2Q8VA

Nbla protein from t. vulcanus crystallized with urea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
LNVDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Thermosynechococcus vulcanus
molecule tags Protein binding
molecule keywords NblA protein
total genus 19
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2q8vA00
2QDOA 2Q8VA 1OJHA 3CS5A
chains in the Genus database with same CATH superfamily
1VQPV 1Q81W 4X20A 3ZMZA 2Q7HA 2PYLA 3I5DA 4B08A 3AEIA 3EFFK 4JAAA 4WFAV 3CHXA 4JI6O 4DR6O 2WA3A 2QTSA 4X89A 3JARA 3OMAB 3ZHUA 2WLLA 3UCSC 3ZMSA 2R70A 2P4KA 2ZXWC 3F7YC 2D2CB 5JCOA 4LFBB 5CBFA 3JSNA 4OX9B 1K33A 1BT8A 5LMNO 4TWKA 5LL6Y 2F4VB 4U7OA 3G67A 2YSUB 2OWOA 2CTPA 5IY5C 1JOYA 2IU0A 2CGNA 3DGEA 4LNUB 1IBKB 4JI8O 1JR9A 2CK3G 1XMQO 4UUJC 3K06A 1SA0A 5DECA 3G80A 5ITZB 3CCRV 3KCYA 2EINC 4NB5A 4DR7B 2OCHA 3BVOA 2YEVB 1K9MW 3M7MX 4CH5A 1WLEA 2Q7EA 4UCOA 4YHHO 1HNXO 1S77D 5H9CA 4UXNA 1K92A 1VQ6V 3CRRA 4JTDB 2QSAA 1XMOO 5EZYA 4FLVA 1J95A 3VQXA 4W4KA 4WFEA 2AZ0A 4MSWC 1IBLO 3CC7V 5B1AC 1BS3A 4JI3B 2OIGA 2Q67A 3ZBHA 1YDXA 2JS5A 2B9ZA 2F66C 4QPKA 2Q9LA 3GB7C 5IWAB 1GAXA 2UUBB 2UU9B 4O2AB 2NN4A 4NTWA 4LH7A 2DOSA 4JI5O 3J80N 3X2QC 4ZHQB 2QDOA 4MW3A 1IXBA 3ASOB 4KHPB 3L72H 4N23A 2ZD9A 4H37A 2ETNA 2BSKA 3FAVB 4UV9A 2UXBO 2Q4PA 4NR1A 1GN3A 1I5XA 2RCVA 4TQFA 1G1XB 4EFBA 3ABKC 2R72A 1W59A 4JYAO 4MVUA 1M5IA 2V1DA 4CH4A 1RSOB 3H1LH 1KBHA 4R50A 4NVPA 1ENVA 3RFRA 2L6LA 5LP6B 1BL8A 5EYPA 3RYCB 4IIJB 3K5OA 4KHPO 2CH7A 5LP6C 1K8AW 3JASA 2X0LA 1M57B 1L1FA 1FKAO 1VF5B 2CUGA 5LOVA 4PA4A 4LF5B 1VQ5V 4DUYO 1QLNA 1V9PA 4TV8A 3D3IA 1J5EB 4RWUA 5EC1C 3D36C 1Y4MA 3CRMA 4BIZA 3UQ8A 4GKKO 1KUQA 4I9QA 1COWG 1VARA 1MOFA 3E86A 3BEHA 2LQTA 2ZE8A 1FXKB 1L0NH 5IY5B 2YIBA 4DV1O 2HLDG 3T4ZA 3QVNA 4YJ3B 3CCUV 4PD4F 4IYIA 2B1GA 1FD9A 1VQ7V 1L8DA 3HB3B 1L0LH 2P4VA 2Z5UA 5JQGB 3FB6C 3LSQA 4X64O 4TV9A 4I55A 4LF5O 4NXNB 3ZRVA 1Q6IA 5FNVA 2DYRB 1CXZB 3M99B 1SQPH 2A06H 4X62B 2DYRC 2WA4A 3ABTA 2XOKG 3ZRWB 1SF9A 1XL4A 3K08A 1ZLZA 2Q73A 2F43G 3P3NA 1AI6A 1F4MA 4E2LA 1N33B 3LDDA 2UXXA 1THZA 2GUZB 3CX5F 2BOCC 2ZE6A 3OEHG 4EB6A 3JD3A 5JWPA 3SYOA 2UUAB 1S5LZ 1DTOA 3W7UA 1XREA 3BABA 3QO8A 1AVMA 4OPAA 5A9GA 2XASA 2C2AA 2BCCH 2OCCB 1VQLV 3ZHRA 4GX5A 3RT3C 1S5JA 2A9HA 4NXNO 3A0HZ 1G8MA 1AJPA 1JFFA 5LGUA 1WPBA 3C3TA 3OTOB 2BE3A 2HKOA 1BHAA 1DGSA 3OAAG 1SQXH 1NZ6A 3BHPA 4J9ZB 3RYFA 3P32A 4FLTA 4LF7B 3OEEG 4LF9B 2LGQA 3VBBA 4DR4O 4LP8A 2UXNA 1UPGA 3CP1A 1U97A 1XQ8A 5IJ9B 2N74A 3KZIZ 3OD4A 1ZL8A 2IJKA 4LF4O 4JI8B 1TAEA 2KG7B 5IT9N 1MSDA 1TVKA 1GM8A 3KCXA 1MNGA 2EZPA 4YJ2A 1B04A 5JH7A 1VQOV 5KX5A 4LF8B 4B7KA 2X6AA 1W0KG 4MTOA 2UXDO 1QBZA 2LFRA 5LHIA 4YXWG 5JVDB 3SPHA 1R3JC 5HFMA 3K57A 4ZBMA 2D3OW 2QM4A 4LFCO 1Q82W 1H2GA 3TCUA 5IWAO 4UCTA 1I94O 3CC2V 4C7UA 4GKJO 2P67A 2AW9A 5CB4B 4G28B 2YS8A 1YTFD 1AILA 4P2ZA 1S0VA 1YZBA 3OGCC 5IJ0B 4X65O 1KP2A 4LWSA 2P06A 4PDRA 1Z5WA 3AG4C 2F93B 2LFSA 1SA0B 1XUQA 1PNLA 3OGIB 1CEZA 1Q6UA 1MABG 3Q4HB 4I0XA 1Q90D 4DUYB 1E1RG 2JGDB 2UXCB 4JTCB 1AP6A 1R6NA 1DF4A 1FAFA 4IHJA 1WB8A 3H1KH 2F1MA 2PY5A 2ZDIA 1LUWA 1SQQH 4U3FH 1N0JA 4GT1A 4K35A 4DR3B 1V55B 2EULA 1WA8B 4UVAA 4O2AA 3E8BA 3E89A 5C8YA 3OTOO 2ZINA 4TUYB 5B3SC 2WPDG 2YC0A 1HW7A 3ZMTA 2GTSA 3U0ZA 3T1CA 5B5EZ 4PI0A 3ZEDA 5KLVH 4EEQA 4K0KB 1AI4A 2Q69A 3NR7A 1HR0O 3HKDB 1PPJH 4B3SB 3HKEA 1FS0G 4N21A 3ABLC 3C3SA 1Y74A 5LMNB 5BMVB 1VIBA 4IL6Z 2AXTZ 1Z5VA 1LR1A 2EIMC 1XNQO 3UO2A 1R73A 3N2KA 4JYBA 4JI7B 1WN7A 5L3FA 4FIPC 1KKCA 3ZMUA 1KKDA 3CCJV 4DR6B 2AGAA 4DV5O 5BY1A 1P49A 3JCZA 1WAZA 3SR2C 1YJWV 4RAIA 2ZKOA 3U10A 1XI1A 4AI8A 2VWKA 4P9OA 1DF5A 2DN9A 3OMIB 4TSFG 5KHKA 3SYCA 2P7TC 2ZM6B 3WU2Z 3JARB 1EZJA 2ZIMA 2WLIB 5LHGA 4ZOLB 3FFQA 3JD0A 4DW1A 4YJ3A 4LFBO 