2Q8VA

Nbla protein from t. vulcanus crystallized with urea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
LNVDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NblA protein
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Thermosynechococcus vulcanus
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2q8vA00
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH superfamily
4PDLA 4KFMA 1Q43A 2KB1A 4YHHO 4FVMA 1RSOA 4UV9A 2L35A 1F7YA 3B8MA 3ZHVA 5K1PA 3J80N 2WSSG 1MSDA 2Q0AA 3HKBA 3ZHQA 2WLJA 3ICXA 1V55B 1LR1A 1KB9F 4YJ3B 4E4EA 1M56C 1S76D 5LYJB 5L3CA 2LW1A 3CP1A 4PA3A 4K3AA 4FLXA 2HLDG 1ZL8B 2Q69A 1AB3A 1V55C 1EM1A 1U96A 2YC0A 1IBMO 1N34B 2QWOB 4X89A 4HNAA 2PUSA 3JATA 1NVPB 3THOA 4ASUG 2YDEA 1AI6A 3BABA 3CWBH 4LF6O 3SYAA 4DV0O 5JH7A 1SQVH 5LHGA 2UU9B 1Z2GA 2NNUA 1CXZB 4PELA 4UUJC 4DO2A 3E8HA 1GM8A 2JGUA 1JA8A 4GUNA 1N36O 4X64O 3IGAC 1AJQA 5CBFA 4IHJB 1NT2B 2Q7GA 2HHHO 4DUYB 3VQWA 4LF5O 4PI0A 1GN3A 4ZBMA 4DV7O 1SESA 1HNZB 1MZFA 5KUMA 3BY6A 1Q8IA 4NR1A 2Q0OC 3FB7C 5K1XA 2HVKC 4X65O 1I08A 5L3GA 4IIJB 3ML0A 4B3RO 2MK3A 1BE3H 5DN6G 1QCEA 3K5MA 1D5NA 4X1YA 3PJSK 2D2CB 1EFRG 3B09A 5GONB 2LFRA 4HYOA 4UCOA 4DV5B 1Y67A 4LF7O 4DV4B 1NVPD 2OYQA 5IDJA 2FYUH 4PD4F 5IY5B 1XI1A 4B3MB 2UXCO 2EZOA 1GRJA 5IYBO 1F51A 1VP7A 5H6RA 2Y4TA 1OJHA 4KP4A 4UB8Z 4CC5A 4WBNB 1XMOO 1VF6A 4GKKB 3CRAA 5LGNA 1L8DA 1X59A 4OPAA 3EVKA 4DV1B 3KZIZ 5FNVB 5E1AC 5IY5C 1FFXB 1F4NA 4O4JA 1BL8A 1TAEA 4O4HA 1N8RW 3RBZA 2E5LO 1WB8A 2UUBB 4JI2O 2VQEO 1PV0A 4R7CA 2YIBA 5LGUA 4H13B 2WLNA 2IJHA 3SDLA 2QM7A 4X62O 2PTMA 2UXDB 1JFFB 3L70H 5B1AC 2YI9A 4OXSA 3J81N 3STLC 5L3DA 1FS0G 3GWKC 4JGSA 3RYIB 3I56V 4WF9V 4YIPA 3UT5B 3ABKB 5KMGB 4MVOA 5H2FZ 2AHYA 3OT7A 4JZ2A 2A79B 3M99B 1AILA 4LR3A 4XDKA 4OGQB 5JJNB 3ZBHA 5J2UA 3QNEA 5J2TB 5CB4B 4EFEA 1WN7A 2XHBA 4UFZA 4ZOLA 4J10A 3SYCA 2UXBB 3ABKC 3CRCA 3VQVA 3ETQA 2JS5A 3OUFA 2ZM6O 4ZKIA 1NBMG 3KG2A 5EYPA 4DR4B 3RW0A 5LP6A 4JYBA 1PPJH 2KSDA 4LNUB 2B1GA 4UCTA 4F6RB 4JTDB 2UU9O 1Y76B 2LW7A 3G80A 4LBEC 1GH6A 5J9PC 3F7YC 4RQEA 2KKWA 4XDLA 1XILA 2OIEA 4IT5A 3CCLV 2Q9LA 4LFCB 4JI6B 4LCUC 2WWWA 3DGEA 3H01A 4Z1VA 2F95B 3JD1A 1F23A 5LL6Y 3H1KH 1XHZA 4GKJO 4I50B 1TA8A 5D5QA 3TJTA 3D3IA 3ZS8C 2XTAA 4J7ZA 2CH7B 5B1NA 4GYCB 4I9WA 3OAAG 4DUYO 2IBZH 3AK3A 4YIOA 3S3XA 1HNZO 1P4RA 1RP3B 1XBLA 2WAMA 5IE9A 3DC6A 4L8JA 4U3JA 1NTKH 2JGDB 3B4SA 1K73W 1WB7A 1JCHA 2YSUB 5IYZB 1JX9A 5EIBC 1L0LH 1URFA 1K4CC 1K3EA 4LF8B 1M4UA 1YIJV 3W7WA 2JDIG 4KL1A 3OMAB 1OCZB 4LF4B 2YIDA 3OE7G 2JEUA 2OCCB 1FXKB 2RDCA 2ZE5A 4DV5O 1FXHA 2PYJA 2IH3C 4NB5A 1XMQB 2ARHA 3N2GA 4DV4O 4YJ2A 3CC4V 2P5OA 5LOVA 3JARB 1XL4A 3IFXA 3MAQA 3U10A 1PNMA 4J9YB 2DYRB 1NR7A 1OCZC 2OIGA 1Y74B 5D5PA 2OCCC 1FXKC 4GKKO 4MTFA 4JV5B 4ABMA 4NXNB 3HR0A 4LP8A 2ADQB 3MDSA 4PI2A 3SJQC 5DM6V 3DTUB 4QJFB 1AVMA 2DYRC 1NTMH 3FB5C 2XUMA 3L9DA 2GBOA 1M90W 5KX5B 2ZNIA 4IYIA 2IU3A 4R8CA 3D36A 1KQSU 5EIBD 3AG3B 1R6NA 2EJ7A 5BR8B 4K0KB 3JAKA 2QEXV 4HAMA 1GTOA 3CCRV 2ZR2A 2QJ1A 4XBFA 3ZRWB 1SETA 5CA3A 4DK1A 3E86A 5KHHA 2BTOA 2EINB 2UXDO 3K08A 1EN4A 2QTSA 3CHXA 2R9RB 1M5IA 2QA4V 2CTQA 2YUAA 4JI5B 5CN0A 2HEPA 3AG3C 3O65A 3CMAV 3CC2V 4TV8B 2HR3A 3QVNA 2WLHA 5JH7B 4JI7B 1MNGA 2BE3A 3G6BA 3J7AU 5L3EA 4FK5C 2ZDIC 3A8TA 2EINC 4CH6A 2X6BA 3CX5F 4O4IA 2HKOA 2B9ZA 1Q6UA 1W59A 3T4ZA 2AXTZ 3W7SA 3N2KA 4PDVA 1YXBA 2PI5A 5KLVH 3HKEA 4IGGA 1GM9A 3T2MA 1CPYA 1SF9A 3K03A 4G27B 5A9GA 2XASA 3OEHG 5B5EZ 4CBCA 1XDCA 2PGGA 5HFLA 2QTOA 4X66O 1VQPV 1M1KW 1QVGU 3HKDB 4KHPO 3AK2A 3SR2C 1ZLZA 5GW7A 1PD3A 1VQ4V 3ETEA 4NXMO 4LFCO 1OV9A 4X1YB 2DWDC 2X6CA 4I5SA 4EB6A 5FPRA 4MSWC 3E35A 2O57A 2A0LA 4J7KA 1PL0A 3KKYA 3SJAC 5A2QN 3JASB 1W0KG 1B3QA 2LP7A 2YXYA 1VMGA 4LH6A 4NTXA 1HWYA 