2Q8VA

Nbla protein from t. vulcanus crystallized with urea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
LNVDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NblA protein
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Thermosynechococcus vulcanus
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2q8vA00
2Q8VA 3CS5A 2QDOA 1OJHA
chains in the Genus database with same CATH superfamily
2FYUH 3QO5A 4ICGA 1DK1A 4JI4O 4JI3O 1PPJH 1XHXA 1L8DA 3AG2C 3APOA 1Z2GA 3JARA 2OCCC 4O4IA 1YJNV 5BMVB 1MA1A 3H1KH 3D36A 1W59A 1TUBB 2EZOA 1NR1A 2PYLA 4GKJO 1AJPA 5B1BC 2AGAA 3DC5A 5HFLA 3N2GA 5EIBD 1B3QA 3SPCA 1GH6A 1N33O 1S77D 4DK0A 4TWKA 3RYFB 1M56B 2FKXA 1QLEB 3GVMA 3W7XA 4NYKA 3G71V 5LHIA 2EIKC 4H0LB 1S5HC 1OCCC 3ZRVA 2QTOA 3ASNC 3JAKA 1Y6XA 3JYCA 4R8CA 4JI1B 2HP8A 1HNWB 3WG7C 1RM1C 4XDLA 1H2KA 3CYOA 4JV5O 2HEPA 1N36O 5H2FZ 1Y67A 4FM2A 2G38A 2HKOA 2H94A 3AG7A 3C3SA 1YJ9V 1J95A 4MT8A 2EBOA 1IBKO 4X1KA 4R7CA 3E22B 5LP6C 1ZL8B 4L8JA 3K0GA 4BR6A 2W6JG 3BAAA 2Q4PA 3LDEA 5LHGA 2LW7A 3CPWU 5KHIA 5L3DA 4DXWA 1MG1A 1KBHA 2ZIOA 1FS0G 1JVMA 5LMNO 4O4JB 1Y76A 4J41A 4B7EA 1Q82W 1EN5A 4JI3B 3ETEA 1M57C 1Q6IA 2DW4A 3N27A 1WLEA 4JI5O 2DQ0A 4Z2WA 4D7TA 4U3JB 4X66O 1J5EO 4GKJB 3SPJA 4X64O 1SC5B 5IY5B 4WF9V 4MVOA 1GM8A 1L0LH 3SPGA 3RYHB 4MW3A 4GKKO 4BW5A 3JCUZ 4RUEA 2UXDO 1VQNV 2WLHA 4P2ZA 1V54C 3SJQC 1UFIA 2X6AA 5BXZA 3N2KB 4OXSA 3FYIB 3OE7G 2QEXV 2R9AA 4ZOLB 3L72H 2BSKA 2UXXA 3ABMB 2B9ZA 2LP7A 4IIJB 1HNZO 4JV5B 1N36B 2PI5A 3WB1A 2RQ6A 2MK3A 1N34O 2X6BA 3JD2A 4JAAA 3A8TA 5LGTA 4DV7O 1IBKB 1OCZC 2IU0A 1R3KC 2R72A 4J11A 2C2AA 4DR1O 3K08A 5LMUO 1AP5A 2XAHA 4JI2O 2V4DA 4UVBA 1SZXA 2ZE8A 2V7QG 4TV9B 4X20A 2UXCO 5IDJA 5LMNB 3OMNB 3OM3B 1DF5A 4GX0A 1KMIZ 1TVKB 4HAMA 1GO3F 2VRZA 4UVAA 3K04A 4I0XA 1QCEA 2QWPB 4JI0O 2VS0A 3SPHA 3K03A 4X66B 1J5EB 5H5NA 4X64B 3QO7A 2ARHA 5LXTB 3P3NA 5GTIZ 3THOA 1VEWA 2PF4E 1KC8W 5KMGB 3OGIB 4GKKB 1NTZH 2QA4V 2UXBB 4IHJB 3KZIZ 1L0NH 2UXDB 2CAZC 3TCUA 1GN6A 2CTPA 1XNRO 1AI4A 3JARB 4MTOA 4MW8A 4O4IB 1SS3A 2GDSA 2P5OA 1I08A 2Z3YA 4FZ1A 2YS8A 1HNZB 2UUBO 5LBQA 3ABKB 4QE7A 3CCLV 3ASOC 1IDSA 4ASUG 5JJJB 1QNMA 1ZTEA 1BHBA 3N2GB 4DV7B 4CH5A 3H1JH 1AR1B 5D5QA 4DR1B 5LMUB 4AILC 2WLJA 1SQFA 4FM0A 3KG2A 4JI2B 1F4NA 2CH7A 2JVDA 3JAKB 1WJZA 2QR4A 1O9GA 1QVGU 4MVUA 2UXCB 4AHCA 2GHYA 1R6NA 2F93B 1ZSPA 2FTKA 1FXVA 1HWYA 2F4VO 4FFBA 3X2QC 2EINC 1VQKV 3OUFA 1FXKC 1WNSA 5C8YA 2WPDG 3SYCA 5L3EA 1VQ7V 1D5AA 4JI0B 2YC0A 2ZDIA 3E35A 4DV3O 2V1DA 1QR8A 4X1KB 4PI0A 3CWBH 2PY5A 1D2DA 1SERA 3OMIB 4JF3A 3TETA 2YIAA 4JI7O 1YITV 3LDCA 2WSSG 4J7ZA 3FAVA 4GZRB 2ZCEA 2A3QA 1GTOA 2ITCC 5J2TA 3CMAV 3K06A 2ADPA 3ABTA 3B8MA 4LF7B 1XNRB 4J42A 4YJ3A 3E8GA 4R50A 2E74B 2XAQA 2UUBB 2DWDC 4EEQA 4ABMA 4LH7A 3E86A 1YJWV 3I5DA 1CEZA 4IT5A 4QJFB 4MSWC 2FL4A 2DWEC 3LSQA 3ZJZA 3ZRSA 3ZCCA 5KHJA 3CS5A 2A7WA 1V55B 1RFYA 3H1IH 1AR4A 3CCQV 1Q8IA 2YDEA 1TUBA 3CRCA 5B3SC 3ZHRA 2YXYA 2P06A 4H44B 3JD0A 1GN3A 3T1HO 5CBGA 3MHSC 2Z0AA 3RGBA 3ZMSA 3UQ8A 1GKFA 1KECA 4CBCA 2BSKB 1YVWA 1JPXA 1PM9A 2ZXWB 4YXWG 1IZ3A 3G80A 3ABUA 2R9IA 4PDLA 3ZRWA 3EFFK 5IWAO 1I5XA 4DUZO 3LSUA 4UCRA 4F6EA 3BHPA 3AG1C 1K8AW 2QJ1A 3T2MA 4X20B 3Q4HA 4JI7B 4JYAO 4GLXA 1QLNA 5FPOA 1KUQA 1NTMH 2Y4UA 3MAQA 3K0DA 4UCUA 4NKGB 3L73H 1ZL8A 3UCSC 2P90A 1VQ6V 4I0XB 1JA8A 5CMUA 5IE9A 1N0JA 3ZIAG 3STLC 4P9PA 1EN4A 1JR9A 2DYSC 4MVZA 3J81N 2LGQA 1PL4A 3FB5C 3H1HH 5L3GA 2ZIMA 1YI2V 3MHHC 3CC7V 1JFFA 2QWNB 2IW5A 1K5QA 4FLVA 4CC6A 4JI6B 3T1HB 2KB1A 2Q7EA 2JS3A 5IT9N 3G6EV 4RQEA 2X6CA 3OR6C 3RYHA 1FKAO 5EYPA 2D3OW 1EFRG 2W0FC 3JASA 4LF5B 2EIMC 4EKWA 1SZTA 3ETDA 4TQFA 4QIWF 2QTSA 4UXNA 2HJDA 2GSMB 2NNUA 3J80N 4ZOLA 4DUZB 2PUSA 4KXRA 5IYCO 1WP7A 4FLZA 1VF6A 2CH7B 5KA6A 3E83A 4DR2O 