3D3QA 4MVOA 1S72V 1JX9A 4X9QA 5EIBC 3RYHB 3SYQA 4DK0A 3TXSA 1YVWA 4RQEA 1OZ0A 4MW8A 1R3IC 4FVMA 4JI4O 3IC7A 1P7GA 1YI2V 4DV7B 2QR4A 3ABMB 2HVKC 1DK1A 3MDSA 3QG5A 4DV4B 3I55V 5KHGA 1BCCH 1SQFA 3T2MA 5KMGB 1CPYA 1NVPB 1GRJA 2Y0PA 1IBLB 1NTZH 3A2FA 3K9SA 3QO7A 4YIPA 1D5NA 4UCUA 4B3MB 4YY3O 4O2BB 2GUZA 1YJ9V 1RFYA 4F6RB 1RM1C 1NT2B 1PV0A 4K8XA 3WB2A 2R9IA 2E74B 3CJHB 4KXRA 2JDIG 3UKMA 1Z2GA 3VOUA 5EBWC 1FFXB 4ICGA 3OR6C 4PDMA 4FM2A 1HNWO 4J41A 4JI2O 5IYZA 1W2BU 3LDEA 4DK1A 4FZ0A 4B7EA 3J7AU 2Y4UA 5CBGA 2IJHA 2UXDB 2OCCC 3D8CA 3ABLB 1QVFU 4L8JA 4ZI7A 4UCSA 4ZKIA 1NKDA 4LR3A 3H9VA 3HPLC 2PI4A 1R3KC 5LXTA 4DV3O 3RN4A 3EVKA 3DXRB 5J2TB 1I0HA 5B1BC 2X7RB 1HNZB 2ITCC 3L75H 4JF3A 2PGGA 1Q8IA 2X6CA 1BE3H 3ZRSA 1AB3A 4ZIBA 4FFBB 1K73W 5CA0A 2ZNJA 3LSUA 4OXSA 2PI5A 4LFAB 2RDCA 3K3WA 2XHBA 1BQ0A 3B77A 2Q5ZA 2E5LB 1GM7A 3JASB 5KA6A 4PELA 1SRYA 5LOVB 3AG2C 4DR1B 4HAMA 1H2KA 1EBOA 4QPJA 1E79G 1U96A 4U3JA 1Y76A 1SS3A 3ZRXA 3CXHF 2EILB 2E76B 3ICXA 4GKJB 2X6BA 1D5AA 3S3XA 3EHBB 2IM9A 3K03A 4P9PA 3AK2A 4D6TH 1N8RW 4B3SO 3FYIB 2VRZA 5DN6G 1OCZB 3CC4V 1H2NA 4PI2A 3SGIA 2W6JG 1SQBH 3CCSV 4BR6A 1JJ2U 4QJFB 3G71V 3BPZA 5FPRA 3BRCA 2IJIA 2XTAA 2HEPA 3HR0A 4LCUC 1B3QA 1A32A 4O4IA 1BQZA 3LNNA 2Y48A 5GONA 4NYKA 1D2DA 3ZJZA 4LWSB 2Y0IA 5KA5A 1JA8A 4DV0O 1M57C 4ASUG 5KUKA 2BTQB 3OT7A 2NLJC 4B3TO 4I55B 2W0XA 4WFBV 4GLXA 1IBMB 5DEDA 1PL4A 5FNVB 1EN6A 2WLHA 4JI1O 3SPCA 1P7BA 3ABUA 3OM3B 3RYIB 2JGDA 1M56B 3E2EA 3W7XA 2LW1A 4DO2A 4Q20A 4MTFA 1YF2A 5KAIZ 4QIWF 5BXZA 3ABMC 1H38A 4O4JA 1URFA 2EIKB 4J9YB 5KHHA 2AHZA 1VQNV 5LYJB 4X1YA 1EZVH 3CS5A 3JATA 4JZGA 4DV7O 1XNRO 1OHHG 3NXSA 1OCOB 4JASA 4F4LA 4QGPA 2LO1A 2YXLA 1TA8A 3E22B 3JD4A 1H2MA 3E8FA 1PP9H 5J9PC 3WB0A 1WB7A 1I08A 4RQFA 1ZTEA 1Q6HA 4BIOA 1RM1B 4RUFA 2WLLB 4DUZO 4WCEV 2N04A 4PDLA 4YHHB 3N2GA 1H8EG 3HKEB 3MHSC 5JJJB 4PA6A 4WBNA 4I50A 4DW0A 1Q86W 1N0NA 1NU1H 4LF6O 1OCCB 3K0GA 5K1XA 3FB8C 4O4LA 1N34O 3CYOA 4W4LA 1GN2A 1E1QG 4DV5B 1MMMA 4LH6A 1FXHA 2DQ0A 4B3TB 4KP4A 1K97A 1O9HA 2QJ1A 1XNRB 1GN6A 5IJ9A 5LBQA 3UT5A 4LNUA 2KB1A 2KG7A 1GH6A 1TUBB 2XAHA 4LBEC 1VEWA 1TVKB 4DXWA 2XUMA 1KU9A 1FJGB 1TUEB 1X59A 4CBCA 1S76D 4JI0O 2ADQB 4D7SA 3WG7B 5J2UB 1QU7A 2DWEC 4J7ZA 3CMAV 1YJNV 5B1AB 1Y66A 1VQ9V 2JRIA 3ZHQA 3FB5C 5IDJA 3U11A 1GK9A 3OE7G 2ARHA 4MVZA 1IBMO 2QM7A 2WLMA 2MK3A 5BZBA 3FB7C 4H44B 3L73H 3L71H 2EILC 1SETA 4JZ2A 1FXKC 1JPXA 4DV2B 3M8AA 3OMNB 4BW5A 1J5EO 4DYLA 3E8GA 5LGTA 3DTUB 2EIJB 4KFMA 4X8AA 2Y69C 2A0LA 2YICA 3T1HO 2QWRB 4JYAB 1IVSA 1HNWB 3ZN0A 2JEXA 1ZWIC 5C93A 2ZM6O 1KC8W 3SJBC 2Z0AA 3JAMN 1H2LA 1FPOA 3CJHA 2E75B 3TK1A 1IXMA 1QLEC 4OX9O 1K34A 2K1EA 4JPRA 2NNUA 4YY3B 2K9PA 4MS2A 2HG5C 3UM7A 4NXMB 3E83A 1MZEA 2YI8A 4K8ZA 4OGQB 4MVSA 3T4DA 3ETGA 3LNMB 1QNMA 1P4RA 4X20B 1ZX3A 3AG1B 3LUTB 1N36O 1KMIZ 4CS3A 4DV6O 3HKDA 3F5TA 3IFXA 4HBNA 1GO3F 4B3MO 2RMKB 1WJZA 3ZX6A 3IAYA 3JALA 5E79Z 2N05A 4CC5A 5BMVA 4TQDA 2GBOA 1AR4A 1ROPA 3JD2A 2BSKB 3FAVA 4JV5O 3APOA 3B2EE 3JAKA 4DV2O 3WG7C 2E3CA 1VF6A 4UB6Z 4HNAB 4JI2B 4FLZA 1RSOA 4PA3A 1PNMA 4R8CA 1SZXA 4AILC 2VQEO 5EYPB 4FM0A 1VQKV 4IIJA 5B3SB 3ETDA 2ZR2A 2ZNIA 2RNBA 2IBZH 4KL1A 5FLXN 1US6A 3VQVA 4G27B 4UB8Z 2QWPB 4Z1MG 1KQSU 5ITZA 2XAGA 1YTFB 3N27A 3SYAA 1XILA 1WP7A 1NR1A 3K5MA 5TISZ 2PZSA 3MAQA 1Q43A 3I56V 2F95B 2GTAA 4QNHB 2P90A 2F23A 3RYHA 1HR0B 3SJCC 3CCQV 1AP5A 5CA1A 4CH3A 2EJ7A 1EN4A 5D5QA 4DR1O 1EN5A 2L35A 2ZCEA 4UCVA 2JK5C 3DC6A 4J80A 2ZT9B 2EZOA 2BTOA 1SQVH 5JQGA 4LFCB 5KMGA 3ETEA 1SQGA 1M1KW 4TV9B 3CD6V 1QR9A 2PTMA 1NI8A 1NTMH 2ZDIC 1XL6A 1KP3A 2ODMA 4X1IB 4H0LB 2VQFB 1RPRA 4R6ZA 4O4JB 3JAWB 4BWAA 3B8MA 4O4HB 3WB1A 5CBHA 3VQWA 5B1NA 2JEUA 1IBKO 2AZ2A 1PKXA 5IYCO 1NH2B 2Z3YA 4JAUA 1JCHA 5IYZB 1F7YA 2HFEC 4RUEA 4FJCC 