2Q94A

E. coli methionine aminopeptidase mn-form with inhibitor a04
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q94A00
4IECA 4ZWPA 4B28A 5JI6A 4A6WA 1WBQA 2EA2A 1C21A 4IPAA 3BIQA 2GG8A 2Q93A 4U69A 5CLSA 4U6CA 4IDYA 1WL6A 3PKDA 1A16A 3FM3A 1WLRA 4U6ZA 3MX6A 3CB6A 4S00A 2GZ5A 2HOWA 4U75A 1B6AA 1YJ3A 1WN1A 2GU6A 1XGOA 2GG5A 3RVAA 5CIKA 3PKBA 1KP0A 4FO7A 4IKSA 1WY2A 3IU9A 4A6VA 1WL9A 1C24A 1W2MA 1YVMA 2GGCA 1N51A 5FCHA 1C27A 1C23A 1R58A 1CHMA 1KQ0A 5FCFA 5CE6A 5E5BA 2EVMA 3TB5A 1B59A 4PV4A 1W7VA 2B3LA 4U76A 2BWYA 2Q8KA 4FKCA 2OKNA 2GG9A 1XNZA 4U6EA 2Q96A 4IF7A 2BHCA 3IU7A 2P98A 4FO8A 4FLJA 4U1BA 1JAWA 1XGNA 3IG4A 4FLKA 4U71A 3RORA 4S01A 2BHAA 4FLIA 3S6BA 1O0XA 3L7GA 5CDLA 1MATA 4OOKA 4QR8A 2Q92A 5JHUA 4Z7MA 4ZNGA 2NQ6A 4JUQA 2ZSGA 2BWWA 1QXYA 1R5GA 2BHBA 4IKRA 5D6EA 1QXZA 2P99A 2GG0A 2V3ZA 3IU8A 4S2RP 2BH3A 1XGMA 5CNXA 2DFIA 2V3YA 4FUKA 4RZZA 3MR1A 2MATA 2BWXA 4S2TP 3BITA 4MATA 4RGZ1 3PKCA 2BWUA 4U6JA 1KQ9A 3D27A 3Q6DA 4R60A 1YW8A 3CTZA 2V3XA 2B3KA 1C22A 2NQ7A 2GTXA 3MATA 1BOAA 4KM3A 3BIPA 2BWSA 3L24A 2GU7A 2GU5A 4ZWUA 2BWVA 2EVCA 2IW2A 3TAVA 1R5HA 2P9AA 3CB5A 1Y1NA 4U6WA 1WKMA 4IKUA 2BWTA 3FMRA 2ADUA 4EGEA 1QZYA 2B3HA 2BN7A 4HXXA 2Q95A 2Q94A 4FLLA 1YW9A 4RZYA 1YW7A 2GA2A 2GGBA 2GG7A 3PKAA 1PV9A 5D6FA 2BHDA 2OAZA 2EVOA 2GG3A 1BN5A 3FMQA 3PKEA 5CDEA 2BB7A 5CDVA 2V6CA 1QXWA 4ZWOA 1M35A 4U73A 5JFRA 4IKTA 4PNCA 1XGSA 2GU4A 2EA4A 4U70A 2GG2A 4IU6A 2G6PA
chains in the Genus database with same CATH superfamily
4IECA 4ZWPA 4B28A 5JI6A 4A6WA 1WBQA 2EA2A 1C21A 4IPAA 3BIQA 2GG8A 2Q93A 4U69A 5CLSA 4U6CA 4IDYA 1WL6A 3PKDA 1A16A 3FM3A 1WLRA 4U6ZA 3MX6A 3CB6A 4S00A 2GZ5A 2HOWA 4U75A 1B6AA 1YJ3A 1WN1A 2GU6A 1XGOA 2GG5A 3RVAA 5CIKA 3PKBA 1KP0A 4FO7A 4IKSA 1WY2A 3IU9A 4A6VA 1WL9A 1C24A 1W2MA 1YVMA 2GGCA 1N51A 5FCHA 1C27A 1C23A 1R58A 1CHMA 1KQ0A 5FCFA 5CE6A 5E5BA 2EVMA 3TB5A 1B59A 4PV4A 1W7VA 2B3LA 4U76A 2BWYA 2Q8KA 4FKCA 2OKNA 2GG9A 1XNZA 4U6EA 2Q96A 4IF7A 2BHCA 3IU7A 2P98A 4FO8A 4FLJA 4U1BA 1JAWA 1XGNA 3IG4A 4FLKA 4U71A 3RORA 4S01A 2BHAA 