2QA43

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qa4300
1VQM3 3G6E3 1YJW3 1QVG2 1KC84 3CD63 3CPW2 1VQP3 3CCJ3 1VQ93 1VQO3 2OTL3 1S723 3CCV3 1Q7Y4 3CMA3 1KD14 1VQ83 1NJI4 3CME3 3CC73 1K734 1N8R4 3CCR3 3CXC2 1YIT3 1YJ93 1YJN3 2QEX3 1VQ73 3CC23 1VQK3 1W2B2 1K8A4 1M1K4 1VQN3 2QA43 1YHQ3 3CCE3 2OTJ3 1K9M4 3CCM3 3CCS3 3I563 1JJ22 3CCU3 3CCL3 1VQ53 1QVF2 1VQ43 1Q824 3G713 1M904 1YIJ3 1Q814 1VQL3 1YI23 1Q864 3OW22 1KQS2 3G4S3 3I553 1VQ63 3CCQ3 3CC43
chains in the Genus database with same CATH superfamily
1M9GA 1YJW3 1WTHA 1KC84 4MJDA 3CCJ3 5AEWB 1BNSA 3B4PA 3O8YA 3GZBA 1O7HB 3KIIA 3DUKA 1RGHA 1RDSA 2OWPA 5HGRA 3AMOB 1BNFA 3WA2X 3EN1B 1JB4A 3X3ZA 5BU4A 1GS3A 2GU3A 3FLJA 1X1XA 1IT8A 1E3VA 2XSHB 4HZBB 4XDVA 1YVBI 1OACA 3DY5A 3NHXA 5D83A 1V58A 2P0MA 1SARA 3GAXA 1UGIA 1RSNA 1GOUA 1W6GA 1UCJA 2H0IA 2JQ5A 3DH2A 3NQZA 3G8ZA 3OWYA 3FF2A 2PZVA 3Q1CA 2XEPA 1E3RA 3FH1A 2KCDA 4PEJA 1KQS2 1UCKA 2IYJA 1GYBA 2LQVA 3VGNA 1MOLA 1SIIA 1TUHA 2RSXA 2XFSA 4EC6A 4OK0A 5EQLA 1IQXA 2OTL3 1BRIA 2CFDA 1RNTA 3F9SA 1A2KA 4FMDA 3WA3A 1YVSA 1FYSA 3ALAA 4KFDA 1BRJA 1DMMA 3S67A 5CF1A 3X40A 4MMXB 2HMLB 2Y73A 1JBRA 1OGXA 5CK6A 1M1XB 3F40A 1RRHA 2KAAA 3QK9A 3RGAA 1K41A 4BL2A 3FG3A 1G0TA 1BGSA 3SEDA 3I563 3WOFB 1ULJB 1V74A 1CYVA 1TRQA 1RCLA 2M7OA 2B24B 3WODG 1BSCA 1NNVA 1RGFA 1X1YA 1HZ1A 4H3UA 4GHOA 1Q814 2E2VA 3K63A 1ZS7A 2C4BA 1FGTA 2FXTA 1VZZA 1LOWA 4BL3A 1A2VA 1OCVA 2HOHA 2BMOB 5JPUA 1U8CB 2RCDA 1TU5A 1KD14 1B2UA 2W0QA 4HM3B 3IMAB 3DGOA 4HOHA 3F8XA 3MG3A 5AYSC 3HIGA 5IG4A 1EA2A 2YFLB 1BANA 3FG4A 3GWRA 3ROBA 3GZXB 1X1UA 1IVWA 2QGUA 3KN4A 6STDA 1PY3A 1PYLA 1CH0A 3GRDA 4FMCA 4O3VA 1WMPA 1I2GA 1MWTA 1LRAA 2ZL8A 4KFEA 4X2OA 1STFI 1RGEA 5CF2A 3EBYA 4MMZB 1VQ43 4EBGA 2O9UX 