1SS3A 1IBLB 1NZ6A 4MVMA 2UUAB 2KQXA 4JPRA 1Y6XA 2EZPA 2RNBA 4JAVA 4B3TB 4UV8A 2X7RB 1N0JA 3ZMUA 2YI8A 2EJRA 2A06H 3RN4A 3VQYA 4FPPA 1QR8A 1K7DA 4LF8O 3FAVB 4LF4O 2WLKA 2F66C 1R3JC 4K8XA 2EBOA 1FAFA 4J9ZB 2R9AA 3QO7A 1BQZA 4O4LA 3U11A 2K9PA 2ZCEA 1XMQO 1DK1A 2ITCC 2YS8A 4K8ZA 4PV1B 1TUBA 4JYCA 5AG2A 4DV6O 2CAZC 1KU9A 3VQXA 4JV5O 3ZHSA 4J80A 3FFQA 5CA1B 4NXNO 3MHSC 5H6QA 1GAXA 4D6TH 1S3JA 2PZSA 3W7XA 2IJJA 1CEZA 3RYFB 2ZKOA 4K0KO 3FX7A 2KG7B 3RYCB 3MD0A 1XOUA 1YTFB 4BIUA 3CCUV 4JI4B 1P7BA 4PJ0Z 4LWSA 3LDEA 4TT3G 4FLZA 2GUZA 3HB3B 3AEIA 1XHXA 2WLIB 4JI5O 1N33B 1Q90D 3ABMB 1K34A 4JI7O 2P67A 4DUZB 5KHKA 1GMGA 1MABG 2E76B 2ZE7A 5JQGA 3T1HB 3HKCA 3H1HH 4JI0O 3QG5A 1D2DA 2WLMA 4I0XA 2IW5A 1NJIW 2NR5A 3JD2A 1THZA 4CH4A 3FKSG 4JTAB 3NR7A 4MW3A 1IDSA 2YIBD 4TUYB 2YXHA 2DN9A 4D7TA 5EC2C 1R3LC 3ABMC 1EZJA 4PA7A 1Q81W 1NH2D 2P4VA 1S5JA 2OCHA 1XNQB 2DW4A 4BIOA 1QR9A 4FM1A 1AI7A 3C3SA 5C8YA 4DXWA 3T4DA 3RFRA 1KP3A 2P06A 4MVSA 2UUCB 2DWEC 3O9OA 5IJ0A 4GX5A 2WLLA 1H2MA 4H33A 1LNQA 3A0BZ 1JJOA 1IZ3A 3Q4HA 3JD3A 1YTFD 2JIZG 2A9HA 2ZD9A 5IYDO 3C3TA 3DSQA 4DYLA 1DF5A 3ZRXA 3UO2A 1N32B 3E22A 5EZYB 2F4VB 1YF2A 1DLBA 4LF9B 1YJ9V 3RYHA 4O2BA 4TV9A 3L74H 3VBBA 5L3FA 5LMUB 3ABUA 5LOVB 5CBHA 5KHJA 1IBLO 1ENVA 2FB5A 2UUAO 2Q4PA 1NR1A 4GX2A 3OD4A 4U7OA 4B3TO 1SQFA 1PP9H 2CE4A 3CJHA 3E2EA 3JCZA 3VOUA 1PL4A 2AW9A 3JALB 2XAHA 1MZEA 2GHYA 5KAIZ 3CS5A 4OPHA 4DRXB 1BT8A 3GB7C 4DR2B 3UO3A 4ZI7B 1I94B 1N4CA 5LA6B 3LUTB 1VF7A 3D8CA 4B3SO 2RMKB 5JVDB 3L73H 4P9PA 4R6ZA 4LFBO 5ITZB 3B77A 4R50A 1Q6HA 1XUQA 1RPOA 1FYJA 4ZIBA 5JCOC 4PA9A 4JASA 1T5EA 3JAWB 3DXRA 4A5UB 1SA0A 1GN6A 1VEWA 2P6JA 2EILB 3W7UA 4Q20A 3L75H 2ZINA 1JJ2U 1PM9A 2QWNB 2EULA 1QLEB 3I5DA 5E79Z 4FFBB 4NTWA 1VQKV 4AQYB 4O4IB 5F2VO 3JCUZ 2ZQMA 1YITV 1BS3A 1RM1B 5CA0B 5CBGA 3R65A 2EILC 3TCUA 4X1IB 1GN2A 1TVKB 3WB1A 5LBQA 3CXHF 4LFAB 2DOSA 1SQPH 3KCXA 4DK0A 4JI8B 3CCEV 4BR6A 4ZHQA 5KHGA 2YEVB 2R70A 1VQMV 1RM1C 3FD9A 1BQ0A 1YVWA 1LUVA 1TUEB 3T1HO 1K8AW 1W2BU 3IC7A 1G1XB 3ZMZA 4FLWA 4I4TA 1N34O 5KHIA 3APOA 3WFVA 5BY1A 1RPRA 2Q5ZA 1AP6A 5LMNB 1ZTEA 2PY5A 1YSCA 5KUKA 3E8FA 3RVZA 1S5HC 4WFFA 3JD4A 3T1CA 3CCVV 3BVOA 1XNQO 1FXVA 1YHQV 4FLVA 1GN4A 4PDMA 1MOFA 4YJ3A 1NU1H 1J5EB 3QF7A 2LGWA 3BPZA 5LYJA 2Q67A 1X4TA 1Q5OA 2BSKB 5B1OA 1QLNA 2GDSA 2Y69B 5KA6A 4JYYA 1O9GA 1ZL8A 2IU0A 3GVMA 3SJBC 4H37A 2VRZA 2QM4A 2N74A 1N32O 2CGOA 4QNHB 2F4VO 1S5LZ 4X20B 4LF9O 3ZN0A 4DR7B 1I7FA 2GTSA 2P90A 3OTFA 2FTKA 1XNRB 2Y69C 4I55B 1QQCA 4FZ0A 4GT1A 3UQ8A 1TUBB 5BMVB 4O2AB 2QE7G 2ZIMA 1JVMA 3OM3B 1S77D 5EC1C 1WJZA 5LXTB 1O9HA 1AR1B 4H0LB 1WP7A 4X1KB 1R1BA 4QGPA 4MVRA 4P2ZA 3UCSC 3EFFK 1Y4MA 2X0LA 5IT9N 4TQFA 4B3MO 4DR2O 4TOIA 1I94O 4IHJA 3SPIA 4QPJA 3RWRD 1JR9A 1ZWIC 1OZ0A 2OWOA 3FYEB 3LSQA 1RSOB 3K59A 1IURA 2VQFB 3HKBB 2YICA 4FIPC 5BZBA 1QBZA 4DV1O 4FM2A 1GO3F 4UCVA 1IBKB 2XAFA 3FYIB 2OTJV 3G67A 1KP2A 2HVJC 3AG4B 2PI4A 2VWKA 5B1BB 4UCSA 4J7JA 4DV3B 1NTZH 2UUBO 1B06A 1BGYH 3ZHTA 1KC8W 1KECA 3HKCB 1BSMA 2W0XA 2XAGA 4JI1B 4I0XB 1H2NA 5GTIZ 4DV2B 4N23A 2EIMB 4WCEV 4HNAB 1UFIA 2QWRB 3JATB 3AG4C 4GZRB 5B1BC 4YY3B 4KUMA 4YHHB 2A7WA 1QU7A 1B6QA 2ATKC 4WBNA 1N0NA 2HJDA 5TISZ 2ZT9B 2C2AA 4G2KA 1PKXA 1M93A 1OCRB 2LJ2A 1YEWA 4N21A 5FNVA 3ZMVA 1VQ7V 4JI8O 1FFXA 3EXAA 1VQ6V 2EIMC 3STZC 3LNMB 3JAMN 2Q7EA 1P7GA 3TK1A 4I9QA 1VQOV 3LDCA 1KBHA 4MVUA 2QSAA 1R3KC 1MG1A 5FL7G 2UXBO 2ITDC 3CRQA 5FPOA 1OCRC 3OGIB 4BIZA 3ZRVA 3ETGA 4MS2A 1JFFA 5LMNO 4G28B 4LH7A 1FKAO 2XNDG 4DR4O 1G6UA 1UJWB 2W6IG 4O2BB 3WU2Z 3ZEDA 1VQLV 4LF6B 1SERA 1PNLA 4DV0B 3G71V 3QO8A 5JJJB 4DR6B 3UT5A 2XAJA 5JWPA 5KMGA 5IWAB 1EZVH 3OGCC 1AR4A 4JI6O 3K04A 1R6KA 1VQ9V 1SRYA 4MTOA 3AG2B 1YJWV 2F23A 5DECA 1VIBA 1SQQH 4YXWG 2QDOA 