S1MH 2NYZD 4JYAQ 2PI2A 4NMZA 2KA7A 1M1KC 2A6HC 1KTKA 3T1HL 2VL6A 4ZQ3A 1SNOA 1UE7A 3NELA 4ZKBB 4ALPA 5C5MA 5IYBG 4WFN3 4HIMA 4PZ7A 1N32Q 4LFBQ 1EWIA 1STYA 2YU9B 3SEBA 4FDBA 4R4CA 4NXML 5KEEA 2EJMA 3AMUA 5IGDA 2NVTH 3VYTA 3J7A5 4KHVA 2SOBA 4JI8L 5BN4A 1WI5A 4KKUA 2I0QA 2QEJC 3R2IA 2K5DA 3J80L 3PGZA 5CV8A 5JOBA 3CCLA 1O7YA 5IIFA 1JQYD 3NTHA 4EQOA 1GHJA 4KHPL 2ALYB 2CH4W 3HOXB 1YNNC 2TSSA 3PF5A 5M3MG 1A3UA 4LWCA 1CKMA 3GTGH 2Z9HA 1X65A 4FF1A 2EIFA 2K75A 5IYCH 2Y0SE 5J1ZA 2HD3A 2L9HA 2MUYA 2R3ZA 4GNXB 5IYDH 1BR9A 3Q6SA 2B2WA 5M5YB 5LL6X 4QIWE 2G5DA 2QKIC 1CUKA 2F0UA 4GN4B 1UEBA 4OIJA 1EFWA 4ME3A 2XVSA 3CCUA 3PO3B 2JP1A 3RZOH 3GP7A 3S14H 4DV1Q 5IE8A 1HA6A 4UY8C 3OTOL 4N9PA 3UDIA 3OWFA 2N8NA 3WOEA 5IP7H 3F1ZA 3RLFA 4RHRA 1RF2D 2E5LQ 2IL8A 5CR3A 2NBFA 4JI1Q 2AMCB 5GAGC 2F03A 2HDMA 1LTBD 2DY8A 3GTMB 3HOXH 1GOZA 3GD7A 1BUVT 4PMWA 1QZGA 4DK3C 5M5XH 1TVXA 2CKZB 5KYLA 2F0PA 5C3EG 2KVMA 3U50C 4OELB 2QA4A 2C5CA 5M5YH 1EYGA 2KHSA 2FINB 3AU7A 3S1QH 4A93B 3D31A 1YHBA 1HHVA 4IALA 1VDZA 1IYVA 2K6AA 1SYDA 4FXKC 1EZ8A 3PO3H 2YV5A 1HUMA 2I5MX 4NP5A 4LF6Q 2OF1A 2E2IB 5EJWA 3LX0A 2SNMA 3RR5A 2JN4A 2XWJB 1HTPA 4J15A 3BS1A 1F2MA 4RHSA 1PYSB 5IOCA 2B2WC 2A19A 1TWAB 2RCFA 4BA2I 5LMNQ 3PSIA 4RGTA 4A3IH 2MQHA 1K0SA 1JJ2A 1EYDA 4JI7L 1QG7A 4LF8L 1JMCA 3OMCA 1QUQA 2WKDA 2BDNA 2K04A 1SBBB 3I91A 5LHY1 1TKWB 2JSOA 3E3XA 3IKJA
chains in the Genus database with same CATH topology
2PW7A 3D3RA 1SMYD 5D3IB 3OPOA 3K5MA 1JOKA 2MJ8A 2MGSA 4BWGB 4IUTA 4PMCA 5M3FB 5IGCA 3MEHA 2PO4A 2AWNA 4K8IA 3SHLA 2BE5D 5CMDA 4K14A 4CHTB 1RKNA 2RKSA 4KY5A 2F0LA 3A8JE 5KNDA 3HOVB 2NTSA 1BO0A 5DEHA 3URYA 3FPUB 2A6EC 1EY4A 4J1MA 2F3WA 4JBWA 2CHBD 5K36H 3IAYA 2NN6H 2B2TA 3SK8A 1CA6A 3A7AB 4KMUC 4CKEA 2M00A 1MGSA 2FHTA 2TMPA 3A56A 1GUOA 2EJGC 2KECA 4KN7C 4NW2A 4K5XA 1CFMA 2L0CA 1JR0D 2MPMA 1T5EA 4K5WA 4K5VA 5ELFA 2O5IC 3R93A 2WIIB 1QILA 2FFKB 1ZYRC 5IT9E 4RWSC 4IURA 1LTID 1XX8A 2EYFA 3M4YA 4G7OC 1T5XD 3GO5A 1CZGA 1FNWA 2F0NA 3L3OC 1A3TA 1DOKA 4DNRB 1I4RA 2PYKA 1L0YB 4MHEA 5CC4A 3KK7A 3W3AA 1LACA 3KLSX 3WDNA 4ZYSA 4XYOA 1KABA 4R8NA 2NZ1D 3PUXA 4L63B 4C2MB 4QCLA 3JAME 2L1BA 4G57A 3TN2A 1HPCA 1RODA 2EYOA 4HTHA 2EYHA 4C3IB 4RKBA 5A2QL 1SYGA 3ONAB 4IFDH 2R6GA 4IUQA 2HQEA 1IL8A 3MFGA 5BN3A 3D6WA 5I6YA 1AEXA 1EEFD 3FVQA 2EYMA 1Y8OB 2PZTA 3KLSA 4BA1I 5CORA 2X6LA 3M7NA 4ZKCB 1PTOH 2E76C 2A69D 1D5XC 4DFAA 4OHJA 1X32A 3A8KE 2A74C 5JEAH 5CYUA 1TU2B 5FLXE 1NAPA 1TWGB 1ENAA 3GV3A 5EPKA 3V2TA 2WP8J 2PNRC 3I73A 1SSOA 3U9OA 3PUWA 4QB4A 1TWFB 3D4DA 4RKLA 1WCMB 3GQBA 2F0GA 5G3LF 1W6KA 2SDFA 3I70A 3BZDB 1GUNA 1CHPD 3R8BA 4ILWA 4ZK9B 1QOHA 3BG3A 2CW0D 3NWSA 1LLRD 2X6GA 2F0KA 4TKOB 3KBGA 1TWCB 1SE3A 2IT1A 2OEOA 4IQZA 4TRDA 4CJ0B 2PQEA 5ELBA 1ZKOA 1BQQT 4OL7A 3MWYW 1EYCA 2NUCA 4I65A 1RTNA 3VR4A 1BOSA 3T4AC 1BBXC 2WINB 1VCIA 2VNUD 1F9SA 1A15A 4EQNA 4RGOS 3MA2B 2R61A 1PLFA 2Z4IA 2RDHA 1SNCA 3O13A 1EIHA 2SNSA 3MZ5A 1SJHD 1LT4D 4A3FB 1V1PA 1CM9A 1PYWD 4O42A 3J7AV 4HCSA 2EZVA 4I7ZC 4C56C 3OHXC 1CHQD 2M2LA 4IUPA 3MTSA 4RCOA 3BDOA 2NVXB 4GZYC 2R7ZB 1EU4A 1LO5D 4R9WA 4L6TB 2H1EA 1CA5A 1I4GA 4ID6A 2B2UA 3HGBA 2PCFB 2EJFC 2XRSD 1OXTA 2LFNA 4XT1B 1TT2A 2PPBC 1STBA 2HCCA 2K7VA 3TP7A 3I4LA 2MHVA 3GTPB 1KAAA 3RZDB 1OXUA 5KNBA 3LWUA 3S2HB 1G91A 1G8ZD 2Q8RE 2JEAI 4R8IA 1JE4A 1S4ZA 3J81E 3BDLA 4PQXA 4C1NK 5FOBB 3M3YB 3S1MB 1B2TA 1STNA 4ABNA 3Q22A 3GTQB 4ME5A 1OXXK 3TZDA 2HCIA 1PTOF 2NVTB 4OO1I 1HA5A 1O7LA 3NPPA 1BCPC 2E2JB 4OO1G 1ICWA 1G2TA 4N9TA 2B2UC 1Z6HA 2LY7A 1B44D 3Q23A 5T1IA 1M8AA 1FGBD 1B53A 1DZ1A 4KV6A 4WRDA 3T53B 3MC0B 4HAEA 4BS9A 1GJXA 3A54A 1F77A 1DONA 3I90A 3M4OB 1B50A 3RZOB 3SDZA 3S14B 3S1NB 4X3SA 5COYA 1GUSA 1RDPD 2BA0A 1IKMA 4PV1C 2A68D 1PRTF 1AW7A 5JVG3 4E6IA 5M5XB 2DY7A 1DCZA 1BF4A 1SYCA 4KY6A 5IGFA 3OIPA 4HSVA 4FF2A 2ZT9C 3S1QB 5C5LA 1UUPA 2F3VA 3NQTA 1ZEQX 3OWEB 1SYBA 3T51B 2RSOA 3NXWA 3K57A 2L11A 3NBIA 4HR7B 2QDBA 4M8AA 2OT2A 4OIKA 5LL6S 1YNJD 3P1HA 2A5HA 2BDOA 4A3IB 3KUPA 1SNPA 3EVQA 4O1NA 3G6JB 3K59A 5CBAE 3X3NA 2I07B 2L12A 1Y8PB 3RMHA 1OO9B 4J6HA 3Q24A 4J8QA 4M1UB 3VA5A 3FRPB 5KYIA 3MVVA 3DWAA 4K2KA 2N88A 2J0TD 4G7ZC 3FDTA 4FXGC 3SXHA 4CKCA 1KDAA 2H4OA 4IZ8A 3QOJA 5G3LD 3K5OA 5EQ0A 3I4NB 4A3BB 4EGVA 4JK1C 3TP6A 2BOSA 3ERQA 3QO2A 1JC7A 5EPLA 4OGQC 1AFPA 1NR2A 4BBRB 2F0IA 4DXGA 3DHQA 1J8IA 3DUZA 1H9KA 5AFWA 5CGKA 4DAVA 5J39A 1SMYC 4DAYA 5C4ZA 3SR1A 5T1GA 3H91A 1VF5C 4DXFA 1FNVA 1G2SA 4XIGS 1KNEA 1EOTA 2JXMB 2NVYB 1ENFA 2NTTA 3E5SA 3GV6A 3OSOA 1B1ZA 4KN4C 2QF7A 1EQTA 4F88A 2BE5C 2LKVA 1QB5D 5JVH3 1X3PA 2EY5A 5EBDA 3DEPA 3TP5A 1UAPA 2XWBB 1LT3D 4LMQD 1HFGA 4ZLTF 1F2YA 4DK0A 1PZID 2WKCA 5I9OA 4KJNA 4K2LA 4H44C 5IGBA 1F2LA 5BN5A 3I4MB 5HURA 2KOLA 2QILA 1B3AA 4DGZA 2FJ2A 3HOWB 3KBXA 4KJOA 4UDUC 4B9XA 1Z47A 3FKIB 1I4QA 1MD2D 3KF8A 3DWPA 3TMEA 1EL0A 2ICEC 3GTKB 3R2TA 3VA7A 5F2DA 1SNQA 1EY9A 1QNUA 3NHHA 1JWMD 2JE6I 1ZYRD 3PUYA 5CBEE 4L8JA 5FO8B 1O7ZA 5IGEA 2Q8IB 3CQZB 1LTAD 1CTMA 4TSSA 3L9AX 5K5PA 2B2TC 4DA2A 1XYIA 1FD7D 2FMMA 1TQOA 1PTOD 1II3A 1PTOB 3G7LA 2NWGA 1IYUA 1KNAA 5JPMC 1WTPA 1JORA 4LK1C 5IT9L 2JYOA 2XNAC 5EKLA 2A73B 2RVLA 3DMUA 2EVBA 3NWTA 4MN3A 2E75C 2O5JC 2EE1A 5JPNC 4DNTB 1R9TB 1STAA 5C6AA 1D6EC 2XSCA 4PMBA 2EXZA 4H7BA 2HUGA 1RCVD 5CV6A 1DOMA 2AWOA 2O4XA 1PZKD 1ET6A 3PO2B 3K5LA 3VR2A 5CV7A 1JWSD 5C44B 2A69C 2BCOA 3S16B 3JAML 1PRTD 3Q0AA 1PRTB 2DN8A 2ENBA 3IFTA 1B9MA 4DAPA 4HEDA 3ITPA 3CRKC 4RA8A 3QG1A 4MIUA 4C3HG 3LWEA 1WVLA 1F2ZA 3C2PA 1A2UA 1JICA 4WORA 3R3OA 4A3DB 4XQNA 1BNZA 1SFOB 4B9WA 2GA4B 5E1FA 2B2VA 2WB1B 4KD4A 1GUWA 1G291 1VMCA 1E2WA 4NKLA 1TWHB 1Y1WB 3I72A 2JA5B 3HRZC 1EWHA 1S5BD 4V190 1OXSC 5FKAC 5EPJA 2CW0C 4FF4A 1Q3LA 3NP8A 1D1IA 2ID0A 4YIJA 5FLXL 3D4RA 3H3VC 1ZXTA 3NTKA 2O2LD 1Z7TA 5EGTA 3H94A 5E4WC 1TY2A 2KCCA 3LNNA 5ELEA 5C4JB 2BA1A 1Y1VB 2WAQB 3BVZA 5KGUA 5IGGA 2KEEA 1F9QA 5I2XA 2VB3X 1Q1BA 3MAQA 4KTAA 1IKLA 2F1MA 3M7GA 1NUCA 2AQ1B 4RGMA 5D3DA 3VYUA 5C3WA 1LV9A 1PDQA 1I4HA 1MSGA 5C4XB 1I3QB 1LTGD 1DD2A 5I4DA 4KK7A 3K7AB 4AYBB 1LTTD 5CV9A 1U4PA 4UAIA 4Y7NB 4ZUJA 3OIQA 2IWHA 4C3JG 2Z4HA 1A3VA 3D6CA 1WTVA 2IX1A 3HKZB 3F2UA 1LTSD 1SXTA 4QMGA 4CKBA 1SEBD 4K6DA 5NUCA 2R92B 3C46A 3E6ZX 1ILPA 2D2CC 2IPKD 3I3CA 2K05A 1F9PA 1KLGD 3NSWA 1AP0A 3EFXD 4KKSA 5C4HA 2B2YA 3BDCA 2Z8LA 3OMGA 1IW7D 4CJ2C 1X3QA 5A35A 2AUKA 2PW5A 4EQPA 1TS3A 2CQAA 1QWYA 4G4KA 4K6LA 4RAUC 2K32A 1FR3A 2YYZA 5DAUA 1WD1A 4G7HC 