4I4TB 3GWKC 3HKCA 3L74H 3CCMV 1YITV 3K5LA 3H1JH 1BGYH 4WFFA 2VWJA 1ZL8B 4NTYA 1AJNA 2KSDA 2DE0X 3K9AA 3CCLV 3GWOA 1EM1A 5LA6A 1SC5B 1JMKC 3SPIA 3STZC 4JYCA 4TV8B 3DXRA 2PUSA 1GMGA 4GX0A 1OCRB 2KKWA 3IC9A 2R9AA 3TGUH 1OCRC 4WBNB 2ZE5A 4DRXA 4JI3O 1GTOA 1JFFB 1V54C 4CH6A 2M7WA 3FD9A 2ZIOA 3OFNG 4TT3G 2QE7G 4EFEA 3ZN1A 4GX2A 4J42A 3AK3A 3BFRA 1KD1W 1HNXB 1PM9A 1EFRG 2IJJA 1TGOA 3UT5B 5EC2C 3ZHVA 4U3JB 3K79A 1XMQB 2ATKC 1MA1A 2UUCO 2Q8VA 3CRQA 1N33O 1F4NA 5H2FZ 1WPXA 4H33A 2UXCO 3H1HH 1MZFA 4LF6B 4I0XB 3SYPA 2CTQA 3OTFA 3T1YO 4J7JA 3WFVA 2F4VO 5B66Z 2Q68A 1HP8A 1NJIW 1HDJA 3K0DA 1S3JA 2YIBD 4CS4A 4I5SA 4GZRB 3CRCA 4UVCA 1XDCA 1M9NA 3T1HB 4WFHA 2JGUA 1YIJV 1BHBA 2E5LO 2FL4A 3K5NA 1G4YB 1NS1A 2MW2B 3G6BA 5K1PA 4BAYA 3ASNC 1WA8A 2V4DA 1SZTA 3A0RA 5LGNA 2Q6AA 2QM8A 1B6QA 3L70H 1M56C 1YHQV 1OCZC 2XT9A 2RJZA 2YI9A 1XNQB 2YUAA 3D36A 4PA7A 2O57A 1AR5A 1G6UA 2OTJV 1PNKA 3PN1A 1BMFG 4DV4O 5DM6V 1QHTA 1N32O 5H6RA 3FKSG 5CA3A 3B8NA 4YIOA 2Y69B 2ZE7A 4J7KA 3JD1A 4PV1B 4X1KA 3Q4HA 3OW2U 1UJWB 4Z2WA 1FFTB 3ZRWA 3RYFB 2OIEA 1KB9F 3RVZA 2DMXA 3CMEV 2DYSB 1RP3B 4EKWA 2YIAA 3APQA 2R9RB 2IH1C 4DR2O 4F6EA 4K3AA 4EB6B 4QE7A 1QLEB 2B5UA 3B40A 3JYCA 2EX3A 1JVMA 1HWYA 3L9DA 3VQYA 3CWBH 2QWOB 1N34B 4FMTA 1XBLA 4DV3B 1FXVA 4YJ2B 1WP8A 4MTXA 4B3RO 5JH7B 5KX5B 2LW7A 3B09A 1N32B 5CN0A 5JVDA 1K5SA 5D5PA 3JALB 2EIJC 2JJ1G 2VQEB 1H8HG 1JJOA 5GW7A 3QO5A 2PF4E 2EIKC 3CSXA 2DW4A 5F2VO 4J10A 2EINB 3OUSA 4X66O 1F51A 4CC6A 5CB4A 3W7SA 4XBFA 4NKGB 2FYUH 4JV5B 3DC5A 1K5QA 1KECA 2ADPA 3BAAA 2RQ6A 3FYEB 2A7WA 2CAZC 4JYYA 1RPOA 1V54B 3IJ4A 5LMUO 3K58A 4K0KO 2WSSG 1FJGO 4L87A 2XAQA 1UFIA 4JGSA 4LC1A 5B1OA 4UVBA 3ETQA 1R6TA 4GKKB 3F7VC 2DJVA 2KQXA 3AG1C 2QEXV 2YEVA 4XDKA 1I5YA 5BR8B 2HHHO 4FK5C 2QKSA 3S3WA 2EJRA 2H94A 5EK0A 3ZS8C 2CE4A 3ABKB 5EBLC 4NTXA 5KHIA 5BR8O 2JS3A 5JJEB 4AHCA 1Q3EA 3BA9A 1JQ0A 1K3EA 5C8YB 2XNDG 2FTKA 2GV9A 4TUYA 3QTCA 3STLC 2WLKA 2IW5A 4I7ZB 4D7TA 2UUBO 3A8TA 1AJQA 3O9OA 4FZ1A 3CXCU 4X1IA 1N4CA 4Q6GA 4BW9A 1NH2D 3HKBA 1IX9A 4UV8A 4JI0B 3MD0A 1R1BA 2NR5A 2Y4TA 2WLNA 3CCVV 5EIBD 3AG4B 4JI5B 1BZKA 3O65A 4I4TA 3HKCB 4IHJB 3F5WC 2A79B 3AG3B 4DR5B 4DV1B 4NXMO 3T1YB 1Q5OA 2GHYA 5IE9A 1Y76B 3QF7A 4FLYA 2PYJA 2W6IG 1XEQA 2WAMA 1FYJA 2CH7B 3BA8A 1AI7A 3KG2A 2XAJA 1XHXA 3OR7C 1M4UA 1NR7A 2DYSC 4ZOLA 2HHHB 2CTRA 1P84F 1YEWA 4RO2A 4DR3O 1IZ3A 3B4SA 2ZXWB 3R65A 5GTHZ 3G6EV 4X62O 4XDLA 2QKAA 3W7WA 4O4IB 4DR2B 1ZSPA 3JAKB 3QNEA 5GONB 4ABMA 1QVGU 1SKVA 1YSCA 2UU9O 4WF9V 1BSMA 4X65B 1F23A 4CZZA 5L3BA 3TJTA 4FFBA 4HZ3A 5CA0B 3BCCH 2XAFA 3P30A 3N2KB 1OCCC 5L3EA 3RBZA 1LNQA 3X2QB 1R6KA 4MTGA 4H13B 3UO3A 1VMGA 2QA4V 2V7QG 2P5OA 4GUNA 1XMOB 1GM9A 1QR8A 3OUFA 3SJAC 5KUMA 1Y6XA 1M90W 4LF7O 2Q0AA 3K04A 5KAFZ 3RVYA 2CGOA 2G38A 4BIUA 1QQCA 2ILMA 3ZCCA 2FKXA 1V55C 2QTOA 4CS2A 3ZHTA 2WLIA 2JJ2G 1R3LC 1I94B 1FFXA 2CDYA 3JATB 5CA1B 2VQFO 2LJ2A 1K4CC 3EXAA 2FB5A 1HNZO 4IT5A 5FL7G 2Q0OC 5EZYB 4P30A 1ZUQA 4X88A 3E22A 1SESA 4ZI7B 1VQ4V 5JJNB 1NVPD 5CMUA 3K59A 2HP8A 3ASOC 4B3RB 5EBMC 2B1IA 5LXTB 2WWWA 2IH3C 4MVQA 4XDJA 2QWNB 4LF4B 3LSSA 3AG3C 4GX1A 4AQYB 3G4SV 2VS0A 4X64B 3N2GB 1OV9A 3JAWA 4ZHQA 2JIZG 4I50B 4O4HA 3ZIAG 3CEIA 2GSMB 2W0FC 3JCUZ 3H1IH 4JAVA 4O4LB 4JI7O 3SPJA 4O2BA 4F6RA 1SERA 3C90A 3ZHSA 2ZR3A 2M6YA 5AG2A 1VF7A 2H8PC 2WLJA 3CRAA 4X1YB 4LFAO 3LDCA 5KHJA 3FX7A 1ORQC 2GDSA 1NQTA 3DSQA 4G2KA 5LA6B 3RWRD 3RGBA 1GKFA 5LP6A 3RYCA 3RW0A 5HFLA 1WNSA 2DWDC 3SDLA 3CPWU 1M93A 1NBMG 3SJQC 5J2UA 3MHHC 5LHHA 2HR3A 3ZMVA 1XHZA 1AR1B 5A2QN 1T5EA 4JI4B 4KUMA 4DRXB 4I9WA 2A3QA 1AI5A 1B06A 3CCEV 1X4TA 5J2TA 2LP7A 1IDSA 4MVRA 2DQ3A 2OTLV 3R66A 2HJFC 4FFKA 4DR7O 2Q7GA 2IU3A 4J11A 4TOIA 2QWQB 1W0JG 5IYBO 4FLWA 2YXHA 1FXKA 2RN9A 4GYCB 3CB2A 1YXBA 