2Q9PA

Human diphosphoinositol polyphosphate phosphohydrolase 1, mg-f complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
b'RTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 1
publication title Crystal structure of human diphosphoinositol phosphatase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 34
structure length 132
sequence length 132
ec nomenclature ec 3.6.1.52: Diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2q9pA00
1XSCA 1X84A 5LPGA 2DUKA 2DSDA 3L85A 4KG3A 3P6YA 3I9XA 1KHZA 3KVHA 2Q9PA 5FSOA 3SONA 5BONA 4JZTA 2AZWA 4JZUA 2DSBA 4N1UA 1SJYA 3X0PA 3EXQA 3BM4A 1SOIA 3EF5A 5FSIA 3ACAA 2YVPA 5GHPA 1VCDA 2G73A 2KDVA 1VIQA 1PPXA 2A8PA 3RH7A 5DDGA 4MPOA 4S2YA 3BAPA 3OGAA 5C8LA 4V14A 2QKMB 2GB5A 5GHJA 4JZVA 1VHZA 2O5WA 4C9WA 4ZG0A 1MQEA 3Q91A 3AC9A 1Q33A 5ANVA 1NQZA 1SU2A 2XSQA 3Q4IA 5DEQA 2GT4A 2DHOA 2QJOA 5CFIA 5ISYA 1V8RA 2ICKA 5GHQA 3X0RA 2W4EA 5ANWA 5FSMA 3X0OA 1K26A 1MQWA 1X51A 3DKUA 3GZ8A 1HZTA 1PUQA 1V8UA 1V8IA 2A8SA 2ICJA 2O1CA 3FK9A 2KDWA 1VC9A 1VK6A 1XSBA 3ID9A 2I8TA 4HFQA 2I6KA 3FFUA 2FVVA 4YPRA 1HX3A 3CNGA 3FJYA 3O8SA 1RRSA 5HZXA 3O52A 4YOQA 1NFZA 1PPWA 1V8NA 3HYQA 2O5FA 1I9AA 5IW4A 3GZ6A 1PPVA 1SZ3A 3Q1PA 4S2VA 3N9UA 3HHJA 2A8RA 1PUSA 3I7UA 1JKNA 3COUA 3N77A 1G9QA 1V8LA 3X0SA 3MDIA 2A8TA 3X0JA 5DPKA 2DSCA 3F13A 3X0MA 5IW5A 4DYWA 1V8VA 2VNQA 3ZR1A 1R67A 3O61A 1V8WA 3Q2TA 2GT2A 1OW2A 1F3YA 1NFSA 1V8TA 2YVNA 5DD4A 3FCMA 5ANTA 2B0VA 1KTGA 4IJXA 5GHIA 3ZR0A 1V8MA 3F6AA 3WHWA 2FKBA 3GWYA 5GHMA 3A6TA 1Q54A 5GHOA 4JZSA 5BS6A 5CFJA 2A8QA 1IRYA 1RRQA 3O6ZA 3FSPA 5C7QA 1VHGA 3GRNA 3MDGA 2JVBA 2J8QA 1VIUA 3A6UA 4KYXA 3MGMA 5FSNA 4HVYA 3DUPA 2FMLA 1JRKA 2G74A 1KT9A 3E57A 3QSJA 4ICKA 3R03A 3BHOA 5FSKA 3SMDA 1GA7A 1QVJA 1XSAA 3MCFA 3O69A 5I8UA 2YYHA 3X0KA 3G0QA 2R5WA 3X0NA 3EESA 2A6TA 1V8SA 1TUMA 1V8YA 5C7TA 1MP2A 4NFWA 5ANSA 1G0SA 2PNYA 2PQVA 2QJTA 3Q2SA 1X83A 3GG6A 1RYAA 4ILQA 2RRKA 2YVOA 3J7Ye 1PUNA 3A6SA 1PVFA 1VC8A 2CL3A 4KTBA 2I8UA 4KG4A 1U20A 5FSLA 2YVMA 1VRLA 2B2KA 4N1TA 4YPHA 3GZ5A 3U53A 3Q93A 5ANUA 1NQYA 1MR2A 1K2EA 3I7VA 4S2WA 5GHNA 3A6VA 3X0QA 3P5TA 4K6EA 2VNPA 3EEUA 4S2XA 4NFXA 1MK1A 2B06A 3X0LA 4C9XA 1MUTA 1Q27A 3SHDA 3X0IA 3H95A