1RD9D 1EY8A 4Q5VA 1ESFA 1O80A 5ELCA 1QNKA 4HMIA 1XWEA 2L4NA 4QIWB 1C48A 2XIWA 5C0XI 4FNFA 3J80E 3NBHA 3K58A 2PZWA 4WJWA 5C0XG 5DM63 3VR6A 1I6VC 5FO7B 2F0MA 4RCNA 3NTIA 1SJED 5EKKA 3EROA 4U68A 1STHA 5JJZA 3J81L 2A6HD 3DM1A 3V96A 5J22A 1Q8IA 3N6RA 1W6JA 4KI0A 4ZRZA 3CHBD 5D65A 1JB3A 1TS2A 2JA7B 2NVQB 1H9SA 4XQJA 3PV0A 5TSSA 3TZUA 2A68C 3TP8A 1SE2A 1TY0A 5EBCA 3SK5A 3WOFA 4FYDA 2DNEA 1YNND 1B9NA 4F87A 4OO1H 4X3TA 4X3KA 2ZXPA 2RA4A 1O78A 2K01A 5CV5A 3BYTB 3HZXA 2V4DA 2FMCA 1OXVA 5C0XH 1LT5D 5M3MB 2R93B 2D9UA 1WD0A 1KLUD 2F0DA 1DYQA 2DNCA 1PXUA 3VYRA 1HFNA 4A3GB 1FYCA 4U673 4FVMA 3PIP3 3ND9A 4HSPA 1EY0A 4P2CB 3C1FA 3PUZA 1MSHA 1DXMA 3DXJC 1YNJC 2X69A 1NR4A 1PMRA 1R4PB 1QCBD 3U9SA 4XTCS 1GUTA 1PFNA 1GUGA 3NE5B 2RDGA 4QF4A 1H9SB 3X3MA 4HMJA 5KNCA 3MXNA 1R4QB 1E2VA 2RDFA 1H9JA 5C0XJ 2D5DA 1AZPA 1M4VA 3D4WA 1KDCA 1RJTA 2D62A 3OW7A 1WTWA 2IJ0A 1ESRA 5C3EB 2KEDA 3TDQA 3KLRA 2G9DA 2K5QA 1EU3A 2NN6I 3RUZA 2F0FA 5K36G 1EY5A 2NN6G 4NDXA 3PMFA 4CJ1B 2G9HD 2IX3A 3TSSA 5KRUA 3FEWX 3S2DB 5IODA 4DK1A 2KCNA 3K0YA 3QB3A 3S17B 2K28A 3E0JA 1I4PA 1LT6D 4H13C 2EY2A 3C1EA 1PFMA 2EOTA 1CQVA 3BVMA 1Q1EA 5FK9C 4V0BA 2Q8TA 3M85A 2RSNA 3T56B 2EDGA 2KJXA 4KD3A 2HDLA 2EY6A 2VB2X 1EY6A 5I9PA 4KY7A 1V1OA 4DN4M 4KHZA 3QWNA 1U4MA 1V8QA 4A3MB 1HRJA 1V43A 2WV6D 4XYQA 1U4LA 1S5ED 4FP5D 1TS4A 3PIO3 1VMPA 2A6ED 3QIAA 1Y69U 4QUCA 4PNYA 5M9OA 3N52A 3DEOA 3K5NA 1GHKA 2B8FA 1E2ZA 2SEBD 3IFDA 1D5MC 3T13A 1DM0B 4IUUA 4A3EB 4RH6A 1CZWA 1Q90A 3CRLC 1K83B 4RGNA 1BCPF 1H9MA 4EVOA 4IFDI 2Z1CA 4DU9A 1EEID 4IFDG 3BYYB 4ZAIA 4K8JA 2IX0A 1CT1D 2I46A 3OOCA 3PUVA 1JCKB 5A2QE 1I50B 2E74C 1MBYA 2E2HB 4CBVA 1JWUD 3AB9A 1U4RA 5E4XA 1D2BA 2XN9C 1H9RA 1S5FD 4ODGA 2PZUA 1WTRA 2E2DC 5JAVA 2VUMB 1S5DD 5FO9B 4XXEA 2RBMA 5JEAG 4C3IG 3EA6A 2ZXRA 3K6OA 2B63B 1EQVA 1KDBA 1TIID 1PTOC 2F0OA 3SVMA 3MXPA 1CQFA 4BY1B 1Q12A 1L0XB 3L7ZC 3P7JA 3P75A 2KUMA 5ISRA 1I4XA 3EJIA 4S3SA 1SE4A 1GXDC 4C1NI 2WACA 1D5ZC 4LAAA 5HGTA 2NB0A 1TR5A 4B08A 2PMZB 1JOOA 1LTRD 4QUFA 3GTLB 3J7YW 2AUJD 3HEJA 4HCEA 1CI3M 4IN3A 2J7ZA 4A3JB 2J4XA 5I2YA 3A55A 2M9VA 2K03A 1SDFA 2C9OA 3HG9A 1PRTC 1K8MA 4IFDJ 2F0JA 2EYPA 1MI2A 1STEA 1XTCD 2F0VA 5EKIA 3BVGA 2F4IA 2VXWA 3SK6A 1UNSA 3RD4A 2F0SA 4RFBA 1SYFA 2K1BA 4C3HB 2L5TA 4FO2A 1DOLA 1FNUA 4XQQA 3H09A 4F8MA 1HUNA 4XT3B 3CKIB 2F0EA 4IUNA 1BXTA 1EFID 4A3KB 4TQUS 5JEAJ 2F0HA 1C8CA 2AQ3B 1JOQA 1HTLD 3HS0C 2AQ2B 1ONLA 1XXGA 4Q0FA 5CV4A 3VR5A 1HXYD 2ICIA 2EYJA 3ZYYX 1I6HB 3S9WA 1EY7A 2N55A 2B39A 3CU7A 3UI2A 2XRQD 3I8ZA 3DWQA 5ELDA 1HQRD 1A6XA 4BY7B 5DM73 3NUCA 2F0TA 2B8GA 2LMCB 2LS01 1STGA 1WTXA 4Z9CB 1PZJD 2EYLA 2B2VC 2RQXA 4XDXA 1K8OA 4HN7A 3H6MA 1PFBA 3EQLC 4ZUIA 2F0QA 1ILQA 5I6WA 3S1RB 2JEBI 3S15B 3HOUB 1C4QA 2IW3A 1RHPA 4H0LC 5DNFA 1TS5A 3FPPA 4IUVA 1QE6A 3T16A 3GTOB 1HQMC 3IL8A 4ULLA 5M5WB 1NSNS 1E0BA 5D14A 1QJOA 1U9RA 3C3LA 3QJYA 1SAPA 4C3JB 4DF7A 1EIGA 4BBSB 3V05A 3SE0A 3HOYB 1UEAB 1CK1A 3FMCA 1WTOA 1J9OA 3HP3A 1ET9A 3QOLA 4FXDA 2CVRA 3NK9A 2QCPX 3VYSA 1DJRD 2MP1A 4KKTA 1B4OA 3A8IE 3ND8A 3J7AF 3MXUA 1Y8NB 1LABA 1EZ6A 3HOZB 1IW7C 1ML0D 3SK4A 3MFYA 2JA6B 1WTQA 3MHBA 1BDOA 3GTJB 3TBIB 1V1PB 5C3XA 1EWCA 1HCZA 3H0GB 1NCVA 1VF7A 1A2TA 3MXGA 1D1KA 3A7LA 2EPBA 1SYEA 1EYAA 1S5CD 2Y0SB 2KQ3A 2K33A 3W2DA 1G6ZA 2OXPA 1F9RA 1BCPD 1ENCA 1SNMA 1BCPB 3VR3A 4F7XA 2JA8B 1AN8A 1IHZA 2EY1A 4LJZC 2F0WA 3P20A 2L55A 1RTOA 1AZQA 3D8GA 5E3FA 4CGYB 3NQIA 1SNDA 2B2YC 4FF3A 5KIXA 3GTGB 4X3UA 2ZXOA 2K5WA 2NYZD 4NMZA 2KA7A 2A6HC 1KTKA 4ZQ3A 1SNOA 4ZKBB 5C5MA 4WFN3 1STYA 2YU9B 3SEBA 5KEEA 2EJMA 3AMUA 5IGDA 3VYTA 4KHVA 2SOBA 5BN4A 4KKUA 2QEJC 3R2IA 2K5DA 3J80L 5CV8A 5JOBA 1O7YA 5IIFA 1JQYD 3NTHA 4EQOA 1GHJA 3HOXB 1YNNC 2TSSA 1A3UA 4FF1A 5J1ZA 2L9HA 2MUYA 2R3ZA 1BR9A 3Q6SA 2B2WA 5M5YB 5LL6X 2QKIC 2F0UA 4OIJA 2XVSA 3PO3B 2JP1A 3GP7A 1HA6A 4N9PA 3OWFA 3WOEA 3RLFA 4RHRA 1RF2D 2IL8A 5CR3A 2NBFA 2F03A 2HDMA 1LTBD 2DY8A 3GTMB 1GOZA 3GD7A 1BUVT 4PMWA 1TVXA 5KYLA 2F0PA 2KVMA 2C5CA 2KHSA 2FINB 3AU7A 4A93B 3D31A 1HHVA 4IALA 1VDZA 1IYVA 2K6AA 1SYDA 4FXKC 1EZ8A 1HUMA 4NP5A 2OF1A 2E2IB 5EJWA 3LX0A 2SNMA 2XWJB 1HTPA 3BS1A 1F2MA 4RHSA 5IOCA 2B2WC 1TWAB 4BA2I 4RGTA 1EYDA 1QG7A 3OMCA 2WKDA 2BDNA 2K04A 1SBBB 3I91A 5LHY1 1TKWB 2JSOA 3IKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2U A;  4QUC A;  1PFN A;  5EQ0 A;  1DOK A;  1ML0 D;  1MSG A;  3N52 A;  1EL0 A;  3DEO A;  4X3S A;  1WTQ A;  2L9H A;  2R3Z A;  2SDF A;  3Q6S A;  4MHE A;  2B2W A;  4XT1 B;  2MJ8 A;  2MGS A;  5COY A;  2HCC A;  1NCV A;  4IUT A;  3IFD A;  2N55 A;  4OIJ A;  1U4P A;  2NZ1 D;  2EPB A;  3QO2 A;  4UAI A;  1AZP A;  1IKM A;  4ZK9 B;  3UI2 A;  4HED A;  5EPL A;  4U68 A;  2JP1 A;  4QUF A;  4RA8 A;  1RJT A;  3I8Z A;  4IUU A;  5CMD A;  5CBE E;  1WTW A;  1G6Z A;  1NR2 A;  1ESR A;  1HA6 A;  2DY7 A;  1WTV A;  1G91 A;  1F9R A;  2X6G A;  2L1B A;  5JJZ A;  1O7Z A;  1BF4 A;  3LWE A;  3TN2 A;  1ROD A;  1J8I A;  1WVL A;  2Q8R E;  3F2U A;  2KED A;  3DM1 A;  1JIC A;  1WTX A;  1BNZ A;  1BO0 A;  2IL8 A;  2B2V C;  3ONA B;  5AFW A;  3FPU B;  4HSV A;  4XDX A;  2J7Z A;  4R8I A;  1JE4 A;  4CJ0 B;  1S4Z A;  2HDM A;  2DY8 A;  2B2V A;  4ZAI A;  1RTO A;  1ILP A;  4IUQ A;  5D65 A;  2B2T C;  1GUW A;  5T1G A;  1IL8 A;  3H91 A;  3I3C A;  1AZQ A;  1TVX A;  2K05 A;  1G2S A;  1XYI A;  3D6W A;  1B2T A;  2K03 A;  1KNE A;  1VMC A;  2B2T A;  1F9P A;  1PFB A;  1SDF A;  2FMM A;  1EOT A;  2KVM A;  2L11 A;  2RSO A;  3MWY W;  4CJ1 B;  1ILQ A;  1CA6 A;  1RTN A;  1AP0 A;  3G7L A;  1CA5 A;  2B2Y C;  3GV6 A;  1U4R A;  3TZD A;  1BBX C;  1MI2 A;  2FIN B;  2NWG A;  1MGS A;  1EQT A;  1RHP A;  2FHT A;  2HCI A;  3I90 A;  5DNF A;  5EPJ A;  5E4X A;  1HHV A;  2B2Y A;  4OIK A;  1F9S A;  1Q3L A;  1KNA A;  4IUV A;  4X3U A;  1WTO A;  1QE6 A;  5EKI A;  1A15 A;  4X3T A;  2K28 A;  4X3K A;  1HUM A;  2NYZ D;  1X3P A;  2KEC A;  3IL8 A;  1WTP A;  2VXW A;  3KUP A;  1ICW A;  1WTR A;  5COR A;  2X6L A;  4CJ2 C;  2RA4 A;  3DEP A;  4NW2 A;  2K01 A;  1PLF A;  1X3Q A;  1ZXT A;  4ZKB B;  4ZKC B;  1E0B A;  5D14 A;  1G2T A;  2B2U C;  2JYO A;  1PFM A;  5EJW A;  5CBA E;  2EOT A;  2RVL A;  1EIH A;  1SAP A;  2K1B A;  2MPM A;  1EIG A;  2L12 A;  4LMQ D;  5E4W C;  1HFG A;  2Q8T A;  1X32 A;  4MN3 A;  4ZLT F;  4RAU C;  1DOL A;  2B2W C;  2RSN A;  1J9O A;  3HP3 A;  1CM9 A;  1NAP A;  2D9U A;  2EE1 A;  3R93 A;  1WD0 A;  4O42 A;  2FFK B;  2HDL A;  5T1I A;  1M8A A;  1F2L A;  1HFN A;  4HCS A;  1B53 A;  4RWS C;  3GV3 A;  4IUR A;  2KEE A;  5EPK A;  1XX8 A;  1WD1 A;  2KOL A;  4XT3 B;  2CVR A;  1F9Q A;  1DZ1 A;  1HUN A;  2N88 A;  2M2L A;  4DN4 M;  1O80 A;  1QG7 A;  3FDT A;  1U4M A;  1B3A A;  1QNK A;  3MTS A;  2HUG A;  2FJ2 A;  4IUP A;  1IKL A;  3SVM A;  2BDN A;  2K04 A;  1HRJ A;  3KBX A;  4HAE A;  1O7Y A;  3I91 A;  1C8C A;  2MP1 A;  3P7J A;  1U4L A;  1SSO A;  1MSH A;  1DOM A;  1B4O A;  2L4N A;  4R9W A;  2KUM A;  1DON A;  1VMP A;  1LV9 A;  2X69 A;  1PDQ A;  1NR4 A;  2H1E A;  2XIW A;  1B50 A; 
