2Q94A

E. coli methionine aminopeptidase mn-form with inhibitor a04
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q94A00
1N51A 4FO8A 2GG9A 4U6EA 2BHAA 3FM3A 4ZNGA 3Q6DA 1XGSA 2Q93A 3RVAA 4ZWUA 2Q8KA 4FUKA 3CTZA 1JAWA 2GG5A 4U1BA 3TAVA 2EA4A 2BWSA 2OKNA 5CNXA 3PKEA 1WN1A 5CLSA 1WBQA 3D27A 2B3KA 4IKSA 4R60A 2HOWA 2GG7A 4B28A 4IECA 4FLLA 4U6WA 3FMQA 2BH3A 1QXYA 4U75A 1A16A 1XGNA 2EVOA 1B59A 1W2MA 2GG0A 2GU5A 4PNCA 1WL6A 1C24A 4IKUA 1WKMA 2GU4A 2V3XA 2Q92A 5JHUA 2ADUA 2BWUA 1YW7A 1C22A 4U71A 5CIKA 2P9AA 4A6WA 2GTXA 1QXZA 2Q96A 1C27A 2EVMA 3PKDA 2OAZA 4RZZA 1KQ0A 2GZ5A 5FCHA 2MATA 1M35A 4U73A 3MATA 1BN5A 4S01A 2B3HA 3PKCA 4FKCA 3CB5A 2ZSGA 1MATA 3IU9A 2BB7A 3PKAA 4IKRA 4Z7MA 4IF7A 3CB6A 3IU8A 4RZYA 5JI6A 2Q95A 1YW8A 1XGOA 3L24A 4U69A 5CE6A 2GU6A 2P98A 2V3YA 2BHBA 4EGEA 1C23A 3PKBA 4OOKA 1KQ9A 3MX6A 5CDVA 1WLRA 3RORA 1XGMA 1C21A 1XNZA 2GG3A 1YW9A 2BWXA 2BWYA 3TB5A 2NQ7A 1YVMA 4QR8A 2BWVA 5CDEA 3BITA 4IDYA 5FCFA 1R5HA 4S2TP 1WY2A 1CHMA 4U6CA 2BWTA 2V3ZA 5JFRA 1BOAA 4FLKA 3L7GA 1Y1NA 2GGCA 2BN7A 2BHCA 2GA2A 4IPAA 2G6PA 2GU7A 4FLIA 2EVCA 1QZYA 4ZWPA 4A6VA 1PV9A 2BWWA 4MATA 4ZWOA 4JUQA 2B3LA 3IG4A 4U6ZA 4S2RP 4U76A 3IU7A 5D6FA 3BIQA 2GG2A 1B6AA 2P99A 4IKTA 4KM3A 4PV4A 4U6JA 2EA2A 3FMRA 1QXWA 1YJ3A 2NQ6A 3BIPA 3MR1A 4FLJA 4RGZ1 5CDLA 2IW2A 4HXXA 4FO7A 2GGBA 5D6EA 5E5BA 2DFIA 1O0XA 1R5GA 4U70A 1W7VA 2Q94A 1WL9A 4IU6A 2GG8A 4S00A 1KP0A 2BHDA 1R58A 2V6CA 3S6BA
chains in the Genus database with same CATH superfamily
1N51A 4FO8A 2GG9A 4U6EA 2BHAA 3FM3A 4ZNGA 3Q6DA 1XGSA 2Q93A 3RVAA 4ZWUA 2Q8KA 4FUKA 3CTZA 1JAWA 2GG5A 4U1BA 3TAVA 2EA4A 2BWSA 2OKNA 5CNXA 3PKEA 1WN1A 5CLSA 1WBQA 3D27A 2B3KA 4IKSA 4R60A 2HOWA 2GG7A 4B28A 4IECA 4FLLA 4U6WA 3FMQA 2BH3A 1QXYA 4U75A 1A16A 1XGNA 2EVOA 1B59A 1W2MA 2GG0A 2GU5A 4PNCA 1WL6A 1C24A 4IKUA 1WKMA 2GU4A 2V3XA 2Q92A 5JHUA 2ADUA 2BWUA 1YW7A 1C22A 4U71A 5CIKA 2P9AA 4A6WA 2GTXA 1QXZA 2Q96A 1C27A 2EVMA 3PKDA 2OAZA 4RZZA 1KQ0A 2GZ5A 5FCHA 2MATA 1M35A 4U73A 3MATA 1BN5A 4S01A 2B3HA 3PKCA 4FKCA 3CB5A 2ZSGA 1MATA 