2Q94A

E. coli methionine aminopeptidase mn-form with inhibitor a04
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q94A00
1O0XA 1XGNA 2EVMA 2GA2A 3IG4A 2EA2A 3FMQA 2Q94A 4JUQA 4ZWPA 2B3HA 4MATA 4U6WA 4R60A 1WLRA 1KQ0A 3D27A 3PKCA 4RGZ1 3FM3A 2EA4A 2IW2A 4FLKA 1CHMA 4IECA 3RVAA 3MATA 2BWSA 5JFRA 3PKBA 2EVCA 4ZWUA 2OKNA 4IKUA 5FCHA 1XGOA 2BWVA 1C24A 2P9AA 2V3YA 3CB5A 2GGBA 3CB6A 1Y1NA 1QXWA 2GG7A 1KP0A 4U6JA 2NQ6A 1BN5A 5JI6A 5CNXA 5D6EA 4FLLA 2B3LA 2GU4A 4FKCA 5JHUA 3MR1A 3PKAA 4IU6A 4U76A 2G6PA 1QXZA 1W2MA 4S00A 4QR8A 2V6CA 1JAWA 1C21A 5CDLA 4RZYA 1WN1A 4U1BA 2P98A 4U6EA 4U75A 3TB5A 1WKMA 3BITA 4FLJA 4ZWOA 1XGSA 2NQ7A 2GU6A 2GGCA 1C27A 3BIPA 2P99A 3IU7A 2BHBA 1R58A 1YW9A 2B3KA 4U6CA 2GG5A 1C23A 2ADUA 1W7VA 2OAZA 1YW7A 2Q8KA 2ZSGA 2GG8A 2GG3A 4PNCA 3TAVA 1B59A 3FMRA 4S2RP 2DFIA 4FO7A 5CE6A 1PV9A 4U70A 2GZ5A 3IU8A 1QZYA 1KQ9A 2MATA 3PKEA 1C22A 4S01A 3PKDA 1R5HA 1WY2A 5CDVA 4A6WA 1XGMA 2GG2A 2Q93A 3L24A 4A6VA 1WL6A 2GTXA 4IPAA 3RORA 2BWXA 4ZNGA 1B6AA 2HOWA 4B28A 4FO8A 1WL9A 4KM3A 4Z7MA 4RZZA 1YW8A 3IU9A 2BH3A 4IDYA 4U6ZA 2Q95A 5E5BA 1XNZA 2BN7A 5CIKA 2BWTA 5FCFA 3S6BA 4FUKA 4EGEA 2BHCA 2GU7A 4IKTA 4PV4A 5CDEA 4IF7A 2GU5A 3CTZA 2BHAA 1BOAA 4U73A 1MATA 1R5GA 2Q92A 3L7GA 4IKRA 5D6FA 1M35A 2BB7A 1YVMA 2GG0A 1YJ3A 2BWWA 2V3XA 4HXXA 1QXYA 1A16A 4S2TP 5CLSA 2GG9A 1WBQA 3MX6A 2Q96A 4U71A 4U69A 4OOKA 1N51A 2BWYA 2EVOA 4IKSA 3BIQA 2BWUA 3Q6DA 2BHDA 4FLIA 2V3ZA
chains in the Genus database with same CATH superfamily
1O0XA 1XGNA 2EVMA 2GA2A 3IG4A 2EA2A 3FMQA 2Q94A 4JUQA 4ZWPA 2B3HA 4MATA 4U6WA 4R60A 1WLRA 1KQ0A 3D27A 3PKCA 4RGZ1 3FM3A 2EA4A 2IW2A 4FLKA 1CHMA 4IECA 3RVAA 3MATA 2BWSA 5JFRA 3PKBA 2EVCA 4ZWUA 2OKNA 4IKUA 5FCHA 1XGOA 2BWVA 1C24A 2P9AA 2V3YA 3CB5A 2GGBA 3CB6A 1Y1NA 1QXWA 2GG7A 1KP0A 4U6JA 2NQ6A 1BN5A 5JI6A 5CNXA 5D6EA 4FLLA 2B3LA 2GU4A 4FKCA 5JHUA 3MR1A 3PKAA 4IU6A 4U76A 2G6PA 1QXZA 1W2MA 4S00A 4QR8A 2V6CA 1JAWA 1C21A 5CDLA 4RZYA 1WN1A 4U1BA 2P98A 4U6EA 4U75A 3TB5A 1WKMA 3BITA 4FLJA 4ZWOA 1XGSA 2NQ7A 2GU6A 2GGCA 1C27A 3BIPA 