#chains in the Genus database with same CATH topology
 2PW7 A;  3D3R A;  1SMY D;  5D3I B;  1XPO A;  3OPO A;  5AJ3 L;  3DM3 A;  2I5H A;  3K5M A;  1JOK A;  2N49 A;  2PI2 E;  2MJ8 A;  2MGS A;  2ZJR A;  1X9N A;  4BWG B;  4IUT A;  4PMC A;  5M3F B;  1WTH A;  5IGC A;  3MEH A;  1I94 L;  2PO4 A;  2AWN A;  1PH3 A;  1J5E L;  3I4N H;  4A3B H;  4K8I A;  3SHL A;  2BE5 D;  5CMD A;  3U4Z A;  4K14 A;  2A1A A;  5LMN W;  4B3R L;  4CHT B;  4GLX A;  1RKN A;  2RKS A;  4KY5 A;  4DUZ L;  2F0L A;  3PIP A;  3A8J E;  5KND A;  2VQF L;  1M90 C;  1XNR Q;  3HOV B;  3H15 A;  2NTS A;  1BO0 A;  5DEH A;  3URY A;  1X3F A;  3FPU B;  2A6E C;  3UDG A;  1EY4 A;  4HIK A;  1VQ9 A;  1Q7Y C;  4J1M A;  2F3W A;  2UUC L;  4JBW A;  2CHB D;  5K36 H;  4BBR H;  3IAY A;  2NN6 H;  4A3E G;  2B2T A;  5FLM G;  2B29 A;  3SK8 A;  1QUQ B;  1CA6 A;  3A7A B;  4KMU C;  4CKE A;  4CDC C;  4H02 A;  2M00 A;  1UWV A;  1T9H A;  1BKB A;  1MGS A;  1E22 A;  2FHT A;  2TMP A;  3A56 A;  4OEM B;  1GUO A;  2EJG C;  2KEC A;  4QGU A;  4KN7 C;  1NE3 A;  4NW2 A;  4K5X A;  1CFM A;  2L0C A;  1JR0 D;  1S3O A;  1T5E A;  2MPM A;  4CDF C;  5JJI A;  3CPF A;  1PH6 A;  3KOJ A;  4K5W A;  3HOV H;  3KF6 A;  4K5V A;  2ZJQ A;  5ELF A;  2O5I C;  3R93 A;  2WII B;  1B7Y B;  1JJC B;  1QIL A;  2FFK B;  2LXK A;  4AH6 A;  1ZYR C;  5IT9 E;  4P72 A;  4RWS C;  4IUR A;  4DV4 Q;  1LTI D;  1XX8 A;  1AE2 A;  2EYF A;  3M4Y A;  4G7O C;  5HGQ A;  1T5X D;  3GO5 A;  1CZG A;  1FNW A;  2IHE A;  2F0N A;  4GLV B;  3L3O C;  4HID A;  4LNQ A;  1A3T A;  2JK8 A;  3I4M H;  1DOK A;  4DNR B;  2B63 G;  2ZM6 L;  1I4R A;  4JI2 Q;  2PYK A;  3HOW H;  2VY3 A;  1L0Y B;  4MHE A;  5CC4 A;  3WWV A;  3KK7 A;  3W3A A;  1E1T A;  1LAC A;  3KLS X;  3WDN A;  4IJH A;  4ZYS A;  4XYO A;  3J7Z C;  1KAB A;  3FKI H;  4R8N A;  2NZ1 D;  3PUX A;  4JYA L;  4DV2 Q;  4L63 B;  4C2M B;  2CWP A;  2F52 A;  4QCL A;  2L15 A;  3JAM E;  1W3S A;  1LUZ A;  4LFB L;  1B70 B;  1N9W A;  2L1B A;  2RF4 A;  4G57 A;  1XNQ Q;  3TN2 A;  1HPC A;  1ROD A;  2EYO A;  4HTH A;  2EYH A;  3NEN A;  1JE5 A;  4C3I B;  5IT9 c;  4RKB A;  5A2Q L;  1SYG A;  3ONA B;  4IFD H;  3KF6 B;  3U4V A;  3K7U C;  4B3T Q;  1YEZ A;  2R6G A;  4IUQ A;  3ULJ A;  2HQE A;  1IL8 A;  3MFG A;  5BN3 A;  3K81 C;  3D6W A;  5I6Y A;  1K9M C;  3PO2 G;  1AEX A;  4HJA A;  4HJ9 A;  1EEF D;  3FVQ A;  3IRB A;  5C44 G;  1MJC A;  5E7N A;  3CQZ H;  2EYM A;  2VQE L;  1O7I A;  1Y8O B;  1IXR A;  3BZC A;  1PHJ A;  2Z6K A;  2PZT A;  4C2M H;  2V1C C;  3KLS A;  4BA1 I;  1VQF A;  4DPG A;  4GKJ Q;  5COR A;  2X6L A;  3M7N A;  4ZKC B;  1PTO H;  2E76 C;  4DR6 Q;  2A69 D;  1D5X C;  4DFA A;  3W5O A;  2HIV A;  4OHJ A;  4DV1 L;  3JAM c;  1V9P A;  1X32 A;  3A8K E;  2A74 C;  5JEA H;  5CYU A;  4C3I H;  1TU2 B;  5FLX E;  1NAP A;  1TWG B;  1ENA A;  3T1Y Q;  3A74 A;  3GV3 A;  5EPK A;  3V2T A;  2E5L L;  2WP8 J;  3PF4 A;  1K3R A;  2PNR C;  3I73 A;  1N33 Q;  1SSO A;  1C0A A;  1GO3 E;  3U9O A;  3PUW A;  4QB4 A;  1R9T H;  1TWF B;  3D4D A;  4RKL A;  1WCM B;  3GQB A;  2F0G A;  5G3L F;  1W6K A;  2SDF A;  1HNW Q;  3I70 A;  3BZD B;  1GUN A;  1CHP D;  3R8B A;  4ILW A;  1PA6 A;  4ZK9 B;  1QOH A;  3BG3 A;  2ZTD A;  4DR5 Q;  1K73 C;  4LF6 L;  2CW0 D;  2KBN A;  3NWS A;  1LLR D;  3L2P A;  1Y1V G;  2X6G A;  2F0K A;  3S16 H;  4TKO B;  1LYL A;  5FLX c;  2UUA L;  1VQD A;  3KBG A;  5HY6 A;  1TWC B;  1Q82 C;  5LMN L;  1SE3 A;  2IT1 A;  2OEO A;  4UPA A;  4DV5 Q;  1BBU A;  4IQZ A;  5GQO A;  4TRD A;  1EOV A;  4CJ0 B;  2PQE A;  5ELB A;  1ZKO A;  1BQQ T;  4BY7 G;  1TWF H;  3G48 A;  1VQN A;  4OL7 A;  3MWY W;  1EYC A;  4LFC L;  4A3D H;  2NUC A;  4I65 A;  1RTN A;  3A0J A;  3G4S A;  3ULP A;  4B3M Q;  2VS1 A;  4R4O A;  3VR4 A;  1SFO H;  1BOS A;  4DV0 Q;  3T4A C;  4AYB G;  2CWA A;  2WIN B;  1VCI A;  1BBX C;  2VNU D;  1F9S A;  3CP0 A;  2QEX A;  1A15 A;  4EQN A;  4RGO S;  3MA2 B;  1YNX A;  3PQI A;  2R61 A;  4X62 Q;  1PLF A;  1NY4 A;  2Z4I A;  2RDH A;  1SNC A;  1Y1W H;  3O13 A;  2JA5 H;  1HNX Q;  1EIH A;  2Q2H A;  2SNS A;  3K0X A;  3MZ5 A;  1SJH D;  3STB C;  3HOU G;  3HKZ G;  1LT4 D;  4A3F B;  4NXN Q;  3H3V H;  1V1P A;  1CM9 A;  1PYW D;  5H1S E;  4O42 A;  1QZH A;  4JPB W;  1XNR L;  3J7A V;  2R92 G;  4HCS A;  1NMF A;  1WOC A;  4I7Z C;  2EZV A;  4C56 C;  3OHX C;  1CHQ D;  2M2L A;  3CCJ A;  2F4V Q;  4IUP A;  3MTS A;  1LM0 A;  3RLO A;  4RCO A;  3BDO A;  2NVX B;  4GZY C;  1VQH A;  4PZ8 A;  2R7Z B;  1N34 Q;  5C4J H;  1EU4 A;  1LO5 D;  4UP8 A;  1BBW A;  3HOY G;  4R9W A;  1Y1V H;  4L6T B;  2H1E A;  1CA5 A;  1I4G A;  4ID6 A;  2B2U A;  2DJF C;  3HGB A;  3I56 A;  2PCF B;  2EJF C;  2XRS D;  1OXT A;  2LFN A;  4GLA C;  1HZA A;  4TVA B;  4XT1 B;  2EXD A;  1TT2 A;  2PPB C;  1STB A;  2HCC A;  2K7V A;  1PVO A;  3TP7 A;  3I4L A;  1KAW A;  2MHV A;  4A3F H;  3HOZ G;  3GTP B;  1KAA A;  3RZD B;  5C4X H;  1I3Q H;  1OXU A;  5KNB A;  3LWU A;  1QVC A;  3S2H B;  1G91 A;  3K7A H;  1G8Z D;  3ERS X;  2JA6 G;  2Q8R E;  5BR8 Q;  2JEA I;  1X54 A;  2K52 A;  3H0G G;  4X65 Q;  4Y7N H;  4R8I A;  1JE4 A;  1ICF B;  1S4Z A;  3J81 E;  3BDL A;  4QQB X;  1HH2 P;  4PQX A;  2H5X A;  2KEN A;  4C1N K;  1Q81 C;  5FOB B;  1HR0 Q;  3M3Y B;  2YTV A;  3S1M B;  1B2T A;  1YHQ A;  1STN A;  4ABN A;  3Q22 A;  1Y14 B;  3GTQ B;  4ME5 A;  3A5Z B;  1OXX K;  2JA8 G;  3TZD A;  2HCI A;  1PTO F;  4R1J A;  4JI2 L;  2NVT B;  1B3Q A;  4OO1 I;  1HA5 A;  4UHV A;  1S72 A;  1O7L A;  3NPP A;  3AFP A;  1BCP C;  2E2J B;  4OO1 G;  1ICW A;  3GTP H;  4A3C G;  2MFI A;  1G2T A;  4DV2 L;  1IBM Q;  4N9T A;  2B2U C;  1Z6H A;  2LY7 A;  4JI0 L;  4A75 A;  3BU2 A;  4DUY Q;  1B44 D;  3Q23 A;  1VQM A;  1XNQ L;  4B3S L;  5T1I A;  1M8A A;  1FGB D;  4JI5 Q;  1B53 A;  1DZ1 A;  1GVP A;  3AEV A;  4KV6 A;  4WRD A;  3T53 B;  1YVC A;  3MC0 B;  3J81 c;  4HAE A;  4BS9 