chains in the Genus database with same CATH superfamily
1XSCA 1X84A 5LPGA 2DUKA 2DSDA 3L85A 4KG3A 3P6YA 3I9XA 1KHZA 3KVHA 2Q9PA 5FSOA 3SONA 5BONA 4JZTA 2AZWA 4JZUA 2DSBA 4N1UA 1SJYA 3X0PA 3EXQA 3BM4A 1SOIA 3EF5A 5FSIA 3ACAA 2YVPA 5GHPA 1VCDA 2G73A 2KDVA 1VIQA 1PPXA 2A8PA 3RH7A 5DDGA 4MPOA 4S2YA 3BAPA 3OGAA 5C8LA 4V14A 2QKMB 2GB5A 5GHJA 4JZVA 1VHZA 2O5WA 4C9WA 4ZG0A 1MQEA 3Q91A 3AC9A 1Q33A 2CZRA 5ANVA 1NQZA 1SU2A 2XSQA 3Q4IA 5DEQA 2GT4A 2DHOA 2QJOA 5CFIA 5ISYA 1V8RA 2ICKA 5GHQA 3X0RA 2W4EA 5ANWA 5FSMA 3X0OA 1K26A 1MQWA 1X51A 3DKUA 3GZ8A 1HZTA 1PUQA 1V8UA 1V8IA 2A8SA 2ICJA 2O1CA 3FK9A 2KDWA 1VC9A 1VK6A 1XSBA 3ID9A 2I8TA 4HFQA 2I6KA 3FFUA 2FVVA 4YPRA 1HX3A 3CNGA 3FJYA 3O8SA 1RRSA 5HZXA 3O52A 4YOQA 1NFZA 1PPWA 1V8NA 3HYQA 2O5FA 1I9AA 5IW4A 3GZ6A 1PPVA 1SZ3A 3Q1PA 4S2VA 3N9UA 3HHJA 2A8RA 1PUSA 3I7UA 1JKNA 3COUA 3N77A 1G9QA 1V8LA 3X0SA 3MDIA 2A8TA 3X0JA 5DPKA 2DSCA 3F13A 3X0MA 5IW5A 4DYWA 1V8VA 2VNQA 3ZR1A 1R67A 3O61A 1V8WA 3Q2TA 2GT2A 1OW2A 1F3YA 1NFSA 1V8TA 2YVNA 5DD4A 3FCMA 5ANTA 2B0VA 1KTGA 4IJXA 5GHIA 3ZR0A 1V8MA 3F6AA 3WHWA 2FKBA 3GWYA 5GHMA 3A6TA 1Q54A 5GHOA 4JZSA 5BS6A 5CFJA 2A8QA 1IRYA 1RRQA 3O6ZA 4J7GA 3FSPA 5C7QA 1VHGA 3GRNA 3MDGA 2JVBA 2J8QA 1VIUA 3A6UA 4KYXA 3MGMA 5FSNA 4HVYA 3DUPA 2FMLA 1JRKA 2G74A 1KT9A 3E57A 3QSJA 4ICKA 3R03A 3BHOA 5FSKA 3SMDA 1GA7A 1QVJA 1XSAA 3MCFA 3O69A 5I8UA 2YYHA 3X0KA 3G0QA 2R5WA 4J7HA 3X0NA 3EESA 2A6TA 1V8SA 1TUMA 1V8YA 5C7TA 1MP2A 4NFWA 5ANSA 1G0SA 2PNYA 2PQVA 2QJTA 3Q2SA 1X83A 3GG6A 1RYAA 4ILQA 2RRKA 2YVOA 3J7Ye 1PUNA 3A6SA 1PVFA 1VC8A 2CL3A 4KTBA 2I8UA 4KG4A 1U20A 5FSLA 2YVMA 1VRLA 2B2KA 4N1TA 4YPHA 3GZ5A 3U53A 3Q93A 5ANUA 1NQYA 1MR2A 1K2EA 3I7VA 4S2WA 5GHNA 3A6VA 3X0QA 3P5TA 4K6EA 2VNPA 3EEUA 4S2XA 4NFXA 1MK1A 2B06A 3X0LA 4C9XA 1MUTA 1Q27A 3SHDA 3X0IA 3H95A
