2Q9XA

Crystal structure of highly stable mutant q40p/s47i/h93g of human fibroblast growth factor-1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
PKLLYCSNGGHFLRILPDGTVDGTRDRSDPHIQLQLIAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENGYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Crystal structure of highly stable mutant Q40P/S47I/H93G of human fibroblast growth factor-1
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 33
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2q9xA00
1IRAX 4TLPA 3QYDA 1DLLA 1II4A 1PWAA 1ISWA 3CA4A 1W3FA 1AF9A 2ZR1B 1K5VA 3AJ5A 3F62B 4Q91A 4FGFA 3BAUA 1ONKB 1DFQA 2D22A 4AN6A 4G6MA 3O4OA 3MPPG 1ITBA 2BEAA 41BIA 4I37A 3FJIA 4JP0A 2Z49A 4IZEA 1JT7A 1T4QA 2BEBA 2HWAA 1S0DA 3LLPA 4G1RA 3MALA 1BFGA 2NTDA 2J3PA 3H6RB 2YUGA 1ISYA 4QALA 3D7WB 1GGPB 1ISZA 4HR6C 3ZXGA 1DIWA 3FJFA 3JRRA 3WMUA 1Q1UA 3WINA 3BAHA 3UJ4A 2FO1A 1VCLA 3BB2A 3AZWA 3A07A 4J2SA 1FMZA 3HBWA 4LO2A 1WBAA 3B9UA 3CRIA 3AKGA 4I2SA 4LO1A 3HALA 4ZFWB 4ZOTA 5JMCA 3WO2A 3NBNA 4H9WA 4I0YA 3RTIB 4OWJA 1IT0A 3FJJA 1FWUA 3VT2A 3CQAA 5F8YA 1BLDA 3A22A 1JLXA 3H6QA 3ILAA 3S8JA 4ZFUB 4H04A 2HW9A 3FFZA 5G00A 5DZUA 3VT0A 3CA5A 5EG6C 1S0BA 4P0JA 4A7KA 5GAQA 1TP0A 4JAWA 3AKIA 2Y9GA 1E0OA 3NBCA 2K8RA 4X38A 1QQKA 3BTAA 1TWEA 4I8MA 3VSZA 4ISQA 1PC8B 3FJAA 1YTOA 1QXMA 4P0KA 4Z9WB 2RG9B 3FJ9A 5FNWA 3A21A 4Z8SB 3PHZA 3FJHA 2MIBA 1AVAC 1AVXB 4Q9GA 3W9TA 3BRGC 5DUYA 1AXMA 1L2HA 5BOWA 4QD2C 3FJKA 1V6WA 4L4HA 1IRPA 3O4AA 1V6XA 3O5WB 2AQZA 1TWMA 1DZDA 3V0AB 1FGAA 1WBCA 3CA1A 1HCDA 2ET2A 3AKHA 1I1EA 3VUOA 1M2TB 4LO7C 2KH2A 3O4BA 4DCKC 2NP0A 2L5XA 1DQGA 4JKQA 4QBCA 1YYNA 4A7ZA 3BAVA 1FV3A 1IHKA 4J2KA 4KC3A 6I1BA 3Q7XA 1HIBA 1W3GA 2UUSA 3N0KA 1NZKA 2ZQOA 2D44A 5FZYA 1S0FA 3CRHA 2DRZA 4P0LA 1RMLA 4QKSA 3O44A 4JQ0A 2IHOA 4QO3A 1BARA 2KI4A 2NYYA 2NVHA 3AH4A 2NM1A 1BFBA 1PUUB 3V0BB 1M16A 3WO3A 2E4MC 4I6IA 1IILA 3AZVA 3BADA 1AFCA 2AXMA 3AJ6A 4OWKA 1JY0A 1XHBA 1YXWA 1V6UA 1ISVA 3N7KA 5B2HA 2D24A 3O49A 3V79C 1HWNB 4D8HA 1F31A 8I1BA 3IM7A 4L4IA 4G6JA 4IZXA 3CAHA 2KLLA 4I4YA 1XG6A 2GO2A 3BX1C 5JLVA 3OBTA 3BA5A 4ZBVB 3RMXA 2VXRA 3RTJB 3VT1A 4IY9A 2D7RA 4IHZA 2RQ9A 1G9DA 4LO0C 4XFUA 3FJCA 1DQOA 2P23A 3FUOA 3UJ0A 3IM5A 2QN4A 3FJEA 1BFFA 4EFQA 4I4UA 4EEEB 1EVTA 3UD9A 4ZFYB 1CVSA 1Q03A 4LO3C 3FUQA 5F8SA 1IOBA 4J2YA 4I4SA 4DENA 2D7IA 2KKIA 1PZZA 3T8SA 3I2XA 1J0SA 1TFMB 1ILR1 2BFHA 1EYLA 1EV2A 2R9KB 4I3NA 1UPSA 5FZZA 2ESUA 1BFCA 4X39A 2D1ZA 4IONA 4D0TA 3BRFA 3HN1A 1YBIA 3JUTA 4ZGRB 5E24E 2X2SA 1G82A 1HCEA 4GAIA 4A7YA 3BAOA 4QC4A 5DSSB 1MD6A 3ZXDA 1EPWA 2KI6B 31BIA 4J2XA 3UDAA 5DVHA 2E4MA 3KMVA 2X2TA 3Q7YA 3HOMA 4JKXB 1SZ6B 5D62A 1TOOA 1ISXA 3RMYA 1MC9A 4Q9PA 3F1RA 3NJ5A 2P39A 1S0EA 1Z4SA 4QBVA 4ISRA 4GOVA 3IAGC 1HKNA 2F2FC 1RZOB 3H6RA 4OWLA 2M49A 5BQUC 4F83A 3AKFA 4LO0A 2F8XC 5F90A 3CA3A 3NBDA 3RSJA 3CRGA 1Q04A 3P6JA 1T9FA 3PUBA 4KBBA 3IM6A 2AFGA 4HA2A 4LO3A 4USOA 4HJJA 2HWMA 2DS0A 1RG8A 1WD4A 4KEIA 4XFSA 2WBCA 3CA0A 3EF2A 4IY8A 3WO4A 3I2AA 4GOYA 3N7MA 3POKA 4I4VA 3Q7WA 4GP3A 2WRYA 3VEQA 3FJDA 1HWPB 2D23A 3BAQA 3H6SE 1K5UA 1BASA 1JT5A 1NUNA 5BXSA 1ABRB 1G9CA 3I29B 1SR4C 2K4AB 3SNVA 4R6UB 5BXRA 1D0HA 4GAFA 3ZX7A 4IQPA 1OQLB 2Y9FA 3ZC9A 2DREA 3N7LA 1DFCA 4IYBA 3FJ8A 4ZA3B 5F8WA 3UD8A 2Q3NB 3HSMA 2K43A 3OBRA 4I4OA 1IJTA 4I4XA 3QR5A 3OJ2A 1G9BA 2D20A 3E8LC 1PUMB 4EKXB 2MLLB 1JT3A 3V0AA 4I96A 4KEJA 1QQLA 4P6AA 3C9ZA 4ZKTB 1FV2A 1R8NA 2F2FA 1FMMS 1XYFA 2VU9A 2RSTA 5BQUA 2VSAA 3CU1B 2ZQNA 1G9AA 5HPZA 2FFVA 5EC5A 5BXPA 4I4PA 4OW4A 4I1BA 4JPZA 5EHAA 1HWOB 1JLYA 1FQ9A 3PG0A 3UD7A 4XFTA 5BP5C 3O4CA 2Y9XE 1V6VA 3CA6A 3WA1A 3A23A 1AVUA 3P53A 3ZC8A 3OJMA 2ERMA 2GZBA 7I1BA 4G9MA 1HWMB 2Q9XA 3V0BA 4WBCA 4ENDA 4I7IA 1BA7A 4J23B 2FGFA 5D61A 2VUAA 3OJVA 4X3AA 4XKIA 3S8KA 3FJBA 3IIRA 5FZUA 3VSFA 2NZ9A 3WMVA 1YF8B 1R8OA 1XZZA 3HMYA 4CJMA 1CE7B 