A;  4HIO A;  4B3T L;  1GJX A;  2HT1 A;  2JA7 G;  3CME A;  3A54 A;  1F77 A;  3GTQ H;  1DON A;  3I90 A;  4GN3 B;  3M4O B;  1B50 A;  3RZO B;  3SDZ A;  1VQC A;  3S14 B;  1EIF A;  3S1N B;  4X3S A;  4DR3 Q;  4YWK A;  2LSS A;  3CAM A;  2E2J H;  2OQ0 A;  3KLW A;  1G6P A;  5COY A;  1GUS A;  1I5F A;  4PZ6 A;  1RDP D;  1UE5 A;  3K80 C;  2BA0 A;  1IKM A;  4PV1 C;  2A68 D;  1PRT F;  1IBK Q;  4K0K Q;  1AW7 A;  2LXJ A;  5JVG 3;  4DR6 L;  1MKH A;  4E6I A;  5M5X B;  2DY7 A;  2R93 G;  1DCZ A;  1BF4 A;  3RNU A;  4A3G G;  1SYC A;  4KY6 A;  3T1Y L;  5IGF A;  3OIP A;  4HSV A;  4FF2 A;  4RG1 A;  2ZT9 C;  3S1Q B;  5C5L A;  1UUP A;  2F3V A;  3NQT A;  4GNX C;  1N33 L;  1ZEQ X;  3OWE B;  3M4O H;  1SYB A;  3T51 B;  4X6A H;  4IPG A;  2RSO A;  3NXW A;  3K57 A;  2L11 A;  3NBI A;  4HJ8 A;  2HQL A;  3S1N H;  3CCR A;  4HR7 B;  2QDB A;  1A8V A;  4M8A A;  2OT2 A;  4OIK A;  5LL6 S;  1HNW L;  1YNJ D;  2BH8 A;  3P1H A;  2A5H A;  2BDO A;  4YY3 Q;  4A3I B;  2JA7 H;  3KUP A;  1SNP A;  3EVQ A;  4O1N A;  3G6J B;  5IYB H;  3K59 A;  5CBA E;  3X3N A;  4HJ5 A;  2I07 B;  4DR5 L;  2L12 A;  1Y8P B;  1WFQ A;  2AHO B;  4A93 G;  3RMH A;  1OO9 B;  4J6H A;  3Q24 A;  5ELN A;  4J8Q A;  4M1U B;  3VA5 A;  3FRP B;  5KYI A;  1YJW A;  3MVV A;  1XMO Q;  3DWA A;  1P8L A;  4K2K A;  2N88 A;  4DV5 L;  2J0T D;  4G7Z C;  3FDT A;  4FXG C;  3SXH A;  1YJ9 A;  2NZO A;  4CKC A;  1KDA A;  2H4O A;  5M3M H;  4IZ8 A;  2R93 H;  3QOJ A;  5G3L D;  4JI6 Q;  3K5O A;  4A3G H;  5EQ0 A;  3I4N B;  4B3M L;  2DJG C;  4A3B B;  4EGV A;  4DV0 L;  4DV7 Q;  1AH9 A;  4JK1 C;  3S24 A;  3TP6 A;  1D7Q A;  1L1O A;  2Q2T A;  2BOS A;  3ERQ A;  3QO2 A;  3HFZ B;  1JC7 A;  5J3B A;  5EPL A;  4X62 L;  1A63 A;  4OGQ C;  1AFP A;  1MHW C;  1NR2 A;  2K14 A;  4BBR B;  2DUD A;  2F0I A;  2QGQ A;  3DHQ A;  4DXG A;  1J8I A;  4NXN L;  3DUZ A;  3KDF A;  1H9K A;  4DV3 Q;  5AFW A;  2CQO A;  5CGK A;  5M3F G;  4A3M G;  4DAV A;  5J39 A;  1SMY C;  4DAY A;  2N3S A;  1VQ5 A;  2F4V L;  3CCS A;  1KXL A;  4DR7 Q;  5C4Z A;  3SR1 A;  5T1G A;  3H91 A;  4OXP A;  4OWT B;  1VF5 C;  4DXF A;  1FNV A;  1G2S A;  4XIG S;  5C3E H;  1N34 L;  1NBW A;  1VQB A;  4DR4 Q;  1KNE A;  4A3L G;  4PG3 A;  1EOT A;  2JXM B;  3U58 A;  2NVY B;  1ENF A;  2NTT A;  1X55 A;  3E5S A;  3GV6 A;  3OSO A;  1B1Z A;  4OWX B;  4KN4 C;  2QF7 A;  1EQT A;  3G71 A;  3W1G A;  4F88 A;  4DR2 Q;  2BE5 C;  2LKV A;  1QB5 D;  5JVH 3;  1X3P A;  2EY5 A;  3KYH C;  5EBD A;  3DEP A;  2UXB Q;  3TP5 A;  1UAP A;  2XWB B;  4DNI A;  3F8T A;  1HJP A;  1LT3 D;  1L1O B;  1XJV A;  4LMQ D;  2GVA A;  1HFG A;  4OWW B;  4ZLT F;  1JJG A;  1F2Y A;  4DK0 A;  1PZI D;  2WKC A;  4KJN A;  5I9O A;  4K2L A;  4H44 C;  5BR8 L;  1L1O C;  5IGB A;  1F2L A;  5BN5 A;  3I4M B;  4UP9 A;  4L5S A;  5HUR A;  2KOL A;  4MTN A;  2QIL A;  1K0R A;  1B3A A;  4DGZ A;  4LW1 A;  2FJ2 A;  3KDF B;  3HOW B;  3JAM i;  3KBX A;  4QL5 A;  4KJO A;  3G6E A;  1IYJ B;  4UDU C;  2NVY H;  4B9X A;  1Z47 A;  1HR0 L;  1U0L A;  3FKI B;  4DAY B;  1I4Q A;  1MD2 D;  3KF8 A;  3QR8 A;  1E3P A;  3DWP A;  3CCV A;  1N36 L;  3TME A;  1VQ8 A;  2K50 A;  1L0W A;  2R7F A;  1PH8 A;  1IL2 A;  2ICE C;  2BH2 A;  1FVI A;  1EL0 A;  1XPU A;  3GTK B;  4A3M H;  3R2T A;  1IZ6 A;  5DLQ E;  3UE0 A;  3VA7 A;  5F2D A;  1SNQ A;  2N78 A;  1EY9 A;  4YCU A;  1QNU A;  3J81 j;  2VUM G;  3I2Z A;  1XTD A;  4L5R C;  4LUV A;  3NHH A;  1JWM D;  1VQE A;  2JE6 I;  4IOA A;  1ZYR D;  1IBM L;  1Z9F A;  3PUY A;  2UXD Q;  3UDF A;  5CBE E;  4L8J A;  4P71 A;  5FO8 B;  1O7Z A;  2KCM A;  4JI4 Q;  5IGE A;  2Q8I B;  3TS2 A;  3CCE A;  3CQZ B;  4JI5 L;  4IOC A;  4EX5 A;  1LTA D;  1SRU A;  4BY1 G;  1CTM A;  4TSS A;  3L9A X;  3CC2 A;  1X3G A;  5K5P A;  2B2T C;  4A3E H;  5GRO A;  3VDY A;  1KIX A;  4DA2 A;  1XYI A;  5FLM H;  1FD7 D;  2FMM A;  1TQO A;  1PTO D;  1N32 L;  1II3 A;  3GTK H;  1PTO B;  3G7L A;  3HKS A;  4MNO A;  2NWG A;  1SRO A;  5IWA Q;  4DR3 L;  1IYU A;  3KF8 B;  1KNA A;  1KRT A;  1IBL Q;  4GKK Q;  1PFS A;  5JPM C;  1WTP A;  1KHI A;  1JOR A;  3PIO A;  1I50 H;  1EQQ A;  4LK1 C;  5IT9 L;  4DV6 Q;  2JYO A;  2XNA C;  5EKL A;  2E2H H;  2A73 B;  2RVL A;  3DMU A;  4K0K L;  2EVB A;  4JBJ A;  3TS0 A;  3NWT A;  4MN3 A;  2E75 C;  4LF7 Q;  2O5J C;  2EE1 A;  4IPC A;  5JPN C;  4DNT B;  1R9T B;  2B3G A;  4R4Q A;  1STA A;  5C6A A;  4A3J G;  1D6E C;  2XSC A;  3OW2 A;  4BXX G;  2MO0 A;  3GDE A;  4PMB A;  2EXZ A;  4H7B A;  2HUG A;  1YZ6 A;  2JQO A;  4A4I A;  1RCV D;  5CV6 A;  1DOM A;  2AWO A;  2O4X A;  1PZK D;  1ET6 A;  2QW7 A;  3PO2 B;  3K5L A;  1C7Y A;  2B63 H;  3VR2 A;  5CV7 A;  1JWS D;  4A76 A;  5C44 B;  4JW0 A;  2A69 C;  2BCO A;  4CDE C;  3S16 B;  2MNA A;  3JAM L;  1G51 A;  1PRT D;  3Q0A A;  4MTK A;  4JI1 L;  1PRT B;  2DN8 A;  2ENB A;  3IFT A;  1B9M A;  4YY3 L;  4DAP A;  1BVS A;  1X56 A;  4HED A;  3ITP A;  3CRK C;  4RA8 A;  3I55 A;  3QG1 A;  4MIU A;  1TXY A;  4C3H G;  1WCM G;  3CF5 A;  1PH9 A;  3LWE A;  1WVL A;  1F2Z A;  3C2P A;  1A2U A;  1JIC A;  4WOR A;  3R3O A;  4A3D B;  4XQN A;  1BNZ A;  5FJ8 G;  1SFO B;  2UUB Q;  4A3K G;  1XMO L;  1D8L A;  4B9W A;  2GA4 B;  4LF9 Q;  5E1F A;  2B2V A;  1KQS A;  2WB1 B;  4KD4 A;  1GUW A;  1G29 1;  1L2F A;  3PO2 H;  3RLN A;  3EIV A;  1VQA A;  1VMC A;  1E2W A;  4NKL A;  1TWH B;  5C44 H;  4N8X 1;  1Y1W B;  3I72 A;  4JI6 L;  2JA5 B;  3HRZ C;  2K4K A;  1EWH A;  1S5B D;  4V19 0;  1OXS C;  2Z6K C;  5FKA C;  5EPJ A;  2CW0 C;  3CPW A;  4DV7 L;  4FF4 A;  1Q3L A;  1MJE A;  3NP8 A;  1D1I A;  5L37 A;  2ID0 A;  4YIJ A;  1EUJ A;  5FLX L;  3D4R A;  3H3V C;  1ZXT A;  3NTK A;  1PH4 A;  2O2L D;  1SLJ A;  1Z7T A;  1EIY B;  5EGT A;  3H94 A;  5E4W C;  1TY2 A;  2KCC A;  3LNN A;  3UDX A;  5ELE A;  5C4J B;  1E1O A;  2BA1 A;  1Y1V B;  2WAQ B;  1P16 A;  3BVZ A;  5KGU A;  3M9B A;  2F3I A;  5IGG A;  2KEE A;  1F9Q A;  5I2X A;  5JJK A;  2VB3 X;  1Q1B A;  3MAQ A;  4KTA A;  1CKO A;  4NPS A;  1IKL A;  2F1M A;  3M7G A;  1NUC A;  2AQ1 B;  4RGM A;  4C3H H;  4DR7 L;  1TWH H;  4LF5 Q;  1C9O A;  5D3D A;  3VYU A;  5C3W A;  1S40 A;  1LV9 A;  1PDQ A;  3CC7 A;  5ELO A;  1I4H A;  1MSG A;  5C4X B;  1I3Q B;  1LTG D;  1DD2 A;  5I4D A;  4LUO A;  3J81 i;  4KK7 A;  3K7A B;  4AYB B;  3A5U A;  2E8G A;  1LTT D;  4DR2 L;  2WFW A;  5CV9 A;  4LF4 Q;  1YIJ A;  1U4P A;  3L0O A;  4UAI A;  4Y7N B;  4ZUJ A;  3OIQ A;  2UXB L;  2IWH A;  4C3J G;  