chains in the Genus database with same CATH topology
1XSCA 1X84A 5LPGA 2DUKA 2DSDA 3L85A 4KG3A 3P6YA 3I9XA 1KHZA 3KVHA 2Q9PA 5FSOA 3SONA 5BONA 4JZTA 2AZWA 4JZUA 2DSBA 4N1UA 1SJYA 3X0PA 3EXQA 3BM4A 1SOIA 3EF5A 5FSIA 3ACAA 2YVPA 5GHPA 1VCDA 2G73A 2KDVA 1VIQA 1PPXA 2A8PA 3RH7A 5DDGA 4MPOA 4S2YA 3BAPA 3OGAA 5C8LA 4V14A 2QKMB 2GB5A 5GHJA 4JZVA 1VHZA 2O5WA 4C9WA 4ZG0A 1MQEA 3Q91A 3AC9A 1Q33A 2CZRA 5ANVA 1NQZA 1SU2A 2XSQA 3Q4IA 5DEQA 2GT4A 2DHOA 2QJOA 5CFIA 5ISYA 1V8RA 2ICKA 5GHQA 3X0RA 2W4EA 5ANWA 5FSMA 3X0OA 1K26A 1MQWA 1X51A 3DKUA 3GZ8A 1HZTA 1PUQA 1V8UA 1V8IA 2A8SA 2ICJA 2O1CA 3FK9A 2KDWA 1VC9A 1VK6A 1XSBA 3ID9A 2I8TA 4HFQA 2I6KA 3FFUA 2FVVA 4YPRA 1HX3A 3CNGA 3FJYA 3O8SA 1RRSA 5HZXA 3O52A 4YOQA 1NFZA 1PPWA 1V8NA 3HYQA 2O5FA 1I9AA 5IW4A 3GZ6A 1PPVA 1SZ3A 3Q1PA 4S2VA 3N9UA 3HHJA 2A8RA 1PUSA 3I7UA 1JKNA 3COUA 3N77A 1G9QA 1V8LA 3X0SA 3MDIA 2A8TA 3X0JA 5DPKA 2DSCA 3F13A 3X0MA 5IW5A 4DYWA 1V8VA 2VNQA 3ZR1A 1R67A 3O61A 1V8WA 3Q2TA 2GT2A 1OW2A 1F3YA 1NFSA 1V8TA 2YVNA 5DD4A 3FCMA 5ANTA 2B0VA 1KTGA 4IJXA 5GHIA 3ZR0A 1V8MA 3F6AA 3WHWA 2FKBA 3GWYA 5GHMA 3A6TA 1Q54A 5GHOA 4JZSA 5BS6A 5CFJA 2A8QA 1IRYA 1RRQA 3O6ZA 4J7GA 3FSPA 5C7QA 1VHGA 3GRNA 3MDGA 2JVBA 2J8QA 1VIUA 3A6UA 4KYXA 3MGMA 5FSNA 4HVYA 3DUPA 2FMLA 1JRKA 2G74A 1KT9A 3E57A 3QSJA 4ICKA 3R03A 3BHOA 5FSKA 3SMDA 1GA7A 1QVJA 1XSAA 3MCFA 3O69A 5I8UA 2YYHA 3X0KA 3G0QA 2R5WA 4J7HA 3X0NA 3EESA 2A6TA 1V8SA 1TUMA 1V8YA 5C7TA 1MP2A 4NFWA 5ANSA 1G0SA 2PNYA 2PQVA 2QJTA 3Q2SA 1X83A 3GG6A 1RYAA 4ILQA 2RRKA 2YVOA 3J7Ye 1PUNA 3A6SA 1PVFA 1VC8A 2CL3A 4KTBA 2I8UA 4KG4A 1U20A 5FSLA 2YVMA 1VRLA 2B2KA 4N1TA 4YPHA 3GZ5A 3U53A 3Q93A 5ANUA 1NQYA 1MR2A 1K2EA 3I7VA 4S2WA 5GHNA 3A6VA 3X0QA 3P5TA 4K6EA 2VNPA 3EEUA 4S2XA 4NFXA 1MK1A 2B06A 3X0LA 4C9XA 1MUTA 1Q27A 3SHDA 3X0IA 3H95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSC A;  1X84 A;  5LPG A;  2DUK A;  2DSD A;  3L85 A;  4KG3 A;  3P6Y A;  3I9X