4N23A 3SDLA 4X65O 2QM4A 2QKCA 3FD9A 4JYAB 4DO2A 3KCYA 2OYQA 4FFBB 3M99B 2KKWA 4BAYA 5CA0A 2AW9A 1H2NA 4JGSA 1V9PA 3OR7C 1W0KG 4KL1A 3S3WA 3WB0A 3CEIA 2KQXA 1W0JG 1FJGO 1H2GA 1R3LC 4FFKA 3HKBA 4FIPC 1SQQH 2XASA 5LA6B 4GX2A 1R1BA 3K5LA 1NJIW 4J10A 1K92A 4LFAO 4FLTA 3RYIA 4I50A 4EB6A 4Z1MG 4O4LA 3FAVB 5J2TB 1R3JC 3B4SA 3ZN0A 2EILC 1VQ9V 5JQGA 4YJ3B 3BFRA 4I5SA 1K73W 5H6RA 1OCOC 2VWKA 5D5PA 4MTFA 3JCZA 3ZHUA 1H2MA 1K5SA 3ZHTA 4HBNA 1BE3H 2YXLA 2QWRB 3ZEDA 3FB8C 3E89A 2N05A 4JZGA 1YZBA 3BPZA 3G67A 4IGGA 4CH4A 2HJFC 2DOSA 2GBOA 4NB5A 1BSMA 4DR2B 2QM7A 2IJKA 5B1AC 4X65B 4LH6A 1HDJA 4JI8O 1WPXA 3QF7A 3JD4A 4HYOA 3AG3C 4JTAB 5L3CA 4UB6Z 5EIBC 2ZINA 1FJGB 3ZRWB 1VQ8V 1NBMG 3FKSG 4DV0O 4GYCB 1OCRC 3JAWA 3L75H 3GB7C 2XOKG 3U11A 2DMXA 2NR5A 3EHBB 3Q4HB 3P30A 4LFAB 3VQXA 5KLVH 1XUQA 1GM9A 1XBLA 2DYRC 2LJ2A 4NTXA 4H13B 1K4CC 1WB7A 3CB2A 2QWOB 5B1NA 3K5OA 1NVPD 1P4RA 1K9MW 1SQXH 4JASA 1UPGA 1I7FA 4JYYA 4R6ZA 1F23A 3LSSA 3CCRV 3SJBC 2LFRA 5EC1C 5K1PA 4I9QA 1BHAA 1VQLV 3AG4C 3OFNG 5IYDO 4I55B 1WPBA 2XNDG 1ORQC 4JTDB 1DLBA 2GV9A 1JFFB 4HZ3A 4LWSB 4YHHO 3JD1A 4B3TO 1RP3B 4DR6O 5CA3A 5JCOC 2Y69C 5H6QA 4OX9O 1S5LZ 1SF9A 4JI8B 2Q6AA 2ZNIA 4Q6GA 1PV0A 1DF4A 1S76D 1LUVA 5EYPB 2UUCO 3JASB 2UXBO 2CK3G 3A0BZ 1KP3A 1W2BU 5A9GA 3ETQA 4DV6O 1B06A 1S0VA 4LF6B 3IC7A 1JMKC 4B3SO 1GN2A 4PA6A 4TV8A 2JS5A 1VQMV 2ZM6O 5GW7A 4DV0B 2EIJC 4BW9A 2QE7G 2QDOA 2RJZA 1JJ2U 4DR5O 4P30A 4TQDA 4RAIA 4H37A 4LC1A 4NXNO 1A32A 4TSFG 4WFBV 3FX7A 3B09A 1FD9A 2F1MA 1MMMA 4AI8A 2RNBA 4NTYA 1VMGA 2AXTZ 3JSNA 2P4KA 3SYAA 5FL7G 5KUKA 1MSWD 5CA0B 5H9CA 1XILA 1K97A 4GX1A 1FFTB 2ITDC 1R73A 1YTFB 2XTAA 2EJ7A 3WB2A 3HKBB 1Q6HA 2Q0AA 2WLKA 4QNHB 4X1IA 2XAFA 3D8CA 1AB3A 4JAUA 4K35A 1F4MA 4ZIBA 4YHHB 3RYIB 4I50B 4EB6B 4B3TB 4O4LB 4IYHA 4MTXA 4DR6B 3HB3B 4UCSA 3TJTA 3CRRA 3OW2U 2Q9LA 3ZRXA 1Q3EA 5JQGB 4OX9B 1NZ6A 1THZA 5CBFA 1EM1A 3CCUV 2UUCB 1X59A 2E76B 2BE3A 3W7UA 1M56C 1QLEC 4DV6B 1KKCA 1G6UA 3JALA 4H33A 1IVSA 4B3SB 4LF7O 1TA8A 1JCHA 1KD1W 5CB4A 5A2QN 2ZM6B 1EBOA 1VIBA 1MZEA 2CUGA 5LOVB 2IJJA 4G2KA 3BY6A 1E1RG 4KFMA 1G4YB 4DR5B 4GT1A 3OMAB 5IJ0A 3M8AA 4NXNB 1N4CA 1NQTA 3K9AA 4PELA 4X1YA 4DV4O 1VF5B 1BCCH 3K3WA 5LP6A 5BY1A 3EVKA 2BOBC 1IXBA 1NH2D 2F66C 5J2UA 2YEVA 1YEWA 5KAFZ 3APQA 1XMOO 2L6LA 1JX9A 1G8MA 3F7VC 1O9HA 2E75B 3K9SA 2UUAB 4BIZA 1MZFA 3WU2Z 1F51A 1N32O 2UU9B 4LF8O 1XEQA 3T4DA 2W0XA 4XBFA 4AQYO 2ZNJA 4X9QA 3JAWB 4PDMA 4FLUA 2X7RB 4WFEA 4J7KA 2N04A 1QU7A 2IH1C 1IBLO 1LNQA 3BA9A 2YI8A 4FLXA 3G6BA 5IY5C 1ZX3A 3DSQA 3FYEB 5LA6A 2CGOA 2OIGA 4CC5A 1WN7A 2ETNA 2PGGA 2DQ3A 3ABLB 4WFGA 1PL0A 4KP4A 4DV1O 1IURA 3RYCA 4XDKA 4QGPA 3T1YB 3CRMA 2PYJA 4QE9A 4ZI7B 4HNAA 2PTMA 1Q81W 2HVKC 3ABMC 3LNNA 3OAAG 3F5TA 1YDXA 4DV4B 3SYPA 3IFXA 2GTAA 4ZBMA 4UVCA 1YTFD 1Q7YW 4WFAV 5DEDA 1BMFG 1XMOB 2X0LA 2EJRA 1YXBA 1Y74B 2M7WA 4NVPA 2CTWA 1VF7A 1BQZA 4WBNA 3O65A 3CHXA 4JI6O 1N32B 1Y4MA 3UM7A 4TV8B 2IU3A 4LF8B 3U10A 5GONA 3OTOO 4AQYB 4MTGA 4E2LA 1N0NA 1YIJV 4BIOA 3T1CA 3SR2C 2ADQB 2F43G 1TAEA 2JRIA 4LF5O 1K7DA 1PNKA 2P7TC 3LUTB 3I56V 5KX5A 2YI9A 5JJNB 2B1IA 1EZVH 4W4KA 1IBLB 4WFFA 2IJHA 5KHKA 1BT8A 4GCZA 5JVDA 4QPJA 4B3RO 3VQVA 2RDCA 3GWKC 1IBMO 3CXHF 3DXRA 3FB6C 4FJCC 4LF4O 4LFBB 3AG2B 2Q69A 2OCCB 2Q0OC 2WLNA 1NTKH 2WA3A 4DV1B 1I5YA 4CH6A 1FXHA 2XUMA 1YF2A 1XOUA 3CJHA 4PA9A 3QG5A 2NN4A 4X1IB 5LHHA 2Q68A 3FFQA 3VQYA 4PA3A 3UT5A 4F4LA 1ZLZA 5ITZA 5B1BB 3D36C 4PD4F 5IJ9A 2YICA 3ABKC 1P84F 3JATA 1URFA 3K57A 2L35A 2JDIG 1RSOA 3K5NA 2ZE6A 4U7NA 2YIBD 4PDVA 1FPOA 3OEEG 1OZ0A 4I55A 2EIKB 2RCVA 1OCCB 3UKMA 3ASNB 4WCEV 4LWSA 1GM7A 1AILA 4CS4A 4B08A 3JALB 3P32A 3HR0A 3WG7B 1MSDA 4GUNA 1RM1B 4TOIA 2W6IG 3ZHSA 5CB4B 1PP9H 1FXKA 5CN0A 5KHGA 1RPOA 2LQTA 3OTOB 1OV9A 5KUMA 