3IU9A 2BB7A 3PKAA 4IKRA 4Z7MA 4IF7A 3CB6A 3IU8A 4RZYA 5JI6A 2Q95A 1YW8A 1XGOA 3L24A 4U69A 5CE6A 2GU6A 2P98A 2V3YA 2BHBA 4EGEA 1C23A 3PKBA 4OOKA 1KQ9A 3MX6A 5CDVA 1WLRA 3RORA 1XGMA 1C21A 1XNZA 2GG3A 1YW9A 2BWXA 2BWYA 3TB5A 2NQ7A 1YVMA 4QR8A 2BWVA 5CDEA 3BITA 4IDYA 5FCFA 1R5HA 4S2TP 1WY2A 1CHMA 4U6CA 2BWTA 2V3ZA 5JFRA 1BOAA 4FLKA 3L7GA 1Y1NA 2GGCA 2BN7A 2BHCA 2GA2A 4IPAA 2G6PA 2GU7A 4FLIA 2EVCA 1QZYA 4ZWPA 4A6VA 1PV9A 2BWWA 4MATA 4ZWOA 4JUQA 2B3LA 3IG4A 4U6ZA 4S2RP 4U76A 3IU7A 5D6FA 3BIQA 2GG2A 1B6AA 2P99A 4IKTA 4KM3A 4PV4A 4U6JA 2EA2A 3FMRA 1QXWA 1YJ3A 2NQ6A 3BIPA 3MR1A 4FLJA 4RGZ1 5CDLA 2IW2A 4HXXA 4FO7A 2GGBA 5D6EA 5E5BA 2DFIA 1O0XA 1R5GA 4U70A 1W7VA 2Q94A 1WL9A 4IU6A 2GG8A 4S00A 1KP0A 2BHDA 1R58A 2V6CA 3S6BA
chains in the Genus database with same CATH topology
1N51A 4FO8A 2GG9A 4U6EA 2BHAA 3FM3A 4ZNGA 3Q6DA 1XGSA 2Q93A 3RVAA 4ZWUA 2Q8KA 4FUKA 3CTZA 1JAWA 2GG5A 4U1BA 3TAVA 2EA4A 2BWSA 2OKNA 5CNXA 3PKEA 1WN1A 5CLSA 1WBQA 3D27A 2B3KA 4IKSA 4R60A 2HOWA 2GG7A 4B28A 4IECA 4FLLA 4U6WA 3FMQA 2BH3A 1QXYA 4U75A 1A16A 1XGNA 2EVOA 1B59A 1W2MA 2GG0A 2GU5A 4PNCA 1WL6A 1C24A 4IKUA 1WKMA 2GU4A 2V3XA 2Q92A 5JHUA 2ADUA 2BWUA 1YW7A 1C22A 4U71A 5CIKA 2P9AA 4A6WA 2GTXA 1QXZA 2Q96A 1C27A 2EVMA 3PKDA 2OAZA 4RZZA 1KQ0A 2GZ5A 5FCHA 2MATA 1M35A 4U73A 3MATA 1BN5A 4S01A 2B3HA 3PKCA 4FKCA 3CB5A 2ZSGA 1MATA 3IU9A 2BB7A 3PKAA 4IKRA 4Z7MA 4IF7A 3CB6A 3IU8A 4RZYA 5JI6A 2Q95A 1YW8A 1XGOA 3L24A 4U69A 5CE6A 2GU6A 2P98A 2V3YA 2BHBA 4EGEA 1C23A 3PKBA 4OOKA 1KQ9A 3MX6A 5CDVA 1WLRA 3RORA 1XGMA 1C21A 1XNZA 2GG3A 1YW9A 2BWXA 2BWYA 3TB5A 2NQ7A 1YVMA 4QR8A 2BWVA 5CDEA 3BITA 4IDYA 5FCFA 1R5HA 4S2TP 1WY2A 1CHMA 4U6CA 2BWTA 2V3ZA 5JFRA 1BOAA 4FLKA 3L7GA 1Y1NA 2GGCA 2BN7A 2BHCA 2GA2A 4IPAA 2G6PA 2GU7A 4FLIA 2EVCA 1QZYA 4ZWPA 4A6VA 1PV9A 2BWWA 4MATA 4ZWOA 4JUQA 2B3LA 3IG4A 4U6ZA 4S2RP 4U76A 3IU7A 5D6FA 3BIQA 2GG2A 1B6AA 2P99A 4IKTA 4KM3A 4PV4A 4U6JA 2EA2A 3FMRA 1QXWA 1YJ3A 2NQ6A 3BIPA 3MR1A 4FLJA 4RGZ1 5CDLA 2IW2A 4HXXA 4FO7A 2GGBA 5D6EA 5E5BA 2DFIA 1O0XA 1R5GA 4U70A 1W7VA 