A;  1KHZ A;  3KVH A;  2Q9P A;  5FSO A;  3SON A;  5BON A;  4JZT A;  2AZW A;  4JZU A;  2DSB A;  4N1U A;  1SJY A;  3X0P A;  3EXQ A;  3BM4 A;  1SOI A;  3EF5 A;  5FSI A;  3ACA A;  2YVP A;  5GHP A;  1VCD A;  2G73 A;  2KDV A;  1VIQ A;  1PPX A;  2A8P A;  3RH7 A;  5DDG A;  4MPO A;  4S2Y A;  3BAP A;  3OGA A;  5C8L A;  4V14 A;  2QKM B;  2GB5 A;  5GHJ A;  4JZV A;  1VHZ A;  2O5W A;  4C9W A;  4ZG0 A;  1MQE A;  3Q91 A;  3AC9 A;  1Q33 A;  5ANV A;  1NQZ A;  1SU2 A;  2XSQ A;  3Q4I A;  5DEQ A;  2GT4 A;  2DHO A;  2QJO A;  5CFI A;  5ISY A;  1V8R A;  2ICK A;  5GHQ A;  3X0R A;  2W4E A;  5ANW A;  5FSM A;  3X0O A;  1K26 A;  1MQW A;  1X51 A;  3DKU A;  3GZ8 A;  1HZT A;  1PUQ A;  1V8U A;  1V8I A;  2A8S A;  2ICJ A;  2O1C A;  3FK9 A;  2KDW A;  1VC9 A;  1VK6 A;  1XSB A;  3ID9 A;  2I8T A;  4HFQ A;  2I6K A;  3FFU A;  2FVV A;  4YPR A;  1HX3 A;  3CNG A;  3FJY A;  3O8S A;  1RRS A;  5HZX A;  3O52 A;  4YOQ A;  1NFZ A;  1PPW A;  1V8N A;  3HYQ A;  2O5F A;  1I9A A;  5IW4 A;  3GZ6 A;  1PPV A;  1SZ3 A;  3Q1P A;  4S2V A;  3N9U A;  3HHJ A;  2A8R A;  1PUS A;  3I7U A;  1JKN A;  3COU A;  3N77 A;  1G9Q A;  1V8L A;  3X0S A;  3MDI A;  2A8T A;  3X0J A;  5DPK A;  2DSC A;  3F13 A;  3X0M A;  5IW5 A;  4DYW A;  1V8V A;  2VNQ A;  3ZR1 A;  1R67 A;  3O61 A;  1V8W A;  3Q2T A;  2GT2 A;  1OW2 A;  1F3Y A;  1NFS A;  1V8T A;  2YVN A;  5DD4 A;  3FCM A;  5ANT A;  2B0V A;  1KTG A;  4IJX A;  5GHI A;  3ZR0 A;  1V8M A;  3F6A A;  3WHW A;  2FKB A;  3GWY A;  5GHM A;  3A6T A;  1Q54 A;  5GHO A;  4JZS A;  5BS6 A;  5CFJ A;  2A8Q A;  1IRY A;  1RRQ A;  3O6Z A;  3FSP A;  5C7Q A;  1VHG A;  3GRN A;  3MDG A;  2JVB A;  2J8Q A;  1VIU A;  3A6U A;  4KYX A;  3MGM A;  5FSN A;  4HVY A;  3DUP A;  2FML A;  1JRK A;  2G74 A;  1KT9 A;  3E57 A;  3QSJ A;  4ICK A;  3R03 A;  3BHO A;  5FSK A;  3SMD A;  1GA7 A;  1QVJ A;  1XSA A;  3MCF A;  3O69 A;  5I8U A;  2YYH A;  3X0K A;  3G0Q A;  2R5W A;  3X0N A;  3EES A;  2A6T A;  1V8S A;  1TUM A;  1V8Y A;  5C7T A;  1MP2 