1VQL3 2FNQA 3KKGA 4WYKB 2STDA 1MWSA 3DGNA 1IVVA 4HKVB 3DGYA 1VQP3 6GSPA 1VQ93 3AGOA 1BNRA 3JUOA 1YGEA 1JN5A 3LTCA 1LVNA 4LZIA 4MMYB 1UDII 3UL5A 3WOEB 3FCSB 2H0GA 1IK3A 2D42A 1W5ZA 2F4YA 2QIYA 4STDA 1VQK3 4HM1B 1K8A4 2F56A 1EQKA 1I2EA 1JB2A 1YHQ3 2F86B 2L1SA 5EVHA 5M1AA 6RNTA 1E97A 1NU3A 4G1MB 3LH4A 2F99A 4HM4B 3G713 4ORLA 5CXOA 1B2ZA 2CFKA 2XGNA 4HM2B 4RBNA 3D79A 4L8PA 4K90B 1G96A 3BNCA 3OV4A 4L8OA 3SVAA 4N6TA 4N3VA 3LT9A 2W03A 1YGWA 1IQYA 4EXRA 2XR8B 4KVHA 9RNTA 3EF8A 3UJMA 3HOHA 1RGKA 3ZFZA 1Z1SA 3EN8A 4OUQA 1T2IA 1UUWB 2CG0A 2W9QA 1WNHA 2RNTA 1FW7A 5AIFA 4AKYA 1B20A 2H0HA 4WHAA 1IDPA 3Q2PA 1RKYA 3CCU3 3EQQB 4IIAA 4LMIA 2F5MA 4BIRA 3X3XA 2OCTA 1B3SA 2OOVC 3Q3FA 3BU4A 4GL6A 3BLZA 3KSED 4N6NB 3I553 1IQ8A 1GD3A 2CK3H 3KCHA 1D6YA 1FGQA 2CC3A 1N8QA 3KZTA 5AIGA 3T0UA 3EJVA 3QRDA 1MWRA 4ILFA 2BU4A 3PS8A 4QWTA 4AEQA 2GXFA 1Q42A 1LQMB 1K734 3E99A 1ISKA 1RN1A 2QEX3 2JDIH 3B7CA 4HAAA 5AYRB 1BSAA 1RGGA 2GEYA 1OPYA 1GSPA 3M8CA 5IG0A 1LQGC 2Z77A 3PXMA 1WQLB 3ZG5A 2CWUA 3ER7A 4HM6B 1BNIA 3RDEA 3SOAA 3BNEA 2I9WA 3V92A 4LSOA 1O7MB 3UL6A 5AEUB 3MWZA 3L0RA 4HZ9B 4I4KA 4EYCA 2KF6A 3OXAA 1OF5A 1QMAA 2UUGC 5D82A 1SPUA 2CX0A 3DGMA 1JBTA 7GSPA 1N8R4 3FKAA 1B2MA 3CC23 1NB5I 1RN7A 1N5PA 2YX9A 2CFGA 3S5CA 4HM7B 1B21A 2L4VA 1BRKA 1OHOA 5G1KA 1OF5B 3CCL3 3CNXA 3N8BA 3WR2A 3V99A 1Q7HA 3KE7A 2MC8A 1RCKA 3LXUX 4FCZA 4RNZA 2CX1A 4NPBA 1A2PA 3ZG0A 2F98A 1I2FA 3OX9A 4FR9A 3LZAA 1TFKA 2V1LA 5M18A 1LOYA 2R4IA 1FGRA 3N54B 5M19A 2FGTA 1IVUA 2K3DA 2RGQA 3LOYA 5IF6A 2SBLA 4O02B 2GBXB 2XGLA 4HVNA 1W00A 3G16A 1UCIA 3U97A 4J9AA 5KP1A 1Y4KA 1S5AA 3EE1A 2P0XA 3A76A 3MKIA 5IW9A 1SQWA 4KZ1A 1BOXA 1TIJA 1OHSA 1IYYA 3NV0A 1IVXA 1T2HA 2XF3A 3JVCA 3HK4A 3PCRA 4HM8B 4XBXA 1QVF2 4R4KA 