2Q94A 1WL9A 4IU6A 2GG8A 4S00A 1KP0A 2BHDA 1R58A 2V6CA 3S6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N51 A;  4FO8 A;  2GG9 A;  4U6E A;  2BHA A;  3FM3 A;  4ZNG A;  3Q6D A;  1XGS A;  2Q93 A;  3RVA A;  4ZWU A;  2Q8K A;  4FUK A;  3CTZ A;  1JAW A;  2GG5 A;  4U1B A;  3TAV A;  2EA4 A;  2BWS A;  2OKN A;  5CNX A;  3PKE A;  1WN1 A;  5CLS A;  1WBQ A;  3D27 A;  2B3K A;  4IKS A;  4R60 A;  2HOW A;  2GG7 A;  4B28 A;  4IEC A;  4FLL A;  4U6W A;  3FMQ A;  2BH3 A;  1QXY A;  4U75 A;  1A16 A;  1XGN A;  2EVO A;  1B59 A;  1W2M A;  2GG0 A;  2GU5 A;  4PNC A;  1WL6 A;  1C24 A;  4IKU A;  1WKM A;  2GU4 A;  2V3X A;  2Q92 A;  5JHU A;  2ADU A;  2BWU A;  1YW7 A;  1C22 A;  4U71 A;  5CIK A;  2P9A A;  4A6W A;  2GTX A;  1QXZ A;  2Q96 A;  1C27 A;  2EVM A;  3PKD A;  2OAZ A;  4RZZ A;  1KQ0 A;  2GZ5 A;  5FCH A;  2MAT A;  1M35 A;  4U73 A;  3MAT A;  1BN5 A;  4S01 A;  2B3H A;  3PKC A;  4FKC A;  3CB5 A;  2ZSG A;  1MAT A;  3IU9 A;  2BB7 A;  3PKA A;  4IKR A;  4Z7M A;  4IF7 A;  3CB6 A;  3IU8 A;  4RZY A;  5JI6 A;  2Q95 A;  1YW8 A;  1XGO A;  3L24 A;  4U69 A;  5CE6 A;  2GU6 A;  2P98 A;  2V3Y A;  2BHB A;  4EGE A;  1C23 A;  3PKB A;  4OOK A;  1KQ9 A;  3MX6 A;  5CDV A;  1WLR A;  3ROR A;  1XGM A;  1C21 A;  1XNZ A;  2GG3 A;  1YW9 A;  2BWX A;  2BWY A;  3TB5 A;  2NQ7 A;  1YVM A;  4QR8 A;  2BWV A;  5CDE A;  3BIT A;  4IDY A;  5FCF A;  1R5H A;  4S2T P;  1WY2 A;  1CHM A;  4U6C A;  2BWT A;  2V3Z A;  5JFR A;  1BOA A;  4FLK A;  3L7G A;  1Y1N A;  2GGC A;  2BN7 A;  2BHC A;  2GA2 A;  4IPA A;  2G6P A;  2GU7 A;  4FLI A;  2EVC A;  1QZY A;  4ZWP A;  4A6V A;  1PV9 A;  2BWW A;  4MAT A;  4ZWO A;  4JUQ A;  2B3L A;  3IG4 A;  4U6Z A;  4S2R P;  4U76 A;  3IU7 A;  5D6F A;  3BIQ A;  2GG2 A;  1B6A A;  2P99 A;  4IKT A;  4KM3 A;  4PV4 A;  4U6J A;  2EA2 A;  3FMR A;  1QXW A;  1YJ3 A;  2NQ6 A;  3BIP A;  3MR1 A;  4FLJ A;  4RGZ 1;  5CDL A;  2IW2 A;  4HXX A;  4FO7 A;  2GGB A;  5D6E A;  5E5B A;  2DFI A;  1O0X A;  1R5G A;  4U70 A;  1W7V A;  2Q94 A;  1WL9 A;  4IU6 A;  2GG8 A;  4S00 A;  1KP0 A;  2BHD A;  1R58 A;  2V6C A;  3S6B A; 