1N36B 3GWOA 5J2TA 5CB4A 1WPBA 1IVSA 5L3BA 3JSLA 4JAAA 2Q73A 2QM8A 1JMKC 3H9VA 3U0ZA 1AROP 1JOYA 2DQ0A 5BXZA 2HHHB 2JRIA 3M7MX 2P4KA 4DR7O 4CS2A 3BAAA 3AG2C 1ORQC 4P30A 1BHAA 1XNRO 4K35A 4BWAA 4LNUA 3E8GA 1V54B 1Y76A 2Z3YA 2EX3A 1FPOA 4UCUA 4EEQA 1R3IC 2RCVA 5EBWC 2AZ0A 4O4JB 3K5OA 1KKCA 1NI8A 2WPDG 4P9OA 1GM7A 4O4HB 2E3CA 1WLEA 2Q7HA 1VF6C 1V54C 2ZE8A 3NXSA 3OUSA 2CTWA 2CH7A 2HFEC 3ZRSA 3S3WA 1NH2B 1AJNA 1U97A 2M7WA 2QGNA 3F5WC 4WFEA 2H3OA 1P49A 2BTQA 2VQFO 2JGDA 2EIJB 2VWJA 4CS4A 1XEQA 4MT8A 4MTGA 4GX0A 5IYZA 1IBKO 4GX1A 4NTYA 3ABLB 1H2LA 4BW9A 1FJGB 3B40A 1MSWD 4QPKA 5B3SB 2QWPB 4MVZA 3TGUH 4DV3O 5BR8O 3MHHC 5J2UB 1KUQA 1FXKA 1BHBA 2F43G 5H5NA 1BMFG 1DGSA 1OHHG 2DYSB 2LFSA 2EIJC 1KMIZ 2RJZA 4FJCC 3BCCH 4JF3A 4ZOLB 3BEHA 3WB2A 4DV2O 4FM0A 2OTLV 3JARA 3ABLC 3K0DA 4JTCB 1SZXA 2X6AA 3OTOB 4X62B 3R66A 5B3SC 2A3QA 1AI5A 4YY3O 1SKVA 3KCYA 5EYPB 1VARA 1Y74A 5LP6B 4J42A 4Z1MG 2JEXA 2DYSC 2HP8A 2DE0X 4W4LA 2QR4A 1AP5A 4FZ1A 2AZ2A 1I5YA 1MA1A 3CCQV 2H94A 4I7ZB 5CMUA 1YCIA 3AK1A 5KX5A 4Z2WA 4UVAA 3CCMV 1GKFA 4RO2A 5LP6C 3SYOA 3D3QA 4XDJA 1ZSPA 3SJCC 1HP8A 1XL6A 3ZRWA 2ZR3A 4CH5A 2ZDIA 3ZMTA 3SPJA 3G6EV 1UPGA 4JI3B 3EHBB 4C7UA 3BA8A 1L1FA 1AJPA 2ZM6B 1K5SA 1VQ8V 3OR7C 4U3JB 1WP8A 2AHZA 3ZHRA 4EFBA 5C93A 4TV8A 1HNWB 3IJ4A 4DR6O 2BOCC 1XREA 5IWAO 2ODMA 3L72H 2NLJC 4WFGA 2QWQB 3LSUA 1VF5B 2CUGA 3B2EE 3W7TA 2IJIA 3K3WA 2DQ3A 1WPXA 3LSSA 2FL4A 3N2GB 3ZJZA 3H1JH 1YDXA 4YJ2B 1ZX3A 3K5LA 5IJ9A 4GKJB 1VQNV 1B04A 3AG7A 3P3PA 1WA8A 3RT3C 5KAFZ 2FMLA 4B7EA 4BW5A 2CTPA 4KXRA 3CCJV 3HKDA 1K5QA 2VS0A 1VQ5V 2EIKB 4AHCA 2DJVA 3CEIA 1YZBA 1ZUQA 3RVYA 3B8NA 4W4KA 1HNXB 1E1RG 3P3NA 1H2SB 3SYPA 1HR0B 4U7NA 1H2KA 3JAKB 3IAYA 3BA9A 3ZMSA 3SPCA 4DR5B 3A0RA 5EK0A 3JASA 3IC9A 4F6EA 1MMMA 2EIKC 2ZE6A 5LGTA 1M9NA 3WB0A 3E89A 3D36C 4NYKA 3QTCA 2ETNA 3OR6C 3I55V 4JZGA 4BAYA 1WNSA 1FJGO 3FAVA 3ZX6A 1QVFU 4X88A 2NN4A 4CS3A 5B1AB 4WFBV 3LNNA 2DMXA 1R73A 3HPLC 3N2KB 4JI4O 2YIAA 3HKEB 4IL6Z 1ROPA 3BRCA 1H8HG 3K9AA 3BFRA 1BZKA 3OTOO 1QLEC 3T1YB 1XQ8A 2LGQA 4MTXA 4CC6A 2GTAA 3CRMA 4GCZA 3CC7V 2LO1A 3DC5A 3F7VC 5GTHZ 2CK3G 1N33O 3JSNA 2QKSA 4DUZO 4UCRA 2K1EA 5CA1A 1S72V 3AG1B 3E83A 1K9MW 3F5TA 1RFYA 1SC5B 4TQDA 3ASOB 1QHTA 2Z5UA 3LDDA 4EB6B 3RYFA 2CDYA 2UXNA 2KG7A 4FMTA 3RYCA 1EBOA 1I5XA 2D3OW 1OCCB 3M8AA 4X9QA 4UXNA 4DR1B 2XT9A 3AG1C 3SPHA 5LHHA 3ZHUA 4JI3O 1EN5A 3ASOC 4F4LA 2YXLA 1K97A 2UUCO 2WLIA 1Y66A 3CRRA 1FD9A 4WFAV 2H8PC 4DW1A 4GLXA 1NS1A 4MVQA 1HNWO 1WAZA 2R9IA 3CSXA 1OCCC 3L71H 3P30A 3K0GA 4B7KA 4X66B 4KHPB 2L6LA 4NKGB 2AGAA 2HG5C 1F4MA 2QKCA 3CD6V 1KYOF 2ZNJA 4NXMB 2FKXA 2RQ6A 4O4LB 4RQFA 1Q6IA 4TUYA 3OEEG 3TETA 5LMUO 3SYQA 3ABTA 4MW8A 2Q68A 2PYLA 2ILMA 1DTOA 4RAIA 3ZN1A 1YI2V 4B08A 3QO5A 2BTQB 1E1QG 4TWKA 1NQTA 4WFHA 4UB6Z 2G38A 5B66Z 2LQTA 3E8BA 1G8MA 4CZZA 5H9CA 1HNXO 1ZAUA 3CXCU 1G4YB 2P7TC 1HR0O 2BOBC 1W0JG 3K9SA 5EZYA 3ASNB 1GK9A 2V1DA 3SPGA 4DR5O 1R6TA 1SQBH 2PF4E 4LWSB 2B5UA 4DR3B 4FLYA 2GUZB 5LHIA 4IIJA 1Z5VA 2JJ1G 1Q82W 2CGNA 1KKDA 1JQ0A 1K33A 2UXXA 3UKMA 4OX9B 1M57B 4DV6B 3X2QB 3ASNC 4QIWF 1SQXH 5EBMC 5GONA 4RUEA 5JQGB 3JALA 5JCOA 2JVDA 3CPWU 1FFTB 4RWUA 1P84F 4AQYO 4DRXA 2Y48A 1JPXA 1HDJA 4JYAB 4ZI7A 3ZIAG 2V4DA 5FLXN 4J41A 3CE2A 2Q6AA 1Z5WA 5LA6A 3K57A 1M57C 3CYOA 3APQA 1DF4A 3X2QC 5JVDA 1TGOA 1H38A 5ITZA 2XAQA 4LFAO 5HFMA 3T1YO 2HJFC 2CTRA 1NKDA 5C8YB 3JAWA 4AI8A 5JJEB 2OT5A 1KD1W 3OMNB 5IJ0B 3H1IH 3OFNG 4D7SA 4AILC 2WLLB 2Z0AA 1OCOB 2IH1C 2WA4A 1S0VA 4UVCA 2JS3A 3OMIB 1Q86W 3Q4HB 4TSFG 2F1MA 3G4SV 4J11A 4JI0B 1US6A 4FFBA 1IBMB 1AI4A 1YJNV 3E22B 3OW2U 1IXMA 3K58A 4DR1O 3A2FA 5CA0A 3RYHB 4TV9B 2V7QG 1OCOC 2Q8VA 4X1IA 3RYIA 5IJ9B 4Q6GA 4E2LA 1TVKA 2XOKG 1WA8B 4FLTA 3FB8C 2MW2B 2N04A 1J5EO 