3R4UA 3FGMA 2LIQA 3BA4A 3PMEA 4PC4A 4DEPA 4ZLBB 1TTUA 3O3QA 1SR4A 1KNMA 1I1BA 1N4KA 1FN0A 4OEGA 3AH1A 1AVWB 3BRDA 1W3AA 4OUJA 4EFRA 1JTCA 2FFUA 1A8DA 1JQZA 2VXTI 3K1XA 2FDBM 3O4DA 1FWVA 1BLAA 4QKRA 9ILBA 1Z0HA 5BVPI 4II0A 4I1EA 2AAIB 4GP0A 4OEFA 3TC2A 3R4SA 4AN7B 2VLCA 1DJSB 2HZ9A 2MC2A 5BXTA 3AH2A 5D63A 4QD2B 3BA7A 2D43A 2Z48A 3WINC 2I1BA 2VSEA 1DZCA 4EFPA 2XOAA 4LO2C 1Z2VA 1RY7A 4LO1C 4YOLA 4I4QA 4D0ZA 1WD3A 1TIEA 4EB2B 4KEKA 1S0CA 3OGGA 5BP5A 3NBEA 21BIA 3P6IA 4LO7B 4F34A 4I4RA 1S0LA 2DRYA 2IWTB 1JT4A 4G9NA 5I1BA 1P63A 4FVVA 4USPA 1S0GA 4LO8B 2Y9WC 4JRAA 2LIEA 4OEEA 3BAGA 2QYIB 3N7JA 3OGFA 5FNXA 4X37A 3LTQA 3VWCA
chains in the Genus database with same CATH superfamily
1IRAX 4TLPA 3QYDA 1DLLA 1II4A 1PWAA 1ISWA 3CA4A 1W3FA 1AF9A 2ZR1B 1K5VA 3AJ5A 3F62B 4Q91A 4FGFA 3BAUA 1ONKB 1DFQA 2D22A 4AN6A 4G6MA 3O4OA 3MPPG 1ITBA 2BEAA 41BIA 4I37A 3FJIA 4JP0A 2Z49A 4IZEA 1JT7A 1T4QA 2BEBA 2HWAA 1S0DA 3LLPA 4G1RA 3MALA 1BFGA 2NTDA 2J3PA 3H6RB 2YUGA 1ISYA 4QALA 3D7WB 1GGPB 1ISZA 4HR6C 3ZXGA 1DIWA 3FJFA 3JRRA 3WMUA 1Q1UA 3WINA 3BAHA 3UJ4A 2FO1A 1VCLA 3BB2A 3AZWA 3A07A 4J2SA 1FMZA 3HBWA 4LO2A 1WBAA 3B9UA 3CRIA 3AKGA 4I2SA 4LO1A 3HALA 4ZFWB 4ZOTA 5JMCA 3WO2A 3NBNA 4H9WA 4I0YA 3RTIB 4OWJA 1IT0A 3FJJA 1FWUA 3VT2A 3CQAA 5F8YA 1BLDA 3A22A 1JLXA 3H6QA 3ILAA 3S8JA 4ZFUB 4H04A 2HW9A 3FFZA 5G00A 5DZUA 3VT0A 3CA5A 5EG6C 1S0BA 4P0JA 4A7KA 5GAQA 1TP0A 4JAWA 3AKIA 2Y9GA 1E0OA 3NBCA 2K8RA 4X38A 1QQKA 3BTAA 1TWEA 4I8MA 3VSZA 4ISQA 1PC8B 3FJAA 1YTOA 1QXMA 4P0KA 4Z9WB 2RG9B 3FJ9A 5FNWA 3A21A 4Z8SB 3PHZA 3FJHA 2MIBA 1AVAC 1AVXB 4Q9GA 3W9TA 3BRGC 5DUYA 4H75A 1AXMA 1L2HA 5BOWA 4QD2C 3FJKA 1V6WA 4L4HA 1IRPA 3O4AA 1V6XA 3O5WB 2AQZA 1TWMA 1DZDA 3V0AB 1FGAA 1WBCA 3CA1A 1HCDA 2ET2A 3AKHA 1I1EA 3VUOA 1M2TB 4LO7C 2KH2A 3O4BA 4DCKC 2NP0A 2L5XA 1DQGA 4JKQA 4QBCA 1YYNA 4A7ZA 3BAVA 1FV3A 1IHKA 4J2KA 4KC3A 6I1BA 3Q7XA 1HIBA 1W3GA 2UUSA 3N0KA 1NZKA 2ZQOA 2D44A 5FZYA 1S0FA 3CRHA 2DRZA 4P0LA 1RMLA 4QKSA 3O44A 4JQ0A 2IHOA 4QO3A 1BARA 2KI4A 2NYYA 2NVHA 3AH4A 2NM1A 1BFBA 1PUUB 3V0BB 1M16A 3WO3A 2E4MC 4I6IA 1IILA 3AZVA 3BADA 1AFCA 2AXMA 3AJ6A 4OWKA 4MZGB 1JY0A 1XHBA 1YXWA 1V6UA 1ISVA 3N7KA 5B2HA 2D24A 3O49A 3V79C 1HWNB 4D8HA 1F31A 8I1BA 3IM7A 4L4IA 4G6JA 4IZXA 3CAHA 2KLLA 4I4YA 1XG6A 2GO2A 3BX1C 5JLVA 3OBTA 3BA5A 4ZBVB 3RMXA 2VXRA 3RTJB 3VT1A 4IY9A 2D7RA 4IHZA 2RQ9A 1G9DA 4LO0C 4XFUA 3FJCA 1DQOA 2P23A 3FUOA 3UJ0A 3IM5A 2QN4A 3FJEA 1BFFA 4EFQA 4I4UA 4EEEB 1EVTA 3UD9A 4ZFYB 1CVSA 1Q03A 4LO3C 3FUQA 5F8SA 1IOBA 4J2YA 4I4SA 4DENA 2D7IA 2KKIA 1PZZA 3T8SA 3I2XA 1J0SA 1TFMB 1ILR1 2BFHA 1EYLA 1EV2A 2R9KB 4I3NA 1UPSA 5FZZA 2ESUA 1BFCA 4X39A 2D1ZA 4IONA 4D0TA 3BRFA 3HN1A 1YBIA 3JUTA 4ZGRB 4UY4A 5E24E 2X2SA 1G82A 1HCEA 4GAIA 4A7YA 3BAOA 4QC4A 5DSSB 1MD6A 3ZXDA 1EPWA 2KI6B 31BIA 4J2XA 3UDAA 5DVHA 2E4MA 3KMVA 2X2TA 3Q7YA 3HOMA 4JKXB 1SZ6B 5D62A 1TOOA 1ISXA 3RMYA 1MC9A 4Q9PA 3F1RA 3NJ5A 2P39A 1S0EA 1Z4SA 4QBVA 4ISRA 4GOVA 3IAGC 1HKNA 2F2FC 1RZOB 3H6RA 4OWLA 2M49A 5BQUC 4F83A 3AKFA 4LO0A 2F8XC 5F90A 3CA3A 3NBDA 3RSJA 3CRGA 1Q04A 3P6JA 1T9FA 3PUBA 4MZFB 4KBBA 3IM6A 2AFGA 4HA2A 4LO3A 4USOA 4HJJA 2HWMA 2DS0A 1RG8A 1WD4A 4KEIA 4XFSA 2WBCA 3CA0A 3EF2A 4IY8A 3WO4A 3I2AA 4GOYA 3N7MA 3POKA 4I4VA 3Q7WA 4GP3A 2WRYA 3VEQA 3FJDA 1HWPB 2D23A 3BAQA 3H6SE 1K5UA 1BASA 1JT5A 1NUNA 5BXSA 1ABRB 1G9CA 3I29B 1SR4C 2K4AB 3SNVA 4R6UB 5BXRA 1D0HA 4GAFA 3ZX7A 4IQPA 1OQLB 2Y9FA 3ZC9A 2DREA 3N7LA 1DFCA 4IYBA 3FJ8A 4ZA3B 5F8WA 3UD8A 2Q3NB 3HSMA 2K43A 3OBRA 4I4OA 1IJTA 4I4XA 3QR5A 3OJ2A 1G9BA 2D20A 3E8LC 1PUMB 4EKXB 2MLLB 1JT3A 3V0AA 4I96A 4KEJA 1QQLA 4P6AA 3C9ZA 4ZKTB 1FV2A 1R8NA 2F2FA 1FMMS 1XYFA 2VU9A 2RSTA 5BQUA 2VSAA 3CU1B 2ZQNA 1G9AA 5HPZA 2FFVA 5EC5A 5BXPA 4I4PA 4OW4A 4I1BA 4JPZA 5EHAA 4MZHA 1HWOB 1JLYA 1FQ9A 3PG0A 3UD7A 4XFTA 5BP5C 3O4CA 2Y9XE 1V6VA 3CA6A 3WA1A 3A23A 1AVUA 3P53A 3ZC8A 