3ML0A 1OCOC 4FLXA 5JCOC 2ZQMA 1MSWD 4Z1VA 4DV6B 2BTQA 3A0BZ 1PL0A 1LUVA 3GVMA 1PD3A 3SPGA 4R7CA 5IJ0A 2P6JA 4DUZB 3THOA 3W7TA 3AG7A 1Q7YW 1TUBA 1H2SB 4PDVA 3E8HA 1S5HC 1VF6C 3KKYA 5IYDO 4JTAB 3BY6A 4MT8A 2CTWA 3CE2A 4DR5O 4OPHA 5L3DA 1O9GA 2QGNA 5H5NA 4JI6B 5LYJA 4X66B 2ITDC 1N36B 2EBOA 2YIDA 4HYOA 1Y67A 4IGGA 2OYQA 4FLUA 3J81N 4GCZA 2P22C 1XOUA 1QCEA 5E1AC 1VQ8V 5L3GA 5L3CA 2FMLA 2HVJC 4JI1B 2EIMB 2UUAO 4A5UB 2YXYA 5B1BB 2UXBB 2LGWA 1CP9A 1KYOF 3TETA 4FM1A 1IURA 2HJDA 1OJHA 4DV0B 4MVMA 3AK1A 4PA9A 4PHZA 1K4DC 3HKBB 4X1KB 5FPOA 1K7DA 5GTIZ 4LF8O 1VP7A 3JSLA 1YCIA 3RYIA 2BOBC 4UCRA 1NTKH 4IYHA 4U7NA 4DR4B 1GN4A 4E4EA 4AQYO 1AROP 1I7FA 4UFZA 2YDEA 4WFGA 2UUCB 3AG2B 4HNAA 1ZAUA 2QKCA 5H6QA 2JVDA 1Y74B 3ASNB 4FPPA 5LMUB 2AHYA 1DLBA 3H01A 4PJ0Z 1VQMV 2OT5A 3P3PA 1MG1A 3IGAC 3PJSK 4LF9O 2H3OA 4QE9A 3TXQA 3E35A
chains in the Genus database with same CATH topology
2QDOA 2Q8VA 1OJHA 3CS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDO A;  2Q8V A;  1OJH A;  3CS5 A; 
#chains in the Genus database with same CATH topology
 1VQP V;  1Q81 W;  4X20 A;  3ZMZ A;  2Q7H A;  2PYL A;  3I5D A;  4B08 A;  3AEI A;  3EFF K;  4JAA A;  4WFA V;  3CHX A;  4JI6 O;  4DR6 O;  2WA3 A;  2QTS A;  4X89 A;  3JAR A;  3OMA B;  3ZHU A;  2WLL A;  3UCS C;  3ZMS A;  2R70 A;  2P4K A;  2ZXW C;  3F7Y C;  2D2C B;  5JCO A;  4LFB B;  5CBF A;  3JSN A;  4OX9 B;  1K33 A;  1BT8 A;  5LMN O;  4TWK A;  5LL6 Y;  2F4V B;  4U7O A;  3G67 A;  2YSU B;  2OWO A;  2CTP A;  5IY5 C;  1JOY A;  2IU0 A;  2CGN A;  3DGE A;  4LNU B;  1IBK B;  4JI8 O;  1JR9 A;  2CK3 G;  1XMQ O;  4UUJ C;  3K06 A;  1SA0 A;  5DEC A;  3G80 A;  5ITZ B;  3CCR V;  3KCY A;  2EIN C;  4NB5 A;  4DR7 B;  2OCH A;  3BVO A;  2YEV B;  1K9M W;  3M7M X;  4CH5 A;  1WLE A;  2Q7E A;  4UCO A;  4YHH O;  1HNX O;  1S77 D;  5H9C A;  4UXN A;  1K92 A;  1VQ6 V;  3CRR A;  4JTD B;  2QSA A;  1XMO O;  5EZY A;  4FLV A;  1J95 A;  3VQX A;  4W4K A;  4WFE A;  2AZ0 A;  4MSW C;  1IBL O;  3CC7 V;  5B1A C;  1BS3 A;  4JI3 B;  2OIG A;  2Q67 A;  3ZBH A;  1YDX A;  2JS5 A;  2B9Z A;  2F66 C;  4QPK A;  2Q9L A;  3GB7 C;  5IWA B;  1GAX A;  2UUB B;  2UU9 B;  4O2A B;  2NN4 A;  4NTW A;  4LH7 A;  2DOS A;  4JI5 O;  3J80 N;  3X2Q C;  4ZHQ B;  2QDO A;  4MW3 A;  1IXB A;  3ASO B;  4KHP B;  3L72 H;  4N23 A;  2ZD9 A;  4H37 A;  2ETN A;  2BSK A;  3FAV B;  4UV9 A;  2UXB O;  2Q4P A;  4NR1 A;  1GN3 A;  1I5X A;  2RCV A;  4TQF A;  1G1X B;  4EFB A;  3ABK C;  2R72 A;  1W59 A;  4JYA O;  4MVU A;  1M5I A;  2V1D A;  4CH4 A;  1RSO B;  3H1L H;  1KBH A;  4R50 A;  4NVP A;  1ENV A;  3RFR A;  2L6L A;  5LP6 B;  1BL8 A;  5EYP A;  3RYC B;  4IIJ B;  3K5O A;  4KHP O;  2CH7 A;  5LP6 C;  1K8A W;  3JAS A;  2X0L A;  1M57 B;  1L1F A;  1FKA O;  1VF5 B;  2CUG A;  5LOV A;  4PA4 A;  4LF5 B;  1VQ5 V;  4DUY O;  1QLN A;  1V9P A;  4TV8 A;  3D3I A;  1J5E B;  4RWU A;  5EC1 C;  3D36 C;  1Y4M A;  3CRM A;  4BIZ A;  3UQ8 A;  4GKK O;  1KUQ A;  4I9Q A;  1COW G;  1VAR A;  1MOF A;  3E86 A;  3BEH A;  2LQT A;  2ZE8 A;  1FXK B;  1L0N H;  5IY5 B;  2YIB A;  4DV1 O;  2HLD G;  3T4Z A;  3QVN A;  4YJ3 B;  3CCU V;  4PD4 F;  4IYI A;  2B1G A;  1FD9 A;  1VQ7 V;  1L8D A;  3HB3 B;  1L0L H;  2P4V A;  2Z5U A;  5JQG B;  3FB6 C;  3LSQ A;  4X64 O;  4TV9 A;  4I55 A;  4LF5 O;  4NXN B;  3ZRV A;  1Q6I A;  5FNV A;  2DYR B;  1CXZ B;  3M99 B;  1SQP H;  2A06 H;  4X62 B;  2DYR C;  2WA4 A;  3ABT A;  2XOK G;  3ZRW B;  1SF9 A;  1XL4 A;  3K08 A;  1ZLZ A;  2Q73 A;  2F43 G;  3P3N A;  1AI6 A;  1F4M A;  4E2L A;  1N33 B;  3LDD A;  2UXX A;  1THZ A;  2GUZ B;  3CX5 F;  2BOC C;  2ZE6 A;  3OEH G;  4EB6 A;  3JD3 A;  5JWP A;  3SYO A;  2UUA B;  1S5L Z;  1DTO A;  3W7U A;  1XRE A;  3BAB A;  3QO8 A;  1AVM A;  4OPA A;  