4FLIA 3S6BA 1O0XA 3L7GA 5CDLA 1MATA 4OOKA 4QR8A 2Q92A 5JHUA 4Z7MA 4ZNGA 2NQ6A 4JUQA 2ZSGA 2BWWA 1QXYA 1R5GA 2BHBA 4IKRA 5D6EA 1QXZA 2P99A 2GG0A 2V3ZA 3IU8A 4S2RP 2BH3A 1XGMA 5CNXA 2DFIA 2V3YA 4FUKA 4RZZA 3MR1A 2MATA 2BWXA 4S2TP 3BITA 4MATA 4RGZ1 3PKCA 2BWUA 4U6JA 1KQ9A 3D27A 3Q6DA 4R60A 1YW8A 3CTZA 2V3XA 2B3KA 1C22A 2NQ7A 2GTXA 3MATA 1BOAA 4KM3A 3BIPA 2BWSA 3L24A 2GU7A 2GU5A 4ZWUA 2BWVA 2EVCA 2IW2A 3TAVA 1R5HA 2P9AA 3CB5A 1Y1NA 4U6WA 1WKMA 4IKUA 2BWTA 3FMRA 2ADUA 4EGEA 1QZYA 2B3HA 2BN7A 4HXXA 2Q95A 2Q94A 4FLLA 1YW9A 4RZYA 1YW7A 2GA2A 2GGBA 2GG7A 3PKAA 1PV9A 5D6FA 2BHDA 2OAZA 2EVOA 2GG3A 1BN5A 3FMQA 3PKEA 5CDEA 2BB7A 5CDVA 2V6CA 1QXWA 4ZWOA 1M35A 4U73A 5JFRA 4IKTA 4PNCA 1XGSA 2GU4A 2EA4A 4U70A 2GG2A 4IU6A 2G6PA
chains in the Genus database with same CATH topology
4IECA 4ZWPA 4B28A 5JI6A 4A6WA 1WBQA 2EA2A 1C21A 4IPAA 3BIQA 2GG8A 2Q93A 4U69A 5CLSA 4U6CA 4IDYA 1WL6A 3PKDA 1A16A 3FM3A 1WLRA 4U6ZA 3MX6A 3CB6A 4S00A 2GZ5A 2HOWA 4U75A 1B6AA 1YJ3A 1WN1A 2GU6A 1XGOA 2GG5A 3RVAA 5CIKA 3PKBA 1KP0A 4FO7A 4IKSA 1WY2A 3IU9A 4A6VA 1WL9A 1C24A 1W2MA 1YVMA 2GGCA 1N51A 5FCHA 1C27A 1C23A 1R58A 1CHMA 1KQ0A 5FCFA 5CE6A 5E5BA 2EVMA 3TB5A 1B59A 4PV4A 1W7VA 2B3LA 4U76A 2BWYA 2Q8KA 4FKCA 2OKNA 2GG9A 1XNZA 4U6EA 2Q96A 4IF7A 2BHCA 3IU7A 2P98A 4FO8A 4FLJA 4U1BA 1JAWA 1XGNA 3IG4A 4FLKA 4U71A 3RORA 4S01A 2BHAA 4FLIA 3S6BA 1O0XA 3L7GA 5CDLA 1MATA 4OOKA 4QR8A 2Q92A 5JHUA 4Z7MA 4ZNGA 2NQ6A 4JUQA 2ZSGA 2BWWA 1QXYA 1R5GA 2BHBA 4IKRA 5D6EA 1QXZA 2P99A 2GG0A 2V3ZA 3IU8A 4S2RP 2BH3A 1XGMA 5CNXA 2DFIA 2V3YA 4FUKA 4RZZA 3MR1A 2MATA 2BWXA 4S2TP 3BITA 4MATA 4RGZ1 3PKCA 2BWUA 4U6JA 1KQ9A 3D27A 3Q6DA 4R60A 1YW8A 3CTZA 2V3XA 2B3KA 1C22A 2NQ7A 2GTXA 3MATA 1BOAA 4KM3A 3BIPA 2BWSA 3L24A 2GU7A 2GU5A 4ZWUA 2BWVA 2EVCA 2IW2A 3TAVA 1R5HA 2P9AA 3CB5A 1Y1NA 4U6WA 1WKMA 4IKUA 2BWTA 3FMRA 2ADUA 4EGEA 1QZYA 2B3HA 2BN7A 4HXXA 2Q95A 2Q94A 4FLLA 1YW9A 4RZYA 1YW7A 2GA2A 2GGBA 2GG7A 3PKAA 1PV9A 5D6FA 2BHDA 2OAZA 2EVOA 2GG3A 1BN5A 3FMQA 3PKEA 5CDEA 2BB7A 5CDVA 2V6CA 1QXWA 4ZWOA 1M35A 4U73A 