#chains in the Genus database with same CATH topology
 1N51 A;  4FO8 A;  2GG9 A;  4U6E A;  2BHA A;  3FM3 A;  4ZNG A;  3Q6D A;  1XGS A;  2Q93 A;  3RVA A;  4ZWU A;  2Q8K A;  4FUK A;  3CTZ A;  1JAW A;  2GG5 A;  4U1B A;  3TAV A;  2EA4 A;  2BWS A;  2OKN A;  5CNX A;  3PKE A;  1WN1 A;  5CLS A;  1WBQ A;  3D27 A;  2B3K A;  4IKS A;  4R60 A;  2HOW A;  2GG7 A;  4B28 A;  4IEC A;  4FLL A;  4U6W A;  3FMQ A;  2BH3 A;  1QXY A;  4U75 A;  1A16 A;  1XGN A;  2EVO A;  1B59 A;  1W2M A;  2GG0 A;  2GU5 A;  4PNC A;  1WL6 A;  1C24 A;  4IKU A;  1WKM A;  2GU4 A;  2V3X A;  2Q92 A;  5JHU A;  2ADU A;  2BWU A;  1YW7 A;  1C22 A;  4U71 A;  5CIK A;  2P9A A;  4A6W A;  2GTX A;  1QXZ A;  2Q96 A;  1C27 A;  2EVM A;  3PKD A;  2OAZ A;  4RZZ A;  1KQ0 A;  2GZ5 A;  5FCH A;  2MAT A;  1M35 A;  4U73 A;  3MAT A;  1BN5 A;  4S01 A;  2B3H A;  3PKC A;  4FKC A;  3CB5 A;  2ZSG A;  1MAT A;  3IU9 A;  2BB7 A;  3PKA A;  4IKR A;  4Z7M A;  4IF7 A;  3CB6 A;  3IU8 A;  4RZY A;  5JI6 A;  2Q95 A;  1YW8 A;  1XGO A;  3L24 A;  4U69 A;  5CE6 A;  2GU6 A;  2P98 A;  2V3Y A;  2BHB A;  4EGE A;  1C23 A;  3PKB A;  4OOK A;  1KQ9 A;  3MX6 A;  5CDV A;  1WLR A;  3ROR A;  1XGM A;  1C21 A;  1XNZ A;  2GG3 A;  1YW9 A;  2BWX A;  2BWY A;  3TB5 A;  2NQ7 A;  1YVM A;  4QR8 A;  2BWV A;  5CDE A;  3BIT A;  4IDY A;  5FCF A;  1R5H A;  4S2T P;  1WY2 A;  1CHM A;  4U6C A;  2BWT A;  2V3Z A;  5JFR A;  1BOA A;  4FLK A;  3L7G A;  1Y1N A;  2GGC A;  2BN7 A;  2BHC A;  2GA2 A;  4IPA A;  2G6P A;  2GU7 A;  4FLI A;  2EVC A;  1QZY A;  4ZWP A;  4A6V A;  1PV9 A;  2BWW A;  4MAT A;  4ZWO A;  4JUQ A;  2B3L A;  3IG4 A;  4U6Z A;  4S2R P;  4U76 A;  3IU7 A;  5D6F A;  3BIQ A;  2GG2 A;  1B6A A;  2P99 A;  4IKT A;  4KM3 A;  4PV4 A;  4U6J A;  2EA2 A;  3FMR A;  1QXW A;  1YJ3 A;  2NQ6 A;  3BIP A;  3MR1 A;  4FLJ A;  4RGZ 1;  5CDL A;  2IW2 A;  4HXX A;  4FO7 A;  2GGB A;  5D6E A;  5E5B A;  2DFI A;  1O0X A;  1R5G A;  4U70 A;  1W7V A;  2Q94 A;  1WL9 A;  4IU6 A;  2GG8 A;  4S00 A;  1KP0 A;  2BHD A;  1R58 A;  2V6C A;  3S6B A; 