2Z4H A;  1VQG A;  1A3V A;  3CCM A;  4BBS G;  3D6C A;  1EQR A;  3LGJ A;  1WTV A;  2IX1 A;  3AYH B;  2WB1 E;  2P5Z X;  3HKZ B;  3F2U A;  1PH7 A;  1WJJ A;  3FHW A;  1LTS D;  1I6H H;  1SXT A;  4QMG A;  4CKB A;  1SEB D;  1AE3 A;  4JCV E;  4K6D A;  5NUC A;  2R92 B;  3C46 A;  3CD6 A;  2CFM A;  3E6Z X;  3PCO B;  1ILP A;  3J80 i;  2D2C C;  4BY7 H;  2IPK D;  3I3C A;  3FP9 A;  4OX9 Q;  4O2D A;  2K05 A;  4YCW A;  4WJ3 M;  4AQY Q;  1F9P A;  1KLG D;  4B3R Q;  3NSW A;  2Q2I A;  3E9H A;  1AP0 A;  3EFX D;  4DR1 Q;  4KKS A;  1GM5 A;  1VQL A;  1VQ7 A;  5C4H A;  2B2Y A;  3BDC A;  4UP7 A;  2Z8L A;  5GAD C;  3OMG A;  4DV4 L;  1VQO A;  2UU9 Q;  4P73 A;  1V1Q A;  2WAQ E;  1PV4 A;  1IW7 D;  2GVB A;  2Y0S G;  4CJ2 C;  1X3Q A;  3S1R H;  5A35 A;  2AUK A;  2PW5 A;  4EQP A;  2GN5 A;  2KHJ A;  1TS3 A;  1CSP A;  2CQA A;  1QWY A;  3HOU H;  4G4K A;  4K6L A;  1XPR A;  2UXD L;  4QY7 A;  5IP9 G;  4RAU C;  2K32 A;  4IO9 A;  1FR3 A;  2YYZ A;  5DAU A;  2R92 H;  1FL0 A;  4JI4 L;  1QVG A;  1WD1 A;  4G7H C;  1RD9 D;  1EY8 A;  4Q5V A;  1ESF A;  1O80 A;  5ELC A;  1QNK A;  4HMI A;  4BBS H;  3HOY H;  1XWE A;  2YTY A;  2L4N A;  3ER0 A;  4QIW B;  1C48 A;  2XIW A;  5C0X I;  4FNF A;  3J80 E;  4R4I A;  3NBH A;  3K58 A;  2PZW A;  1H95 A;  4WJW A;  5C0X G;  1Q46 A;  5IY0 A;  5DM6 3;  3VR6 A;  5IYC G;  1I6V C;  5FO7 B;  5IWA L;  2F0M A;  4RCN A;  4GOP A;  1XMQ Q;  3NTI A;  4GKK L;  1MIU A;  3HKZ E;  4JOI A;  1YBY A;  1SJE D;  5EKK A;  3ERO A;  3HOZ H;  4U68 A;  1FJG Q;  2JA6 H;  1STH A;  5JJZ A;  3J81 L;  3GTJ H;  2OTL A;  4YWM A;  2A6H D;  3DM1 A;  1UE1 A;  2XGT A;  3H0G H;  3V96 A;  5IP7 G;  2UXC Q;  5J22 A;  2D0P A;  3NEM A;  1Q8I A;  3N6R A;  3KJO A;  1W6J A;  4KI0 A;  3E0E A;  3K8A A;  4ZRZ A;  3CHB D;  1VQK A;  1DGS A;  5D65 A;  3HOX G;  1JB3 A;  4GKJ L;  3I7F A;  1TS2 A;  2JA7 B;  2NVQ B;  1H9S A;  5IP9 H;  4XQJ A;  4JC0 A;  1SMX A;  2K5N A;  3PV0 A;  1E7Z A;  3J80 c;  2JA8 H;  5TSS A;  3TZU A;  2A68 C;  3TP8 A;  1SE2 A;  1TY0 A;  5EBC A;  3SK5 A;  3WOF A;  4FYD A;  2DNE A;  1YNN D;  3NBH B;  1B9N A;  4F87 A;  4OO1 H;  4X3T A;  4X3K A;  3CXC A;  4LFA Q;  4A3C H;  3PO3 G;  2ZXP A;  2RA4 A;  1O78 A;  2K01 A;  4DK6 C;  5CV5 A;  2CH4 A;  2YTX A;  3BYT B;  4GOP B;  3HZX A;  2V4D A;  1K8A C;  2FMC A;  1OXV A;  1HZB A;  5C0X H;  1LT5 D;  2VQE Q;  3JC6 6;  2A8V A;  5M3M B;  2NZH A;  4GOP C;  2R93 B;  2D9U A;  1WD0 A;  1KLU D;  2F0D A;  4JBK A;  1YHA A;  1DYQ A;  2DNC A;  1PXU A;  4JOI C;  3VYR A;  1HFN A;  4CDD C;  4A3G B;  2VW9 A;  4A3I G;  4Y52 H;  4JV5 Q;  1FYC A;  4U67 3;  3CMA A;  2OCE A;  4FVM A;  3PIP 3;  2UUB L;  3ND9 A;  4HSP A;  1EY0 A;  4P2C B;  4LF9 L;  2YU9 H;  3C1F A;  3PUZ A;  2NVQ H;  1MSH A;  1DXM A;  3RN5 A;  3DXJ C;  1YNJ C;  2X69 A;  1NR4 A;  1PMR A;  4L5Q A;  1R4P B;  1QCB D;  3U9S A;  2QDL A;  4KLK A;  4XTC S;  1GUT A;  1GD7 A;  1VS0 A;  1PFN A;  1GUG A;  3NE5 B;  2RDG A;  1RIP A;  1YJN A;  3CW2 C;  4QF4 A;  1H9S B;  3X3M A;  4HMJ A;  4I7A A;  1ASY A;  3TRE A;  5KNC A;  3MXN A;  1R4Q B;  1E2V A;  2RDF A;  1H9J A;  3F2D A;  2HHH Q;  5C0X J;  2D5D A;  1AZP A;  1M4V A;  3I4O A;  3D4W A;  1KDC A;  1RJT A;  2D62 A;  3OW7 A;  1WTW A;  3I4N G;  2IJ0 A;  1ESR A;  4A3B G;  5C3E B;  2KED A;  3TDQ A;  4IJL A;  4NB3 A;  3KLR A;  2G9D A;  3M4Q A;  2K5Q A;  1EU3 A;  2NN6 I;  1RL2 A;  2JA9 A;  1NTG A;  3RUZ A;  4N8F A;  2F0F A;  1OTC A;  5LMU Q;  5K36 G;  3TQY A;  4BBR G;  4LF5 L;  1EY5 A;  2NN6 G;  4NDX A;  3PMF A;  1N8R C;  4CJ1 B;  1HNX L;  2G9H D;  2IX3 A;  2UUA Q;  4O0A A;  1K28 A;  3TSS A;  5KRU A;  3FEW X;  1SE8 A;  3S2D B;  1HZC A;  5IOD A;  4DK1 A;  2KCN A;  1WYD A;  3GTM H;  1SN8 A;  3K0Y A;  1HNZ Q;  3QB3 A;  3S17 B;  2AKW B;  2K28 A;  3E0J A;  1I4P A;  4LF4 L;  1LT6 D;  4H13 C;  2EY2 A;  1VQI A;  3C1E A;  1PFM A;  2EOT A;  1CQV A;  3BVM A;  4LFC Q;  1Q1E A;  5FK9 C;  4V0B A;  3MXN B;  2Q8T A;  3M85 A;  4A93 H;  2RSN A;  4AIM A;  3OYY A;  3T56 B;  3HOV G;  1NJI C;  2EDG A;  2KJX A;  2ZJP A;  4KD3 A;  2HDL A;  2EY6 A;  2VB2 X;  3W1B A;  1EY6 A;  4YHH Q;  2OTJ A;  5I9P A;  4KY7 A;  4APV A;  1V1O A;  4DN4 M;  4KHZ A;  3QWN A;  2E2I H;  1U4M A;  1V8Q A;  4A3M B;  1HRJ A;  1V43 A;  2WV6 D;  4IPH A;  2PNH A;  4XYQ A;  3RN2 A;  1U4L A;  1S5E D;  4OX9 L;  4FP5 D;  1TS4 A;  1TWA H;  1VMP A;  3PIO 3;  1QVF A;  3S2D H;  4AQY L;  2A6E D;  3QIA A;  1Y69 U;  4QUC A;  4PNY A;  5M9O A;  3N52 A;  3I4M G;  4DR1 L;  3DEO A;  3S17 H;  1VQP A;  3K5N A;  1GHK A;  2B8F A;  3TEH B;  3HOW G;  1J6Q A;  1E2Z A;  4X65 L;  1FGU A;  2SEB D;  3KFU A;  3IFD A;  1D5M C;  2UU9 L;  3F2C A;  3FKI G;  3T13 A;  1DM0 B;  4IUU A;  1PH2 A;  4A3E B;  1Q8K A;  4RH6 A;  2R7D A;  4IPD A;  1CZW A;  1Q90 A;  3CRL C;  1K83 B;  1NMG A;  4RGN A;  4JI3 Q;  5M3F H;  1BCP F;  1H9M A;  4EVO A;  4IFD I;  2Z1C A;  4DU9 A;  1EEI D;  4IFD G;  3BYY B;  4ZAI A;  4K8J A;  2IX0 A;  1CT1 D;  2I46 A;  4HJ7 A;  3OOC A;  4A3L H;  3PUV A;  1JCK B;  5A2Q E;  1I50 B;  2E74 C;  4DUY L;  1MBY A;  2E2H B;  4P75 A;  1B8A A;  1JWU D;  3AB9 A;  4CBV A;  4X66 Q;  1U4R A;  5EAY A;  5E4X A;  1D2B A;  2XN9 C;  1H9R A;  4YWL A;  3CC4 A;  1S5F D;  4ODG A;  1XMQ L;  2PZU A;  1WTR A;  2E2D C;  5JAV A;  2VUM B;  4X64 Q;  1NNX A;  1S5D D;  5FO9 B;  1FJG L;  1K83 H;  4XXE A;  2RBM A;  2KHI A;  3EN2 A;  1KD1 C;  5JEA G;  3M4P A;  4C3I G;  3UE1 A;  3EA6 A;  1E24 A;  2ZXR A;  4POG A;  3K6O A;  1VQ6 A;  1X6O A;  2UXC L;  2B63 B;  1EQV A;  1KDB A;  1TII D;  2XTI A;  1PTO C;  4GN5 A;  2F0O A;  3SVM A;  3MXP A;  1CQF A;  4BY1 B;  1Q12 A;  1L0X B;  3L7Z C;  4JI0 Q;  3P7J A;  3P75 A;  2OWO A;  2KUM A;  1IBK L;  5ISR A;  3E9I A;  1I4X A;  2ASB A;  3EJI A;  4S3S A;  1SR3 A;  4B3S Q;  1SE4 A;  4DAM A;  1GXD C;  4C1N I;  2WAC A;  1D5Z C;  2IY5 B;  4RMF A;  4P74 A;  4LAA A;  5HGT A;  2NB0 A;  2VUM H;  1TR5 A;  4B08 A;  2PMZ B;  1JOO A;  3T1H Q;  3ICE A;  4LFA L;  1Q86 C;  1LTR D;  2IHF A;  4QUF A;  3BJU A;  3GTL B;  4NXM Q;  3J7Y W;  2AUJ D;  2I5L X;  3HEJ A;  4HCE A;  1CI3 M;  4LUZ A;  4JI8 Q;  2CCZ A;  4IN3 A;  4BY1 H;  2J7Z A;  4A3J B;  4JV5 L;  2JJQ A;  2J4X A;  5I2Y A;  2Z6B A;  1YIT A;  4KHP Q;  3A55 A;  3Q8D A;  1U5K A;  2M9V A;  1A62 A;  2K03 A;  1VQJ A;  3EBE A;  1SDF A;  2C9O A;  5JJL A;  3HG9 A;  2Z0S A;  1W2B A;  1PRT C;  1K8M A;  4IFD J;  4A3D G;  