A;  4NFW A;  5ANS A;  1G0S A;  2PNY A;  2PQV A;  2QJT A;  3Q2S A;  1X83 A;  3GG6 A;  1RYA A;  4ILQ A;  2RRK A;  2YVO A;  3J7Y e;  1PUN A;  3A6S A;  1PVF A;  1VC8 A;  2CL3 A;  4KTB A;  2I8U A;  4KG4 A;  1U20 A;  5FSL A;  2YVM A;  1VRL A;  2B2K A;  4N1T A;  4YPH A;  3GZ5 A;  3U53 A;  3Q93 A;  5ANU A;  1NQY A;  1MR2 A;  1K2E A;  3I7V A;  4S2W A;  5GHN A;  3A6V A;  3X0Q A;  3P5T A;  4K6E A;  2VNP A;  3EEU A;  4S2X A;  4NFX A;  1MK1 A;  2B06 A;  3X0L A;  4C9X A;  1MUT A;  1Q27 A;  3SHD A;  3X0I A;  3H95 A; 
#chains in the Genus database with same CATH topology
 1XSC A;  1X84 A;  5LPG A;  2DUK A;  2DSD A;  3L85 A;  4KG3 A;  3P6Y A;  3I9X A;  1KHZ A;  3KVH A;  2Q9P A;  5FSO A;  3SON A;  5BON A;  4JZT A;  2AZW A;  4JZU A;  2DSB A;  4N1U A;  1SJY A;  3X0P A;  3EXQ A;  3BM4 A;  1SOI A;  3EF5 A;  5FSI A;  3ACA A;  2YVP A;  5GHP A;  1VCD A;  2G73 A;  2KDV A;  1VIQ A;  1PPX A;  2A8P A;  3RH7 A;  5DDG A;  4MPO A;  4S2Y A;  3BAP A;  3OGA A;  5C8L A;  4V14 A;  2QKM B;  2GB5 A;  5GHJ A;  4JZV A;  1VHZ A;  2O5W A;  4C9W A;  4ZG0 A;  1MQE A;  3Q91 A;  3AC9 A;  1Q33 A;  2CZR A;  5ANV A;  1NQZ A;  1SU2 A;  2XSQ A;  3Q4I A;  5DEQ A;  2GT4 A;  2DHO A;  2QJO A;  5CFI A;  5ISY A;  1V8R A;  2ICK A;  5GHQ A;  3X0R A;  2W4E A;  5ANW A;  5FSM A;  3X0O A;  1K26 A;  1MQW A;  1X51 A;  3DKU A;  3GZ8 A;  1HZT A;  1PUQ A;  1V8U A;  1V8I A;  2A8S A;  2ICJ A;  2O1C A;  3FK9 A;  2KDW A;  1VC9 A;  1VK6 A;  1XSB A;  3ID9 A;  2I8T A;  4HFQ A;  2I6K A;  3FFU A;  2FVV A;  4YPR A;  1HX3 A;  3CNG A;  3FJY A;  3O8S A;  1RRS A;  5HZX A;  3O52 A;  4YOQ A;  1NFZ A;  1PPW A;  1V8N A;  3HYQ A;  2O5F A;  1I9A A;  5IW4 A;  3GZ6 A;  1PPV A;  1SZ3 A;  3Q1P A;  4S2V A;  3N9U A;  3HHJ A;  2A8R A;  1PUS A;  3I7U A;  1JKN A;  3COU A;  3N77 A;  1G9Q A;  1V8L A;  3X0S A;  3MDI A;  2A8T A;  3X0J A;  5DPK A;  2DSC A;  3F13 A;  3X0M A;  5IW5 A;  4DYW A;  1V8V A;  2VNQ A;  3ZR1 A;  1R67 A;  3O61 A;  1V8W A;  3Q2T A;  2GT2 