1Q43A 1B6QA 4D7SA 4I4TA 3RWRD 5IJ0B 4X1YB 1COWG 1F7YA 3L9DA 5LP6B 1NVPB 5DECA 1XI1A 5J2UB 2YEVB 5JWPA 4U3FH 3CCEV 1M4UA 3E8HA 5JH7A 2QWQB 4B3RB 2YIDA 1PKXA 1K4DC 2Y48A 5LYJA 1IBMB 3W7SA 5K1XA 5LGNA 5J9PC 3RN4A 3K58A 1M57B 4LF4B 3ZHVA 4B3MO 2R70A 3H01A 4DV5O 4FLYA 4UCTA 3AK2A 3B8NA 4DW1A 4F6RB 1QQCA 2QGNA 2K1EA 4GX5A 2RN9A 5IYZB 1IX9A 4UUJC 2P6JA 3BEHA 4C7UA 2XT9A 1AJQA 1K34A 3RBZA 1PNLA 2Y4TA 3IC9A 4NXMO 5E1AC 1BZKA 3HKDA 4FMTA 4IL6Z 1H2SB 2JIZG 1KYOF 3B2EE 2PI4A 1V55C 1TGOA 4MVSA 4G27B 1V54B 3BA8A 5EK0A 3D3QA 2BTOA 1WP8A 3LDDA 5L3FA 3RYCB 1XMQO 4TT3G 1P7BA 1QBZA 1BQ0A 4HNAB 1S3JA 2HVJC 5CA1A 4LNUA 1JOYA 3E8BA 1US6A 2EULA 2KG7A 1OCZB 1SQVH 4FLWA 2CDYA 2ZXWC 3DC6A 4FZ0A 2BOCC 1FFXA 3S3XA 5LOVA 2ZD9A 3CC4V 2ZE5A 3PN1A 4OGQB 5AG2A 3L70H 4WBNB 4ZHQA 4NR1A 5EZYA 3F5WC 3BVOA 3R66A 5GONB 3AK1A 1P7GA 4B3MB 3DGEA 2IJIA 1EN6A 1Z5WA 2XAGA 4DV5B 3CRQA 2JEUA 3CSXA 4MVRA 4RQFA 3CD6V 4JAVA 4LF6O 4K8XA 1RPRA 2YIBA 5KX5B 4O2AA 1SQBH 4KUMA 2ZQMA 4RUFA 5BR8O 4LR3A 1M90W 4TUYA 2XAJA 4UFZA 4NXMB 1B04A 5KAIZ 4X88A 5JVDB 1XL4A 3L74H 1YCIA 1VQ5V 3HKCA 2EZPA 3DXRB 3PJSK 4DK1A 3L71H 4DR7O 3QNEA 3M7MX 1XMQB 4K3AA 4ZKIA 4G28B 3CJHB 2D2CB 1MABG 2ZT9B 3F7YC 4MVQA 3ASOB 3UT5B 2Q5ZA 2BTQA 4JZ2A 2CE4A 5ITZB 3MD0A 3A0HZ 1NH2B 5IJ9B 3QVNA 4RO2A 2Q67A 2ODMA 1FYJA 3JATB 1KQSU 1CXZB 1NI8A 2XHBA 1RSOB 4ZI7A 3SJAC 1LR1A 3IAYA 4FVMA 1AJNA 1AROP 2BCCH 4PJ0Z 1GAXA 3D3IA 2AZ2A 3OTFA 4PDRA 3VOUA 1DTOA 2Y0IA 3X2QB 2EINB 4JI4B 3UO2A 1FXKB 4CS2A 1LUWA 4FPPA 2FMLA 2WLMA 1WA8A 4I4TB 4YJ2B 2A06H 1Y74A 2QSAA 1U96A 4LCUC 2ZDIC 2HHHO 2AZ0A 3HKEA 5BR8B 1N33B 1Q90D 1YHQV 2NLJC 1VQ4V 5JH7B 2OTJV 2JJ2G 5LYJB 5LL6Y 4BWAA 3AK3A 4FK5C 1BGYH 4DR7B 3DTUB 2VQEO 1ZUQA 4J9ZB 3J7AU 3BCCH 4IYIA 5EBLC 1Z5VA 1ZAUA 2OT5A 3CP1A 3A2FA 5L3BA 3T4ZA 4PI2A 4UCOA 1DGSA 2Q73A 1NU1H 1PD3A 5FNVA 2UUAO 4DUYO 1JJOA 3CCVV 2WAMA 1PNMA 1KU9A 3UO3A 1P49A 4Z1VA 2UU9O 4PHZA 2LFSA 3HKDB 5EBMC 3JD3A 1IXMA 5B3SB 2YSUB 4LP8A 2A0LA 2AHYA 1Q6UA 4J9YB 1UJWB 1D5NA 1HP8A 4U7OA 1Q86W 2Q8VA 3K79A 4CS3A 5CA1B 4LNUB 4BIUA 4DV2O 4JI5B 1MNGA 2KG7B 1VQOV 2N74A 2OIEA 2YUAA 1Y66A 1H8EG 2HHHB 3T1YO 4DR4O 2K9PA 1SA0A 1KP2A 1VP7A 1R6TA 1FFXB 3AG1B 3C3TA 4O4HA 2CGNA 1HW7A 1SQPH 2QKSA 2LGWA 2Y0PA 2HLDG 3I55V 4ZHQB 4K0KO 5IYBO 1BL8A 2WLLA 5EZYB 2VQEB 1H2LA 1VARA 3NR7A 4YY3O 4B7KA 1CP9A 3ZMTA 1GK9A 2GUZA 4WFHA 1T5EA 3BABA 2JK5C 3H1LH 3C90A 3AEIA 3CCSV 3ZMVA 3W7WA 2Z5UA 2DYSB 2E3CA 4O2AB 1U97A 2E5LO 4DUYB 1XQ8A 1N34B 4QPKA 5BZBA 4TUYB 1S5JA 1AVMA 3CXCU 1MOFA 1XREA 3STZC 5FLXN 3G4SV 5E79Z 3P3PA 3EXAA 5DM6V 1X4TA 4PV1B 1SESA 2WA4A 4L87A 3HKCB 4MVMA 4JPRA 5B1OA 4F6RA 5DN6G 5JCOA 2CTRA 5IYZA 2P4VA 3TXQA 1HNXO 4LFCO 2M6YA 3K59A 3JSLA 5KHHA 3O9OA 2BTQB 2EIMB 4O2BA 2QKAA 3RFRA 1WB8A 5JJEB 3ZX6A 5EC2C 4DV2B 3IJ4A 2ATKC 4PA7A 4LFBO 3CC2V 1QVFU 4DR4B 2RMKB 3E8FA 3CRAA 3VBBA 4OPHA 4CZZA 2P67A 3ZHQA 4JTCB 2JGDA 3QO8A 3OEHG 2OTLV 1M9NA 1VF6C 2B5UA 4MS2A 2F95B 1XNQO 1Y76B 4K0KB 4K8ZA 4JYCA 4YIPA 2UXNA 3OT7A 1AR5A 4YY3B 1XHZA 1KKDA 3QTCA 2WLIA 2B1GA 4PA4A 1NS1A 4YIOA 2CTQA 1WA8B 1FAFA 3SPIA 1SETA 3GWOA 2DJVA 1AI6A 3HPLC 1NT2B 4DRXA 2E5LB 3HKEB 2ZE7A 2ILMA 3SJCC 1E1QG 4W4LA 3CX5F 3FB7C 2IBZH 2FB5A 4RWUA 2F23A 5BMVA 2A9HA 1OHHG 1R6KA 1SRYA 2P22C 4DYLA 1AI5A 2EX3A 3SYOA 3WFVA 3LNMB 2EILB 1HNXB 4LFCB 2IH3C 2AHZA 3SYQA 1ROPA 3RT3C 2JEXA 2F4VB 1EZJA 1OCOB 1XL6A 4DW0A 3RYFA 3TGUH 2DE0X 5FNVB 1CPYA 1HR0O 1AP6A 5CBHA 4DV3B 4A5UB 3H9VA 3RVYA 4X62O 4LF9O 2QM8A 2GTSA 1XDCA 1SKVA 3ETGA 4P9OA 1YSCA 2R9RB 4UCVA 3OGCC 1VQPV 3JAMN 5B1AB 2HG5C 1AI7A 3ZBHA 4XDJA 5GTHZ 1XNQB 4LBEC 2YXHA 3E22A 2JGUA 3OUSA 4EFEA 2VWJA 3AG3B 1N8RW 3SGIA 2JJ1G 4OPAA 5HFMA 2ZR3A 4UV8A 3CCMV 3KCXA 4Q20A 2MW2B 2OCHA 2HFEC 4O4JA 2HR3A 1M1KW 1SA0B 