2F0J A;  2EYP A;  3SGI A;  1MI2 A;  1VQ4 A;  1STE A;  2VZA A;  1XTC D;  2F0V A;  2WB1 G;  5EKI A;  3BVG A;  2F4I A;  2VXW A;  2ZTC A;  3SK6 A;  3GTL H;  1UNS A;  3RD4 A;  4EQ5 A;  2F0S A;  2HHH L;  4RFB A;  1CSQ A;  4YCV A;  1KRS A;  1Y1W G;  1SYF A;  2JA5 G;  2K1B A;  3OTO Q;  1PH5 A;  3H3V I;  4C3H B;  2L5T A;  4FO2 A;  1DOL A;  1FNU A;  2C35 B;  2ZTE A;  3D0F A;  4XQQ A;  4A3J H;  3H09 A;  4F8M A;  4BXX H;  5GAE C;  1HUN A;  4XT3 B;  3CKI B;  2F0E A;  4IUN A;  1BXT A;  1EFI D;  5GAH C;  4A3K B;  4TQU S;  5JEA J;  2F0H A;  1JB7 A;  1C8C A;  2K5H A;  2AQ3 B;  4OON A;  1JOQ A;  5LMU L;  1HTL D;  3HS0 C;  1TWG H;  2AQ2 B;  1ONL A;  1XXG A;  2PMZ E;  2EQS A;  2WAQ G;  4Q0F A;  5CV4 A;  3VR5 A;  2ATW A;  1HXY D;  2ICI A;  2EYJ A;  1X3E A;  3ZYY X;  4DV3 L;  1HNZ L;  1I6H B;  3S9W A;  1EY7 A;  2N55 A;  1KL9 A;  2B39 A;  4R4T A;  3CU7 A;  2KCT A;  3UI2 A;  1WCM H;  2XRQ D;  3I8Z A;  3DWQ A;  5ELD A;  1HQR D;  2PQA A;  1A6X A;  2D0O A;  4A3F G;  2K5V A;  4DR4 L;  4BY7 B;  3AFQ A;  5C4X G;  5DM7 3;  3NUC A;  2F0T A;  2B8G A;  2LMC B;  2LS0 1;  1STG A;  4DKA C;  3ZJY C;  3F2B A;  1WTX A;  4Z9C B;  5FJ8 H;  1PZJ D;  2EYL A;  4YHH L;  4A3K H;  2B2V C;  2RQX A;  4XDX A;  2MO1 A;  4JI7 Q;  1K8O A;  4HN7 A;  4LF8 Q;  3STB D;  4JBM A;  1UE6 A;  3H6M A;  2R7Z G;  3AQQ A;  1CKN A;  1PFB A;  3EQL C;  1TWC H;  4ZUI A;  4JVZ A;  2F0Q A;  1ILQ A;  5I6W A;  3S1R B;  2JEB I;  5AJ3 Q;  3S15 B;  4POF A;  3HOU B;  1C4Q A;  2IW3 A;  3DLL A;  1RHP A;  4H0L C;  5DNF A;  1TS5 A;  3FPP A;  3CCQ A;  4IUV A;  1K8G A;  1QE6 A;  3T16 A;  3GTO B;  1HQM C;  4QJF A;  3IL8 A;  4ULL A;  1I94 Q;  1JT8 A;  5M5W B;  3ULL A;  1NSN S;  1E0B A;  5D14 A;  1QJO A;  1U9R A;  1J5E Q;  3C3L A;  1YI2 A;  3QJY A;  1SAP A;  4ZCK A;  4C3J B;  4DF7 A;  1EIG A;  3B6Y A;  3V05 A;  3SE0 A;  4BBS B;  3HOY B;  1UEA B;  1CK1 A;  3FMC A;  4DUZ Q;  1WTO A;  2Q2U A;  1J9O A;  3HP3 A;  2VQF Q;  1ET9 A;  2RCN A;  2PQA B;  1LTL A;  4JI3 L;  2OQK A;  3QOL A;  4FXD A;  2CVR A;  2UUC Q;  3NK9 A;  2QCP X;  2DGY A;  3VYS A;  1DJR D;  1HZ9 A;  2MP1 A;  4KKT A;  2HIX A;  1B4O A;  3A8I E;  3ND8 A;  3J7A F;  3S15 H;  3MXU A;  1Y8N B;  3TRZ A;  2RHQ B;  1LAB A;  1EZ6 A;  3HOZ B;  1IW7 C;  1ML0 D;  3SK4 A;  1CKN B;  3MFY A;  2JA6 B;  1WTQ A;  4X66 L;  3GTO H;  3MHB A;  1BDO A;  3GTJ B;  3TBI B;  2NVX H;  1PYB A;  1V1P B;  1K3B C;  1GKH A;  5C3X A;  5M5W H;  2R7Z H;  1EWC A;  1HCZ A;  3H0G B;  1NCV A;  1VF7 A;  1A2T A;  3MXG A;  1D1K A;  1PH1 A;  3A7L A;  2EPB A;  1SYE A;  1EYA A;  4C3J H;  1S5C D;  2Y0S B;  2KQ3 A;  4AYB E;  4X64 L;  2K33 A;  3W2D A;  1G6Z A;  2OXP A;  1N36 Q;  1A0I A;  1F9R A;  3MEF A;  1BCP D;  1ENC A;  1SNM A;  1BCP B;  3VR3 A;  4F7X A;  2JA8 B;  5IYD G;  1AN8 A;  1IHZ A;  2EY1 A;  4LJZ C;  2F0W A;  3P20 A;  2L55 A;  2RHS B;  1IBL L;  4GS3 A;  1RTO A;  3RZD H;  4MZ9 A;  3S2H H;  1AZQ A;  1KC8 C;  4GNX A;  1ASZ A;  3D8G A;  4DV6 L;  5E3F A;  4CGY B;  3BZK A;  3NQI A;  2ZM6 Q;  4JG2 A;  1SND A;  2B2Y C;  4L5T A;  4WJ4 A;  4FF3 A;  4LF7 L;  5KIX A;  3GTG B;  3KJP A;  4X3U A;  2ZXO A;  2K5W A;  2ES2 A;  3M3Y H;  2FXQ A;  1HR0 W;  3S1M H;  2NYZ D;  4JYA Q;  2PI2 A;  4NMZ A;  2KA7 A;  1M1K C;  2A6H C;  1KTK A;  3T1H L;  2VL6 A;  4ZQ3 A;  1SNO A;  1UE7 A;  3NEL A;  4ZKB B;  4ALP A;  5C5M A;  5IYB G;  4WFN 3;  4HIM A;  4PZ7 A;  1N32 Q;  4LFB Q;  1EWI A;  1STY A;  2YU9 B;  3SEB A;  4FDB A;  4R4C A;  4NXM L;  5KEE A;  2EJM A;  3AMU A;  5IGD A;  2NVT H;  3VYT A;  3J7A 5;  4KHV A;  2SOB A;  4JI8 L;  5BN4 A;  1WI5 A;  4KKU A;  2I0Q A;  2QEJ C;  3R2I A;  2K5D A;  3J80 L;  3PGZ A;  5CV8 A;  5JOB A;  3CCL A;  1O7Y A;  5IIF A;  1JQY D;  3NTH A;  4EQO A;  1GHJ A;  4KHP L;  2ALY B;  2CH4 W;  3HOX B;  1YNN C;  2TSS A;  3PF5 A;  5M3M G;  1A3U A;  4LWC A;  1CKM A;  3GTG H;  2Z9H A;  1X65 A;  4FF1 A;  2EIF A;  2K75 A;  5IYC H;  2Y0S E;  5J1Z A;  2HD3 A;  2L9H A;  2MUY A;  2R3Z A;  4GNX B;  5IYD H;  1BR9 A;  3Q6S A;  2B2W A;  5M5Y B;  5LL6 X;  4QIW E;  2G5D A;  2QKI C;  1CUK A;  2F0U A;  4GN4 B;  1UEB A;  4OIJ A;  1EFW A;  4ME3 A;  2XVS A;  3CCU A;  3PO3 B;  2JP1 A;  3RZO H;  3GP7 A;  3S14 H;  4DV1 Q;  5IE8 A;  1HA6 A;  4UY8 C;  3OTO L;  4N9P A;  3UDI A;  3OWF A;  2N8N A;  3WOE A;  5IP7 H;  3F1Z A;  3RLF A;  4RHR A;  1RF2 D;  2E5L Q;  2IL8 A;  5CR3 A;  2NBF A;  4JI1 Q;  2AMC B;  5GAG C;  2F03 A;  2HDM A;  1LTB D;  2DY8 A;  3GTM B;  3HOX H;  1GOZ A;  3GD7 A;  1BUV T;  4PMW A;  1QZG A;  4DK3 C;  5M5X H;  1TVX A;  2CKZ B;  5KYL A;  2F0P A;  5C3E G;  2KVM A;  3U50 C;  4OEL B;  2QA4 A;  2C5C A;  5M5Y H;  1EYG A;  2KHS A;  2FIN B;  3AU7 A;  3S1Q H;  4A93 B;  3D31 A;  1YHB A;  1HHV A;  4IAL A;  1VDZ A;  1IYV A;  2K6A A;  1SYD A;  4FXK C;  1EZ8 A;  3PO3 H;  2YV5 A;  1HUM A;  2I5M X;  4NP5 A;  4LF6 Q;  2OF1 A;  2E2I B;  5EJW A;  3LX0 A;  2SNM A;  3RR5 A;  2JN4 A;  2XWJ B;  1HTP A;  4J15 A;  3BS1 A;  1F2M A;  4RHS A;  1PYS B;  5IOC A;  2B2W C;  2A19 A;  1TWA B;  2RCF A;  4BA2 I;  5LMN Q;  3PSI A;  4RGT A;  4A3I H;  2MQH A;  1K0S A;  1JJ2 A;  1EYD A;  4JI7 L;  1QG7 A;  4LF8 L;  1JMC A;  3OMC A;  1QUQ A;  2WKD A;  2BDN A;  2K04 A;  1SBB B;  3I91 A;  5LHY 1;  1TKW B;  2JSO A;  3E3X A;  3IKJ A; 
#chains in the Genus database with same CATH homology
 2PW7 A;  3D3R A;  1SMY D;  5D3I B;  3OPO A;  3K5M A;  1JOK A;  2MJ8 A;  2MGS A;  4BWG B;  4IUT A;  4PMC A;  5M3F B;  5IGC A;  3MEH A;  2PO4 A;  2AWN A;  4K8I A;  3SHL A;  2BE5 D;  5CMD A;  4K14 A;  4CHT B;  1RKN A;  2RKS A;  4KY5 A;  2F0L A;  3A8J E;  5KND A;  3HOV B;  2NTS A;  1BO0 A;  5DEH A;  3URY A;  3FPU B;  2A6E C;  1EY4 A;  4J1M A;  2F3W A;  4JBW A;  2CHB D;  5K36 H;  3IAY A;  2NN6 H;  2B2T A;  3SK8 A;  1CA6 A;  3A7A B;  4KMU C;  4CKE A;  2M00 A;  1MGS A;  2FHT A;  2TMP A;  3A56 A;  1GUO A;  2EJG C;  2KEC A;  4KN7 C;  4NW2 A;  4K5X A;  1CFM A;  2L0C A;  1JR0 D;  2MPM A;  1T5E A;  4K5W A;  4K5V A;  5ELF A;  2O5I C;  3R93 A;  2WII B;  1QIL A;  2FFK B;  1ZYR C;  5IT9 E;  4RWS C;  4IUR A;  1LTI D;  1XX8 A;  2EYF A;  3M4Y A;  4G7O C;  1T5X D;  3GO5 A;  1CZG A;  1FNW A;  2F0N A;  3L3O C;  1A3T A;  1DOK A;  4DNR B;  1I4R A;  2PYK A;  1L0Y B;  4MHE A;  5CC4 A;  3KK7 A;  3W3A A;  1LAC A;  3KLS X;  3WDN A;  4ZYS A;  4XYO A;  1KAB A;  4R8N A;  2NZ1 D;  3PUX A;  4L63 B;  4C2M B;  