A;  1OW2 A;  1F3Y A;  1NFS A;  1V8T A;  2YVN A;  5DD4 A;  3FCM A;  5ANT A;  2B0V A;  1KTG A;  4IJX A;  5GHI A;  3ZR0 A;  1V8M A;  3F6A A;  3WHW A;  2FKB A;  3GWY A;  5GHM A;  3A6T A;  1Q54 A;  5GHO A;  4JZS A;  5BS6 A;  5CFJ A;  2A8Q A;  1IRY A;  1RRQ A;  3O6Z A;  4J7G A;  3FSP A;  5C7Q A;  1VHG A;  3GRN A;  3MDG A;  2JVB A;  2J8Q A;  1VIU A;  3A6U A;  4KYX A;  3MGM A;  5FSN A;  4HVY A;  3DUP A;  2FML A;  1JRK A;  2G74 A;  1KT9 A;  3E57 A;  3QSJ A;  4ICK A;  3R03 A;  3BHO A;  5FSK A;  3SMD A;  1GA7 A;  1QVJ A;  1XSA A;  3MCF A;  3O69 A;  5I8U A;  2YYH A;  3X0K A;  3G0Q A;  2R5W A;  4J7H A;  3X0N A;  3EES A;  2A6T A;  1V8S A;  1TUM A;  1V8Y A;  5C7T A;  1MP2 A;  4NFW A;  5ANS A;  1G0S A;  2PNY A;  2PQV A;  2QJT A;  3Q2S A;  1X83 A;  3GG6 A;  1RYA A;  4ILQ A;  2RRK A;  2YVO A;  3J7Y e;  1PUN A;  3A6S A;  1PVF A;  1VC8 A;  2CL3 A;  4KTB A;  2I8U A;  4KG4 A;  1U20 A;  5FSL A;  2YVM A;  1VRL A;  2B2K A;  4N1T A;  4YPH A;  3GZ5 A;  3U53 A;  3Q93 A;  5ANU A;  1NQY A;  1MR2 A;  1K2E A;  3I7V A;  4S2W A;  5GHN A;  3A6V A;  3X0Q A;  3P5T A;  4K6E A;  2VNP A;  3EEU A;  4S2X A;  4NFX A;  1MK1 A;  2B06 A;  3X0L A;  4C9X A;  1MUT A;  1Q27 A;  3SHD A;  3X0I A;  3H95 A; 
#chains in the Genus database with same CATH homology
 1XSC A;  1X84 A;  5LPG A;  2DUK A;  2DSD A;  3L85 A;  4KG3 A;  3P6Y A;  3I9X A;  1KHZ A;  3KVH A;  2Q9P A;  5FSO A;  3SON A;  5BON A;  4JZT A;  2AZW A;  4JZU A;  2DSB A;  4N1U A;  1SJY A;  3X0P A;  3EXQ A;  3BM4 A;  1SOI A;  3EF5 A;  5FSI A;  3ACA A;  2YVP A;  5GHP A;  1VCD A;  2G73 A;  2KDV A;  1VIQ A;  1PPX A;  2A8P A;  3RH7 A;  5DDG A;  4MPO A;  4S2Y A;  3BAP A;  3OGA A;  5C8L A;  4V14 A;  2QKM B;  2GB5 A;  5GHJ A;  4JZV A;  1VHZ A;  2O5W A;  4C9W A;  4ZG0 A;  1MQE A;  3Q91 A;  3AC9 A;  1Q33 A;  2CZR A;  5ANV A;  1NQZ A;  1SU2 A;  2XSQ A;  3Q4I A;  5DEQ A;  2GT4 A;  2DHO A;  2QJO A;  5CFI A;  5ISY A;  1V8R A;  2ICK A;  5GHQ A;  3X0R A;  2W4E A;  5ANW