5JFRA 4IKTA 4PNCA 1XGSA 2GU4A 2EA4A 4U70A 2GG2A 4IU6A 2G6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEC A;  4ZWP A;  4B28 A;  5JI6 A;  4A6W A;  1WBQ A;  2EA2 A;  1C21 A;  4IPA A;  3BIQ A;  2GG8 A;  2Q93 A;  4U69 A;  5CLS A;  4U6C A;  4IDY A;  1WL6 A;  3PKD A;  1A16 A;  3FM3 A;  1WLR A;  4U6Z A;  3MX6 A;  3CB6 A;  4S00 A;  2GZ5 A;  2HOW A;  4U75 A;  1B6A A;  1YJ3 A;  1WN1 A;  2GU6 A;  1XGO A;  2GG5 A;  3RVA A;  5CIK A;  3PKB A;  1KP0 A;  4FO7 A;  4IKS A;  1WY2 A;  3IU9 A;  4A6V A;  1WL9 A;  1C24 A;  1W2M A;  1YVM A;  2GGC A;  1N51 A;  5FCH A;  1C27 A;  1C23 A;  1R58 A;  1CHM A;  1KQ0 A;  5FCF A;  5CE6 A;  5E5B A;  2EVM A;  3TB5 A;  1B59 A;  4PV4 A;  1W7V A;  2B3L A;  4U76 A;  2BWY A;  2Q8K A;  4FKC A;  2OKN A;  2GG9 A;  1XNZ A;  4U6E A;  2Q96 A;  4IF7 A;  2BHC A;  3IU7 A;  2P98 A;  4FO8 A;  4FLJ A;  4U1B A;  1JAW A;  1XGN A;  3IG4 A;  4FLK A;  4U71 A;  3ROR A;  4S01 A;  2BHA A;  4FLI A;  3S6B A;  1O0X A;  3L7G A;  5CDL A;  1MAT A;  4OOK A;  4QR8 A;  2Q92 A;  5JHU A;  4Z7M A;  4ZNG A;  2NQ6 A;  4JUQ A;  2ZSG A;  2BWW A;  1QXY A;  1R5G A;  2BHB A;  4IKR A;  5D6E A;  1QXZ A;  2P99 A;  2GG0 A;  2V3Z A;  3IU8 A;  4S2R P;  2BH3 A;  1XGM A;  5CNX A;  2DFI A;  2V3Y A;  4FUK A;  4RZZ A;  3MR1 A;  2MAT A;  2BWX A;  4S2T P;  3BIT A;  4MAT A;  4RGZ 1;  3PKC A;  2BWU A;  4U6J A;  1KQ9 A;  3D27 A;  3Q6D A;  4R60 A;  1YW8 A;  3CTZ A;  2V3X A;  2B3K A;  1C22 A;  2NQ7 A;  2GTX A;  3MAT A;  1BOA A;  4KM3 A;  3BIP A;  2BWS A;  3L24 A;  2GU7 A;  2GU5 A;  4ZWU A;  2BWV A;  2EVC A;  2IW2 A;  3TAV A;  1R5H A;  2P9A A;  3CB5 A;  1Y1N A;  4U6W A;  1WKM A;  4IKU A;  2BWT A;  3FMR A;  2ADU A;  4EGE A;  1QZY A;  2B3H A;  2BN7 A;  4HXX A;  2Q95 A;  2Q94 A;  4FLL A;  1YW9 A;  4RZY A;  1YW7 A;  2GA2 A;  2GGB A;  2GG7 A;  3PKA A;  1PV9 A;  5D6F A;  2BHD A;  2OAZ A;  2EVO A;  2GG3 A;  1BN5 A;  3FMQ A;  3PKE A;  5CDE A;  2BB7 A;  5CDV A;  2V6C A;  1QXW A;  4ZWO A;  1M35 A;  4U73 A;  5JFR A;  4IKT A;  4PNC A;  1XGS A;  2GU4 A;  2EA4 A;  4U70 A;  2GG2 A;  4IU6 A;  2G6P A; 