1KB9F 2WWWA 2VQFO 2H8PC 1OCRB 3ML0A 4J7JA 5C93A 1QHTA 2IM9A 4O4HB 2ZKOA 2H3OA 3MDSA 3TXSA 2Q7GA 4YJ2A 2PZSA 4U3JA 2KSDA 2WLLB 2DYRB 3BRCA 3KKYA 4X8AA 1I0HA 3ZN1A 4N21A 2GUZB 4KHPO 1E79G 3CE2A 1NR7A 3ZS8C 1I94O 1OJHA 2A79B 5F2VO 1GN4A 4DR3O 1HR0B 3NXSA 3ABLC 3CMEV 3AG4B 4LF9B 4X62B 1H8HG 3N2KA 1NKDA 2OWOA 5IWAB 4X89A 3ZMZA 1K3EA 4J80A 1M93A 4IIJA 3K5MA 1SQGA 2Y69B 5B66Z 3RVZA 5EBWC 4CH3A 3ZMUA 2LW1A 5KA5A 4UB8Z 2ZR2A 4NTWA 1H38A 3RW0A 3U0ZA 1M5IA 2DN9A 1R3IC 5C8YB 3B40A 4O2BB 1K33A 2LO1A 4I9WA 3CCJV 3E2EA 3OD4A 1ZWIC 1S72V 4TV9A 1JQ0A 4JI1O 3IGAC 1HNWO 2EIJB 2VQFB 1TVKA 3TK1A 1G1XB 4E4EA 2O57A 3R65A 1TUEB 1BS3A 3B77A 1WAZA 2JGDB 4I7ZB 5FPRA 5LGUA 1GMGA 4EFBA 3A0RA 1L1FA 3ICXA 5LXTA 4UV9A 2WLIB 5TISZ 3VQWA 4KHPB 1QR9A 4JYBA 3W7TA 4FM1A 1Q5OA 5KMGA 2Q7HA 5B5EZ 1ENVA 1I94B 4IHJA 4D6TH 1GRJA 4DRXB 4DR3B
chains in the Genus database with same CATH topology
2Q8VA 3CS5A 2QDOA 1OJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8V A;  3CS5 A;  2QDO A;  1OJH A; 
#chains in the Genus database with same CATH topology
 2FYU H;  3QO5 A;  4ICG A;  1DK1 A;  4JI4 O;  4JI3 O;  1PPJ H;  1XHX A;  1L8D A;  3AG2 C;  3APO A;  1Z2G A;  3JAR A;  2OCC C;  4O4I A;  1YJN V;  5BMV B;  1MA1 A;  3H1K H;  3D36 A;  1W59 A;  1TUB B;  2EZO A;  1NR1 A;  2PYL A;  4GKJ O;  1AJP A;  5B1B C;  2AGA A;  3DC5 A;  5HFL A;  3N2G A;  5EIB D;  1B3Q A;  3SPC A;  1GH6 A;  1N33 O;  1S77 D;  4DK0 A;  4TWK A;  3RYF B;  1M56 B;  2FKX A;  1QLE B;  3GVM A;  3W7X A;  4NYK A;  3G71 V;  5LHI A;  2EIK C;  4H0L B;  1S5H C;  1OCC C;  3ZRV A;  2QTO A;  3ASN C;  3JAK A;  1Y6X A;  3JYC A;  4R8C A;  4JI1 B;  2HP8 A;  1HNW B;  3WG7 C;  1RM1 C;  4XDL A;  1H2K A;  3CYO A;  4JV5 O;  2HEP A;  1N36 O;  5H2F Z;  1Y67 A;  4FM2 A;  2G38 A;  2HKO A;  2H94 A;  3AG7 A;  3C3S A;  1YJ9 V;  1J95 A;  4MT8 A;  2EBO A;  1IBK O;  4X1K A;  4R7C A;  3E22 B;  5LP6 C;  1ZL8 B;  4L8J A;  3K0G A;  4BR6 A;  2W6J G;  3BAA A;  2Q4P A;  3LDE A;  5LHG A;  2LW7 A;  3CPW U;  5KHI A;  5L3D A;  4DXW A;  1MG1 A;  1KBH A;  2ZIO A;  1FS0 G;  1JVM A;  5LMN O;  4O4J B;  1Y76 A;  4J41 A;  4B7E A;  1Q82 W;  1EN5 A;  4JI3 B;  3ETE A;  1M57 C;  1Q6I A;  2DW4 A;  3N27 A;  1WLE A;  4JI5 O;  2DQ0 A;  4Z2W A;  4D7T A;  4U3J B;  4X66 O;  1J5E O;  4GKJ B;  3SPJ A;  4X64 O;  1SC5 B;  5IY5 B;  4WF9 V;  4MVO A;  1GM8 A;  1L0L H;  3SPG A;  3RYH B;  4MW3 A;  4GKK O;  4BW5 A;  3JCU Z;  4RUE A;  2UXD O;  1VQN V;  2WLH A;  4P2Z A;  1V54 C;  3SJQ C;  1UFI A;  2X6A A;  5BXZ A;  3N2K B;  4OXS A;  3FYI B;  3OE7 G;  2QEX V;  2R9A A;  4ZOL B;  3L72 H;  2BSK A;  2UXX A;  3ABM B;  2B9Z A;  2LP7 A;  4IIJ B;  1HNZ O;  4JV5 B;  1N36 B;  2PI5 A;  3WB1 A;  2RQ6 A;  2MK3 A;  1N34 O;  2X6B A;  3JD2 A;  4JAA A;  3A8T A;  5LGT A;  4DV7 O;  1IBK B;  1OCZ C;  2IU0 A;  1R3K C;  2R72 A;  4J11 A;  2C2A A;  4DR1 O;  3K08 A;  5LMU O;  1AP5 A;  2XAH A;  4JI2 O;  2V4D A;  4UVB A;  1SZX A;  2ZE8 A;  2V7Q G;  4TV9 B;  4X20 A;  2UXC O;  5IDJ A;  5LMN B;  3OMN B;  3OM3 B;  1DF5 A;  4GX0 A;  1KMI Z;  1TVK B;  4HAM A;  1GO3 F;  2VRZ A;  4UVA A;  3K04 A;  4I0X A;  1QCE A;  2QWP B;  4JI0 O;  2VS0 A;  3SPH A;  3K03 A;  4X66 B;  1J5E B;  5H5N A;  4X64 B;  3QO7 A;  2ARH A;  5LXT B;  3P3N A;  5GTI Z;  3THO A;  1VEW A;  2PF4 E;  1KC8 W;  5KMG B;  3OGI B;  4GKK B;  1NTZ H;  2QA4 V;  2UXB B;  4IHJ B;  3KZI Z;  1L0N H;  2UXD B;  2CAZ C;  3TCU A;  1GN6 A;  2CTP A;  1XNR O;  1AI4 A;  3JAR B;  4MTO A;  4MW8 A;  4O4I B;  1SS3 A;  2GDS A;  2P5O A;  1I08 A;  2Z3Y A;  4FZ1 A;  2YS8 A;  1HNZ B;  2UUB O;  5LBQ A;  3ABK B;  4QE7 A;  3CCL V;  3ASO C;  1IDS A;  4ASU G;  5JJJ B;  1QNM A;  1ZTE A;  1BHB A;  3N2G B;  4DV7 B;  4CH5 A;  3H1J H;  1AR1 