5A9G A;  2XAS A;  2C2A A;  2BCC H;  2OCC B;  1VQL V;  3ZHR A;  4GX5 A;  3RT3 C;  1S5J A;  2A9H A;  4NXN O;  3A0H Z;  1G8M A;  1AJP A;  1JFF A;  5LGU A;  1WPB A;  3C3T A;  3OTO B;  2BE3 A;  2HKO A;  1BHA A;  1DGS A;  3OAA G;  1SQX H;  1NZ6 A;  3BHP A;  4J9Z B;  3RYF A;  3P32 A;  4FLT A;  4LF7 B;  3OEE G;  4LF9 B;  2LGQ A;  3VBB A;  4DR4 O;  4LP8 A;  2UXN A;  1UPG A;  3CP1 A;  1U97 A;  1XQ8 A;  5IJ9 B;  2N74 A;  3KZI Z;  3OD4 A;  1ZL8 A;  2IJK A;  4LF4 O;  4JI8 B;  1TAE A;  2KG7 B;  5IT9 N;  1MSD A;  1TVK A;  1GM8 A;  3KCX A;  1MNG A;  2EZP A;  4YJ2 A;  1B04 A;  5JH7 A;  1VQO V;  5KX5 A;  4LF8 B;  4B7K A;  2X6A A;  1W0K G;  4MTO A;  2UXD O;  1QBZ A;  2LFR A;  5LHI A;  4YXW G;  5JVD B;  3SPH A;  1R3J C;  5HFM A;  3K57 A;  4ZBM A;  2D3O W;  2QM4 A;  4LFC O;  1Q82 W;  1H2G A;  3TCU A;  5IWA O;  4UCT A;  1I94 O;  3CC2 V;  4C7U A;  4GKJ O;  2P67 A;  2AW9 A;  5CB4 B;  4G28 B;  2YS8 A;  1YTF D;  1AIL A;  4P2Z A;  1S0V A;  1YZB A;  3OGC C;  5IJ0 B;  4X65 O;  1KP2 A;  4LWS A;  2P06 A;  4PDR A;  1Z5W A;  3AG4 C;  2F93 B;  2LFS A;  1SA0 B;  1XUQ A;  1PNL A;  3OGI B;  1CEZ A;  1Q6U A;  1MAB G;  3Q4H B;  4I0X A;  1Q90 D;  4DUY B;  1E1R G;  2JGD B;  2UXC B;  4JTC B;  1AP6 A;  1R6N A;  1DF4 A;  1FAF A;  4IHJ A;  1WB8 A;  3H1K H;  2F1M A;  2PY5 A;  2ZDI A;  1LUW A;  1SQQ H;  4U3F H;  1N0J A;  4GT1 A;  4K35 A;  4DR3 B;  1V55 B;  2EUL A;  1WA8 B;  4UVA A;  4O2A A;  3E8B A;  3E89 A;  5C8Y A;  3OTO O;  2ZIN A;  4TUY B;  5B3S C;  2WPD G;  2YC0 A;  1HW7 A;  3ZMT A;  2GTS A;  3U0Z A;  3T1C A;  5B5E Z;  4PI0 A;  3ZED A;  5KLV H;  4EEQ A;  4K0K B;  1AI4 A;  2Q69 A;  3NR7 A;  1HR0 O;  3HKD B;  1PPJ H;  4B3S B;  3HKE A;  1FS0 G;  4N21 A;  3ABL C;  3C3S A;  1Y74 A;  5LMN B;  5BMV B;  1VIB A;  4IL6 Z;  2AXT Z;  1Z5V A;  1LR1 A;  2EIM C;  1XNQ O;  3UO2 A;  1R73 A;  3N2K A;  4JYB A;  4JI7 B;  1WN7 A;  5L3F A;  4FIP C;  1KKC A;  3ZMU A;  1KKD A;  3CCJ V;  4DR6 B;  2AGA A;  4DV5 O;  5BY1 A;  1P49 A;  3JCZ A;  1WAZ A;  3SR2 C;  1YJW V;  4RAI A;  2ZKO A;  3U10 A;  1XI1 A;  4AI8 A;  2VWK A;  4P9O A;  1DF5 A;  2DN9 A;  3OMI B;  4TSF G;  5KHK A;  3SYC A;  2P7T C;  2ZM6 B;  3WU2 Z;  3JAR B;  1EZJ A;  2ZIM A;  2WLI B;  5LHG A;  4ZOL B;  3FFQ A;  3JD0 A;  4DW1 A;  4YJ3 A;  4LFB O;  3D3Q A;  4MVO A;  1S72 V;  1JX9 A;  4X9Q A;  5EIB C;  3RYH B;  3SYQ A;  4DK0 A;  3TXS A;  1YVW A;  4RQE A;  1OZ0 A;  4MW8 A;  1R3I C;  4FVM A;  4JI4 O;  3IC7 A;  1P7G A;  1YI2 V;  4DV7 B;  2QR4 A;  3ABM B;  2HVK C;  1DK1 A;  3MDS A;  3QG5 A;  4DV4 B;  3I55 V;  5KHG A;  1BCC H;  1SQF A;  3T2M A;  5KMG B;  1CPY A;  1NVP B;  1GRJ A;  2Y0P A;  1IBL B;  1NTZ H;  3A2F A;  3K9S A;  3QO7 A;  4YIP A;  1D5N A;  4UCU A;  4B3M B;  4YY3 O;  4O2B B;  2GUZ A;  1YJ9 V;  1RFY A;  4F6R B;  1RM1 C;  1NT2 B;  1PV0 A;  4K8X A;  3WB2 A;  2R9I A;  2E74 B;  3CJH B;  4KXR A;  2JDI G;  3UKM A;  1Z2G A;  3VOU A;  5EBW C;  1FFX B;  4ICG A;  3OR6 C;  4PDM A;  4FM2 A;  1HNW O;  4J41 A;  4JI2 O;  5IYZ A;  1W2B U;  3LDE A;  4DK1 A;  4FZ0 A;  4B7E A;  3J7A U;  2Y4U A;  5CBG A;  2IJH A;  2UXD B;  2OCC C;  3D8C A;  3ABL B;  1QVF U;  4L8J A;  4ZI7 A;  4UCS A;  4ZKI A;  1NKD A;  4LR3 A;  3H9V A;  3HPL C;  2PI4 A;  1R3K C;  5LXT A;  4DV3 O;  3RN4 A;  3EVK A;  3DXR B;  5J2T B;  1I0H A;  5B1B C;  2X7R B;  1HNZ B;  2ITC C;  3L75 H;  4JF3 A;  2PGG A;  1Q8I A;  2X6C A;  1BE3 H;  3ZRS A;  1AB3 A;  4ZIB A;  4FFB B;  1K73 W;  5CA0 A;  2ZNJ A;  3LSU A;  4OXS A;  2PI5 A;  4LFA B;  2RDC A;  3K3W A;  2XHB A;  1BQ0 A;  3B77 A;  2Q5Z A;  2E5L B;  1GM7 A;  3JAS B;  5KA6 A;  4PEL A;  1SRY A;  5LOV B;  3AG2 C;  4DR1 B;  4HAM A;  1H2K A;  1EBO A;  4QPJ A;  1E79 G;  1U96 A;  4U3J A;  1Y76 A;  1SS3 