#chains in the Genus database with same CATH homology
 1N51 A;  4FO8 A;  2GG9 A;  4U6E A;  2BHA A;  3FM3 A;  4ZNG A;  3Q6D A;  1XGS A;  2Q93 A;  3RVA A;  4ZWU A;  2Q8K A;  4FUK A;  3CTZ A;  1JAW A;  2GG5 A;  4U1B A;  3TAV A;  2EA4 A;  2BWS A;  2OKN A;  5CNX A;  3PKE A;  1WN1 A;  5CLS A;  1WBQ A;  3D27 A;  2B3K A;  4IKS A;  4R60 A;  2HOW A;  2GG7 A;  4B28 A;  4IEC A;  4FLL A;  4U6W A;  3FMQ A;  2BH3 A;  1QXY A;  4U75 A;  1A16 A;  1XGN A;  2EVO A;  1B59 A;  1W2M A;  2GG0 A;  2GU5 A;  4PNC A;  1WL6 A;  1C24 A;  4IKU A;  1WKM A;  2GU4 A;  2V3X A;  2Q92 A;  5JHU A;  2ADU A;  2BWU A;  1YW7 A;  1C22 A;  4U71 A;  5CIK A;  2P9A A;  4A6W A;  2GTX A;  1QXZ A;  2Q96 A;  1C27 A;  2EVM A;  3PKD A;  2OAZ A;  4RZZ A;  1KQ0 A;  2GZ5 A;  5FCH A;  2MAT A;  1M35 A;  4U73 A;  3MAT A;  1BN5 A;  4S01 A;  2B3H A;  3PKC A;  4FKC A;  3CB5 A;  2ZSG A;  1MAT A;  3IU9 A;  2BB7 A;  3PKA A;  4IKR A;  4Z7M A;  4IF7 A;  3CB6 A;  3IU8 A;  4RZY A;  5JI6 A;  2Q95 A;  1YW8 A;  1XGO A;  3L24 A;  4U69 A;  5CE6 A;  2GU6 A;  2P98 A;  2V3Y A;  2BHB A;  4EGE A;  1C23 A;  3PKB A;  4OOK A;  1KQ9 A;  3MX6 A;  5CDV A;  1WLR A;  3ROR A;  1XGM A;  1C21 A;  1XNZ A;  2GG3 A;  1YW9 A;  2BWX A;  2BWY A;  3TB5 A;  2NQ7 A;  1YVM A;  4QR8 A;  2BWV A;  5CDE A;  3BIT A;  4IDY A;  5FCF A;  1R5H A;  4S2T P;  1WY2 A;  1CHM A;  4U6C A;  2BWT A;  2V3Z A;  5JFR A;  1BOA A;  4FLK A;  3L7G A;  1Y1N A;  2GGC A;  2BN7 A;  2BHC A;  2GA2 A;  4IPA A;  2G6P A;  2GU7 A;  4FLI A;  2EVC A;  1QZY A;  4ZWP A;  4A6V A;  1PV9 A;  2BWW A;  4MAT A;  4ZWO A;  4JUQ A;  2B3L A;  3IG4 A;  4U6Z A;  4S2R P;  4U76 A;  3IU7 A;  5D6F A;  3BIQ A;  2GG2 A;  1B6A A;  2P99 A;  4IKT A;  4KM3 A;  4PV4 A;  4U6J A;  2EA2 A;  3FMR A;  1QXW A;  1YJ3 A;  2NQ6 A;  3BIP A;  3MR1 A;  4FLJ A;  4RGZ 1;  5CDL A;  2IW2 A;  4HXX A;  4FO7 A;  2GGB A;  5D6E A;  5E5B A;  2DFI A;  1O0X A;  1R5G A;  4U70 A;  1W7V A;  2Q94 A;  1WL9 A;  4IU6 A;  2GG8 A;  4S00 A;  1KP0 A;  2BHD A;  1R58 A;  2V6C A;  3S6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...