B;  5D5Q A;  4DR1 B;  5LMU B;  4AIL C;  2WLJ A;  1SQF A;  4FM0 A;  3KG2 A;  4JI2 B;  1F4N A;  2CH7 A;  2JVD A;  3JAK B;  1WJZ A;  2QR4 A;  1O9G A;  1QVG U;  4MVU A;  2UXC B;  4AHC A;  2GHY A;  1R6N A;  2F93 B;  1ZSP A;  2FTK A;  1FXV A;  1HWY A;  2F4V O;  4FFB A;  3X2Q C;  2EIN C;  1VQK V;  3OUF A;  1FXK C;  1WNS A;  5C8Y A;  2WPD G;  3SYC A;  5L3E A;  1VQ7 V;  1D5A A;  4JI0 B;  2YC0 A;  2ZDI A;  3E35 A;  4DV3 O;  2V1D A;  1QR8 A;  4X1K B;  4PI0 A;  3CWB H;  2PY5 A;  1D2D A;  1SER A;  3OMI B;  4JF3 A;  3TET A;  2YIA A;  4JI7 O;  1YIT V;  3LDC A;  2WSS G;  4J7Z A;  3FAV A;  4GZR B;  2ZCE A;  2A3Q A;  1GTO A;  2ITC C;  5J2T A;  3CMA V;  3K06 A;  2ADP A;  3ABT A;  3B8M A;  4LF7 B;  1XNR B;  4J42 A;  4YJ3 A;  3E8G A;  4R50 A;  2E74 B;  2XAQ A;  2UUB B;  2DWD C;  4EEQ A;  4ABM A;  4LH7 A;  3E86 A;  1YJW V;  3I5D A;  1CEZ A;  4IT5 A;  4QJF B;  4MSW C;  2FL4 A;  2DWE C;  3LSQ A;  3ZJZ A;  3ZRS A;  3ZCC A;  5KHJ A;  3CS5 A;  2A7W A;  1V55 B;  1RFY A;  3H1I H;  1AR4 A;  3CCQ V;  1Q8I A;  2YDE A;  1TUB A;  3CRC A;  5B3S C;  3ZHR A;  2YXY A;  2P06 A;  4H44 B;  3JD0 A;  1GN3 A;  3T1H O;  5CBG A;  3MHS C;  2Z0A A;  3RGB A;  3ZMS A;  3UQ8 A;  1GKF A;  1KEC A;  4CBC A;  2BSK B;  1YVW A;  1JPX A;  1PM9 A;  2ZXW B;  4YXW G;  1IZ3 A;  3G80 A;  3ABU A;  2R9I A;  4PDL A;  3ZRW A;  3EFF K;  5IWA O;  1I5X A;  4DUZ O;  3LSU A;  4UCR A;  4F6E A;  3BHP A;  3AG1 C;  1K8A W;  2QJ1 A;  3T2M A;  4X20 B;  3Q4H A;  4JI7 B;  4JYA O;  4GLX A;  1QLN A;  5FPO A;  1KUQ A;  1NTM H;  2Y4U A;  3MAQ A;  3K0D A;  4UCU A;  4NKG B;  3L73 H;  1ZL8 A;  3UCS C;  2P90 A;  1VQ6 V;  4I0X B;  1JA8 A;  5CMU A;  5IE9 A;  1N0J A;  3ZIA G;  3STL C;  4P9P A;  1EN4 A;  1JR9 A;  2DYS C;  4MVZ A;  3J81 N;  2LGQ A;  1PL4 A;  3FB5 C;  3H1H H;  5L3G A;  2ZIM A;  1YI2 V;  3MHH C;  3CC7 V;  1JFF A;  2QWN B;  2IW5 A;  1K5Q A;  4FLV A;  4CC6 A;  4JI6 B;  3T1H B;  2KB1 A;  2Q7E A;  2JS3 A;  5IT9 N;  3G6E V;  4RQE A;  2X6C A;  3OR6 C;  3RYH A;  1FKA O;  5EYP A;  2D3O W;  1EFR G;  2W0F C;  3JAS A;  4LF5 B;  2EIM C;  4EKW A;  1SZT A;  3ETD A;  4TQF A;  4QIW F;  2QTS A;  4UXN A;  2HJD A;  2GSM B;  2NNU A;  3J80 N;  4ZOL A;  4DUZ B;  2PUS A;  4KXR A;  5IYC O;  1WP7 A;  4FLZ A;  1VF6 A;  2CH7 B;  5KA6 A;  3E83 A;  4DR2 O;  4N23 A;  3SDL A;  4X65 O;  2QM4 A;  2QKC A;  3FD9 A;  4JYA B;  4DO2 A;  3KCY A;  2OYQ A;  4FFB B;  3M99 B;  2KKW A;  4BAY A;  5CA0 A;  2AW9 A;  1H2N A;  4JGS A;  1V9P A;  3OR7 C;  1W0K G;  4KL1 A;  3S3W A;  3WB0 A;  3CEI A;  2KQX A;  1W0J G;  1FJG O;  1H2G A;  1R3L C;  4FFK A;  3HKB A;  4FIP C;  1SQQ H;  2XAS A;  5LA6 B;  4GX2 A;  1R1B A;  3K5L A;  1NJI W;  4J10 A;  1K92 A;  4LFA O;  4FLT A;  3RYI A;  4I50 A;  4EB6 A;  4Z1M G;  4O4L A;  3FAV B;  5J2T B;  1R3J C;  3B4S A;  3ZN0 A;  2EIL C;  1VQ9 V;  5JQG A;  4YJ3 B;  3BFR A;  4I5S A;  1K73 W;  5H6R A;  1OCO C;  2VWK A;  5D5P A;  4MTF A;  3JCZ A;  3ZHU A;  1H2M A;  1K5S A;  3ZHT A;  4HBN A;  1BE3 H;  2YXL A;  2QWR B;  3ZED A;  3FB8 C;  3E89 A;  2N05 A;  4JZG A;  1YZB A;  3BPZ A;  3G67 A;  4IGG A;  4CH4 A;  2HJF C;  2DOS A;  2GBO A;  4NB5 A;  1BSM A;  4DR2 B;  2QM7 A;  2IJK A;  5B1A C;  4X65 B;  4LH6 A;  1HDJ A;  4JI8 O;  1WPX A;  3QF7 A;  3JD4 A;  4HYO A;  3AG3 C;  4JTA B;  5L3C A;  4UB6 Z;  5EIB C;  2ZIN A;  1FJG B;  3ZRW B;  1VQ8 V;  1NBM G;  3FKS G;  4DV0 O;  4GYC B;  1OCR C;  3JAW A;  3L75 H;  3GB7 C;  2XOK G;  3U11 A;  2DMX A;  2NR5 A;  3EHB B;  3Q4H B;  3P30 A;  4LFA B;  3VQX A;  5KLV H;  1XUQ A;  1GM9 A;  1XBL A;  2DYR C;  2LJ2 A;  4NTX A;  4H13 B;  1K4C C;  1WB7 A;  3CB2 A;  2QWO B;  5B1N A;  3K5O A;  1NVP D;  1P4R A;  1K9M W;  1SQX H;  4JAS A;  1UPG A;  1I7F A;  4JYY A;  