A;  3ZRX A;  3CXH F;  2EIL B;  2E76 B;  3ICX A;  4GKJ B;  2X6B A;  1D5A A;  3S3X A;  3EHB B;  2IM9 A;  3K03 A;  4P9P A;  3AK2 A;  4D6T H;  1N8R W;  4B3S O;  3FYI B;  2VRZ A;  5DN6 G;  1OCZ B;  3CC4 V;  1H2N A;  4PI2 A;  3SGI A;  2W6J G;  1SQB H;  3CCS V;  4BR6 A;  1JJ2 U;  4QJF B;  3G71 V;  3BPZ A;  5FPR A;  3BRC A;  2IJI A;  2XTA A;  2HEP A;  3HR0 A;  4LCU C;  1B3Q A;  1A32 A;  4O4I A;  1BQZ A;  3LNN A;  2Y48 A;  5GON A;  4NYK A;  1D2D A;  3ZJZ A;  4LWS B;  2Y0I A;  5KA5 A;  1JA8 A;  4DV0 O;  1M57 C;  4ASU G;  5KUK A;  2BTQ B;  3OT7 A;  2NLJ C;  4B3T O;  4I55 B;  2W0X A;  4WFB V;  4GLX A;  1IBM B;  5DED A;  1PL4 A;  5FNV B;  1EN6 A;  2WLH A;  4JI1 O;  3SPC A;  1P7B A;  3ABU A;  3OM3 B;  3RYI B;  2JGD A;  1M56 B;  3E2E A;  3W7X A;  2LW1 A;  4DO2 A;  4Q20 A;  4MTF A;  1YF2 A;  5KAI Z;  4QIW F;  5BXZ A;  3ABM C;  1H38 A;  4O4J A;  1URF A;  2EIK B;  4J9Y B;  5KHH A;  2AHZ A;  1VQN V;  5LYJ B;  4X1Y A;  1EZV H;  3CS5 A;  3JAT A;  4JZG A;  4DV7 O;  1XNR O;  1OHH G;  3NXS A;  1OCO B;  4JAS A;  4F4L A;  4QGP A;  2LO1 A;  2YXL A;  1TA8 A;  3E22 B;  3JD4 A;  1H2M A;  3E8F A;  1PP9 H;  5J9P C;  3WB0 A;  1WB7 A;  1I08 A;  4RQF A;  1ZTE A;  1Q6H A;  4BIO A;  1RM1 B;  4RUF A;  2WLL B;  4DUZ O;  4WCE V;  2N04 A;  4PDL A;  4YHH B;  3N2G A;  1H8E G;  3HKE B;  3MHS C;  5JJJ B;  4PA6 A;  4WBN A;  4I50 A;  4DW0 A;  1Q86 W;  1N0N A;  1NU1 H;  4LF6 O;  1OCC B;  3K0G A;  5K1X A;  3FB8 C;  4O4L A;  1N34 O;  3CYO A;  4W4L A;  1GN2 A;  1E1Q G;  4DV5 B;  1MMM A;  4LH6 A;  1FXH A;  2DQ0 A;  4B3T B;  4KP4 A;  1K97 A;  1O9H A;  2QJ1 A;  1XNR B;  1GN6 A;  5IJ9 A;  5LBQ A;  3UT5 A;  4LNU A;  2KB1 A;  2KG7 A;  1GH6 A;  1TUB B;  2XAH A;  4LBE C;  1VEW A;  1TVK B;  4DXW A;  2XUM A;  1KU9 A;  1FJG B;  1TUE B;  1X59 A;  4CBC A;  1S76 D;  4JI0 O;  2ADQ B;  4D7S A;  3WG7 B;  5J2U B;  1QU7 A;  2DWE C;  4J7Z A;  3CMA V;  1YJN V;  5B1A B;  1Y66 A;  1VQ9 V;  2JRI A;  3ZHQ A;  3FB5 C;  5IDJ A;  3U11 A;  1GK9 A;  3OE7 G;  2ARH A;  4MVZ A;  1IBM O;  2QM7 A;  2WLM A;  2MK3 A;  5BZB A;  3FB7 C;  4H44 B;  3L73 H;  3L71 H;  2EIL C;  1SET A;  4JZ2 A;  1FXK C;  1JPX A;  4DV2 B;  3M8A A;  3OMN B;  4BW5 A;  1J5E O;  4DYL A;  3E8G A;  5LGT A;  3DTU B;  2EIJ B;  4KFM A;  4X8A A;  2Y69 C;  2A0L A;  2YIC A;  3T1H O;  2QWR B;  4JYA B;  1IVS A;  1HNW B;  3ZN0 A;  2JEX A;  1ZWI C;  5C93 A;  2ZM6 O;  1KC8 W;  3SJB C;  2Z0A A;  3JAM N;  1H2L A;  1FPO A;  3CJH A;  2E75 B;  3TK1 A;  1IXM A;  1QLE C;  4OX9 O;  1K34 A;  2K1E A;  4JPR A;  2NNU A;  4YY3 B;  2K9P A;  4MS2 A;  2HG5 C;  3UM7 A;  4NXM B;  3E83 A;  1MZE A;  2YI8 A;  4K8Z A;  4OGQ B;  4MVS A;  3T4D A;  3ETG A;  3LNM B;  1QNM A;  1P4R A;  4X20 B;  1ZX3 A;  3AG1 B;  3LUT B;  1N36 O;  1KMI Z;  4CS3 A;  4DV6 O;  3HKD A;  3F5T A;  3IFX A;  4HBN A;  1GO3 F;  4B3M O;  2RMK B;  1WJZ A;  3ZX6 A;  3IAY A;  3JAL A;  5E79 Z;  2N05 A;  4CC5 A;  5BMV A;  4TQD A;  2GBO A;  1AR4 A;  1ROP A;  3JD2 A;  2BSK B;  3FAV A;  4JV5 O;  3APO A;  3B2E E;  3JAK A;  4DV2 O;  3WG7 C;  2E3C A;  1VF6 A;  4UB6 Z;  4HNA B;  4JI2 B;  4FLZ A;  1RSO A;  4PA3 A;  1PNM A;  4R8C A;  1SZX A;  4AIL C;  2VQE O;  5EYP B;  4FM0 A;  1VQK V;  4IIJ A;  5B3S B;  3ETD A;  2ZR2 A;  2ZNI A;  2RNB A;  2IBZ H;  4KL1 A;  5FLX N;  1US6 A;  3VQV A;  4G27 B;  4UB8 Z;  2QWP B;  4Z1M G;  1KQS U;  5ITZ A;  2XAG A;  1YTF B;  3N27 A;  3SYA A;  1XIL A;  1WP7 A;  1NR1 A;  3K5M A;  5TIS Z;  2PZS A;  3MAQ A;  1Q43 A;  3I56 V;  2F95 B;  2GTA A;  4QNH B;  2P90 A;  2F23 A;  3RYH A;  1HR0 B;  3SJC C;  3CCQ V;  1AP5 A;  5CA1 A;  4CH3 A;  2EJ7 A;  1EN4 A;  5D5Q A;  4DR1 O;  1EN5 A;  2L35 A;  2ZCE A;  4UCV A;  2JK5 C;  3DC6 A;  4J80 A;  2ZT9 B;  2EZO A;  2BTO