3OJMA 2ERMA 2GZBA 7I1BA 4G9MA 1HWMB 2Q9XA 3V0BA 4WBCA 4ENDA 4I7IA 1BA7A 4J23B 2FGFA 5D61A 2VUAA 3OJVA 4X3AA 4XKIA 3S8KA 3FJBA 3IIRA 5FZUA 3VSFA 2NZ9A 3WMVA 1YF8B 1R8OA 1XZZA 3HMYA 4CJMA 1CE7B 3R4UA 3FGMA 2LIQA 3BA4A 3PMEA 4PC4A 4DEPA 4ZLBB 1TTUA 3O3QA 1SR4A 1KNMA 1I1BA 1N4KA 1FN0A 4OEGA 3AH1A 1AVWB 3BRDA 1W3AA 4OUJA 4EFRA 1JTCA 2FFUA 1A8DA 1JQZA 2VXTI 3K1XA 2FDBM 3O4DA 1FWVA 1BLAA 4QKRA 9ILBA 1Z0HA 5BVPI 4II0A 4I1EA 2AAIB 4GP0A 2NS2A 4OEFA 3TC2A 3R4SA 4AN7B 2VLCA 1DJSB 2HZ9A 2MC2A 5BXTA 3AH2A 5D63A 4QD2B 3BA7A 2D43A 2Z48A 3WINC 2I1BA 2VSEA 1DZCA 4EFPA 2XOAA 4LO2C 1Z2VA 1RY7A 4LO1C 4YOLA 4I4QA 4D0ZA 1WD3A 1TIEA 4EB2B 4KEKA 1S0CA 3OGGA 5BP5A 3NBEA 21BIA 3P6IA 4LO7B 4F34A 4I4RA 1S0LA 2DRYA 2IWTB 1JT4A 4G9NA 5I1BA 1P63A 4FVVA 4USPA 1S0GA 4LO8B 2Y9WC 4JRAA 2LIEA 4OEEA 3BAGA 2QYIB 3N7JA 3OGFA 5FNXA 4X37A 3LTQA 3VWCA
chains in the Genus database with same CATH topology
1IRAX 4TLPA 3QYDA 1DLLA 1II4A 1PWAA 1ISWA 3CA4A 1W3FA 1AF9A 2ZR1B 1K5VA 3AJ5A 3F62B 4Q91A 4FGFA 3BAUA 1ONKB 1DFQA 2D22A 4AN6A 4G6MA 3O4OA 3MPPG 1ITBA 2BEAA 41BIA 4I37A 3FJIA 4JP0A 2Z49A 4IZEA 1JT7A 1T4QA 2BEBA 2HWAA 1S0DA 3LLPA 4G1RA 3MALA 1BFGA 2NTDA 2J3PA 3H6RB 2YUGA 1ISYA 4QALA 3D7WB 1GGPB 1ISZA 4HR6C 3ZXGA 1DIWA 3FJFA 3JRRA 3WMUA 1Q1UA 3WINA 3BAHA 3UJ4A 2FO1A 1VCLA 3BB2A 3AZWA 3A07A 4J2SA 1FMZA 3HBWA 4LO2A 1WBAA 3B9UA 3CRIA 3AKGA 4I2SA 4LO1A 3HALA 4ZFWB 4ZOTA 5JMCA 3WO2A 3NBNA 4H9WA 4I0YA 3RTIB 4OWJA 1IT0A 3FJJA 1FWUA 3VT2A 3CQAA 5F8YA 1BLDA 3A22A 1JLXA 3H6QA 3ILAA 3S8JA 4ZFUB 4H04A 2HW9A 3FFZA 5G00A 5DZUA 3VT0A 3CA5A 5EG6C 1S0BA 4P0JA 4A7KA 5GAQA 1TP0A 4JAWA 3AKIA 2Y9GA 1E0OA 3NBCA 2K8RA 4X38A 1QQKA 3BTAA 1TWEA 4I8MA 3VSZA 4ISQA 1PC8B 3FJAA 1YTOA 1QXMA 4P0KA 4Z9WB 2RG9B 3FJ9A 5FNWA 3A21A 4Z8SB 3PHZA 3FJHA 2MIBA 1AVAC 1AVXB 4Q9GA 3W9TA 3BRGC 5DUYA 4H75A 1AXMA 1L2HA 5BOWA 4QD2C 3FJKA 1V6WA 4L4HA 1IRPA 3O4AA 1V6XA 3O5WB 2AQZA 1TWMA 1DZDA 3V0AB 1FGAA 1WBCA 3CA1A 1HCDA 2ET2A 3AKHA 1I1EA 3VUOA 1M2TB 4LO7C 2KH2A 3O4BA 4DCKC 2NP0A 2L5XA 1DQGA 4JKQA 4QBCA 1YYNA 4A7ZA 3BAVA 1FV3A 1IHKA 4J2KA 4KC3A 6I1BA 3Q7XA 1HIBA 1W3GA 2UUSA 3N0KA 1NZKA 2ZQOA 2D44A 5FZYA 1S0FA 3CRHA 2DRZA 4P0LA 1RMLA 4QKSA 3O44A 4JQ0A 2IHOA 4QO3A 1BARA 2KI4A 2NYYA 2NVHA 3AH4A 2NM1A 1BFBA 1PUUB 3V0BB 1M16A 3WO3A 2E4MC 4I6IA 1IILA 3AZVA 3BADA 1AFCA 2AXMA 3AJ6A 4OWKA 4MZGB 1JY0A 1XHBA 1YXWA 1V6UA 1ISVA 3N7KA 5B2HA 2D24A 3O49A 3V79C 1HWNB 4D8HA 1F31A 8I1BA 3IM7A 4L4IA 4G6JA 4IZXA 3CAHA 2KLLA 4I4YA 1XG6A 2GO2A 3BX1C 5JLVA 3OBTA 3BA5A 4ZBVB 3RMXA 2VXRA 3RTJB 3VT1A 4IY9A 2D7RA 4IHZA 2RQ9A 1G9DA 4LO0C 4XFUA 3FJCA 1DQOA 2P23A 3FUOA 3UJ0A 3IM5A 2QN4A 3FJEA 1BFFA 4EFQA 4I4UA 4EEEB 1EVTA 3UD9A 4ZFYB 1CVSA 1Q03A 4LO3C 3FUQA 5F8SA 1IOBA 4J2YA 4I4SA 4DENA 2D7IA 2KKIA 1PZZA 3T8SA 3I2XA 1J0SA 1TFMB 1ILR1 2BFHA 1EYLA 1EV2A 2R9KB 4I3NA 1UPSA 5FZZA 2ESUA 1BFCA 4X39A 2D1ZA 4IONA 4D0TA 3BRFA 3HN1A 1YBIA 3JUTA 4ZGRB 4UY4A 5E24E 2X2SA 1G82A 1HCEA 4GAIA 4A7YA 3BAOA 4QC4A 5DSSB 1MD6A 3ZXDA 1EPWA 2KI6B 31BIA 4J2XA 3UDAA 5DVHA 2E4MA 3KMVA 2X2TA 3Q7YA 3HOMA 4JKXB 1SZ6B 5D62A 1TOOA 1ISXA 3RMYA 1MC9A 4Q9PA 3F1RA 3NJ5A 2P39A 1S0EA 1Z4SA 4QBVA 4ISRA 4GOVA 3IAGC 1HKNA 2F2FC 1RZOB 3H6RA 4OWLA 2M49A 5BQUC 4F83A 3AKFA 4LO0A 2F8XC 5F90A 3CA3A 3NBDA 3RSJA 3CRGA 1Q04A 3P6JA 1T9FA 3PUBA 4MZFB 4KBBA 3IM6A 2AFGA 4HA2A 4LO3A 4USOA 4HJJA 2HWMA 2DS0A 1RG8A 1WD4A 4KEIA 4XFSA 2WBCA 3CA0A 3EF2A 4IY8A 3WO4A 3I2AA 4GOYA 3N7MA 3POKA 4I4VA 3Q7WA 4GP3A 2WRYA 3VEQA 3FJDA 1HWPB 2D23A 3BAQA 3H6SE 1K5UA 1BASA 1JT5A 1NUNA 5BXSA 1ABRB 1G9CA 3I29B 1SR4C 2K4AB 3SNVA 4R6UB 5BXRA 1D0HA 4GAFA 3ZX7A 4IQPA 1OQLB 2Y9FA 3ZC9A 2DREA 3N7LA 1DFCA 4IYBA 3FJ8A 4ZA3B 5F8WA 3UD8A 2Q3NB 3HSMA 2K43A 3OBRA 4I4OA 1IJTA 4I4XA 3QR5A 3OJ2A 1G9BA 2D20A 3E8LC 1PUMB 4EKXB 2MLLB 1JT3A 3V0AA 4I96A 4KEJA 1QQLA 4P6AA 3C9ZA 4ZKTB 1FV2A 1R8NA 2F2FA 1FMMS 1XYFA 