3OWUA 5ELUA 2GU1A 1FUSA 4GSPA 1Q40A 1HU9A 2WOHA 3HX8A 3Q90A 4BTXA 3PCSA 2Z76A 1SJWA 4EV2A 4FMBA 3G6E3 1D6ZA 4CCVA 3CPW2 4AKZA 7STDA 2BNGA 1QALA 2RBIA 1ASKA 1B2XA 1EUIC 4BU4A 1MGWA 3KSPA 1GD4A 1BNJA 1DVCA 3S27A 5IERA 1C7HA 1BSBA 1I0VA 3JUNA 5IG5A 4N6UA 4WWUC 3TDGA 5D81A 3CC73 1FGMA 1AV4A 1DYUA 2Q07A 1Q40B 3CNMA 5ELJA 1AVLA 1M1K4 1W2B2 2WO0A 3NM2A 1BRNL 1J2BA 4HBRA 4N6MA 2Y74A 4X2HA 2XH9A 4RNYA 1K9M4 5BIRA 4K1UA 2ZDJA 4Q53A 5FW5A 1W6CA 1RLSA 1I3IA 1WMOA 2KF5A 1O7NB 1W7CA 1O7WB 3K5TA 3AGNA 1RJOA 3S29A 2HMMB 1RNBA 1JN5B 4NREA 4EV5A 1DE3A 3SLUA 1IV7A 4R1KA 2W56A 1ZO2A 3DXOA 1QAFA 1NO3A 2W6JH 3F8HA 3JUPA 3LYGA 4WFOA 1JNQA 1N9EA 1VQM3 3S28A 3HZPA 1F8NA 3VSYA 2HMOB 3EHCA 1SIHA 5LC6A 2XRXB 3T8NA 5BVBA 4LYLB 1FZUA 5IEOA 4FCMA 1GMRA 1O7PB 5A0OB 2CWTA 1BSDA 4K1VA 5BXQA 3FGYA 3RGRA 1FA3A 4R9LA 1JKGA 3H3HA 1O7GB 2WOFA 2OOVA 1FUTA 2E2TA 3K9MC 1UCLA 3GZYB 1RGLA 1T5YA 3CCS3 5DREA 1BUJA 2W2CA 2WGQA 1WMNA 2CH9A 3AHWA 1MWUA 2AADA 1RGAA 3DZLA 4FCJA 3X3YA 1QAKA 3KFQC 5IG3A 1Q864 3EB8A 3BIRA 1I70A 3G4S3 3PYJA 4O8SA 3WDGB 1ZX2A 2W04A 3SXXA 3MYTA 4BTWA 2P05A 4HYZA 3DM8A 1OUNA 3FZWA 3CCV3 3I0YA 1EEJA 3IJEB 1RMSA 2BHMA 8CHOA 1OHPA 2PNCA 3DGLA 1V57A 4HM0B 3NUVA 5AI1A 4MEIA 3CCR3 5AIHA 1VQN3 1HKXA 1KWIA 1NDOB 3LTAA 4GB5A 1CYUA 2OQEA 2RFRA 2CG1A 1UUGB 4R9KA 1DMNA 3AHSA 3PGBA 1A67A 2IUKA 3BB9A 1C54A 1Q824 2E2UA 3D5IA 2OQEC 1PU4A 1OH0A 2C11A 3HI7A 4CPKA 1GOYA 1ROVA 1X1WA 3G0KA 1LNIA 2Z7AA 5TGNA 4EW5A 5HOHA 4IPBA 2W9PA 4IT7A 1VQO3 1S723 2CFLA 1PFPA 1DETA 1EG9B 2HMKB 2HMJB 3D3LA 4RZMA 2UGIA 2CFWA 1TJDA 4XM4A 2ZA4A 3CPOA 3STDA 5KP3A 5IENA 2GSPA 3V98A 3T8UA 2KXGA 1I3FA 2K0MA 2CW9A 1CEWI 1GMQA 5DRVA 1GY6A 3F14A 3A5EA 4H61A 1JJ22 1IV9A 3ECFA 1U5OA 3N9HA 1VQ53 4DKIA 2BIRA 3X41A 1RN4A 1I0XA 2CWVA 4XBYA 3U1WA 1YIJ3 3OWSA 1YI23 2KF4A 3JUMA 1AR0A 1AY7A 1DMQA 3MHEA 2IA7A 5LC7A 1JV2B 3MG1A 3WMDA 3D9RA 5JPPA 3EC9A 2IMJA 3CMA3 2GEXA 1FUWA 1I8VA 1CQSA 1W6YA 1BIRA 4J5KA 4N6LA 5EEOA 2P38A 3BNDA 1YJ93 4J8TA 4ZM8A 5G1LA 3NX0A 3GSPA 1KSIA 3CCE3 3CU3A 2KF3A 3HIIA 1BRHA 3CCM3 1JZOA 3NM7A 3LMLA 4XB5A 3X42A 1W02A 4WP5A 4CJNA 3JUQA 4JF8A 1RRLA 1US1A 1T3BA 1LNHA 3OW22 3GZRA 1W01A 3NBRA 4HJLB 2F5WA 4CDLA 1A90A 5KP4A 3F7SA 1EKMA 1QVG2 3CD63 4L7KA 4R80A 2BMRB 3B4OA 1Q7Y4 2XFTA 2CIUA 4BTYA 1UI7A 3NV0B 1UUVB 4KT3B 1VQ83 3PZWA 3CME3 4WYKA 4LGQA 1YJN3 1AQZA 2ML5A 5GSPA 4FMAA 1BNEA 3DMCA 1LXEA 2XSOB 3FSDA 4N6V0 5CLKA 1NB3I 2QA43 5G2GA 4N6OB 1R4YA 1UI8A 4JRFA 1JRQA 2LYXA 5IEPA 2CKFB 3D4AA 2A15A 1GMPA 4K61A 1B2SA 3EBTA 3K0ZA 1HYFA 1UGHI 3F7XA 3K7CA 3FG1A 2P09A 2BMQB 1B27A 3BNBA 4HM5B 2INXA 1VQQA 4J5GA 2KRTA 1GY5A 2UX0A 3NXJA 3MPHA 1K28A 3URPA 5FGOA 2BT3A 1BAOA 1UW1A 3FF0A 1LOVA 3RNTA 3SX1A 1BVIA 3UB1A 3NBJA 1D6UA 4U13A 2ML6A 1MNLA 2D1WA 1MGRA 1TTOA 3SYUA 2HMNB 3CXC2 3MSOA 1VQ73 2W56B 1BSEA 1BU4A 1GOVA 2YFJB 2IY2A 1ULIB 1R4CA 2SARA 2OTJ3 1Q9EA 4XBTA 3NBBA 1OGZA 2IUJA 2CHCA 5AIIA 1N9JA 2O3OA 3B8LA 1M904 2YFIB 3WHOA 1LOXA 8RNTA 2J8XB 5I97A 1JBSA 2MF7A 2C10A 3CC43 1RTUA 2K54A 2AAEA 4OVMA 1JB5A 1JKGB 1STDA 1BRGA 1NWWA 1G02A 1TFOA 3MG2A 1L5GB 1ROAA 3UNLA 1BNGA 1FGOA 2WGOA 3LTBA 4LEHA 1DVDA 1ZGXA 4O2HA 2ZHXB 4I5QA 3H51A 3VF1A 1NJI4 5RNTA 4TX4A 3LTDA 1TRPA 3D5GA 4XDWA 1YIT3 3IPTA 3SOYA 4NHFA 1BUQA 1YNVX 1IT7A 1BRSA 2B1XB 2R41A 3EX9A 3LT8A 7RNTA 5JBSA 1W2ZA 1RGCA 4KFFA 5STDA 1AVKA 1N5HA 1RHLA 3J7Yd 1TP6A 3AMOA 1GY7A 4RNTA 1W4NA 2GBWB 3NQYA 1QJGA 2BO9B 1VQ63 1IU7A 2Z6BA 3CCQ3 1JZDA
chains in the Genus database with same CATH topology