A;  1SQV H;  5JQG A;  4LFC B;  5KMG A;  3ETE A;  1SQG A;  1M1K W;  4TV9 B;  3CD6 V;  1QR9 A;  2PTM A;  1NI8 A;  1NTM H;  2ZDI C;  1XL6 A;  1KP3 A;  2ODM A;  4X1I B;  4H0L B;  2VQF B;  1RPR A;  4R6Z A;  4O4J B;  3JAW B;  4BWA A;  3B8M A;  4O4H B;  3WB1 A;  5CBH A;  3VQW A;  5B1N A;  2JEU A;  1IBK O;  2AZ2 A;  1PKX A;  5IYC O;  1NH2 B;  2Z3Y A;  4JAU A;  1JCH A;  5IYZ B;  1F7Y A;  2HFE C;  4RUE A;  4FJC C;  4I4T B;  3GWK C;  3HKC A;  3L74 H;  3CCM V;  1YIT V;  3K5L A;  3H1J H;  1BGY H;  4WFF A;  2VWJ A;  1ZL8 B;  4NTY A;  1AJN A;  2KSD A;  2DE0 X;  3K9A A;  3CCL V;  3GWO A;  1EM1 A;  5LA6 A;  1SC5 B;  1JMK C;  3SPI A;  3STZ C;  4JYC A;  4TV8 B;  3DXR A;  2PUS A;  1GMG A;  4GX0 A;  1OCR B;  2KKW A;  3IC9 A;  2R9A A;  3TGU H;  1OCR C;  4WBN B;  2ZE5 A;  4DRX A;  4JI3 O;  1GTO A;  1JFF B;  1V54 C;  4CH6 A;  2M7W A;  3FD9 A;  2ZIO A;  3OFN G;  4TT3 G;  2QE7 G;  4EFE A;  3ZN1 A;  4GX2 A;  4J42 A;  3AK3 A;  3BFR A;  1KD1 W;  1HNX B;  1PM9 A;  1EFR G;  2IJJ A;  1TGO A;  3UT5 B;  5EC2 C;  3ZHV A;  4U3J B;  3K79 A;  1XMQ B;  2ATK C;  1MA1 A;  2UUC O;  2Q8V A;  3CRQ A;  1N33 O;  1F4N A;  5H2F Z;  1WPX A;  4H33 A;  2UXC O;  3H1H H;  1MZF A;  4LF6 B;  4I0X B;  3SYP A;  2CTQ A;  3OTF A;  3T1Y O;  4J7J A;  3WFV A;  2F4V O;  5B66 Z;  2Q68 A;  1HP8 A;  1NJI W;  1HDJ A;  3K0D A;  1S3J A;  2YIB D;  4CS4 A;  4I5S A;  4GZR B;  3CRC A;  4UVC A;  1XDC A;  1M9N A;  3T1H B;  4WFH A;  2JGU A;  1YIJ V;  1BHB A;  2E5L O;  2FL4 A;  3K5N A;  1G4Y B;  1NS1 A;  2MW2 B;  3G6B A;  5K1P A;  4BAY A;  3ASN C;  1WA8 A;  2V4D A;  1SZT A;  3A0R A;  5LGN A;  2Q6A A;  2QM8 A;  1B6Q A;  3L70 H;  1M56 C;  1YHQ V;  1OCZ C;  2XT9 A;  2RJZ A;  2YI9 A;  1XNQ B;  2YUA A;  3D36 A;  4PA7 A;  2O57 A;  1AR5 A;  1G6U A;  2OTJ V;  1PNK A;  3PN1 A;  1BMF G;  4DV4 O;  5DM6 V;  1QHT A;  1N32 O;  5H6R A;  3FKS G;  5CA3 A;  3B8N A;  4YIO A;  2Y69 B;  2ZE7 A;  4J7K A;  3JD1 A;  4PV1 B;  4X1K A;  3Q4H A;  3OW2 U;  1UJW B;  4Z2W A;  1FFT B;  3ZRW A;  3RYF B;  2OIE A;  1KB9 F;  3RVZ A;  2DMX A;  3CME V;  2DYS B;  1RP3 B;  4EKW A;  2YIA A;  3APQ A;  2R9R B;  2IH1 C;  4DR2 O;  4F6E A;  4K3A A;  4EB6 B;  4QE7 A;  1QLE B;  2B5U A;  3B40 A;  3JYC A;  2EX3 A;  1JVM A;  1HWY A;  3L9D A;  3VQY A;  3CWB H;  2QWO B;  1N34 B;  4FMT A;  1XBL A;  4DV3 B;  1FXV A;  4YJ2 B;  1WP8 A;  4MTX A;  4B3R O;  5JH7 B;  5KX5 B;  2LW7 A;  3B09 A;  1N32 B;  5CN0 A;  5JVD A;  1K5S A;  5D5P A;  3JAL B;  2EIJ C;  2JJ1 G;  2VQE B;  1H8H G;  1JJO A;  5GW7 A;  3QO5 A;  2PF4 E;  2EIK C;  3CSX A;  2DW4 A;  5F2V O;  4J10 A;  2EIN B;  3OUS A;  4X66 O;  1F51 A;  4CC6 A;  5CB4 A;  3W7S A;  4XBF A;  4NKG B;  2FYU H;  4JV5 B;  3DC5 A;  1K5Q A;  1KEC A;  2ADP A;  3BAA A;  2RQ6 A;  3FYE B;  2A7W A;  2CAZ C;  4JYY A;  1RPO A;  1V54 B;  3IJ4 A;  5LMU O;  3K58 A;  4K0K O;  2WSS G;  1FJG O;  4L87 A;  2XAQ A;  1UFI A;  4JGS A;  4LC1 A;  5B1O A;  4UVB A;  3ETQ A;  1R6T A;  4GKK B;  3F7V C;  2DJV A;  2KQX A;  3AG1 C;  2QEX V;  2YEV A;  4XDK A;  1I5Y A;  5BR8 B;  2HHH O;  4FK5 C;  2QKS A;  3S3W A;  2EJR A;  2H94 A;  5EK0 A;  3ZS8 C;  2CE4 A;  3ABK B;  5EBL C;  4NTX A;  5KHI A;  5BR8 O;  2JS3 A;  5JJE B;  4AHC A;  1Q3E A;  3BA9 A;  1JQ0 A;  1K3E A;  5C8Y B;  2XND G;  2FTK A;  2GV9 A;  4TUY A;  3QTC A;  3STL C;  2WLK A;  2IW5 A;  4I7Z B;  4D7T A;  2UUB O;  3A8T A;  1AJQ A;  3O9O A;  4FZ1 A;  3CXC U;  4X1I A;  1N4C A;  4Q6G A;  4BW9 A;  1NH2 D;  3HKB A;  1IX9 A;  4UV8 A;  4JI0 B;  3MD0 A;  1R1B A;  2NR5 A;  2Y4T A;  2WLN A;  3CCV V;  5EIB D;  3AG4 B;  4JI5 B;  1BZK A;  3O65 A;  4I4T A;  3HKC B;  4IHJ B;  3F5W C;  2A79 B;  3AG3 B;  4DR5 B;  4DV1 B;  4NXM O;  3T1Y B;  1Q5O A;  2GHY A;  5IE9 A;  