A;  5FSM A;  3X0O A;  1K26 A;  1MQW A;  1X51 A;  3DKU A;  3GZ8 A;  1HZT A;  1PUQ A;  1V8U A;  1V8I A;  2A8S A;  2ICJ A;  2O1C A;  3FK9 A;  2KDW A;  1VC9 A;  1VK6 A;  1XSB A;  3ID9 A;  2I8T A;  4HFQ A;  2I6K A;  3FFU A;  2FVV A;  4YPR A;  1HX3 A;  3CNG A;  3FJY A;  3O8S A;  1RRS A;  5HZX A;  3O52 A;  4YOQ A;  1NFZ A;  1PPW A;  1V8N A;  3HYQ A;  2O5F A;  1I9A A;  5IW4 A;  3GZ6 A;  1PPV A;  1SZ3 A;  3Q1P A;  4S2V A;  3N9U A;  3HHJ A;  2A8R A;  1PUS A;  3I7U A;  1JKN A;  3COU A;  3N77 A;  1G9Q A;  1V8L A;  3X0S A;  3MDI A;  2A8T A;  3X0J A;  5DPK A;  2DSC A;  3F13 A;  3X0M A;  5IW5 A;  4DYW A;  1V8V A;  2VNQ A;  3ZR1 A;  1R67 A;  3O61 A;  1V8W A;  3Q2T A;  2GT2 A;  1OW2 A;  1F3Y A;  1NFS A;  1V8T A;  2YVN A;  5DD4 A;  3FCM A;  5ANT A;  2B0V A;  1KTG A;  4IJX A;  5GHI A;  3ZR0 A;  1V8M A;  3F6A A;  3WHW A;  2FKB A;  3GWY A;  5GHM A;  3A6T A;  1Q54 A;  5GHO A;  4JZS A;  5BS6 A;  5CFJ A;  2A8Q A;  1IRY A;  1RRQ A;  3O6Z A;  4J7G A;  3FSP A;  5C7Q A;  1VHG A;  3GRN A;  3MDG A;  2JVB A;  2J8Q A;  1VIU A;  3A6U A;  4KYX A;  3MGM A;  5FSN A;  4HVY A;  3DUP A;  2FML A;  1JRK A;  2G74 A;  1KT9 A;  3E57 A;  3QSJ A;  4ICK A;  3R03 A;  3BHO A;  5FSK A;  3SMD A;  1GA7 A;  1QVJ A;  1XSA A;  3MCF A;  3O69 A;  5I8U A;  2YYH A;  3X0K A;  3G0Q A;  2R5W A;  4J7H A;  3X0N A;  3EES A;  2A6T A;  1V8S A;  1TUM A;  1V8Y A;  5C7T A;  1MP2 A;  4NFW A;  5ANS A;  1G0S A;  2PNY A;  2PQV A;  2QJT A;  3Q2S A;  1X83 A;  3GG6 A;  1RYA A;  4ILQ A;  2RRK A;  2YVO A;  3J7Y e;  1PUN A;  3A6S A;  1PVF A;  1VC8 A;  2CL3 A;  4KTB A;  2I8U A;  4KG4 A;  1U20 A;  5FSL A;  2YVM A;  1VRL A;  2B2K A;  4N1T A;  4YPH A;  3GZ5 A;  3U53 A;  3Q93 A;  5ANU A;  1NQY A;  1MR2 A;  1K2E A;  3I7V A;  4S2W A;  5GHN A;  3A6V A;  3X0Q A;  3P5T A;  4K6E A;  2VNP A;  3EEU A;  4S2X A;  4NFX A;  1MK1 A;  2B06 A;  3X0L A;  4C9X A;  1MUT A;  1Q27 A;  3SHD A;  3X0I A;  3H95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...