#chains in the Genus database with same CATH topology
 4IEC A;  4ZWP A;  4B28 A;  5JI6 A;  4A6W A;  1WBQ A;  2EA2 A;  1C21 A;  4IPA A;  3BIQ A;  2GG8 A;  2Q93 A;  4U69 A;  5CLS A;  4U6C A;  4IDY A;  1WL6 A;  3PKD A;  1A16 A;  3FM3 A;  1WLR A;  4U6Z A;  3MX6 A;  3CB6 A;  4S00 A;  2GZ5 A;  2HOW A;  4U75 A;  1B6A A;  1YJ3 A;  1WN1 A;  2GU6 A;  1XGO A;  2GG5 A;  3RVA A;  5CIK A;  3PKB A;  1KP0 A;  4FO7 A;  4IKS A;  1WY2 A;  3IU9 A;  4A6V A;  1WL9 A;  1C24 A;  1W2M A;  1YVM A;  2GGC A;  1N51 A;  5FCH A;  1C27 A;  1C23 A;  1R58 A;  1CHM A;  1KQ0 A;  5FCF A;  5CE6 A;  5E5B A;  2EVM A;  3TB5 A;  1B59 A;  4PV4 A;  1W7V A;  2B3L A;  4U76 A;  2BWY A;  2Q8K A;  4FKC A;  2OKN A;  2GG9 A;  1XNZ A;  4U6E A;  2Q96 A;  4IF7 A;  2BHC A;  3IU7 A;  2P98 A;  4FO8 A;  4FLJ A;  4U1B A;  1JAW A;  1XGN A;  3IG4 A;  4FLK A;  4U71 A;  3ROR A;  4S01 A;  2BHA A;  4FLI A;  3S6B A;  1O0X A;  3L7G A;  5CDL A;  1MAT A;  4OOK A;  4QR8 A;  2Q92 A;  5JHU A;  4Z7M A;  4ZNG A;  2NQ6 A;  4JUQ A;  2ZSG A;  2BWW A;  1QXY A;  1R5G A;  2BHB A;  4IKR A;  5D6E A;  1QXZ A;  2P99 A;  2GG0 A;  2V3Z A;  3IU8 A;  4S2R P;  2BH3 A;  1XGM A;  5CNX A;  2DFI A;  2V3Y A;  4FUK A;  4RZZ A;  3MR1 A;  2MAT A;  2BWX A;  4S2T P;  3BIT A;  4MAT A;  4RGZ 1;  3PKC A;  2BWU A;  4U6J A;  1KQ9 A;  3D27 A;  3Q6D A;  4R60 A;  1YW8 A;  3CTZ A;  2V3X A;  2B3K A;  1C22 A;  2NQ7 A;  2GTX A;  3MAT A;  1BOA A;  4KM3 A;  3BIP A;  2BWS A;  3L24 A;  2GU7 A;  2GU5 A;  4ZWU A;  2BWV A;  2EVC A;  2IW2 A;  3TAV A;  1R5H A;  2P9A A;  3CB5 A;  1Y1N A;  4U6W A;  1WKM A;  4IKU A;  2BWT A;  3FMR A;  2ADU A;  4EGE A;  1QZY A;  2B3H A;  2BN7 A;  4HXX A;  2Q95 A;  2Q94 A;  4FLL A;  1YW9 A;  4RZY A;  1YW7 A;  2GA2 A;  2GGB A;  2GG7 A;  3PKA A;  1PV9 A;  5D6F A;  2BHD A;  2OAZ A;  2EVO A;  2GG3 A;  1BN5 A;  3FMQ A;  3PKE A;  5CDE A;  2BB7 A;  5CDV A;  2V6C A;  1QXW A;  4ZWO A;  1M35 A;  4U73 A;  5JFR A;  4IKT A;  4PNC A;  1XGS A;  2GU4 A;  2EA4 A;  4U70 A;  2GG2 A;  4IU6 A;  2G6P A; 