4QCL A;  3JAM E;  2L1B A;  4G57 A;  3TN2 A;  1HPC A;  1ROD A;  2EYO A;  4HTH A;  2EYH A;  4C3I B;  4RKB A;  5A2Q L;  1SYG A;  3ONA B;  4IFD H;  2R6G A;  4IUQ A;  2HQE A;  1IL8 A;  3MFG A;  5BN3 A;  3D6W A;  5I6Y A;  1AEX A;  1EEF D;  3FVQ A;  2EYM A;  1Y8O B;  2PZT A;  3KLS A;  4BA1 I;  5COR A;  2X6L A;  3M7N A;  4ZKC B;  1PTO H;  2E76 C;  2A69 D;  1D5X C;  4DFA A;  4OHJ A;  1X32 A;  3A8K E;  2A74 C;  5JEA H;  5CYU A;  1TU2 B;  5FLX E;  1NAP A;  1TWG B;  1ENA A;  3GV3 A;  5EPK A;  3V2T A;  2WP8 J;  2PNR C;  3I73 A;  1SSO A;  3U9O A;  3PUW A;  4QB4 A;  1TWF B;  3D4D A;  4RKL A;  1WCM B;  3GQB A;  2F0G A;  5G3L F;  1W6K A;  2SDF A;  3I70 A;  3BZD B;  1GUN A;  1CHP D;  3R8B A;  4ILW A;  4ZK9 B;  1QOH A;  3BG3 A;  2CW0 D;  3NWS A;  1LLR D;  2X6G A;  2F0K A;  4TKO B;  3KBG A;  1TWC B;  1SE3 A;  2IT1 A;  2OEO A;  4IQZ A;  4TRD A;  4CJ0 B;  2PQE A;  5ELB A;  1ZKO A;  1BQQ T;  4OL7 A;  3MWY W;  1EYC A;  2NUC A;  4I65 A;  1RTN A;  3VR4 A;  1BOS A;  3T4A C;  1BBX C;  2WIN B;  1VCI A;  2VNU D;  1F9S A;  1A15 A;  4EQN A;  4RGO S;  3MA2 B;  2R61 A;  1PLF A;  2Z4I A;  2RDH A;  1SNC A;  3O13 A;  1EIH A;  2SNS A;  3MZ5 A;  1SJH D;  1LT4 D;  4A3F B;  1V1P A;  1CM9 A;  1PYW D;  4O42 A;  3J7A V;  4HCS A;  2EZV A;  4I7Z C;  4C56 C;  3OHX C;  1CHQ D;  2M2L A;  4IUP A;  3MTS A;  4RCO A;  3BDO A;  2NVX B;  4GZY C;  2R7Z B;  1EU4 A;  1LO5 D;  4R9W A;  4L6T B;  2H1E A;  1CA5 A;  1I4G A;  4ID6 A;  2B2U A;  3HGB A;  2PCF B;  2EJF C;  2XRS D;  1OXT A;  2LFN A;  4XT1 B;  1TT2 A;  2PPB C;  1STB A;  2HCC A;  2K7V A;  3TP7 A;  3I4L A;  2MHV A;  3GTP B;  1KAA A;  3RZD B;  1OXU A;  5KNB A;  3LWU A;  3S2H B;  1G91 A;  1G8Z D;  2Q8R E;  2JEA I;  4R8I A;  1JE4 A;  1S4Z A;  3J81 E;  3BDL A;  4PQX A;  4C1N K;  5FOB B;  3M3Y B;  3S1M B;  1B2T A;  1STN A;  4ABN A;  3Q22 A;  3GTQ B;  4ME5 A;  1OXX K;  3TZD A;  2HCI A;  1PTO F;  2NVT B;  4OO1 I;  1HA5 A;  1O7L A;  3NPP A;  1BCP C;  2E2J B;  4OO1 G;  1ICW A;  1G2T A;  4N9T A;  2B2U C;  1Z6H A;  2LY7 A;  1B44 D;  3Q23 A;  5T1I A;  1M8A A;  1FGB D;  1B53 A;  1DZ1 A;  4KV6 A;  4WRD A;  3T53 B;  3MC0 B;  4HAE A;  4BS9 A;  1GJX A;  3A54 A;  1F77 A;  1DON A;  3I90 A;  3M4O B;  1B50 A;  3RZO B;  3SDZ A;  3S14 B;  3S1N B;  4X3S A;  5COY A;  1GUS A;  1RDP D;  2BA0 A;  1IKM A;  4PV1 C;  2A68 D;  1PRT F;  1AW7 A;  5JVG 3;  4E6I A;  5M5X B;  2DY7 A;  1DCZ A;  1BF4 A;  1SYC A;  4KY6 A;  5IGF A;  3OIP A;  4HSV A;  4FF2 A;  2ZT9 C;  3S1Q B;  5C5L A;  1UUP A;  2F3V A;  3NQT A;  1ZEQ X;  3OWE B;  1SYB A;  3T51 B;  2RSO A;  3NXW A;  3K57 A;  2L11 A;  3NBI A;  4HR7 B;  2QDB A;  4M8A A;  2OT2 A;  4OIK A;  5LL6 S;  1YNJ D;  3P1H A;  2A5H A;  2BDO A;  4A3I B;  3KUP A;  1SNP A;  3EVQ A;  4O1N A;  3G6J B;  3K59 A;  5CBA E;  3X3N A;  2I07 B;  2L12 A;  1Y8P B;  3RMH A;  1OO9 B;  4J6H A;  3Q24 A;  4J8Q A;  4M1U B;  3VA5 A;  3FRP B;  5KYI A;  3MVV A;  3DWA A;  4K2K A;  2N88 A;  2J0T D;  4G7Z C;  3FDT A;  4FXG C;  3SXH A;  4CKC A;  1KDA A;  2H4O A;  4IZ8 A;  3QOJ A;  5G3L D;  3K5O A;  5EQ0 A;  3I4N B;  4A3B B;  4EGV A;  4JK1 C;  3TP6 A;  2BOS A;  3ERQ A;  3QO2 A;  1JC7 A;  5EPL A;  4OGQ C;  1AFP A;  1NR2 A;  4BBR B;  2F0I A;  4DXG A;  3DHQ A;  1J8I A;  3DUZ A;  1H9K A;  5AFW A;  5CGK A;  4DAV A;  5J39 A;  1SMY C;  4DAY A;  5C4Z A;  3SR1 A;  5T1G A;  3H91 A;  1VF5 C;  4DXF A;  1FNV A;  1G2S A;  4XIG S;  1KNE A;  1EOT A;  2JXM B;  2NVY B;  1ENF A;  2NTT A;  3E5S A;  3GV6 A;  3OSO A;  1B1Z A;  4KN4 C;  2QF7 A;  1EQT A;  4F88 A;  2BE5 C;  2LKV A;  1QB5 D;  5JVH 3;  1X3P A;  2EY5 A;  5EBD A;  3DEP A;  3TP5 A;  1UAP A;  2XWB B;  1LT3 D;  4LMQ D;  1HFG A;  4ZLT F;  1F2Y A;  4DK0 A;  1PZI D;  2WKC A;  5I9O A;  4KJN A;  4K2L A;  4H44 C;  5IGB A;  1F2L A;  5BN5 A;  3I4M B;  5HUR A;  2KOL A;  2QIL A;  1B3A A;  4DGZ A;  2FJ2 A;  3HOW B;  3KBX A;  4KJO A;  4UDU C;  4B9X A;  1Z47 A;  3FKI B;  1I4Q A;  1MD2 D;  3KF8 A;  3DWP A;  3TME A;  1EL0 A;  2ICE C;  3GTK B;  3R2T A;  3VA7 A;  5F2D A;  1SNQ A;  1EY9 A;  1QNU A;  3NHH A;  1JWM D;  2JE6 I;  1ZYR D;  3PUY A;  5CBE E;  4L8J A;  5FO8 B;  1O7Z A;  5IGE A;  2Q8I B;  3CQZ B;  1LTA D;  1CTM A;  4TSS A;  3L9A X;  5K5P A;  2B2T C;  4DA2 A;  1XYI A;  1FD7 D;  2FMM A;  1TQO A;  1PTO D;  1II3 A;  1PTO B;  3G7L A;  2NWG A;  1IYU A;  1KNA A;  5JPM C;  1WTP A;  1JOR A;  4LK1 C;  5IT9 L;  2JYO A;  2XNA C;  5EKL A;  2A73 B;  2RVL A;  3DMU A;  2EVB A;  3NWT A;  4MN3 A;  2E75 C;  2O5J C;  2EE1 A;  5JPN C;  4DNT B;  1R9T B;  1STA A;  5C6A A;  1D6E C;  2XSC A;  4PMB A;  2EXZ A;  4H7B A;  2HUG A;  1RCV D;  5CV6 A;  1DOM A;  2AWO A;  2O4X A;  1PZK D;  1ET6 A;  3PO2 B;  3K5L A;  3VR2 A;  5CV7 A;  1JWS D;  5C44 B;  2A69 C;  2BCO A;  3S16 B;  3JAM L;  1PRT D;  3Q0A A;  1PRT B;  2DN8 A;  2ENB A;  3IFT A;  1B9M A;  4DAP A;  4HED A;  3ITP A;  3CRK C;  4RA8 A;  3QG1 A;  4MIU A;  4C3H G;  3LWE A;  1WVL A;  1F2Z A;  3C2P A;  1A2U A;  1JIC A;  4WOR A;  3R3O A;  4A3D B;  4XQN A;  1BNZ A;  1SFO B;  4B9W A;  2GA4 B;  5E1F A;  2B2V A;  2WB1 B;  4KD4 A;  1GUW A;  1G29 1;  1VMC A;  1E2W A;  4NKL A;  1TWH B;  1Y1W B;  3I72 A;  2JA5 B;  3HRZ C;  1EWH A;  1S5B D;  4V19 0;  1OXS C;  5FKA C;  5EPJ A;  2CW0 C;  4FF4 A;  1Q3L A;  3NP8 A;  1D1I A;  2ID0 A;  4YIJ A;  5FLX L;  3D4R A;  3H3V C;  1ZXT A;  3NTK A;  2O2L D;  1Z7T A;  5EGT A;  3H94 A;  5E4W C;  1TY2 A;  2KCC A;  3LNN A;  5ELE A;  5C4J B;  2BA1 A;  1Y1V B;  2WAQ B;  3BVZ A;  5KGU A;  5IGG A;  2KEE A;  1F9Q A;  5I2X A;  2VB3 X;  1Q1B A;  3MAQ A;  4KTA A;  1IKL A;  2F1M A;  3M7G A;  1NUC A;  2AQ1 B;  4RGM A;  5D3D A;  3VYU A;  5C3W A;  1LV9 A;  1PDQ A;  1I4H A;  1MSG A;  5C4X B;  1I3Q B;  1LTG D;  1DD2 A;  5I4D A;  4KK7 A;  3K7A B;  4AYB B;  1LTT D;  5CV9 A;  1U4P A;  4UAI A;  4Y7N B;  4ZUJ A;  3OIQ A;  2IWH A;  4C3J G;  2Z4H A;  1A3V A;  3D6C A;  1WTV A;  2IX1 A;  3HKZ B;  3F2U A;  1LTS D;  1SXT A;  4QMG A;  4CKB A;  1SEB D;  4K6D A;  5NUC A;  2R92 B;  3C46 A;  3E6Z X;  1ILP A;  2D2C C;  2IPK D;  3I3C A;  2K05 A;  1F9P A;  1KLG D;  3NSW A;  1AP0 A;  3EFX D;  4KKS A;  5C4H A;  2B2Y A;  3BDC A;  2Z8L A;  3OMG A;  1IW7 D;  4CJ2 C;  1X3Q A;  5A35 A;  2AUK A;  2PW5 A;  4EQP A;  1TS3 A;  2CQA A;  1QWY A;  4G4K A;  4K6L A;  4RAU C;  2K32 A;  1FR3 A;  2YYZ A;  5DAU A;  1WD1 A;  4G7H C;  1RD9 D;  1EY8 