2VU9A 2RSTA 5BQUA 2VSAA 3CU1B 2ZQNA 1G9AA 5HPZA 2FFVA 5EC5A 5BXPA 4I4PA 4OW4A 4I1BA 4JPZA 5EHAA 4MZHA 1HWOB 1JLYA 1FQ9A 3PG0A 3UD7A 4XFTA 5BP5C 3O4CA 2Y9XE 1V6VA 3CA6A 3WA1A 3A23A 1AVUA 3P53A 3ZC8A 3OJMA 2ERMA 2GZBA 7I1BA 4G9MA 1HWMB 2Q9XA 3V0BA 4WBCA 4ENDA 4I7IA 1BA7A 4J23B 2FGFA 5D61A 2VUAA 3OJVA 4X3AA 4XKIA 3S8KA 3FJBA 3IIRA 5FZUA 3VSFA 2NZ9A 3WMVA 1YF8B 1R8OA 1XZZA 3HMYA 4CJMA 1CE7B 3R4UA 3FGMA 2LIQA 3BA4A 3PMEA 4PC4A 4DEPA 4ZLBB 1TTUA 3O3QA 1SR4A 1KNMA 1I1BA 1N4KA 1FN0A 4OEGA 3AH1A 1AVWB 3BRDA 1W3AA 4OUJA 4EFRA 1JTCA 2FFUA 1A8DA 1JQZA 2VXTI 3K1XA 2FDBM 3O4DA 1FWVA 1BLAA 4QKRA 9ILBA 1Z0HA 5BVPI 4II0A 4I1EA 2AAIB 4GP0A 2NS2A 4OEFA 3TC2A 3R4SA 4AN7B 2VLCA 1DJSB 2HZ9A 2MC2A 5BXTA 3AH2A 5D63A 4QD2B 3BA7A 2D43A 2Z48A 3WINC 2I1BA 2VSEA 1DZCA 4EFPA 2XOAA 4LO2C 1Z2VA 1RY7A 4LO1C 4YOLA 4I4QA 4D0ZA 1WD3A 1TIEA 4EB2B 4KEKA 1S0CA 3OGGA 5BP5A 3NBEA 21BIA 3P6IA 4LO7B 4F34A 4I4RA 1S0LA 2DRYA 2IWTB 1JT4A 4G9NA 5I1BA 1P63A 4FVVA 4USPA 1S0GA 4LO8B 2Y9WC 4JRAA 2LIEA 4OEEA 3BAGA 2QYIB 3N7JA 3OGFA 5FNXA 4X37A 3LTQA 3VWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRA X;  4TLP A;  3QYD A;  1DLL A;  1II4 A;  1PWA A;  1ISW A;  3CA4 A;  1W3F A;  1AF9 A;  2ZR1 B;  1K5V A;  3AJ5 A;  3F62 B;  4Q91 A;  4FGF A;  3BAU A;  1ONK B;  1DFQ A;  2D22 A;  4AN6 A;  4G6M A;  3O4O A;  3MPP G;  1ITB A;  2BEA A;  41BI A;  4I37 A;  3FJI A;  4JP0 A;  2Z49 A;  4IZE A;  1JT7 A;  1T4Q A;  2BEB A;  2HWA A;  1S0D A;  3LLP A;  4G1R A;  3MAL A;  1BFG A;  2NTD A;  2J3P A;  3H6R B;  2YUG A;  1ISY A;  4QAL A;  3D7W B;  1GGP B;  1ISZ A;  4HR6 C;  3ZXG A;  1DIW A;  3FJF A;  3JRR A;  3WMU A;  1Q1U A;  3WIN A;  3BAH A;  3UJ4 A;  2FO1 A;  1VCL A;  3BB2 A;  3AZW A;  3A07 A;  4J2S A;  1FMZ A;  3HBW A;  4LO2 A;  1WBA A;  3B9U A;  3CRI A;  3AKG A;  4I2S A;  4LO1 A;  3HAL A;  4ZFW B;  4ZOT A;  5JMC A;  3WO2 A;  3NBN A;  4H9W A;  4I0Y A;  3RTI B;  4OWJ A;  1IT0 A;  3FJJ A;  1FWU A;  3VT2 A;  3CQA A;  5F8Y A;  1BLD A;  3A22 A;  1JLX A;  3H6Q A;  3ILA A;  3S8J A;  4ZFU B;  4H04 A;  2HW9 A;  3FFZ A;  5G00 A;  5DZU A;  3VT0 A;  3CA5 A;  5EG6 C;  1S0B A;  4P0J A;  4A7K A;  5GAQ A;  1TP0 A;  4JAW A;  3AKI A;  2Y9G A;  1E0O A;  3NBC A;  2K8R A;  4X38 A;  1QQK A;  3BTA A;  1TWE A;  4I8M A;  3VSZ A;  4ISQ A;  1PC8 B;  3FJA A;  1YTO A;  1QXM A;  4P0K A;  4Z9W B;  2RG9 B;  3FJ9 A;  5FNW A;  3A21 A;  4Z8S B;  3PHZ A;  3FJH A;  2MIB A;  1AVA C;  1AVX B;  4Q9G A;  3W9T A;  3BRG C;  5DUY A;  1AXM A;  1L2H A;  5BOW A;  4QD2 C;  3FJK A;  1V6W A;  4L4H A;  1IRP A;  3O4A A;  1V6X A;  3O5W B;  2AQZ A;  1TWM A;  1DZD A;  3V0A B;  1FGA A;  1WBC A;  3CA1 A;  1HCD A;  2ET2 A;  3AKH A;  1I1E A;  3VUO A;  1M2T B;  4LO7 C;  2KH2 A;  3O4B A;  4DCK C;  2NP0 A;  2L5X A;  1DQG A;  4JKQ A;  4QBC A;  1YYN A;  4A7Z A;  3BAV A;  1FV3 A;  1IHK A;  4J2K A;  4KC3 A;  6I1B A;  3Q7X A;  1HIB A;  1W3G A;  2UUS A;  3N0K A;  1NZK A;  2ZQO A;  2D44 A;  5FZY A;  1S0F A;  3CRH A;  2DRZ A;  4P0L A;  1RML A;  4QKS A;  3O44 A;  4JQ0 A;  2IHO A;  4QO3 A;  1BAR A;  2KI4 A;  2NYY A;  2NVH A;  3AH4 A;  2NM1 A;  1BFB A;  1PUU B;  3V0B B;  1M16 A;  3WO3 A;  2E4M C;  4I6I A;  1IIL A;  3AZV A;  3BAD A;  1AFC A;  2AXM A;  3AJ6 A;  4OWK A;  1JY0 A;  1XHB A;  1YXW A;  1V6U A;  1ISV A;  3N7K A;  5B2H A;  2D24 A;  3O49 A;  3V79 C;  1HWN B;  4D8H A;  1F31 A;  8I1B A;  3IM7 A;  4L4I A;  4G6J A;  4IZX A;  3CAH A;  2KLL A;  4I4Y A;  1XG6 A;  2GO2 A;  3BX1 C;  5JLV A;  3OBT A;  3BA5 A;  4ZBV B;  3RMX A;  2VXR A;  3RTJ B;  3VT1 A;  4IY9 A;  2D7R A;  4IHZ A;  2RQ9 A;  1G9D A;  4LO0 C;  4XFU A;  3FJC A;  1DQO A;  2P23 A;  3FUO A;  3UJ0 A;  3IM5 A;  2QN4 A;  3FJE A;  1BFF A;  4EFQ A;  4I4U A;  4EEE B;  1EVT A;  3UD9 A;  4ZFY B;  1CVS A;  1Q03 A;  4LO3 C;  3FUQ A;  5F8S A;  1IOB A;  4J2Y A;  4I4S A;  4DEN A;  2D7I