3WG7B 4PA4A 4UVBA 4IYHA 4PHZA 2YEVA 4PA6A 3CJHB 3K5NA 4QE7A 3N27A 3CB2A 5KA5A 4X64B 3BHPA 1EN6A 3H1LH 2W0FC 1HW7A 1I0HA 3JD0A 4FLUA 2Y4UA 2IJKA 1BCCH 1PNKA 3WG7C 1K92A 3JYCA 1QNMA 1IX9A 4LF5B 4L87A 4CH3A 4DV7B 2ZXWB 1SZTA 1E79G 2B1IA 2E75B 2Y0IA 4F6RA 4LC1A 1K4DC 1D5AA 2GV9A 2QKAA 4X65B 4DW0A 2IM9A 4U3FH 4B3RB 3P32A 2GSMB 5EBLC 3DXRB 3TXSA 3C90A 1SA0B 4X8AA 3FB6C 2JK5C 1AR5A 2Y0PA 4EKWA 1L0NH 5IYCO 3CCSV 2BSKA 2ZXWC 1H2GA 3K79A 4PDRA 3CMEV 4H44B 2M6YA 2P22C 4QE9A 4I50A 4LF7B 4HBNA 2UXCB 4X20A 2E74B 2WA3A 3UM7A 2N05A 4RUFA 4B3SB 1Q7YW 4DR3O 1XMOB 4LFBB 2R72A 4FFKA 5DEDA 2JJ2G 4I55A 1IXBA 1H8EG 3A0HZ 5BMVA 1V9PA 4O2AA 2ZIOA 4HZ3A 1CP9A 4OX9O 2RN9A 4ICGA 4ZHQB 1SQGA 1LUWA 5LXTA 2BCCH 3ETDA 4X1KA 3SGIA 1J95A 2F93B 4NVPA 3K06A 4JI1O 2E5LB 2ADPA 3PN1A 1Q3EA 3RGBA 4JI2B 4I4TB 2VQEB 1COWG 2W6JG 3TXQA 4JYAO 4JAUA 1M56B 3ZCCA 1A32A
chains in the Genus database with same CATH topology
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
#chains in the Genus database with same CATH topology
 4PDL A;  4KFM A;  1Q43 A;  2KB1 A;  4YHH O;  4FVM A;  1RSO A;  4UV9 A;  2L35 A;  1F7Y A;  3B8M A;  3ZHV A;  5K1P A;  3J80 N;  2WSS G;  1MSD A;  2Q0A A;  3HKB A;  3ZHQ A;  2WLJ A;  3ICX A;  1V55 B;  1LR1 A;  1KB9 F;  4YJ3 B;  4E4E A;  1M56 C;  1S76 D;  5LYJ B;  5L3C A;  2LW1 A;  3CP1 A;  4PA3 A;  4K3A A;  4FLX A;  2HLD G;  1ZL8 B;  2Q69 A;  1AB3 A;  1V55 C;  1EM1 A;  1U96 A;  2YC0 A;  1IBM O;  1N34 B;  2QWO B;  4X89 A;  4HNA A;  2PUS A;  3JAT A;  1NVP B;  3THO A;  4ASU G;  2YDE A;  1AI6 A;  3BAB A;  3CWB H;  4LF6 O;  3SYA A;  4DV0 O;  5JH7 A;  1SQV H;  5LHG A;  2UU9 B;  1Z2G A;  2NNU A;  1CXZ B;  4PEL A;  4UUJ C;  4DO2 A;  3E8H A;  1GM8 A;  2JGU A;  1JA8 A;  4GUN A;  1N36 O;  4X64 O;  3IGA C;  1AJQ A;  5CBF A;  4IHJ B;  1NT2 B;  2Q7G A;  2HHH O;  4DUY B;  3VQW A;  4LF5 O;  4PI0 A;  1GN3 A;  4ZBM A;  4DV7 O;  1SES A;  1HNZ B;  1MZF A;  5KUM A;  3BY6 A;  1Q8I A;  4NR1 A;  2Q0O C;  3FB7 C;  5K1X A;  2HVK C;  4X65 O;  1I08 A;  5L3G A;  4IIJ B;  3ML0 A;  4B3R O;  2MK3 A;  1BE3 H;  5DN6 G;  1QCE A;  3K5M A;  1D5N A;  4X1Y A;  3PJS K;  2D2C B;  1EFR G;  3B09 A;  5GON B;  2LFR A;  4HYO A;  4UCO A;  4DV5 B;  1Y67 A;  4LF7 O;  4DV4 B;  1NVP D;  2OYQ A;  5IDJ A;  2FYU H;  4PD4 F;  5IY5 B;  1XI1 A;  4B3M B;  2UXC O;  2EZO A;  1GRJ A;  5IYB O;  1F51 A;  1VP7 A;  5H6R A;  2Y4T A;  1OJH A;  4KP4 A;  4UB8 Z;  4CC5 A;  4WBN B;  1XMO O;  1VF6 A;  4GKK B;  3CRA A;  5LGN A;  1L8D A;  1X59 A;  4OPA A;  3EVK A;  4DV1 B;  3KZI Z;  5FNV B;  5E1A C;  5IY5 C;  1FFX B;  1F4N A;  4O4J A;  1BL8 A;  1TAE A;  4O4H A;  1N8R W;  3RBZ A;  2E5L O;  1WB8 A;  2UUB B;  4JI2 O;  2VQE O;  1PV0 A;  4R7C A;  2YIB A;  5LGU A;  4H13 B;  2WLN A;  2IJH A;  3SDL A;  2QM7 A;  4X62 O;  2PTM A;  2UXD B;  1JFF B;  3L70 H;  5B1A C;  2YI9 A;  4OXS A;  3J81 N;  3STL C;  5L3D A;  1FS0 G;  3GWK C;  4JGS A;  3RYI B;  3I56 V;  4WF9 V;  4YIP A;  3UT5 B;  3ABK B;  5KMG B;  4MVO A;  5H2F Z;  2AHY A;  3OT7 A;  4JZ2 A;  2A79 B;  3M99 B;  1AIL A;  4LR3 A;  4XDK A;  4OGQ B;  5JJN B;  3ZBH A;  5J2U A;  3QNE A;  5J2T B;  5CB4 B;  4EFE A;  1WN7 A;  2XHB A;  4UFZ A;  4ZOL A;  4J10 A;  3SYC A;  2UXB B;  3ABK C;  3CRC A;  3VQV A;  3ETQ A;  2JS5 A;  3OUF A;  2ZM6 O;  4ZKI A;  1NBM G;  3KG2 A;  5EYP A;  4DR4 B;  3RW0 A;  5LP6 A;  4JYB A;  1PPJ H;  2KSD A;  4LNU B;  2B1G A;  4UCT A;  4F6R B;  4JTD B;  2UU9 O;  1Y76 B;  2LW7 A;  3G80 A;  4LBE C;  1GH6 A;  5J9P C;  3F7Y C;  4RQE A;  2KKW A;  4XDL A;  1XIL A;  2OIE A;  4IT5 A;  3CCL V;  2Q9L A;  4LFC B;  4JI6 B;  4LCU C;  2WWW A;  3DGE A;  3H01 A;  4Z1V A;  2F95 B;  3JD1 A;  1F23 A;  5LL6 Y;  3H1K H;  1XHZ A;  4GKJ O;  4I50 B;  1TA8 A;  5D5Q A;  3TJT A;  3D3I A;  3ZS8 C;  2XTA A;  4J7Z A;  2CH7 B;  5B1N A;  4GYC B;  4I9W A;  3OAA G;  4DUY O;  2IBZ H;  3AK3 A;  4YIO A;  3S3X A;  1HNZ O;  1P4R A;  1RP3 B;  1XBL A;  2WAM A;  5IE9 A;  3DC6 A;  4L8J A;  4U3J A;  1NTK H;  2JGD B;  3B4S A;  1K73 W;  1WB7 A;  1JCH A;  2YSU B;  5IYZ B;  1JX9 A;  5EIB C;  1L0L H;  1URF A;  1K4C C;  1K3E A;  4LF8 B;  1M4U A;  1YIJ V;  3W7W A;  2JDI G;  4KL1 A;  3OMA B;  1OCZ B;  4LF4 B;  2YID A;  3OE7 G;  2JEU A;  2OCC B;  1FXK B;  2RDC A;  2ZE5 A;  4DV5 O;  1FXH A;  2PYJ A;  2IH3 C;  4NB5 A;  1XMQ B;  2ARH A;  3N2G A;  4DV4 O;  4YJ2 A;  3CC4 V;  2P5O A;  5LOV A;  3JAR B;  1XL4 A;  3IFX A;  3MAQ A;  3U10 A;  1PNM A;  4J9Y B;  2DYR B;  1NR7 A;  1OCZ C;  2OIG A;  1Y74 B;  5D5P A;  2OCC C;  1FXK C;  4GKK O;  4MTF A;  4JV5 B;  4ABM A;  4NXN B;  3HR0 A;  4LP8 A;  2ADQ B;  3MDS A;  4PI2 A;  3SJQ C;  5DM6 V;  3DTU B;  4QJF B;  1AVM A;  2DYR C;  1NTM H;  3FB5 C;  2XUM A;  3L9D A;  2GBO A;  1M90 W;  5KX5 B;  2ZNI A;  4IYI A;  2IU3 A;  4R8C A;  3D36 A;  1KQS U;  5EIB D;  3AG3 B;  1R6N A;  2EJ7 A;  5BR8 B;  4K0K B;  3JAK A;  2QEX V;  4HAM A;  1GTO A;  3CCR V;  2ZR2 A;  2QJ1 A;  4XBF A;  3ZRW B;  1SET A;  5CA3 A;  4DK1 A;  3E86 A;  5KHH A;  2BTO A;  2EIN B;  2UXD O;  3K08 A;  1EN4 A;  2QTS A;  3CHX A;  2R9R B;  1M5I A;  2QA4 V;  2CTQ A;  2YUA A;  4JI5 B;  5CN0 A;  2HEP A;  3AG3 C;  3O65 A;  3CMA V;  3CC2 V;  4TV8 B;  2HR3 A;  3QVN A;  2WLH A;  5JH7 B;  4JI7 B;  1MNG A;  2BE3 A;  3G6B A;  3J7A U;  5L3E A;  4FK5 C;  2ZDI C;  3A8T A;  2EIN C;  4CH6 A;  2X6B A;  3CX5 F;  4O4I A;  2HKO A;  2B9Z A;  1Q6U A;  1W59 A;  3T4Z A;  2AXT Z;  3W7S A;  3N2K A;  4PDV A;  1YXB A;  2PI5 A;  5KLV H;  3HKE A;  4IGG A;  1GM9 A;  3T2M A;  1CPY A;  1SF9 A;  3K03 A;  4G27 B;  5A9G A;  2XAS A;  3OEH G;  5B5E Z;  4CBC A;  1XDC A;  2PGG A;  5HFL A;  2QTO A;  4X66 O;  1VQP V;  1M1K W;  1QVG U;  3HKD B;  4KHP O;  3AK2 A;  3SR2 C;  1ZLZ A;  5GW7 A;  1PD3 A;  1VQ4 V;  3ETE A;  4NXM O;  4LFC O;  1OV9 A;  4X1Y B;  2DWD C;  2X6C A;  4I5S A;  4EB6 A;  5FPR A;  4MSW C;  3E35 A;  2O57 A;  2A0L A;  4J7K A;  1PL0 A;  3KKY A;  3SJA C;  5A2Q N;  3JAS B;  1W0K G;  1B3Q A;  2LP7 A;  2YXY A;  1VMG A;  4LH6 A;  4NTX A;  1HWY A;  1SS3 A;  1IBL B;  1NZ6 A;  4MVM A;  2UUA B;  2KQX A;  4JPR A;  1Y6X A;  2EZP A;  2RNB A;  4JAV A;  4B3T B;  4UV8 A;  2X7R B;  1N0J A;  3ZMU A;  2YI8 A;  2EJR A;  2A06 H;  3RN4 A;  3VQY A;  4FPP A;  1QR8 A;  1K7D A;  4LF8 O;  3FAV B;  4LF4 O;  2WLK A;  2F66 C;  1R3J C;  4K8X A;  2EBO A;  1FAF A;  4J9Z B;  2R9A A;  3QO7 A;  1BQZ A;  4O4L A;  3U11 A;  2K9P A;  2ZCE A;  1XMQ O;  1DK1 A;  2ITC C;  2YS8 A;  4K8Z A;  4PV1 B;  1TUB A;  4JYC A;  5AG2 A;  4DV6 O;  2CAZ C;  1KU9 A;  3VQX A;  4JV5 O;  3ZHS A;  4J80 A;  3FFQ A;  5CA1 B;  4NXN O;  3MHS C;  5H6Q A;  1GAX A;  4D6T H;  1S3J A;  2PZS A;  3W7X A;  2IJJ A;  1CEZ A;  3RYF B;  2ZKO A;  4K0K O;  3FX7 A;  2KG7 B;  3RYC B;  3MD0 A;  1XOU A;  1YTF B;  4BIU A;  3CCU V;  4JI4 B;  1P7B A;  4PJ0 Z;  4LWS A;  3LDE A;  4TT3 G;  4FLZ A;  2GUZ A;  3HB3 B;  3AEI A;  1XHX A;  2WLI B;  4JI5 O;  1N33 B;  1Q90 D;  3ABM B;  1K34 A;  4JI7 O;  2P67 A;  4DUZ B;  5KHK A;  1GMG A;  1MAB G;  2E76 B;  2ZE7 A;  5JQG A;  3T1H B;  3HKC A;  3H1H H;  4JI0 O;  3QG5 A;  1D2D A;  2WLM A;  4I0X A;  2IW5 A;  1NJI W;  2NR5 A;  3JD2 A;  1THZ A;  4CH4 A;  3FKS G;  4JTA B;  3NR7 A;  4MW3 A;  1IDS A;  2YIB D;  4TUY B;  2YXH A;  2DN9 A;  4D7T A;  5EC2 C;  1R3L C;  3ABM C;  1EZJ A;  4PA7 A;  1Q81 W;  1NH2 D;  2P4V A;  1S5J A;  2OCH A;  1XNQ B;  2DW4 A;  4BIO A;  1QR9 A;  4FM1 A;  1AI7 A;  3C3S A;  5C8Y A;  4DXW A;  3T4D A;  3RFR