1Y76 B;  3QF7 A;  4FLY A;  2PYJ A;  2W6I G;  1XEQ A;  2WAM A;  1FYJ A;  2CH7 B;  3BA8 A;  1AI7 A;  3KG2 A;  2XAJ A;  1XHX A;  3OR7 C;  1M4U A;  1NR7 A;  2DYS C;  4ZOL A;  2HHH B;  2CTR A;  1P84 F;  1YEW A;  4RO2 A;  4DR3 O;  1IZ3 A;  3B4S A;  2ZXW B;  3R65 A;  5GTH Z;  3G6E V;  4X62 O;  4XDL A;  2QKA A;  3W7W A;  4O4I B;  4DR2 B;  1ZSP A;  3JAK B;  3QNE A;  5GON B;  4ABM A;  1QVG U;  1SKV A;  1YSC A;  2UU9 O;  4WF9 V;  1BSM A;  4X65 B;  1F23 A;  4CZZ A;  5L3B A;  3TJT A;  4FFB A;  4HZ3 A;  5CA0 B;  3BCC H;  2XAF A;  3P30 A;  3N2K B;  1OCC C;  5L3E A;  3RBZ A;  1LNQ A;  3X2Q B;  1R6K A;  4MTG A;  4H13 B;  3UO3 A;  1VMG A;  2QA4 V;  2V7Q G;  2P5O A;  4GUN A;  1XMO B;  1GM9 A;  1QR8 A;  3OUF A;  3SJA C;  5KUM A;  1Y6X A;  1M90 W;  4LF7 O;  2Q0A A;  3K04 A;  5KAF Z;  3RVY A;  2CGO A;  2G38 A;  4BIU A;  1QQC A;  2ILM A;  3ZCC A;  2FKX A;  1V55 C;  2QTO A;  4CS2 A;  3ZHT A;  2WLI A;  2JJ2 G;  1R3L C;  1I94 B;  1FFX A;  2CDY A;  3JAT B;  5CA1 B;  2VQF O;  2LJ2 A;  1K4C C;  3EXA A;  2FB5 A;  1HNZ O;  4IT5 A;  5FL7 G;  2Q0O C;  5EZY B;  4P30 A;  1ZUQ A;  4X88 A;  3E22 A;  1SES A;  4ZI7 B;  1VQ4 V;  5JJN B;  1NVP D;  5CMU A;  3K59 A;  2HP8 A;  3ASO C;  4B3R B;  5EBM C;  2B1I A;  5LXT B;  2WWW A;  2IH3 C;  4MVQ A;  4XDJ A;  2QWN B;  4LF4 B;  3LSS A;  3AG3 C;  4GX1 A;  4AQY B;  3G4S V;  2VS0 A;  4X64 B;  3N2G B;  1OV9 A;  3JAW A;  4ZHQ A;  2JIZ G;  4I50 B;  4O4H A;  3ZIA G;  3CEI A;  2GSM B;  2W0F C;  3JCU Z;  3H1I H;  4JAV A;  4O4L B;  4JI7 O;  3SPJ A;  4O2B A;  4F6R A;  1SER A;  3C90 A;  3ZHS A;  2ZR3 A;  2M6Y A;  5AG2 A;  1VF7 A;  2H8P C;  2WLJ A;  3CRA A;  4X1Y B;  4LFA O;  3LDC A;  5KHJ A;  3FX7 A;  1ORQ C;  2GDS A;  1NQT A;  3DSQ A;  4G2K A;  5LA6 B;  3RWR D;  3RGB A;  1GKF A;  5LP6 A;  3RYC A;  3RW0 A;  5HFL A;  1WNS A;  2DWD C;  3SDL A;  3CPW U;  1M93 A;  1NBM G;  3SJQ C;  5J2U A;  3MHH C;  5LHH A;  2HR3 A;  3ZMV A;  1XHZ A;  1AR1 B;  5A2Q N;  1T5E A;  4JI4 B;  4KUM A;  4DRX B;  4I9W A;  2A3Q A;  1AI5 A;  1B06 A;  3CCE V;  1X4T A;  5J2T A;  2LP7 A;  1IDS A;  4MVR A;  2DQ3 A;  2OTL V;  3R66 A;  2HJF C;  4FFK A;  4DR7 O;  2Q7G A;  2IU3 A;  4J11 A;  4TOI A;  2QWQ B;  1W0J G;  5IYB O;  4FLW A;  2YXH A;  1FXK A;  2RN9 A;  4GYC B;  3CB2 A;  1YXB A;  3ML0 A;  1OCO C;  4FLX A;  5JCO C;  2ZQM A;  1MSW D;  4Z1V A;  4DV6 B;  2BTQ A;  3A0B Z;  1PL0 A;  1LUV A;  3GVM A;  1PD3 A;  3SPG A;  4R7C A;  5IJ0 A;  2P6J A;  4DUZ B;  3THO A;  3W7T A;  3AG7 A;  1Q7Y W;  1TUB A;  1H2S B;  4PDV A;  3E8H A;  1S5H C;  1VF6 C;  3KKY A;  5IYD O;  4JTA B;  3BY6 A;  4MT8 A;  2CTW A;  3CE2 A;  4DR5 O;  4OPH A;  5L3D A;  1O9G A;  2QGN A;  5H5N A;  4JI6 B;  5LYJ A;  4X66 B;  2ITD C;  1N36 B;  2EBO A;  2YID A;  4HYO A;  1Y67 A;  4IGG A;  2OYQ A;  4FLU A;  3J81 N;  4GCZ A;  2P22 C;  1XOU A;  1QCE A;  5E1A C;  1VQ8 V;  5L3G A;  5L3C A;  2FML A;  2HVJ C;  4JI1 B;  2EIM B;  2UUA O;  4A5U B;  2YXY A;  5B1B B;  2UXB B;  2LGW A;  1CP9 A;  1KYO F;  3TET A;  4FM1 A;  1IUR A;  2HJD A;  1OJH A;  4DV0 B;  4MVM A;  3AK1 A;  4PA9 A;  4PHZ A;  1K4D C;  3HKB B;  4X1K B;  5FPO A;  1K7D A;  5GTI Z;  4LF8 O;  1VP7 A;  3JSL A;  1YCI A;  3RYI A;  2BOB C;  4UCR A;  1NTK H;  4IYH A;  4U7N A;  4DR4 B;  1GN4 A;  4E4E A;  4AQY O;  1ARO P;  1I7F A;  4UFZ A;  2YDE A;  4WFG A;  2UUC B;  3AG2 B;  4HNA A;  1ZAU A;  2QKC A;  5H6Q A;  2JVD A;  1Y74 B;  3ASN B;  4FPP A;  5LMU B;  2AHY A;  1DLB A;  3H01 A;  4PJ0 Z;  1VQM V;  2OT5 A;  3P3P A;  1MG1 A;  3IGA C;  3PJS K;  4LF9 O;  2H3O A;  4QE9 A;  3TXQ A;  3E35 A; 
#chains in the Genus database with same CATH homology
 2QDO A;  2Q8V A;  1OJH A;  3CS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...