2P99A 3IU7A 2BHBA 1R58A 1YW9A 2B3KA 4U6CA 2GG5A 1C23A 2ADUA 1W7VA 2OAZA 1YW7A 2Q8KA 2ZSGA 2GG8A 2GG3A 4PNCA 3TAVA 1B59A 3FMRA 4S2RP 2DFIA 4FO7A 5CE6A 1PV9A 4U70A 2GZ5A 3IU8A 1QZYA 1KQ9A 2MATA 3PKEA 1C22A 4S01A 3PKDA 1R5HA 1WY2A 5CDVA 4A6WA 1XGMA 2GG2A 2Q93A 3L24A 4A6VA 1WL6A 2GTXA 4IPAA 3RORA 2BWXA 4ZNGA 1B6AA 2HOWA 4B28A 4FO8A 1WL9A 4KM3A 4Z7MA 4RZZA 1YW8A 3IU9A 2BH3A 4IDYA 4U6ZA 2Q95A 5E5BA 1XNZA 2BN7A 5CIKA 2BWTA 5FCFA 3S6BA 4FUKA 4EGEA 2BHCA 2GU7A 4IKTA 4PV4A 5CDEA 4IF7A 2GU5A 3CTZA 2BHAA 1BOAA 4U73A 1MATA 1R5GA 2Q92A 3L7GA 4IKRA 5D6FA 1M35A 2BB7A 1YVMA 2GG0A 1YJ3A 2BWWA 2V3XA 4HXXA 1QXYA 1A16A 4S2TP 5CLSA 2GG9A 1WBQA 3MX6A 2Q96A 4U71A 4U69A 4OOKA 1N51A 2BWYA 2EVOA 4IKSA 3BIQA 2BWUA 3Q6DA 2BHDA 4FLIA 2V3ZA
chains in the Genus database with same CATH topology
1O0XA 1XGNA 2EVMA 2GA2A 3IG4A 2EA2A 3FMQA 2Q94A 4JUQA 4ZWPA 2B3HA 4MATA 4U6WA 4R60A 1WLRA 1KQ0A 3D27A 3PKCA 4RGZ1 3FM3A 2EA4A 2IW2A 4FLKA 1CHMA 4IECA 3RVAA 3MATA 2BWSA 5JFRA 3PKBA 2EVCA 4ZWUA 2OKNA 4IKUA 5FCHA 1XGOA 2BWVA 1C24A 2P9AA 2V3YA 3CB5A 2GGBA 3CB6A 1Y1NA 1QXWA 2GG7A 1KP0A 4U6JA 2NQ6A 1BN5A 5JI6A 5CNXA 5D6EA 4FLLA 2B3LA 2GU4A 4FKCA 5JHUA 3MR1A 3PKAA 4IU6A 4U76A 2G6PA 1QXZA 1W2MA 4S00A 4QR8A 2V6CA 1JAWA 1C21A 5CDLA 4RZYA 1WN1A 4U1BA 2P98A 4U6EA 4U75A 3TB5A 1WKMA 3BITA 4FLJA 4ZWOA 1XGSA 2NQ7A 2GU6A 2GGCA 1C27A 3BIPA 2P99A 3IU7A 2BHBA 1R58A 1YW9A 2B3KA 4U6CA 2GG5A 1C23A 2ADUA 1W7VA 2OAZA 1YW7A 2Q8KA 2ZSGA 2GG8A 2GG3A 4PNCA 3TAVA 1B59A 3FMRA 4S2RP 2DFIA 4FO7A 5CE6A 1PV9A 4U70A 2GZ5A 3IU8A 1QZYA 1KQ9A 2MATA 3PKEA 1C22A 4S01A 3PKDA 1R5HA 1WY2A 5CDVA 4A6WA 1XGMA 2GG2A 2Q93A 3L24A 4A6VA 1WL6A 2GTXA 4IPAA 3RORA 2BWXA 4ZNGA 1B6AA 2HOWA 4B28A 4FO8A 1WL9A 4KM3A 4Z7MA 4RZZA 1YW8A 3IU9A 2BH3A 4IDYA 4U6ZA 2Q95A 5E5BA 1XNZA 2BN7A 5CIKA 2BWTA 5FCFA 3S6BA 4FUKA 4EGEA 2BHCA 2GU7A 4IKTA 4PV4A 5CDEA 4IF7A 2GU5A 3CTZA 2BHAA 1BOAA 4U73A 1MATA 1R5GA 2Q92A 3L7GA 4IKRA 5D6FA 1M35A 2BB7A 1YVMA 2GG0A 1YJ3A 2BWWA 2V3XA 4HXXA 1QXYA 1A16A 4S2TP 5CLSA 2GG9A 1WBQA 3MX6A 2Q96A 4U71A 4U69A 4OOKA 