A;  1KP3 A;  2P06 A;  4MVS A;  2UUC B;  2DWE C;  3O9O A;  5IJ0 A;  4GX5 A;  2WLL A;  1H2M A;  4H33 A;  1LNQ A;  3A0B Z;  1JJO A;  1IZ3 A;  3Q4H A;  3JD3 A;  1YTF D;  2JIZ G;  2A9H A;  2ZD9 A;  5IYD O;  3C3T A;  3DSQ A;  4DYL A;  1DF5 A;  3ZRX A;  3UO2 A;  1N32 B;  3E22 A;  5EZY B;  2F4V B;  1YF2 A;  1DLB A;  4LF9 B;  1YJ9 V;  3RYH A;  4O2B A;  4TV9 A;  3L74 H;  3VBB A;  5L3F A;  5LMU B;  3ABU A;  5LOV B;  5CBH A;  5KHJ A;  1IBL O;  1ENV A;  2FB5 A;  2UUA O;  2Q4P A;  1NR1 A;  4GX2 A;  3OD4 A;  4U7O A;  4B3T O;  1SQF A;  1PP9 H;  2CE4 A;  3CJH A;  3E2E A;  3JCZ A;  3VOU A;  1PL4 A;  2AW9 A;  3JAL B;  2XAH A;  1MZE A;  2GHY A;  5KAI Z;  3CS5 A;  4OPH A;  4DRX B;  1BT8 A;  3GB7 C;  4DR2 B;  3UO3 A;  4ZI7 B;  1I94 B;  1N4C A;  5LA6 B;  3LUT B;  1VF7 A;  3D8C A;  4B3S O;  2RMK B;  5JVD B;  3L73 H;  4P9P A;  4R6Z A;  4LFB O;  5ITZ B;  3B77 A;  4R50 A;  1Q6H A;  1XUQ A;  1RPO A;  1FYJ A;  4ZIB A;  5JCO C;  4PA9 A;  4JAS A;  1T5E A;  3JAW B;  3DXR A;  4A5U B;  1SA0 A;  1GN6 A;  1VEW A;  2P6J A;  2EIL B;  3W7U A;  4Q20 A;  3L75 H;  2ZIN A;  1JJ2 U;  1PM9 A;  2QWN B;  2EUL A;  1QLE B;  3I5D A;  5E79 Z;  4FFB B;  4NTW A;  1VQK V;  4AQY B;  4O4I B;  5F2V O;  3JCU Z;  2ZQM A;  1YIT V;  1BS3 A;  1RM1 B;  5CA0 B;  5CBG A;  3R65 A;  2EIL C;  3TCU A;  4X1I B;  1GN2 A;  1TVK B;  3WB1 A;  5LBQ A;  3CXH F;  4LFA B;  2DOS A;  1SQP H;  3KCX A;  4DK0 A;  4JI8 B;  3CCE V;  4BR6 A;  4ZHQ A;  5KHG A;  2YEV B;  2R70 A;  1VQM V;  1RM1 C;  3FD9 A;  1BQ0 A;  1YVW A;  1LUV A;  1TUE B;  3T1H O;  1K8A W;  1W2B U;  3IC7 A;  1G1X B;  3ZMZ A;  4FLW A;  4I4T A;  1N34 O;  5KHI A;  3APO A;  3WFV A;  5BY1 A;  1RPR A;  2Q5Z A;  1AP6 A;  5LMN B;  1ZTE A;  2PY5 A;  1YSC A;  5KUK A;  3E8F A;  3RVZ A;  1S5H C;  4WFF A;  3JD4 A;  3T1C A;  3CCV V;  3BVO A;  1XNQ O;  1FXV A;  1YHQ V;  4FLV A;  1GN4 A;  4PDM A;  1MOF A;  4YJ3 A;  1NU1 H;  1J5E B;  3QF7 A;  2LGW A;  3BPZ A;  5LYJ A;  2Q67 A;  1X4T A;  1Q5O A;  2BSK B;  5B1O A;  1QLN A;  2GDS A;  2Y69 B;  5KA6 A;  4JYY A;  1O9G A;  1ZL8 A;  2IU0 A;  3GVM A;  3SJB C;  4H37 A;  2VRZ A;  2QM4 A;  2N74 A;  1N32 O;  2CGO A;  4QNH B;  2F4V O;  1S5L Z;  4X20 B;  4LF9 O;  3ZN0 A;  4DR7 B;  1I7F A;  2GTS A;  2P90 A;  3OTF A;  2FTK A;  1XNR B;  2Y69 C;  4I55 B;  1QQC A;  4FZ0 A;  4GT1 A;  3UQ8 A;  1TUB B;  5BMV B;  4O2A B;  2QE7 G;  2ZIM A;  1JVM A;  3OM3 B;  1S77 D;  5EC1 C;  1WJZ A;  5LXT B;  1O9H A;  1AR1 B;  4H0L B;  1WP7 A;  4X1K B;  1R1B A;  4QGP A;  4MVR A;  4P2Z A;  3UCS C;  3EFF K;  1Y4M A;  2X0L A;  5IT9 N;  4TQF A;  4B3M O;  4DR2 O;  4TOI A;  1I94 O;  4IHJ A;  3SPI A;  4QPJ A;  3RWR D;  1JR9 A;  1ZWI C;  1OZ0 A;  2OWO A;  3FYE B;  3LSQ A;  1RSO B;  3K59 A;  1IUR A;  2VQF B;  3HKB B;  2YIC A;  4FIP C;  5BZB A;  1QBZ A;  4DV1 O;  4FM2 A;  1GO3 F;  4UCV A;  1IBK B;  2XAF A;  3FYI B;  2OTJ V;  3G67 A;  1KP2 A;  2HVJ C;  3AG4 B;  2PI4 A;  2VWK A;  5B1B B;  4UCS A;  4J7J A;  4DV3 B;  1NTZ H;  2UUB O;  1B06 A;  1BGY H;  3ZHT A;  1KC8 W;  1KEC A;  3HKC B;  1BSM A;  2W0X A;  2XAG A;  4JI1 B;  4I0X B;  1H2N A;  5GTI Z;  4DV2 B;  4N23 A;  2EIM B;  4WCE V;  4HNA B;  1UFI A;  2QWR B;  3JAT B;  3AG4 C;  4GZR B;  5B1B C;  4YY3 B;  4KUM A;  4YHH B;  2A7W A;  1QU7 A;  1B6Q A;  2ATK C;  4WBN A;  1N0N A;  2HJD A;  5TIS Z;  2ZT9 B;  2C2A A;  4G2K A;  1PKX A;  1M93 A;  1OCR B;  2LJ2 A;  1YEW A;  4N21 A;  5FNV A;  3ZMV A;  1VQ7 V;  4JI8 O;  1FFX A;  3EXA A;  1VQ6 V;  2EIM C;  3STZ C;  3LNM B;  3JAM N;  2Q7E A;  1P7G A;  3TK1 A;  4I9Q A;  1VQO V;  3LDC A;  1KBH A;  4MVU A;  2QSA A;  1R3K C;  1MG1 A;  5FL7 G;  2UXB O;  2ITD C;  3CRQ A;  5FPO A;  1OCR C;  3OGI B;  4BIZ A;  3ZRV A;  3ETG A;  