4R6Z A;  1F23 A;  3LSS A;  3CCR V;  3SJB C;  2LFR A;  5EC1 C;  5K1P A;  4I9Q A;  1BHA A;  1VQL V;  3AG4 C;  3OFN G;  5IYD O;  4I55 B;  1WPB A;  2XND G;  1ORQ C;  4JTD B;  1DLB A;  2GV9 A;  1JFF B;  4HZ3 A;  4LWS B;  4YHH O;  3JD1 A;  4B3T O;  1RP3 B;  4DR6 O;  5CA3 A;  5JCO C;  2Y69 C;  5H6Q A;  4OX9 O;  1S5L Z;  1SF9 A;  4JI8 B;  2Q6A A;  2ZNI A;  4Q6G A;  1PV0 A;  1DF4 A;  1S76 D;  1LUV A;  5EYP B;  2UUC O;  3JAS B;  2UXB O;  2CK3 G;  3A0B Z;  1KP3 A;  1W2B U;  5A9G A;  3ETQ A;  4DV6 O;  1B06 A;  1S0V A;  4LF6 B;  3IC7 A;  1JMK C;  4B3S O;  1GN2 A;  4PA6 A;  4TV8 A;  2JS5 A;  1VQM V;  2ZM6 O;  5GW7 A;  4DV0 B;  2EIJ C;  4BW9 A;  2QE7 G;  2QDO A;  2RJZ A;  1JJ2 U;  4DR5 O;  4P30 A;  4TQD A;  4RAI A;  4H37 A;  4LC1 A;  4NXN O;  1A32 A;  4TSF G;  4WFB V;  3FX7 A;  3B09 A;  1FD9 A;  2F1M A;  1MMM A;  4AI8 A;  2RNB A;  4NTY A;  1VMG A;  2AXT Z;  3JSN A;  2P4K A;  3SYA A;  5FL7 G;  5KUK A;  1MSW D;  5CA0 B;  5H9C A;  1XIL A;  1K97 A;  4GX1 A;  1FFT B;  2ITD C;  1R73 A;  1YTF B;  2XTA A;  2EJ7 A;  3WB2 A;  3HKB B;  1Q6H A;  2Q0A A;  2WLK A;  4QNH B;  4X1I A;  2XAF A;  3D8C A;  1AB3 A;  4JAU A;  4K35 A;  1F4M A;  4ZIB A;  4YHH B;  3RYI B;  4I50 B;  4EB6 B;  4B3T B;  4O4L B;  4IYH A;  4MTX A;  4DR6 B;  3HB3 B;  4UCS A;  3TJT A;  3CRR A;  3OW2 U;  2Q9L A;  3ZRX A;  1Q3E A;  5JQG B;  4OX9 B;  1NZ6 A;  1THZ A;  5CBF A;  1EM1 A;  3CCU V;  2UUC B;  1X59 A;  2E76 B;  2BE3 A;  3W7U A;  1M56 C;  1QLE C;  4DV6 B;  1KKC A;  1G6U A;  3JAL A;  4H33 A;  1IVS A;  4B3S B;  4LF7 O;  1TA8 A;  1JCH A;  1KD1 W;  5CB4 A;  5A2Q N;  2ZM6 B;  1EBO A;  1VIB A;  1MZE A;  2CUG A;  5LOV B;  2IJJ A;  4G2K A;  3BY6 A;  1E1R G;  4KFM A;  1G4Y B;  4DR5 B;  4GT1 A;  3OMA B;  5IJ0 A;  3M8A A;  4NXN B;  1N4C A;  1NQT A;  3K9A A;  4PEL A;  4X1Y A;  4DV4 O;  1VF5 B;  1BCC H;  3K3W A;  5LP6 A;  5BY1 A;  3EVK A;  2BOB C;  1IXB A;  1NH2 D;  2F66 C;  5J2U A;  2YEV A;  1YEW A;  5KAF Z;  3APQ A;  1XMO O;  2L6L A;  1JX9 A;  1G8M A;  3F7V C;  1O9H A;  2E75 B;  3K9S A;  2UUA B;  4BIZ A;  1MZF A;  3WU2 Z;  1F51 A;  1N32 O;  2UU9 B;  4LF8 O;  1XEQ A;  3T4D A;  2W0X A;  4XBF A;  4AQY O;  2ZNJ A;  4X9Q A;  3JAW B;  4PDM A;  4FLU A;  2X7R B;  4WFE A;  4J7K A;  2N04 A;  1QU7 A;  2IH1 C;  1IBL O;  1LNQ A;  3BA9 A;  2YI8 A;  4FLX A;  3G6B A;  5IY5 C;  1ZX3 A;  3DSQ A;  3FYE B;  5LA6 A;  2CGO A;  2OIG A;  4CC5 A;  1WN7 A;  2ETN A;  2PGG A;  2DQ3 A;  3ABL B;  4WFG A;  1PL0 A;  4KP4 A;  4DV1 O;  1IUR A;  3RYC A;  4XDK A;  4QGP A;  3T1Y B;  3CRM A;  2PYJ A;  4QE9 A;  4ZI7 B;  4HNA A;  2PTM A;  1Q81 W;  2HVK C;  3ABM C;  3LNN A;  3OAA G;  3F5T A;  1YDX A;  4DV4 B;  3SYP A;  3IFX A;  2GTA A;  4ZBM A;  4UVC A;  1YTF D;  1Q7Y W;  4WFA V;  5DED A;  1BMF G;  1XMO B;  2X0L A;  2EJR A;  1YXB A;  1Y74 B;  2M7W A;  4NVP A;  2CTW A;  1VF7 A;  1BQZ A;  4WBN A;  3O65 A;  3CHX A;  4JI6 O;  1N32 B;  1Y4M A;  3UM7 A;  4TV8 B;  2IU3 A;  4LF8 B;  3U10 A;  5GON A;  3OTO O;  4AQY B;  4MTG A;  4E2L A;  1N0N A;  1YIJ V;  4BIO A;  3T1C A;  3SR2 C;  2ADQ B;  2F43 G;  1TAE A;  2JRI A;  4LF5 O;  1K7D A;  1PNK A;  2P7T C;  3LUT B;  3I56 V;  5KX5 A;  2YI9 A;  5JJN B;  2B1I A;  1EZV H;  4W4K A;  1IBL B;  4WFF A;  2IJH A;  5KHK A;  1BT8 A;  4GCZ A;  5JVD A;  4QPJ A;  4B3R O;  3VQV A;  2RDC A;  3GWK C;  1IBM O;  3CXH F;  3DXR A;  3FB6 C;  4FJC C;  4LF4 O;  4LFB B;  3AG2 B;  2Q69 A;  2OCC B;  2Q0O C;  2WLN A;  1NTK H;  2WA3 A;  4DV1 B;  1I5Y A;  4CH6 A;  1FXH A;  2XUM A;  1YF2 A;  1XOU A;  3CJH A;  4PA9 A;  3QG5 A;  2NN4 A;  4X1I B;  5LHH A;  2Q68 A;  3FFQ A;  3VQY A;  4PA3 A;  3UT5 A;  4F4L A;  1ZLZ A;  5ITZ A;  5B1B B;  3D36 C;  4PD4 F;  5IJ9 A;  2YIC A;  3ABK C;  1P84 