1N51A 2BWYA 2EVOA 4IKSA 3BIQA 2BWUA 3Q6DA 2BHDA 4FLIA 2V3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  1XGN A;  2EVM A;  2GA2 A;  3IG4 A;  2EA2 A;  3FMQ A;  2Q94 A;  4JUQ A;  4ZWP A;  2B3H A;  4MAT A;  4U6W A;  4R60 A;  1WLR A;  1KQ0 A;  3D27 A;  3PKC A;  4RGZ 1;  3FM3 A;  2EA4 A;  2IW2 A;  4FLK A;  1CHM A;  4IEC A;  3RVA A;  3MAT A;  2BWS A;  5JFR A;  3PKB A;  2EVC A;  4ZWU A;  2OKN A;  4IKU A;  5FCH A;  1XGO A;  2BWV A;  1C24 A;  2P9A A;  2V3Y A;  3CB5 A;  2GGB A;  3CB6 A;  1Y1N A;  1QXW A;  2GG7 A;  1KP0 A;  4U6J A;  2NQ6 A;  1BN5 A;  5JI6 A;  5CNX A;  5D6E A;  4FLL A;  2B3L A;  2GU4 A;  4FKC A;  5JHU A;  3MR1 A;  3PKA A;  4IU6 A;  4U76 A;  2G6P A;  1QXZ A;  1W2M A;  4S00 A;  4QR8 A;  2V6C A;  1JAW A;  1C21 A;  5CDL A;  4RZY A;  1WN1 A;  4U1B A;  2P98 A;  4U6E A;  4U75 A;  3TB5 A;  1WKM A;  3BIT A;  4FLJ A;  4ZWO A;  1XGS A;  2NQ7 A;  2GU6 A;  2GGC A;  1C27 A;  3BIP A;  2P99 A;  3IU7 A;  2BHB A;  1R58 A;  1YW9 A;  2B3K A;  4U6C A;  2GG5 A;  1C23 A;  2ADU A;  1W7V A;  2OAZ A;  1YW7 A;  2Q8K A;  2ZSG A;  2GG8 A;  2GG3 A;  4PNC A;  3TAV A;  1B59 A;  3FMR A;  4S2R P;  2DFI A;  4FO7 A;  5CE6 A;  1PV9 A;  4U70 A;  2GZ5 A;  3IU8 A;  1QZY A;  1KQ9 A;  2MAT A;  3PKE A;  1C22 A;  4S01 A;  3PKD A;  1R5H A;  1WY2 A;  5CDV A;  4A6W A;  1XGM A;  2GG2 A;  2Q93 A;  3L24 A;  4A6V A;  1WL6 A;  2GTX A;  4IPA A;  3ROR A;  2BWX A;  4ZNG A;  1B6A A;  2HOW A;  4B28 A;  4FO8 A;  1WL9 A;  4KM3 A;  4Z7M A;  4RZZ A;  1YW8 A;  3IU9 A;  2BH3 A;  4IDY A;  4U6Z A;  2Q95 A;  5E5B A;  1XNZ A;  2BN7 A;  5CIK A;  2BWT A;  5FCF A;  3S6B A;  4FUK A;  4EGE A;  2BHC A;  2GU7 A;  4IKT A;  4PV4 A;  5CDE A;  4IF7 A;  2GU5 A;  3CTZ A;  2BHA A;  1BOA A;  4U73 A;  1MAT A;  1R5G A;  2Q92 A;  3L7G A;  4IKR A;  5D6F A;  1M35 A;  2BB7 A;  1YVM A;  2GG0 A;  1YJ3 A;  2BWW A;  2V3X A;  4HXX A;  1QXY A;  1A16 A;  4S2T P;  5CLS A;  2GG9 A;  1WBQ A;  3MX6 A;  2Q96 A;  4U71 A;  4U69 A;  4OOK A;  1N51 A;  2BWY A;  2EVO A;  4IKS A;  3BIQ A;  2BWU A;  3Q6D A;  2BHD A;  4FLI A;  2V3Z A; 