4MS2 A;  1JFF A;  5LMN O;  4G28 B;  4LH7 A;  1FKA O;  2XND G;  4DR4 O;  1G6U A;  1UJW B;  2W6I G;  4O2B B;  3WU2 Z;  3ZED A;  1VQL V;  4LF6 B;  1SER A;  1PNL A;  4DV0 B;  3G71 V;  3QO8 A;  5JJJ B;  4DR6 B;  3UT5 A;  2XAJ A;  5JWP A;  5KMG A;  5IWA B;  1EZV H;  3OGC C;  1AR4 A;  4JI6 O;  3K04 A;  1R6K A;  1VQ9 V;  1SRY A;  4MTO A;  3AG2 B;  1YJW V;  2F23 A;  5DEC A;  1VIB A;  1SQQ H;  4YXW G;  2QDO A;  1N36 B;  3GWO A;  5J2T A;  5CB4 A;  1WPB A;  1IVS A;  5L3B A;  3JSL A;  4JAA A;  2Q73 A;  2QM8 A;  1JMK C;  3H9V A;  3U0Z A;  1ARO P;  1JOY A;  2DQ0 A;  5BXZ A;  2HHH B;  2JRI A;  3M7M X;  2P4K A;  4DR7 O;  4CS2 A;  3BAA A;  3AG2 C;  1ORQ C;  4P30 A;  1BHA A;  1XNR O;  4K35 A;  4BWA A;  4LNU A;  3E8G A;  1V54 B;  1Y76 A;  2Z3Y A;  2EX3 A;  1FPO A;  4UCU A;  4EEQ A;  1R3I C;  2RCV A;  5EBW C;  2AZ0 A;  4O4J B;  3K5O A;  1KKC A;  1NI8 A;  2WPD G;  4P9O A;  1GM7 A;  4O4H B;  2E3C A;  1WLE A;  2Q7H A;  1VF6 C;  1V54 C;  2ZE8 A;  3NXS A;  3OUS A;  2CTW A;  2CH7 A;  2HFE C;  3ZRS A;  3S3W A;  1NH2 B;  1AJN A;  1U97 A;  2M7W A;  2QGN A;  3F5W C;  4WFE A;  2H3O A;  1P49 A;  2BTQ A;  2VQF O;  2JGD A;  2EIJ B;  2VWJ A;  4CS4 A;  1XEQ A;  4MT8 A;  4MTG A;  4GX0 A;  5IYZ A;  1IBK O;  4GX1 A;  4NTY A;  3ABL B;  1H2L A;  4BW9 A;  1FJG B;  3B40 A;  1MSW D;  4QPK A;  5B3S B;  2QWP B;  4MVZ A;  3TGU H;  4DV3 O;  5BR8 O;  3MHH C;  5J2U B;  1KUQ A;  1FXK A;  1BHB A;  2F43 G;  5H5N A;  1BMF G;  1DGS A;  1OHH G;  2DYS B;  2LFS A;  2EIJ C;  1KMI Z;  2RJZ A;  4FJC C;  3BCC H;  4JF3 A;  4ZOL B;  3BEH A;  3WB2 A;  4DV2 O;  4FM0 A;  2OTL V;  3JAR A;  3ABL C;  3K0D A;  4JTC B;  1SZX A;  2X6A A;  3OTO B;  4X62 B;  3R66 A;  5B3S C;  2A3Q A;  1AI5 A;  4YY3 O;  1SKV A;  3KCY A;  5EYP B;  1VAR A;  1Y74 A;  5LP6 B;  4J42 A;  4Z1M G;  2JEX A;  2DYS C;  2HP8 A;  2DE0 X;  4W4L A;  2QR4 A;  1AP5 A;  4FZ1 A;  2AZ2 A;  1I5Y A;  1MA1 A;  3CCQ V;  2H94 A;  4I7Z B;  5CMU A;  1YCI A;  3AK1 A;  5KX5 A;  4Z2W A;  4UVA A;  3CCM V;  1GKF A;  4RO2 A;  5LP6 C;  3SYO A;  3D3Q A;  4XDJ A;  1ZSP A;  3SJC C;  1HP8 A;  1XL6 A;  3ZRW A;  2ZR3 A;  4CH5 A;  2ZDI A;  3ZMT A;  3SPJ A;  3G6E V;  1UPG A;  4JI3 B;  3EHB B;  4C7U A;  3BA8 A;  1L1F A;  1AJP A;  2ZM6 B;  1K5S A;  1VQ8 V;  3OR7 C;  4U3J B;  1WP8 A;  2AHZ A;  3ZHR A;  4EFB A;  5C93 A;  4TV8 A;  1HNW B;  3IJ4 A;  4DR6 O;  2BOC C;  1XRE A;  5IWA O;  2ODM A;  3L72 H;  2NLJ C;  4WFG A;  2QWQ B;  3LSU A;  1VF5 B;  2CUG A;  3B2E E;  3W7T A;  2IJI A;  3K3W A;  2DQ3 A;  1WPX A;  3LSS A;  2FL4 A;  3N2G B;  3ZJZ A;  3H1J H;  1YDX A;  4YJ2 B;  1ZX3 A;  3K5L A;  5IJ9 A;  4GKJ B;  1VQN V;  1B04 A;  3AG7 A;  3P3P A;  1WA8 A;  3RT3 C;  5KAF Z;  2FML A;  4B7E A;  4BW5 A;  2CTP A;  4KXR A;  3CCJ V;  3HKD A;  1K5Q A;  2VS0 A;  1VQ5 V;  2EIK B;  4AHC A;  2DJV A;  3CEI A;  1YZB A;  1ZUQ A;  3RVY A;  3B8N A;  4W4K A;  1HNX B;  1E1R G;  3P3N A;  1H2S B;  3SYP A;  1HR0 B;  4U7N A;  1H2K A;  3JAK B;  3IAY A;  3BA9 A;  3ZMS A;  3SPC A;  4DR5 B;  3A0R A;  5EK0 A;  3JAS A;  3IC9 A;  4F6E A;  1MMM A;  2EIK C;  2ZE6 A;  5LGT A;  1M9N A;  3WB0 A;  3E89 A;  3D36 C;  4NYK A;  3QTC A;  2ETN A;  3OR6 C;  3I55 V;  4JZG A;  4BAY A;  1WNS A;  1FJG O;  3FAV A;  3ZX6 A;  1QVF U;  4X88 A;  2NN4 A;  4CS3 A;  5B1A B;  4WFB V;  3LNN A;  2DMX A;  1R73 A;  3HPL C;  3N2K B;  4JI4 O;  2YIA A;  3HKE B;  4IL6 Z;  1ROP A;  3BRC A;  1H8H G;  3K9A A;  3BFR A;  1BZK A;  3OTO O;  1QLE C;  3T1Y B;  1XQ8 A;  2LGQ A;  4MTX A;  4CC6 A;  2GTA A;  3CRM A;  4GCZ A;  3CC7 V;  2LO1 A;  3DC5 A;  3F7V C;  5GTH Z;  2CK3 G;  1N33 O;  3JSN A;  2QKS A;  4DUZ O;  4UCR A;  2K1E A;  5CA1 A;  1S72 V;  3AG1 B;  3E83 A;  1K9M W;  3F5T A;  