A;  2KKI A;  1PZZ A;  3T8S A;  3I2X A;  1J0S A;  1TFM B;  1ILR 1;  2BFH A;  1EYL A;  1EV2 A;  2R9K B;  4I3N A;  1UPS A;  5FZZ A;  2ESU A;  1BFC A;  4X39 A;  2D1Z A;  4ION A;  4D0T A;  3BRF A;  3HN1 A;  1YBI A;  3JUT A;  4ZGR B;  5E24 E;  2X2S A;  1G82 A;  1HCE A;  4GAI A;  4A7Y A;  3BAO A;  4QC4 A;  5DSS B;  1MD6 A;  3ZXD A;  1EPW A;  2KI6 B;  31BI A;  4J2X A;  3UDA A;  5DVH A;  2E4M A;  3KMV A;  2X2T A;  3Q7Y A;  3HOM A;  4JKX B;  1SZ6 B;  5D62 A;  1TOO A;  1ISX A;  3RMY A;  1MC9 A;  4Q9P A;  3F1R A;  3NJ5 A;  2P39 A;  1S0E A;  1Z4S A;  4QBV A;  4ISR A;  4GOV A;  3IAG C;  1HKN A;  2F2F C;  1RZO B;  3H6R A;  4OWL A;  2M49 A;  5BQU C;  4F83 A;  3AKF A;  4LO0 A;  2F8X C;  5F90 A;  3CA3 A;  3NBD A;  3RSJ A;  3CRG A;  1Q04 A;  3P6J A;  1T9F A;  3PUB A;  4KBB A;  3IM6 A;  2AFG A;  4HA2 A;  4LO3 A;  4USO A;  4HJJ A;  2HWM A;  2DS0 A;  1RG8 A;  1WD4 A;  4KEI A;  4XFS A;  2WBC A;  3CA0 A;  3EF2 A;  4IY8 A;  3WO4 A;  3I2A A;  4GOY A;  3N7M A;  3POK A;  4I4V A;  3Q7W A;  4GP3 A;  2WRY A;  3VEQ A;  3FJD A;  1HWP B;  2D23 A;  3BAQ A;  3H6S E;  1K5U A;  1BAS A;  1JT5 A;  1NUN A;  5BXS A;  1ABR B;  1G9C A;  3I29 B;  1SR4 C;  2K4A B;  3SNV A;  4R6U B;  5BXR A;  1D0H A;  4GAF A;  3ZX7 A;  4IQP A;  1OQL B;  2Y9F A;  3ZC9 A;  2DRE A;  3N7L A;  1DFC A;  4IYB A;  3FJ8 A;  4ZA3 B;  5F8W A;  3UD8 A;  2Q3N B;  3HSM A;  2K43 A;  3OBR A;  4I4O A;  1IJT A;  4I4X A;  3QR5 A;  3OJ2 A;  1G9B A;  2D20 A;  3E8L C;  1PUM B;  4EKX B;  2MLL B;  1JT3 A;  3V0A A;  4I96 A;  4KEJ A;  1QQL A;  4P6A A;  3C9Z A;  4ZKT B;  1FV2 A;  1R8N A;  2F2F A;  1FMM S;  1XYF A;  2VU9 A;  2RST A;  5BQU A;  2VSA A;  3CU1 B;  2ZQN A;  1G9A A;  5HPZ A;  2FFV A;  5EC5 A;  5BXP A;  4I4P A;  4OW4 A;  4I1B A;  4JPZ A;  5EHA A;  1HWO B;  1JLY A;  1FQ9 A;  3PG0 A;  3UD7 A;  4XFT A;  5BP5 C;  3O4C A;  2Y9X E;  1V6V A;  3CA6 A;  3WA1 A;  3A23 A;  1AVU A;  3P53 A;  3ZC8 A;  3OJM A;  2ERM A;  2GZB A;  7I1B A;  4G9M A;  1HWM B;  2Q9X A;  3V0B A;  4WBC A;  4END A;  4I7I A;  1BA7 A;  4J23 B;  2FGF A;  5D61 A;  2VUA A;  3OJV A;  4X3A A;  4XKI A;  3S8K A;  3FJB A;  3IIR A;  5FZU A;  3VSF A;  2NZ9 A;  3WMV A;  1YF8 B;  1R8O A;  1XZZ A;  3HMY A;  4CJM A;  1CE7 B;  3R4U A;  3FGM A;  2LIQ A;  3BA4 A;  3PME A;  4PC4 A;  4DEP A;  4ZLB B;  1TTU A;  3O3Q A;  1SR4 A;  1KNM A;  1I1B A;  1N4K A;  1FN0 A;  4OEG A;  3AH1 A;  1AVW B;  3BRD A;  1W3A A;  4OUJ A;  4EFR A;  1JTC A;  2FFU A;  1A8D A;  1JQZ A;  2VXT I;  3K1X A;  2FDB M;  3O4D A;  1FWV A;  1BLA A;  4QKR A;  9ILB A;  1Z0H A;  5BVP I;  4II0 A;  4I1E A;  2AAI B;  4GP0 A;  4OEF A;  3TC2 A;  3R4S A;  4AN7 B;  2VLC A;  1DJS B;  2HZ9 A;  2MC2 A;  5BXT A;  3AH2 A;  5D63 A;  4QD2 B;  3BA7 A;  2D43 A;  2Z48 A;  3WIN C;  2I1B A;  2VSE A;  1DZC A;  4EFP A;  2XOA A;  4LO2 C;  1Z2V A;  1RY7 A;  4LO1 C;  4YOL A;  4I4Q A;  4D0Z A;  1WD3 A;  1TIE A;  4EB2 B;  4KEK A;  1S0C A;  3OGG A;  5BP5 A;  3NBE A;  21BI A;  3P6I A;  4LO7 B;  4F34 A;  4I4R A;  1S0L A;  2DRY A;  2IWT B;  1JT4 A;  4G9N A;  5I1B A;  1P63 A;  4FVV A;  4USP A;  1S0G A;  4LO8 B;  2Y9W C;  4JRA A;  2LIE A;  4OEE A;  3BAG A;  2QYI B;  3N7J A;  3OGF A;  5FNX A;  4X37 A;  3LTQ A;  3VWC A; 
#chains in the Genus database with same CATH topology