#chains in the Genus database with same CATH topology
 1O0X A;  1XGN A;  2EVM A;  2GA2 A;  3IG4 A;  2EA2 A;  3FMQ A;  2Q94 A;  4JUQ A;  4ZWP A;  2B3H A;  4MAT A;  4U6W A;  4R60 A;  1WLR A;  1KQ0 A;  3D27 A;  3PKC A;  4RGZ 1;  3FM3 A;  2EA4 A;  2IW2 A;  4FLK A;  1CHM A;  4IEC A;  3RVA A;  3MAT A;  2BWS A;  5JFR A;  3PKB A;  2EVC A;  4ZWU A;  2OKN A;  4IKU A;  5FCH A;  1XGO A;  2BWV A;  1C24 A;  2P9A A;  2V3Y A;  3CB5 A;  2GGB A;  3CB6 A;  1Y1N A;  1QXW A;  2GG7 A;  1KP0 A;  4U6J A;  2NQ6 A;  1BN5 A;  5JI6 A;  5CNX A;  5D6E A;  4FLL A;  2B3L A;  2GU4 A;  4FKC A;  5JHU A;  3MR1 A;  3PKA A;  4IU6 A;  4U76 A;  2G6P A;  1QXZ A;  1W2M A;  4S00 A;  4QR8 A;  2V6C A;  1JAW A;  1C21 A;  5CDL A;  4RZY A;  1WN1 A;  4U1B A;  2P98 A;  4U6E A;  4U75 A;  3TB5 A;  1WKM A;  3BIT A;  4FLJ A;  4ZWO A;  1XGS A;  2NQ7 A;  2GU6 A;  2GGC A;  1C27 A;  3BIP A;  2P99 A;  3IU7 A;  2BHB A;  1R58 A;  1YW9 A;  2B3K A;  4U6C A;  2GG5 A;  1C23 A;  2ADU A;  1W7V A;  2OAZ A;  1YW7 A;  2Q8K A;  2ZSG A;  2GG8 A;  2GG3 A;  4PNC A;  3TAV A;  1B59 A;  3FMR A;  4S2R P;  2DFI A;  4FO7 A;  5CE6 A;  1PV9 A;  4U70 A;  2GZ5 A;  3IU8 A;  1QZY A;  1KQ9 A;  2MAT A;  3PKE A;  1C22 A;  4S01 A;  3PKD A;  1R5H A;  1WY2 A;  5CDV A;  4A6W A;  1XGM A;  2GG2 A;  2Q93 A;  3L24 A;  4A6V A;  1WL6 A;  2GTX A;  4IPA A;  3ROR A;  2BWX A;  4ZNG A;  1B6A A;  2HOW A;  4B28 A;  4FO8 A;  1WL9 A;  4KM3 A;  4Z7M A;  4RZZ A;  1YW8 A;  3IU9 A;  2BH3 A;  4IDY A;  4U6Z A;  2Q95 A;  5E5B A;  1XNZ A;  2BN7 A;  5CIK A;  2BWT A;  5FCF A;  3S6B A;  4FUK A;  4EGE A;  2BHC A;  2GU7 A;  4IKT A;  4PV4 A;  5CDE A;  4IF7 A;  2GU5 A;  3CTZ A;  2BHA A;  1BOA A;  4U73 A;  1MAT A;  1R5G A;  2Q92 A;  3L7G A;  4IKR A;  5D6F A;  1M35 A;  2BB7 A;  1YVM A;  2GG0 A;  1YJ3 A;  2BWW A;  2V3X A;  4HXX A;  1QXY A;  1A16 A;  4S2T P;  5CLS A;  2GG9 A;  1WBQ A;  3MX6 A;  2Q96 A;  4U71 A;  4U69 A;  4OOK A;  1N51 A;  2BWY A;  2EVO A;  4IKS A;  3BIQ A;  2BWU A;  3Q6D A;  2BHD A;  4FLI A;  2V3Z A; 