1RFY A;  1SC5 B;  4TQD A;  3ASO B;  1QHT A;  2Z5U A;  3LDD A;  4EB6 B;  3RYF A;  2CDY A;  2UXN A;  2KG7 A;  4FMT A;  3RYC A;  1EBO A;  1I5X A;  2D3O W;  1OCC B;  3M8A A;  4X9Q A;  4UXN A;  4DR1 B;  2XT9 A;  3AG1 C;  3SPH A;  5LHH A;  3ZHU A;  4JI3 O;  1EN5 A;  3ASO C;  4F4L A;  2YXL A;  1K97 A;  2UUC O;  2WLI A;  1Y66 A;  3CRR A;  1FD9 A;  4WFA V;  2H8P C;  4DW1 A;  4GLX A;  1NS1 A;  4MVQ A;  1HNW O;  1WAZ A;  2R9I A;  3CSX A;  1OCC C;  3L71 H;  3P30 A;  3K0G A;  4B7K A;  4X66 B;  4KHP B;  2L6L A;  4NKG B;  2AGA A;  2HG5 C;  1F4M A;  2QKC A;  3CD6 V;  1KYO F;  2ZNJ A;  4NXM B;  2FKX A;  2RQ6 A;  4O4L B;  4RQF A;  1Q6I A;  4TUY A;  3OEE G;  3TET A;  5LMU O;  3SYQ A;  3ABT A;  4MW8 A;  2Q68 A;  2PYL A;  2ILM A;  1DTO A;  4RAI A;  3ZN1 A;  1YI2 V;  4B08 A;  3QO5 A;  2BTQ B;  1E1Q G;  4TWK A;  1NQT A;  4WFH A;  4UB6 Z;  2G38 A;  5B66 Z;  2LQT A;  3E8B A;  1G8M A;  4CZZ A;  5H9C A;  1HNX O;  1ZAU A;  3CXC U;  1G4Y B;  2P7T C;  1HR0 O;  2BOB C;  1W0J G;  3K9S A;  5EZY A;  3ASN B;  1GK9 A;  2V1D A;  3SPG A;  4DR5 O;  1R6T A;  1SQB H;  2PF4 E;  4LWS B;  2B5U A;  4DR3 B;  4FLY A;  2GUZ B;  5LHI A;  4IIJ A;  1Z5V A;  2JJ1 G;  1Q82 W;  2CGN A;  1KKD A;  1JQ0 A;  1K33 A;  2UXX A;  3UKM A;  4OX9 B;  1M57 B;  4DV6 B;  3X2Q B;  3ASN C;  4QIW F;  1SQX H;  5EBM C;  5GON A;  4RUE A;  5JQG B;  3JAL A;  5JCO A;  2JVD A;  3CPW U;  1FFT B;  4RWU A;  1P84 F;  4AQY O;  4DRX A;  2Y48 A;  1JPX A;  1HDJ A;  4JYA B;  4ZI7 A;  3ZIA G;  2V4D A;  5FLX N;  4J41 A;  3CE2 A;  2Q6A A;  1Z5W A;  5LA6 A;  3K57 A;  1M57 C;  3CYO A;  3APQ A;  1DF4 A;  3X2Q C;  5JVD A;  1TGO A;  1H38 A;  5ITZ A;  2XAQ A;  4LFA O;  5HFM A;  3T1Y O;  2HJF C;  2CTR A;  1NKD A;  5C8Y B;  3JAW A;  4AI8 A;  5JJE B;  2OT5 A;  1KD1 W;  3OMN B;  5IJ0 B;  3H1I H;  3OFN G;  4D7S A;  4AIL C;  2WLL B;  2Z0A A;  1OCO B;  2IH1 C;  2WA4 A;  1S0V A;  4UVC A;  2JS3 A;  3OMI B;  1Q86 W;  3Q4H B;  4TSF G;  2F1M A;  3G4S V;  4J11 A;  4JI0 B;  1US6 A;  4FFB A;  1IBM B;  1AI4 A;  1YJN V;  3E22 B;  3OW2 U;  1IXM A;  3K58 A;  4DR1 O;  3A2F A;  5CA0 A;  3RYH B;  4TV9 B;  2V7Q G;  1OCO C;  2Q8V A;  4X1I A;  3RYI A;  5IJ9 B;  4Q6G A;  4E2L A;  1TVK A;  2XOK G;  1WA8 B;  4FLT A;  3FB8 C;  2MW2 B;  2N04 A;  1J5E O;  3WG7 B;  4PA4 A;  4UVB A;  4IYH A;  4PHZ A;  2YEV A;  4PA6 A;  3CJH B;  3K5N A;  4QE7 A;  3N27 A;  3CB2 A;  5KA5 A;  4X64 B;  3BHP A;  1EN6 A;  3H1L H;  2W0F C;  1HW7 A;  1I0H A;  3JD0 A;  4FLU A;  2Y4U A;  2IJK A;  1BCC H;  1PNK A;  3WG7 C;  1K92 A;  3JYC A;  1QNM A;  1IX9 A;  4LF5 B;  4L87 A;  4CH3 A;  4DV7 B;  2ZXW B;  1SZT A;  1E79 G;  2B1I A;  2E75 B;  2Y0I A;  4F6R A;  4LC1 A;  1K4D C;  1D5A A;  2GV9 A;  2QKA A;  4X65 B;  4DW0 A;  2IM9 A;  4U3F H;  4B3R B;  3P32 A;  2GSM B;  5EBL C;  3DXR B;  3TXS A;  3C90 A;  1SA0 B;  4X8A A;  3FB6 C;  2JK5 C;  1AR5 A;  2Y0P A;  4EKW A;  1L0N H;  5IYC O;  3CCS V;  2BSK A;  2ZXW C;  1H2G A;  3K79 A;  4PDR A;  3CME V;  4H44 B;  2M6Y A;  2P22 C;  4QE9 A;  4I50 A;  4LF7 B;  4HBN A;  2UXC B;  4X20 A;  2E74 B;  2WA3 A;  3UM7 A;  2N05 A;  4RUF A;  4B3S B;  1Q7Y W;  4DR3 O;  1XMO B;  4LFB B;  2R72 A;  4FFK A;  5DED A;  2JJ2 G;  4I55 A;  1IXB A;  1H8E G;  3A0H Z;  5BMV A;  1V9P A;  4O2A A;  2ZIO A;  4HZ3 A;  1CP9 A;  4OX9 O;  2RN9 A;  4ICG A;  4ZHQ B;  1SQG A;  1LUW A;  5LXT A;  2BCC H;  3ETD A;  4X1K A;  3SGI A;  1J95 A;  2F93 B;  4NVP A;  3K06 A;  4JI1 O;  2E5L B;  2ADP A;  3PN1 A;  1Q3E A;  3RGB A;  4JI2 B;  4I4T B;  2VQE B;  1COW G;  2W6J G;  3TXQ A;  4JYA O;  4JAU A;  1M56 B;  3ZCC A;  1A32 A; 
#chains in the Genus database with same CATH homology
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...