#chains in the Genus database with same CATH homology
 4IEC A;  4ZWP A;  4B28 A;  5JI6 A;  4A6W A;  1WBQ A;  2EA2 A;  1C21 A;  4IPA A;  3BIQ A;  2GG8 A;  2Q93 A;  4U69 A;  5CLS A;  4U6C A;  4IDY A;  1WL6 A;  3PKD A;  1A16 A;  3FM3 A;  1WLR A;  4U6Z A;  3MX6 A;  3CB6 A;  4S00 A;  2GZ5 A;  2HOW A;  4U75 A;  1B6A A;  1YJ3 A;  1WN1 A;  2GU6 A;  1XGO A;  2GG5 A;  3RVA A;  5CIK A;  3PKB A;  1KP0 A;  4FO7 A;  4IKS A;  1WY2 A;  3IU9 A;  4A6V A;  1WL9 A;  1C24 A;  1W2M A;  1YVM A;  2GGC A;  1N51 A;  5FCH A;  1C27 A;  1C23 A;  1R58 A;  1CHM A;  1KQ0 A;  5FCF A;  5CE6 A;  5E5B A;  2EVM A;  3TB5 A;  1B59 A;  4PV4 A;  1W7V A;  2B3L A;  4U76 A;  2BWY A;  2Q8K A;  4FKC A;  2OKN A;  2GG9 A;  1XNZ A;  4U6E A;  2Q96 A;  4IF7 A;  2BHC A;  3IU7 A;  2P98 A;  4FO8 A;  4FLJ A;  4U1B A;  1JAW A;  1XGN A;  3IG4 A;  4FLK A;  4U71 A;  3ROR A;  4S01 A;  2BHA A;  4FLI A;  3S6B A;  1O0X A;  3L7G A;  5CDL A;  1MAT A;  4OOK A;  4QR8 A;  2Q92 A;  5JHU A;  4Z7M A;  4ZNG A;  2NQ6 A;  4JUQ A;  2ZSG A;  2BWW A;  1QXY A;  1R5G A;  2BHB A;  4IKR A;  5D6E A;  1QXZ A;  2P99 A;  2GG0 A;  2V3Z A;  3IU8 A;  4S2R P;  2BH3 A;  1XGM A;  5CNX A;  2DFI A;  2V3Y A;  4FUK A;  4RZZ A;  3MR1 A;  2MAT A;  2BWX A;  4S2T P;  3BIT A;  4MAT A;  4RGZ 1;  3PKC A;  2BWU A;  4U6J A;  1KQ9 A;  3D27 A;  3Q6D A;  4R60 A;  1YW8 A;  3CTZ A;  2V3X A;  2B3K A;  1C22 A;  2NQ7 A;  2GTX A;  3MAT A;  1BOA A;  4KM3 A;  3BIP A;  2BWS A;  3L24 A;  2GU7 A;  2GU5 A;  4ZWU A;  2BWV A;  2EVC A;  2IW2 A;  3TAV A;  1R5H A;  2P9A A;  3CB5 A;  1Y1N A;  4U6W A;  1WKM A;  4IKU A;  2BWT A;  3FMR A;  2ADU A;  4EGE A;  1QZY A;  2B3H A;  2BN7 A;  4HXX A;  2Q95 A;  2Q94 A;  4FLL A;  1YW9 A;  4RZY A;  1YW7 A;  2GA2 A;  2GGB A;  2GG7 A;  3PKA A;  1PV9 A;  5D6F A;  2BHD A;  2OAZ A;  2EVO A;  2GG3 A;  1BN5 A;  3FMQ A;  3PKE A;  5CDE A;  2BB7 A;  5CDV A;  2V6C A;  1QXW A;  4ZWO A;  1M35 A;  4U73 A;  5JFR A;  4IKT A;  4PNC A;  1XGS A;  2GU4 A;  2EA4 A;  4U70 A;  2GG2 A;  4IU6 A;  2G6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...