#chains in the Genus database with same CATH homology
 1O0X A;  1XGN A;  2EVM A;  2GA2 A;  3IG4 A;  2EA2 A;  3FMQ A;  2Q94 A;  4JUQ A;  4ZWP A;  2B3H A;  4MAT A;  4U6W A;  4R60 A;  1WLR A;  1KQ0 A;  3D27 A;  3PKC A;  4RGZ 1;  3FM3 A;  2EA4 A;  2IW2 A;  4FLK A;  1CHM A;  4IEC A;  3RVA A;  3MAT A;  2BWS A;  5JFR A;  3PKB A;  2EVC A;  4ZWU A;  2OKN A;  4IKU A;  5FCH A;  1XGO A;  2BWV A;  1C24 A;  2P9A A;  2V3Y A;  3CB5 A;  2GGB A;  3CB6 A;  1Y1N A;  1QXW A;  2GG7 A;  1KP0 A;  4U6J A;  2NQ6 A;  1BN5 A;  5JI6 A;  5CNX A;  5D6E A;  4FLL A;  2B3L A;  2GU4 A;  4FKC A;  5JHU A;  3MR1 A;  3PKA A;  4IU6 A;  4U76 A;  2G6P A;  1QXZ A;  1W2M A;  4S00 A;  4QR8 A;  2V6C A;  1JAW A;  1C21 A;  5CDL A;  4RZY A;  1WN1 A;  4U1B A;  2P98 A;  4U6E A;  4U75 A;  3TB5 A;  1WKM A;  3BIT A;  4FLJ A;  4ZWO A;  1XGS A;  2NQ7 A;  2GU6 A;  2GGC A;  1C27 A;  3BIP A;  2P99 A;  3IU7 A;  2BHB A;  1R58 A;  1YW9 A;  2B3K A;  4U6C A;  2GG5 A;  1C23 A;  2ADU A;  1W7V A;  2OAZ A;  1YW7 A;  2Q8K A;  2ZSG A;  2GG8 A;  2GG3 A;  4PNC A;  3TAV A;  1B59 A;  3FMR A;  4S2R P;  2DFI A;  4FO7 A;  5CE6 A;  1PV9 A;  4U70 A;  2GZ5 A;  3IU8 A;  1QZY A;  1KQ9 A;  2MAT A;  3PKE A;  1C22 A;  4S01 A;  3PKD A;  1R5H A;  1WY2 A;  5CDV A;  4A6W A;  1XGM A;  2GG2 A;  2Q93 A;  3L24 A;  4A6V A;  1WL6 A;  2GTX A;  4IPA A;  3ROR A;  2BWX A;  4ZNG A;  1B6A A;  2HOW A;  4B28 A;  4FO8 A;  1WL9 A;  4KM3 A;  4Z7M A;  4RZZ A;  1YW8 A;  3IU9 A;  2BH3 A;  4IDY A;  4U6Z A;  2Q95 A;  5E5B A;  1XNZ A;  2BN7 A;  5CIK A;  2BWT A;  5FCF A;  3S6B A;  4FUK A;  4EGE A;  2BHC A;  2GU7 A;  4IKT A;  4PV4 A;  5CDE A;  4IF7 A;  2GU5 A;  3CTZ A;  2BHA A;  1BOA A;  4U73 A;  1MAT A;  1R5G A;  2Q92 A;  3L7G A;  4IKR A;  5D6F A;  1M35 A;  2BB7 A;  1YVM A;  2GG0 A;  1YJ3 A;  2BWW A;  2V3X A;  4HXX A;  1QXY A;  1A16 A;  4S2T P;  5CLS A;  2GG9 A;  1WBQ A;  3MX6 A;  2Q96 A;  4U71 A;  4U69 A;  4OOK A;  1N51 A;  2BWY A;  2EVO A;  4IKS A;  3BIQ A;  2BWU A;  3Q6D A;  2BHD A;  4FLI A;  2V3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...