 1IRA X;  4TLP A;  3QYD A;  1DLL A;  1II4 A;  1PWA A;  1ISW A;  3CA4 A;  1W3F A;  1AF9 A;  2ZR1 B;  1K5V A;  3AJ5 A;  3F62 B;  4Q91 A;  4FGF A;  3BAU A;  1ONK B;  1DFQ A;  2D22 A;  4AN6 A;  4G6M A;  3O4O A;  3MPP G;  1ITB A;  2BEA A;  41BI A;  4I37 A;  3FJI A;  4JP0 A;  2Z49 A;  4IZE A;  1JT7 A;  1T4Q A;  2BEB A;  2HWA A;  1S0D A;  3LLP A;  4G1R A;  3MAL A;  1BFG A;  2NTD A;  2J3P A;  3H6R B;  2YUG A;  1ISY A;  4QAL A;  3D7W B;  1GGP B;  1ISZ A;  4HR6 C;  3ZXG A;  1DIW A;  3FJF A;  3JRR A;  3WMU A;  1Q1U A;  3WIN A;  3BAH A;  3UJ4 A;  2FO1 A;  1VCL A;  3BB2 A;  3AZW A;  3A07 A;  4J2S A;  1FMZ A;  3HBW A;  4LO2 A;  1WBA A;  3B9U A;  3CRI A;  3AKG A;  4I2S A;  4LO1 A;  3HAL A;  4ZFW B;  4ZOT A;  5JMC A;  3WO2 A;  3NBN A;  4H9W A;  4I0Y A;  3RTI B;  4OWJ A;  1IT0 A;  3FJJ A;  1FWU A;  3VT2 A;  3CQA A;  5F8Y A;  1BLD A;  3A22 A;  1JLX A;  3H6Q A;  3ILA A;  3S8J A;  4ZFU B;  4H04 A;  2HW9 A;  3FFZ A;  5G00 A;  5DZU A;  3VT0 A;  3CA5 A;  5EG6 C;  1S0B A;  4P0J A;  4A7K A;  5GAQ A;  1TP0 A;  4JAW A;  3AKI A;  2Y9G A;  1E0O A;  3NBC A;  2K8R A;  4X38 A;  1QQK A;  3BTA A;  1TWE A;  4I8M A;  3VSZ A;  4ISQ A;  1PC8 B;  3FJA A;  1YTO A;  1QXM A;  4P0K A;  4Z9W B;  2RG9 B;  3FJ9 A;  5FNW A;  3A21 A;  4Z8S B;  3PHZ A;  3FJH A;  2MIB A;  1AVA C;  1AVX B;  4Q9G A;  3W9T A;  3BRG C;  5DUY A;  4H75 A;  1AXM A;  1L2H A;  5BOW A;  4QD2 C;  3FJK A;  1V6W A;  4L4H A;  1IRP A;  3O4A A;  1V6X A;  3O5W B;  2AQZ A;  1TWM A;  1DZD A;  3V0A B;  1FGA A;  1WBC A;  3CA1 A;  1HCD A;  2ET2 A;  3AKH A;  1I1E A;  3VUO A;  1M2T B;  4LO7 C;  2KH2 A;  3O4B A;  4DCK C;  2NP0 A;  2L5X A;  1DQG A;  4JKQ A;  4QBC A;  1YYN A;  4A7Z A;  3BAV A;  1FV3 A;  1IHK A;  4J2K A;  4KC3 A;  6I1B A;  3Q7X A;  1HIB A;  1W3G A;  2UUS A;  3N0K A;  1NZK A;  2ZQO A;  2D44 A;  5FZY A;  1S0F A;  3CRH A;  2DRZ A;  4P0L A;  1RML A;  4QKS A;  3O44 A;  4JQ0 A;  2IHO A;  4QO3 A;  1BAR A;  2KI4 A;  2NYY A;  2NVH A;  3AH4 A;  2NM1 A;  1BFB A;  1PUU B;  3V0B B;  1M16 A;  3WO3 A;  2E4M C;  4I6I A;  1IIL A;  3AZV A;  3BAD A;  1AFC A;  2AXM A;  3AJ6 A;  4OWK A;  4MZG B;  1JY0 A;  1XHB A;  1YXW A;  1V6U A;  1ISV A;  3N7K A;  5B2H A;  2D24 A;  3O49 A;  3V79 C;  1HWN B;  4D8H A;  1F31 A;  8I1B A;  3IM7 A;  4L4I A;  4G6J A;  4IZX A;  3CAH A;  2KLL A;  4I4Y A;  1XG6 A;  2GO2 A;  3BX1 C;  5JLV A;  3OBT A;  3BA5 A;  4ZBV B;  3RMX A;  2VXR A;  3RTJ B;  3VT1 A;  4IY9 A;  2D7R A;  4IHZ A;  2RQ9 A;  1G9D A;  4LO0 C;  4XFU A;  3FJC A;  1DQO A;  2P23 A;  3FUO A;  3UJ0 A;  3IM5 A;  2QN4 A;  3FJE A;  1BFF A;  4EFQ A;  4I4U A;  4EEE B;  1EVT A;  3UD9 A;  4ZFY B;  1CVS A;  1Q03 A;  4LO3 C;  3FUQ A;  5F8S A;  1IOB A;  4J2Y A;  4I4S A;  4DEN A;  2D7I A;  2KKI A;  1PZZ A;  3T8S A;  3I2X A;  1J0S A;  1TFM B;  1ILR 1;  2BFH A;  1EYL A;  1EV2 A;  2R9K B;  4I3N A;  1UPS A;  5FZZ A;  2ESU A;  1BFC A;  4X39 A;  2D1Z A;  4ION A;  4D0T A;  3BRF A;  3HN1 A;  1YBI A;  3JUT A;  4ZGR B;  4UY4 A;  5E24 E;  2X2S A;  1G82 A;  1HCE A;  4GAI A;  4A7Y A;  3BAO A;  4QC4 A;  5DSS B;  1MD6 A;  3ZXD A;  1EPW A;  2KI6 B;  31BI A;  4J2X A;  3UDA A;  5DVH A;  2E4M A;  3KMV A;  2X2T A;  3Q7Y A;  3HOM A;  4JKX B;  1SZ6 B;  5D62 A;  1TOO A;  1ISX A;  3RMY A;  1MC9 A;  4Q9P A;  3F1R A;  3NJ5 A;  2P39 A;  1S0E A;  1Z4S A;  4QBV A;  4ISR A;  4GOV A;  3IAG C;  1HKN A;  2F2F C;  1RZO B;  3H6R A;  4OWL A;  2M49 A;  5BQU C;  4F83 A;  3AKF A;  4LO0 A;  2F8X C;  5F90 A;  3CA3 A;  3NBD A;  3RSJ A;  3CRG A;  1Q04 A;  3P6J A;  1T9F A;  3PUB A;  4MZF B;  4KBB A;  3IM6 A;  2AFG A;  4HA2 A;  4LO3 A;  4USO A;  4HJJ A;  2HWM A;  2DS0 A;  1RG8 A;  1WD4 A;  4KEI A;  4XFS A;  2WBC A;  3CA0 A;  3EF2 A;  4IY8 A;  3WO4 A;  3I2A A;  4GOY A;  3N7M A;  3POK A;  4I4V A;  3Q7W A;  4GP3 A;  2WRY A;  3VEQ A;  3FJD A;  1HWP B;  2D23 A;  3BAQ A;  3H6S E;  1K5U A;  1BAS A;  1JT5 A;  1NUN A;  5BXS A;  1ABR B;  1G9C A;  3I29 B;  1SR4 C;  2K4A B;  3SNV A;  4R6U B;  5BXR A;  1D0H A;  4GAF A;  3ZX7 A;  4IQP A;  1OQL B;  2Y9F A;  3ZC9 A;  2DRE A;  3N7L A;  1DFC A;  4IYB A;  3FJ8 A;  4ZA3 B;  5F8W A;  3UD8 A;  2Q3N B;  3HSM A;  2K43 A;  3OBR A;  4I4O A;  1IJT A;  4I4X A;  3QR5 A;  3OJ2 A;  1G9B A;  2D20 A;  3E8L C;  1PUM B;  4EKX B;  2MLL B;  1JT3 A;  3V0A A;  4I96 A;  4KEJ A;  1QQL A;  4P6A A;  3C9Z A;  4ZKT B;  1FV2 A;  1R8N A;  2F2F A;  1FMM S;  1XYF A;  2VU9 A;  2RST A;  5BQU