F;  3JAT A;  1URF A;  3K57 A;  2L35 A;  2JDI G;  1RSO A;  3K5N A;  2ZE6 A;  4U7N A;  2YIB D;  4PDV A;  1FPO A;  3OEE G;  1OZ0 A;  4I55 A;  2EIK B;  2RCV A;  1OCC B;  3UKM A;  3ASN B;  4WCE V;  4LWS A;  1GM7 A;  1AIL A;  4CS4 A;  4B08 A;  3JAL B;  3P32 A;  3HR0 A;  3WG7 B;  1MSD A;  4GUN A;  1RM1 B;  4TOI A;  2W6I G;  3ZHS A;  5CB4 B;  1PP9 H;  1FXK A;  5CN0 A;  5KHG A;  1RPO A;  2LQT A;  3OTO B;  1OV9 A;  5KUM A;  1Q43 A;  1B6Q A;  4D7S A;  4I4T A;  3RWR D;  5IJ0 B;  4X1Y B;  1COW G;  1F7Y A;  3L9D A;  5LP6 B;  1NVP B;  5DEC A;  1XI1 A;  5J2U B;  2YEV B;  5JWP A;  4U3F H;  3CCE V;  1M4U A;  3E8H A;  5JH7 A;  2QWQ B;  4B3R B;  2YID A;  1PKX A;  1K4D C;  2Y48 A;  5LYJ A;  1IBM B;  3W7S A;  5K1X A;  5LGN A;  5J9P C;  3RN4 A;  3K58 A;  1M57 B;  4LF4 B;  3ZHV A;  4B3M O;  2R70 A;  3H01 A;  4DV5 O;  4FLY A;  4UCT A;  3AK2 A;  3B8N A;  4DW1 A;  4F6R B;  1QQC A;  2QGN A;  2K1E A;  4GX5 A;  2RN9 A;  5IYZ B;  1IX9 A;  4UUJ C;  2P6J A;  3BEH A;  4C7U A;  2XT9 A;  1AJQ A;  1K34 A;  3RBZ A;  1PNL A;  2Y4T A;  3IC9 A;  4NXM O;  5E1A C;  1BZK A;  3HKD A;  4FMT A;  4IL6 Z;  1H2S B;  2JIZ G;  1KYO F;  3B2E E;  2PI4 A;  1V55 C;  1TGO A;  4MVS A;  4G27 B;  1V54 B;  3BA8 A;  5EK0 A;  3D3Q A;  2BTO A;  1WP8 A;  3LDD A;  5L3F A;  3RYC B;  1XMQ O;  4TT3 G;  1P7B A;  1QBZ A;  1BQ0 A;  4HNA B;  1S3J A;  2HVJ C;  5CA1 A;  4LNU A;  1JOY A;  3E8B A;  1US6 A;  2EUL A;  2KG7 A;  1OCZ B;  1SQV H;  4FLW A;  2CDY A;  2ZXW C;  3DC6 A;  4FZ0 A;  2BOC C;  1FFX A;  3S3X A;  5LOV A;  2ZD9 A;  3CC4 V;  2ZE5 A;  3PN1 A;  4OGQ B;  5AG2 A;  3L70 H;  4WBN B;  4ZHQ A;  4NR1 A;  5EZY A;  3F5W C;  3BVO A;  3R66 A;  5GON B;  3AK1 A;  1P7G A;  4B3M B;  3DGE A;  2IJI A;  1EN6 A;  1Z5W A;  2XAG A;  4DV5 B;  3CRQ A;  2JEU A;  3CSX A;  4MVR A;  4RQF A;  3CD6 V;  4JAV A;  4LF6 O;  4K8X A;  1RPR A;  2YIB A;  5KX5 B;  4O2A A;  1SQB H;  4KUM A;  2ZQM A;  4RUF A;  5BR8 O;  4LR3 A;  1M90 W;  4TUY A;  2XAJ A;  4UFZ A;  4NXM B;  1B04 A;  5KAI Z;  4X88 A;  5JVD B;  1XL4 A;  3L74 H;  1YCI A;  1VQ5 V;  3HKC A;  2EZP A;  3DXR B;  3PJS K;  4DK1 A;  3L71 H;  4DR7 O;  3QNE A;  3M7M X;  1XMQ B;  4K3A A;  4ZKI A;  4G28 B;  3CJH B;  2D2C B;  1MAB G;  2ZT9 B;  3F7Y C;  4MVQ A;  3ASO B;  3UT5 B;  2Q5Z A;  2BTQ A;  4JZ2 A;  2CE4 A;  5ITZ B;  3MD0 A;  3A0H Z;  1NH2 B;  5IJ9 B;  3QVN A;  4RO2 A;  2Q67 A;  2ODM A;  1FYJ A;  3JAT B;  1KQS U;  1CXZ B;  1NI8 A;  2XHB A;  1RSO B;  4ZI7 A;  3SJA C;  1LR1 A;  3IAY A;  4FVM A;  1AJN A;  1ARO P;  2BCC H;  4PJ0 Z;  1GAX A;  3D3I A;  2AZ2 A;  3OTF A;  4PDR A;  3VOU A;  1DTO A;  2Y0I A;  3X2Q B;  2EIN B;  4JI4 B;  3UO2 A;  1FXK B;  4CS2 A;  1LUW A;  4FPP A;  2FML A;  2WLM A;  1WA8 A;  4I4T B;  4YJ2 B;  2A06 H;  1Y74 A;  2QSA A;  1U96 A;  4LCU C;  2ZDI C;  2HHH O;  2AZ0 A;  3HKE A;  5BR8 B;  1N33 B;  1Q90 D;  1YHQ V;  2NLJ C;  1VQ4 V;  5JH7 B;  2OTJ V;  2JJ2 G;  5LYJ B;  5LL6 Y;  4BWA A;  3AK3 A;  4FK5 C;  1BGY H;  4DR7 B;  3DTU B;  2VQE O;  1ZUQ A;  4J9Z B;  3J7A U;  3BCC H;  4IYI A;  5EBL C;  1Z5V A;  1ZAU A;  2OT5 A;  3CP1 A;  3A2F A;  5L3B A;  3T4Z A;  4PI2 A;  4UCO A;  1DGS A;  2Q73 A;  1NU1 H;  1PD3 A;  5FNV A;  2UUA O;  4DUY O;  1JJO A;  3CCV V;  2WAM A;  1PNM A;  1KU9 A;  3UO3 A;  1P49 A;  4Z1V A;  2UU9 O;  4PHZ A;  2LFS A;  3HKD B;  5EBM C;  3JD3 A;  1IXM A;  5B3S B;  2YSU B;  4LP8 A;  2A0L A;  2AHY A;  1Q6U A;  4J9Y B;  1UJW B;  1D5N A;  1HP8 A;  4U7O A;  1Q86 W;  2Q8V A;  3K79 A;  4CS3 A;  5CA1 B;  4LNU B;  4BIU A;  4DV2 O;  4JI5 B;  1MNG A;  2KG7 B;  1VQO V;  2N74 A;  2OIE A;  2YUA A;  1Y66 A;  1H8E G;  2HHH B;  3T1Y O;  4DR4 O;  2K9P A;  1SA0 A;  1KP2 A;  1VP7 A;  1R6T A;  1FFX B;  3AG1 B;  3C3T A;  