A;  4Q5V A;  1ESF A;  1O80 A;  5ELC A;  1QNK A;  4HMI A;  1XWE A;  2L4N A;  4QIW B;  1C48 A;  2XIW A;  5C0X I;  4FNF A;  3J80 E;  3NBH A;  3K58 A;  2PZW A;  4WJW A;  5C0X G;  5DM6 3;  3VR6 A;  1I6V C;  5FO7 B;  2F0M A;  4RCN A;  3NTI A;  1SJE D;  5EKK A;  3ERO A;  4U68 A;  1STH A;  5JJZ A;  3J81 L;  2A6H D;  3DM1 A;  3V96 A;  5J22 A;  1Q8I A;  3N6R A;  1W6J A;  4KI0 A;  4ZRZ A;  3CHB D;  5D65 A;  1JB3 A;  1TS2 A;  2JA7 B;  2NVQ B;  1H9S A;  4XQJ A;  3PV0 A;  5TSS A;  3TZU A;  2A68 C;  3TP8 A;  1SE2 A;  1TY0 A;  5EBC A;  3SK5 A;  3WOF A;  4FYD A;  2DNE A;  1YNN D;  1B9N A;  4F87 A;  4OO1 H;  4X3T A;  4X3K A;  2ZXP A;  2RA4 A;  1O78 A;  2K01 A;  5CV5 A;  3BYT B;  3HZX A;  2V4D A;  2FMC A;  1OXV A;  5C0X H;  1LT5 D;  5M3M B;  2R93 B;  2D9U A;  1WD0 A;  1KLU D;  2F0D A;  1DYQ A;  2DNC A;  1PXU A;  3VYR A;  1HFN A;  4A3G B;  1FYC A;  4U67 3;  4FVM A;  3PIP 3;  3ND9 A;  4HSP A;  1EY0 A;  4P2C B;  3C1F A;  3PUZ A;  1MSH A;  1DXM A;  3DXJ C;  1YNJ C;  2X69 A;  1NR4 A;  1PMR A;  1R4P B;  1QCB D;  3U9S A;  4XTC S;  1GUT A;  1PFN A;  1GUG A;  3NE5 B;  2RDG A;  4QF4 A;  1H9S B;  3X3M A;  4HMJ A;  5KNC A;  3MXN A;  1R4Q B;  1E2V A;  2RDF A;  1H9J A;  5C0X J;  2D5D A;  1AZP A;  1M4V A;  3D4W A;  1KDC A;  1RJT A;  2D62 A;  3OW7 A;  1WTW A;  2IJ0 A;  1ESR A;  5C3E B;  2KED A;  3TDQ A;  3KLR A;  2G9D A;  2K5Q A;  1EU3 A;  2NN6 I;  3RUZ A;  2F0F A;  5K36 G;  1EY5 A;  2NN6 G;  4NDX A;  3PMF A;  4CJ1 B;  2G9H D;  2IX3 A;  3TSS A;  5KRU A;  3FEW X;  3S2D B;  5IOD A;  4DK1 A;  2KCN A;  3K0Y A;  3QB3 A;  3S17 B;  2K28 A;  3E0J A;  1I4P A;  1LT6 D;  4H13 C;  2EY2 A;  3C1E A;  1PFM A;  2EOT A;  1CQV A;  3BVM A;  1Q1E A;  5FK9 C;  4V0B A;  2Q8T A;  3M85 A;  2RSN A;  3T56 B;  2EDG A;  2KJX A;  4KD3 A;  2HDL A;  2EY6 A;  2VB2 X;  1EY6 A;  5I9P A;  4KY7 A;  1V1O A;  4DN4 M;  4KHZ A;  3QWN A;  1U4M A;  1V8Q A;  4A3M B;  1HRJ A;  1V43 A;  2WV6 D;  4XYQ A;  1U4L A;  1S5E D;  4FP5 D;  1TS4 A;  3PIO 3;  1VMP A;  2A6E D;  3QIA A;  1Y69 U;  4QUC A;  4PNY A;  5M9O A;  3N52 A;  3DEO A;  3K5N A;  1GHK A;  2B8F A;  1E2Z A;  2SEB D;  3IFD A;  1D5M C;  3T13 A;  1DM0 B;  4IUU A;  4A3E B;  4RH6 A;  1CZW A;  1Q90 A;  3CRL C;  1K83 B;  4RGN A;  1BCP F;  1H9M A;  4EVO A;  4IFD I;  2Z1C A;  4DU9 A;  1EEI D;  4IFD G;  3BYY B;  4ZAI A;  4K8J A;  2IX0 A;  1CT1 D;  2I46 A;  3OOC A;  3PUV A;  1JCK B;  5A2Q E;  1I50 B;  2E74 C;  1MBY A;  2E2H B;  4CBV A;  1JWU D;  3AB9 A;  1U4R A;  5E4X A;  1D2B A;  2XN9 C;  1H9R A;  1S5F D;  4ODG A;  2PZU A;  1WTR A;  2E2D C;  5JAV A;  2VUM B;  1S5D D;  5FO9 B;  4XXE A;  2RBM A;  5JEA G;  4C3I G;  3EA6 A;  2ZXR A;  3K6O A;  2B63 B;  1EQV A;  1KDB A;  1TII D;  1PTO C;  2F0O A;  3SVM A;  3MXP A;  1CQF A;  4BY1 B;  1Q12 A;  1L0X B;  3L7Z C;  3P7J A;  3P75 A;  2KUM A;  5ISR A;  1I4X A;  3EJI A;  4S3S A;  1SE4 A;  1GXD C;  4C1N I;  2WAC A;  1D5Z C;  4LAA A;  5HGT A;  2NB0 A;  1TR5 A;  4B08 A;  2PMZ B;  1JOO A;  1LTR D;  4QUF A;  3GTL B;  3J7Y W;  2AUJ D;  3HEJ A;  4HCE A;  1CI3 M;  4IN3 A;  2J7Z A;  4A3J B;  2J4X A;  5I2Y A;  3A55 A;  2M9V A;  2K03 A;  1SDF A;  2C9O A;  3HG9 A;  1PRT C;  1K8M A;  4IFD J;  2F0J A;  2EYP A;  1MI2 A;  1STE A;  1XTC D;  2F0V A;  5EKI A;  3BVG A;  2F4I A;  2VXW A;  3SK6 A;  1UNS A;  3RD4 A;  2F0S A;  4RFB A;  1SYF A;  2K1B A;  4C3H B;  2L5T A;  4FO2 A;  1DOL A;  1FNU A;  4XQQ A;  3H09 A;  4F8M A;  1HUN A;  4XT3 B;  3CKI B;  2F0E A;  4IUN A;  1BXT A;  1EFI D;  4A3K B;  4TQU S;  5JEA J;  2F0H A;  1C8C A;  2AQ3 B;  1JOQ A;  1HTL D;  3HS0 C;  2AQ2 B;  1ONL A;  1XXG A;  4Q0F A;  5CV4 A;  3VR5 A;  1HXY D;  2ICI A;  2EYJ A;  3ZYY X;  1I6H B;  3S9W A;  1EY7 A;  2N55 A;  2B39 A;  3CU7 A;  3UI2 A;  2XRQ D;  3I8Z A;  3DWQ A;  5ELD A;  1HQR D;  1A6X A;  4BY7 B;  5DM7 3;  3NUC A;  2F0T A;  2B8G A;  2LMC B;  2LS0 1;  1STG A;  1WTX A;  4Z9C B;  1PZJ D;  2EYL A;  2B2V C;  2RQX A;  4XDX A;  1K8O A;  4HN7 A;  3H6M A;  1PFB A;  3EQL C;  4ZUI A;  2F0Q A;  1ILQ A;  5I6W A;  3S1R B;  2JEB I;  3S15 B;  3HOU B;  1C4Q A;  2IW3 A;  1RHP A;  4H0L C;  5DNF A;  1TS5 A;  3FPP A;  4IUV A;  1QE6 A;  3T16 A;  3GTO B;  1HQM C;  3IL8 A;  4ULL A;  5M5W B;  1NSN S;  1E0B A;  5D14 A;  1QJO A;  1U9R A;  3C3L A;  3QJY A;  1SAP A;  4C3J B;  4DF7 A;  1EIG A;  4BBS B;  3V05 A;  3SE0 A;  3HOY B;  1UEA B;  1CK1 A;  3FMC A;  1WTO A;  1J9O A;  3HP3 A;  1ET9 A;  3QOL A;  4FXD A;  2CVR A;  3NK9 A;  2QCP X;  3VYS A;  1DJR D;  2MP1 A;  4KKT A;  1B4O A;  3A8I E;  3ND8 A;  3J7A F;  3MXU A;  1Y8N B;  1LAB A;  1EZ6 A;  3HOZ B;  1IW7 C;  1ML0 D;  3SK4 A;  3MFY A;  2JA6 B;  1WTQ A;  3MHB A;  1BDO A;  3GTJ B;  3TBI B;  1V1P B;  5C3X A;  1EWC A;  1HCZ A;  3H0G B;  1NCV A;  1VF7 A;  1A2T A;  3MXG A;  1D1K A;  3A7L A;  2EPB A;  1SYE A;  1EYA A;  1S5C D;  2Y0S B;  2KQ3 A;  2K33 A;  3W2D A;  1G6Z A;  2OXP A;  1F9R A;  1BCP D;  1ENC A;  1SNM A;  1BCP B;  3VR3 A;  4F7X A;  2JA8 B;  1AN8 A;  1IHZ A;  2EY1 A;  4LJZ C;  2F0W A;  3P20 A;  2L55 A;  1RTO A;  1AZQ A;  3D8G A;  5E3F A;  4CGY B;  3NQI A;  1SND A;  2B2Y C;  4FF3 A;  5KIX A;  3GTG B;  4X3U A;  2ZXO A;  2K5W A;  2NYZ D;  4NMZ A;  2KA7 A;  2A6H C;  1KTK A;  4ZQ3 A;  1SNO A;  4ZKB B;  5C5M A;  4WFN 3;  1STY A;  2YU9 B;  3SEB A;  5KEE A;  2EJM A;  3AMU A;  5IGD A;  3VYT A;  4KHV A;  2SOB A;  5BN4 A;  4KKU A;  2QEJ C;  3R2I A;  2K5D A;  3J80 L;  5CV8 A;  5JOB A;  1O7Y A;  5IIF A;  1JQY D;  3NTH A;  4EQO A;  1GHJ A;  3HOX B;  1YNN C;  2TSS A;  1A3U A;  4FF1 A;  5J1Z A;  2L9H A;  2MUY A;  2R3Z A;  1BR9 A;  3Q6S A;  2B2W A;  5M5Y B;  5LL6 X;  2QKI C;  2F0U A;  4OIJ A;  2XVS A;  3PO3 B;  2JP1 A;  3GP7 A;  1HA6 A;  4N9P A;  3OWF A;  3WOE A;  3RLF A;  4RHR A;  1RF2 D;  2IL8 A;  5CR3 A;  2NBF A;  2F03 A;  2HDM A;  1LTB D;  2DY8 A;  3GTM B;  1GOZ A;  3GD7 A;  1BUV T;  4PMW A;  1TVX A;  5KYL A;  2F0P A;  2KVM A;  2C5C A;  2KHS A;  2FIN B;  3AU7 A;  4A93 B;  3D31 A;  1HHV A;  4IAL A;  1VDZ A;  1IYV A;  2K6A A;  1SYD A;  4FXK C;  1EZ8 A;  1HUM A;  4NP5 A;  2OF1 A;  2E2I B;  5EJW A;  3LX0 A;  2SNM A;  2XWJ B;  1HTP A;  3BS1 A;  1F2M A;  4RHS A;  5IOC A;  2B2W C;  1TWA B;  4BA2 I;  4RGT A;  1EYD A;  1QG7 A;  3OMC A;  2WKD A;  2BDN A;  2K04 A;  1SBB B;  3I91 A;  5LHY 1;  1TKW B;  2JSO A;  3IKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...