A;  2VSA A;  3CU1 B;  2ZQN A;  1G9A A;  5HPZ A;  2FFV A;  5EC5 A;  5BXP A;  4I4P A;  4OW4 A;  4I1B A;  4JPZ A;  5EHA A;  4MZH A;  1HWO B;  1JLY A;  1FQ9 A;  3PG0 A;  3UD7 A;  4XFT A;  5BP5 C;  3O4C A;  2Y9X E;  1V6V A;  3CA6 A;  3WA1 A;  3A23 A;  1AVU A;  3P53 A;  3ZC8 A;  3OJM A;  2ERM A;  2GZB A;  7I1B A;  4G9M A;  1HWM B;  2Q9X A;  3V0B A;  4WBC A;  4END A;  4I7I A;  1BA7 A;  4J23 B;  2FGF A;  5D61 A;  2VUA A;  3OJV A;  4X3A A;  4XKI A;  3S8K A;  3FJB A;  3IIR A;  5FZU A;  3VSF A;  2NZ9 A;  3WMV A;  1YF8 B;  1R8O A;  1XZZ A;  3HMY A;  4CJM A;  1CE7 B;  3R4U A;  3FGM A;  2LIQ A;  3BA4 A;  3PME A;  4PC4 A;  4DEP A;  4ZLB B;  1TTU A;  3O3Q A;  1SR4 A;  1KNM A;  1I1B A;  1N4K A;  1FN0 A;  4OEG A;  3AH1 A;  1AVW B;  3BRD A;  1W3A A;  4OUJ A;  4EFR A;  1JTC A;  2FFU A;  1A8D A;  1JQZ A;  2VXT I;  3K1X A;  2FDB M;  3O4D A;  1FWV A;  1BLA A;  4QKR A;  9ILB A;  1Z0H A;  5BVP I;  4II0 A;  4I1E A;  2AAI B;  4GP0 A;  2NS2 A;  4OEF A;  3TC2 A;  3R4S A;  4AN7 B;  2VLC A;  1DJS B;  2HZ9 A;  2MC2 A;  5BXT A;  3AH2 A;  5D63 A;  4QD2 B;  3BA7 A;  2D43 A;  2Z48 A;  3WIN C;  2I1B A;  2VSE A;  1DZC A;  4EFP A;  2XOA A;  4LO2 C;  1Z2V A;  1RY7 A;  4LO1 C;  4YOL A;  4I4Q A;  4D0Z A;  1WD3 A;  1TIE A;  4EB2 B;  4KEK A;  1S0C A;  3OGG A;  5BP5 A;  3NBE A;  21BI A;  3P6I A;  4LO7 B;  4F34 A;  4I4R A;  1S0L A;  2DRY A;  2IWT B;  1JT4 A;  4G9N A;  5I1B A;  1P63 A;  4FVV A;  4USP A;  1S0G A;  4LO8 B;  2Y9W C;  4JRA A;  2LIE A;  4OEE A;  3BAG A;  2QYI B;  3N7J A;  3OGF A;  5FNX A;  4X37 A;  3LTQ A;  3VWC A; 
#chains in the Genus database with same CATH homology
 1IRA X;  4TLP A;  3QYD A;  1DLL A;  1II4 A;  1PWA A;  1ISW A;  3CA4 A;  1W3F A;  1AF9 A;  2ZR1 B;  1K5V A;  3AJ5 A;  3F62 B;  4Q91 A;  4FGF A;  3BAU A;  1ONK B;  1DFQ A;  2D22 A;  4AN6 A;  4G6M A;  3O4O A;  3MPP G;  1ITB A;  2BEA A;  41BI A;  4I37 A;  3FJI A;  4JP0 A;  2Z49 A;  4IZE A;  1JT7 A;  1T4Q A;  2BEB A;  2HWA A;  1S0D A;  3LLP A;  4G1R A;  3MAL A;  1BFG A;  2NTD A;  2J3P A;  3H6R B;  2YUG A;  1ISY A;  4QAL A;  3D7W B;  1GGP B;  1ISZ A;  4HR6 C;  3ZXG A;  1DIW A;  3FJF A;  3JRR A;  3WMU A;  1Q1U A;  3WIN A;  3BAH A;  3UJ4 A;  2FO1 A;  1VCL A;  3BB2 A;  3AZW A;  3A07 A;  4J2S A;  1FMZ A;  3HBW A;  4LO2 A;  1WBA A;  3B9U A;  3CRI A;  3AKG A;  4I2S A;  4LO1 A;  3HAL A;  4ZFW B;  4ZOT A;  5JMC A;  3WO2 A;  3NBN A;  4H9W A;  4I0Y A;  3RTI B;  4OWJ A;  1IT0 A;  3FJJ A;  1FWU A;  3VT2 A;  3CQA A;  5F8Y A;  1BLD A;  3A22 A;  1JLX A;  3H6Q A;  3ILA A;  3S8J A;  4ZFU B;  4H04 A;  2HW9 A;  3FFZ A;  5G00 A;  5DZU A;  3VT0 A;  3CA5 A;  5EG6 C;  1S0B A;  4P0J A;  4A7K A;  5GAQ A;  1TP0 A;  4JAW A;  3AKI A;  2Y9G A;  1E0O A;  3NBC A;  2K8R A;  4X38 A;  1QQK A;  3BTA A;  1TWE A;  4I8M A;  3VSZ A;  4ISQ A;  1PC8 B;  3FJA A;  1YTO A;  1QXM A;  4P0K A;  4Z9W B;  2RG9 B;  3FJ9 A;  5FNW A;  3A21 A;  4Z8S B;  3PHZ A;  3FJH A;  2MIB A;  1AVA C;  1AVX B;  4Q9G A;  3W9T A;  3BRG C;  5DUY A;  4H75 A;  1AXM A;  1L2H A;  5BOW A;  4QD2 C;  3FJK A;  1V6W A;  4L4H A;  1IRP A;  3O4A A;  1V6X A;  3O5W B;  2AQZ A;  1TWM A;  1DZD A;  3V0A B;  1FGA A;  1WBC A;  3CA1 A;  1HCD A;  2ET2 A;  3AKH A;  1I1E A;  3VUO A;  1M2T B;  4LO7 C;  2KH2 A;  3O4B A;  4DCK C;  2NP0 A;  2L5X A;  1DQG A;  4JKQ A;  4QBC A;  1YYN A;  4A7Z A;  3BAV A;  1FV3 A;  1IHK A;  4J2K A;  4KC3 A;  6I1B A;  3Q7X A;  1HIB A;  1W3G A;  2UUS A;  3N0K A;  1NZK A;  2ZQO A;  2D44 A;  5FZY A;  1S0F A;  3CRH A;  2DRZ A;  4P0L A;  1RML A;  4QKS A;  3O44 A;  4JQ0 A;  2IHO A;  4QO3 A;  1BAR A;  2KI4 A;  2NYY A;  2NVH A;  3AH4 A;  2NM1 A;  1BFB A;  1PUU B;  3V0B B;  1M16 A;  3WO3 A;  2E4M C;  4I6I A;  1IIL A;  3AZV A;  3BAD A;  1AFC A;  2AXM A;  3AJ6 A;  4OWK A;  4MZG B;  1JY0 A;  1XHB A;  1YXW A;  1V6U A;  1ISV A;  3N7K A;  5B2H A;  