4O4H A;  2CGN A;  1HW7 A;  1SQP H;  2QKS A;  2LGW A;  2Y0P A;  2HLD G;  3I55 V;  4ZHQ B;  4K0K O;  5IYB O;  1BL8 A;  2WLL A;  5EZY B;  2VQE B;  1H2L A;  1VAR A;  3NR7 A;  4YY3 O;  4B7K A;  1CP9 A;  3ZMT A;  1GK9 A;  2GUZ A;  4WFH A;  1T5E A;  3BAB A;  2JK5 C;  3H1L H;  3C90 A;  3AEI A;  3CCS V;  3ZMV A;  3W7W A;  2Z5U A;  2DYS B;  2E3C A;  4O2A B;  1U97 A;  2E5L O;  4DUY B;  1XQ8 A;  1N34 B;  4QPK A;  5BZB A;  4TUY B;  1S5J A;  1AVM A;  3CXC U;  1MOF A;  1XRE A;  3STZ C;  5FLX N;  3G4S V;  5E79 Z;  3P3P A;  3EXA A;  5DM6 V;  1X4T A;  4PV1 B;  1SES A;  2WA4 A;  4L87 A;  3HKC B;  4MVM A;  4JPR A;  5B1O A;  4F6R A;  5DN6 G;  5JCO A;  2CTR A;  5IYZ A;  2P4V A;  3TXQ A;  1HNX O;  4LFC O;  2M6Y A;  3K59 A;  3JSL A;  5KHH A;  3O9O A;  2BTQ B;  2EIM B;  4O2B A;  2QKA A;  3RFR A;  1WB8 A;  5JJE B;  3ZX6 A;  5EC2 C;  4DV2 B;  3IJ4 A;  2ATK C;  4PA7 A;  4LFB O;  3CC2 V;  1QVF U;  4DR4 B;  2RMK B;  3E8F A;  3CRA A;  3VBB A;  4OPH A;  4CZZ A;  2P67 A;  3ZHQ A;  4JTC B;  2JGD A;  3QO8 A;  3OEH G;  2OTL V;  1M9N A;  1VF6 C;  2B5U A;  4MS2 A;  2F95 B;  1XNQ O;  1Y76 B;  4K0K B;  4K8Z A;  4JYC A;  4YIP A;  2UXN A;  3OT7 A;  1AR5 A;  4YY3 B;  1XHZ A;  1KKD A;  3QTC A;  2WLI A;  2B1G A;  4PA4 A;  1NS1 A;  4YIO A;  2CTQ A;  1WA8 B;  1FAF A;  3SPI A;  1SET A;  3GWO A;  2DJV A;  1AI6 A;  3HPL C;  1NT2 B;  4DRX A;  2E5L B;  3HKE B;  2ZE7 A;  2ILM A;  3SJC C;  1E1Q G;  4W4L A;  3CX5 F;  3FB7 C;  2IBZ H;  2FB5 A;  4RWU A;  2F23 A;  5BMV A;  2A9H A;  1OHH G;  1R6K A;  1SRY A;  2P22 C;  4DYL A;  1AI5 A;  2EX3 A;  3SYO A;  3WFV A;  3LNM B;  2EIL B;  1HNX B;  4LFC B;  2IH3 C;  2AHZ A;  3SYQ A;  1ROP A;  3RT3 C;  2JEX A;  2F4V B;  1EZJ A;  1OCO B;  1XL6 A;  4DW0 A;  3RYF A;  3TGU H;  2DE0 X;  5FNV B;  1CPY A;  1HR0 O;  1AP6 A;  5CBH A;  4DV3 B;  4A5U B;  3H9V A;  3RVY A;  4X62 O;  4LF9 O;  2QM8 A;  2GTS A;  1XDC A;  1SKV A;  3ETG A;  4P9O A;  1YSC A;  2R9R B;  4UCV A;  3OGC C;  1VQP V;  3JAM N;  5B1A B;  2HG5 C;  1AI7 A;  3ZBH A;  4XDJ A;  5GTH Z;  1XNQ B;  4LBE C;  2YXH A;  3E22 A;  2JGU A;  3OUS A;  4EFE A;  2VWJ A;  3AG3 B;  1N8R W;  3SGI A;  2JJ1 G;  4OPA A;  5HFM A;  2ZR3 A;  4UV8 A;  3CCM V;  3KCX A;  4Q20 A;  2MW2 B;  2OCH A;  2HFE C;  4O4J A;  2HR3 A;  1M1K W;  1SA0 B;  1KB9 F;  2WWW A;  2VQF O;  2H8P C;  1OCR B;  3ML0 A;  4J7J A;  5C93 A;  1QHT A;  2IM9 A;  4O4H B;  2ZKO A;  2H3O A;  3MDS A;  3TXS A;  2Q7G A;  4YJ2 A;  2PZS A;  4U3J A;  2KSD A;  2WLL B;  2DYR B;  3BRC A;  3KKY A;  4X8A A;  1I0H A;  3ZN1 A;  4N21 A;  2GUZ B;  4KHP O;  1E79 G;  3CE2 A;  1NR7 A;  3ZS8 C;  1I94 O;  1OJH A;  2A79 B;  5F2V O;  1GN4 A;  4DR3 O;  1HR0 B;  3NXS A;  3ABL C;  3CME V;  3AG4 B;  4LF9 B;  4X62 B;  1H8H G;  3N2K A;  1NKD A;  2OWO A;  5IWA B;  4X89 A;  3ZMZ A;  1K3E A;  4J80 A;  1M93 A;  4IIJ A;  3K5M A;  1SQG A;  2Y69 B;  5B66 Z;  3RVZ A;  5EBW C;  4CH3 A;  3ZMU A;  2LW1 A;  5KA5 A;  4UB8 Z;  2ZR2 A;  4NTW A;  1H38 A;  3RW0 A;  3U0Z A;  1M5I A;  2DN9 A;  1R3I C;  5C8Y B;  3B40 A;  4O2B B;  1K33 A;  2LO1 A;  4I9W A;  3CCJ V;  3E2E A;  3OD4 A;  1ZWI C;  1S72 V;  4TV9 A;  1JQ0 A;  4JI1 O;  3IGA C;  1HNW O;  2EIJ B;  2VQF B;  1TVK A;  3TK1 A;  1G1X B;  4E4E A;  2O57 A;  3R65 A;  1TUE B;  1BS3 A;  3B77 A;  1WAZ A;  2JGD B;  4I7Z B;  5FPR A;  5LGU A;  1GMG A;  4EFB A;  3A0R A;  1L1F A;  3ICX A;  5LXT A;  4UV9 A;  2WLI B;  5TIS Z;  3VQW A;  4KHP B;  1QR9 A;  4JYB A;  3W7T A;  4FM1 A;  1Q5O A;  5KMG A;  2Q7H A;  5B5E Z;  1ENV A;  1I94 B;  4IHJ A;  4D6T H;  1GRJ A;  4DRX B;  4DR3 B; 
#chains in the Genus database with same CATH homology
 2Q8V A;  3CS5 A;  2QDO A;  1OJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...