2D24 A;  3O49 A;  3V79 C;  1HWN B;  4D8H A;  1F31 A;  8I1B A;  3IM7 A;  4L4I A;  4G6J A;  4IZX A;  3CAH A;  2KLL A;  4I4Y A;  1XG6 A;  2GO2 A;  3BX1 C;  5JLV A;  3OBT A;  3BA5 A;  4ZBV B;  3RMX A;  2VXR A;  3RTJ B;  3VT1 A;  4IY9 A;  2D7R A;  4IHZ A;  2RQ9 A;  1G9D A;  4LO0 C;  4XFU A;  3FJC A;  1DQO A;  2P23 A;  3FUO A;  3UJ0 A;  3IM5 A;  2QN4 A;  3FJE A;  1BFF A;  4EFQ A;  4I4U A;  4EEE B;  1EVT A;  3UD9 A;  4ZFY B;  1CVS A;  1Q03 A;  4LO3 C;  3FUQ A;  5F8S A;  1IOB A;  4J2Y A;  4I4S A;  4DEN A;  2D7I A;  2KKI A;  1PZZ A;  3T8S A;  3I2X A;  1J0S A;  1TFM B;  1ILR 1;  2BFH A;  1EYL A;  1EV2 A;  2R9K B;  4I3N A;  1UPS A;  5FZZ A;  2ESU A;  1BFC A;  4X39 A;  2D1Z A;  4ION A;  4D0T A;  3BRF A;  3HN1 A;  1YBI A;  3JUT A;  4ZGR B;  4UY4 A;  5E24 E;  2X2S A;  1G82 A;  1HCE A;  4GAI A;  4A7Y A;  3BAO A;  4QC4 A;  5DSS B;  1MD6 A;  3ZXD A;  1EPW A;  2KI6 B;  31BI A;  4J2X A;  3UDA A;  5DVH A;  2E4M A;  3KMV A;  2X2T A;  3Q7Y A;  3HOM A;  4JKX B;  1SZ6 B;  5D62 A;  1TOO A;  1ISX A;  3RMY A;  1MC9 A;  4Q9P A;  3F1R A;  3NJ5 A;  2P39 A;  1S0E A;  1Z4S A;  4QBV A;  4ISR A;  4GOV A;  3IAG C;  1HKN A;  2F2F C;  1RZO B;  3H6R A;  4OWL A;  2M49 A;  5BQU C;  4F83 A;  3AKF A;  4LO0 A;  2F8X C;  5F90 A;  3CA3 A;  3NBD A;  3RSJ A;  3CRG A;  1Q04 A;  3P6J A;  1T9F A;  3PUB A;  4MZF B;  4KBB A;  3IM6 A;  2AFG A;  4HA2 A;  4LO3 A;  4USO A;  4HJJ A;  2HWM A;  2DS0 A;  1RG8 A;  1WD4 A;  4KEI A;  4XFS A;  2WBC A;  3CA0 A;  3EF2 A;  4IY8 A;  3WO4 A;  3I2A A;  4GOY A;  3N7M A;  3POK A;  4I4V A;  3Q7W A;  4GP3 A;  2WRY A;  3VEQ A;  3FJD A;  1HWP B;  2D23 A;  3BAQ A;  3H6S E;  1K5U A;  1BAS A;  1JT5 A;  1NUN A;  5BXS A;  1ABR B;  1G9C A;  3I29 B;  1SR4 C;  2K4A B;  3SNV A;  4R6U B;  5BXR A;  1D0H A;  4GAF A;  3ZX7 A;  4IQP A;  1OQL B;  2Y9F A;  3ZC9 A;  2DRE A;  3N7L A;  1DFC A;  4IYB A;  3FJ8 A;  4ZA3 B;  5F8W A;  3UD8 A;  2Q3N B;  3HSM A;  2K43 A;  3OBR A;  4I4O A;  1IJT A;  4I4X A;  3QR5 A;  3OJ2 A;  1G9B A;  2D20 A;  3E8L C;  1PUM B;  4EKX B;  2MLL B;  1JT3 A;  3V0A A;  4I96 A;  4KEJ A;  1QQL A;  4P6A A;  3C9Z A;  4ZKT B;  1FV2 A;  1R8N A;  2F2F A;  1FMM S;  1XYF A;  2VU9 A;  2RST A;  5BQU A;  2VSA A;  3CU1 B;  2ZQN A;  1G9A A;  5HPZ A;  2FFV A;  5EC5 A;  5BXP A;  4I4P A;  4OW4 A;  4I1B A;  4JPZ A;  5EHA A;  4MZH A;  1HWO B;  1JLY A;  1FQ9 A;  3PG0 A;  3UD7 A;  4XFT A;  5BP5 C;  3O4C A;  2Y9X E;  1V6V A;  3CA6 A;  3WA1 A;  3A23 A;  1AVU A;  3P53 A;  3ZC8 A;  3OJM A;  2ERM A;  2GZB A;  7I1B A;  4G9M A;  1HWM B;  2Q9X A;  3V0B A;  4WBC A;  4END A;  4I7I A;  1BA7 A;  4J23 B;  2FGF A;  5D61 A;  2VUA A;  3OJV A;  4X3A A;  4XKI A;  3S8K A;  3FJB A;  3IIR A;  5FZU A;  3VSF A;  2NZ9 A;  3WMV A;  1YF8 B;  1R8O A;  1XZZ A;  3HMY A;  4CJM A;  1CE7 B;  3R4U A;  3FGM A;  2LIQ A;  3BA4 A;  3PME A;  4PC4 A;  4DEP A;  4ZLB B;  1TTU A;  3O3Q A;  1SR4 A;  1KNM A;  1I1B A;  1N4K A;  1FN0 A;  4OEG A;  3AH1 A;  1AVW B;  3BRD A;  1W3A A;  4OUJ A;  4EFR A;  1JTC A;  2FFU A;  1A8D A;  1JQZ A;  2VXT I;  3K1X A;  2FDB M;  3O4D A;  1FWV A;  1BLA A;  4QKR A;  9ILB A;  1Z0H A;  5BVP I;  4II0 A;  4I1E A;  2AAI B;  4GP0 A;  2NS2 A;  4OEF A;  3TC2 A;  3R4S A;  4AN7 B;  2VLC A;  1DJS B;  2HZ9 A;  2MC2 A;  5BXT A;  3AH2 A;  5D63 A;  4QD2 B;  3BA7 A;  2D43 A;  2Z48 A;  3WIN C;  2I1B A;  2VSE A;  1DZC A;  4EFP A;  2XOA A;  4LO2 C;  1Z2V A;  1RY7 A;  4LO1 C;  4YOL A;  4I4Q A;  4D0Z A;  1WD3 A;  1TIE A;  4EB2 B;  4KEK A;  1S0C A;  3OGG A;  5BP5 A;  3NBE A;  21BI A;  3P6I A;  4LO7 B;  4F34 A;  4I4R A;  1S0L A;  2DRY A;  2IWT B;  1JT4 A;  4G9N A;  5I1B A;  1P63 A;  4FVV A;  4USP A;  1S0G A;  4LO8 B;  2Y9W C;  4JRA A;  2LIE A;  4OEE A;  3BAG A;  2QYI B;  3N7J A;  3OGF A;  5FNX A;  4X37 A;  3LTQ A;  3VWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...