1M9GA 1YJW3 1WTHA 1KC84 4MJDA 3CCJ3 5AEWB 3B4PA 3O8YA 3GZBA 1O7HB 3KIIA 3DUKA 2OWPA 5HGRA 3AMOB 3WA2X 3EN1B 1JB4A 3X3ZA 1GS3A 2GU3A 3FLJA 1IT8A 1E3VA 2XSHB 4HZBB 4XDVA 1YVBI 1OACA 3DY5A 3NHXA 5D83A 2P0MA 3GAXA 1W6GA 2JQ5A 3NQZA 3G8ZA 3OWYA 3FF2A 2PZVA 3Q1CA 2XEPA 1E3RA 3FH1A 2KCDA 4PEJA 1KQS2 1GYBA 2LQVA 3VGNA 1MOLA 1SIIA 1TUHA 2RSXA 2XFSA 4EC6A 4OK0A 5EQLA 1IQXA 2OTL3 2CFDA 3F9SA 1A2KA 4FMDA 3WA3A 3ALAA 4KFDA 1DMMA 3S67A 5CF1A 3X40A 4MMXB 2HMLB 2Y73A 1OGXA 5CK6A 1M1XB 3F40A 1RRHA 3QK9A 3RGAA 1K41A 3FG3A 3SEDA 3I563 3WOFB 1ULJB 1V74A 1CYVA 2M7OA 2B24B 3WODG 4H3UA 1Q814 2E2VA 3K63A 2FXTA 1FGTA 1VZZA 1A2VA 1OCVA 2BMOB 5JPUA 1U8CB 2RCDA 1TU5A 1KD14 2W0QA 4HM3B 3IMAB 3DGOA 3F8XA 3MG3A 5AYSC 3HIGA 5IG4A 1EA2A 2YFLB 3FG4A 3ROBA 3GWRA 3GZXB 1IVWA 2QGUA 3KN4A 6STDA 3GRDA 4FMCA 4O3VA 1WMPA 2ZL8A 4KFEA 4X2OA 5CF2A 1STFI 3EBYA 4MMZB 1VQ43 4EBGA 2O9UX 1VQL3 2FNQA 3KKGA 4WYKB 2STDA 3DGNA 1IVVA 4HKVB 1VQP3 1VQ93 3JUOA 1YGEA 1JN5A 3LTCA 1LVNA 4LZIA 4MMYB 3UL5A 1IK3A 3FCSB 2D42A 1W5ZA 2QIYA 4STDA 1VQK3 4HM1B 1K8A4 1EQKA 1JB2A 1YHQ3 2F86B 5EVHA 1E97A 1NU3A 4G1MB 3LH4A 2F99A 4HM4B 3G713 4ORLA 5CXOA 2CFKA 2XGNA 4HM2B 4RBNA 4L8PA 4K90B 1G96A 3BNCA 3OV4A 4L8OA 3SVAA 4N6TA 4N3VA 3LT9A 2W03A 1IQYA 4EXRA 2XR8B 4KVHA 3EF8A 3UJMA 1Z1SA 3EN8A 4OUQA 1UUWB 2CG0A 2W9QA 1WNHA 5AIFA 4AKYA 4WHAA 1IDPA 3Q2PA 1RKYA 3CCU3 3EQQB 4IIAA 4LMIA 3X3XA 2OCTA 4GL6A 2OOVC 3BLZA 3KSED 4N6NB 3I553 1IQ8A 1GD3A 2CK3H 1D6YA 1FGQA 2CC3A 1N8QA 3KZTA 5AIGA 3T0UA 3EJVA 3QRDA 3PS8A 4QWTA 4AEQA 2GXFA 1Q42A 1K734 3E99A 1ISKA 2QEX3 2JDIH 3B7CA 5AYRB 2GEYA 1OPYA 3M8CA 5IG0A 2Z77A 3PXMA 1WQLB 2CWUA 3ER7A 4HM6B 3RDEA 3SOAA 3BNEA 2I9WA 3V92A 4LSOA 1O7MB 3UL6A 5AEUB 3MWZA 3L0RA 4HZ9B 4I4KA 4EYCA 3OXAA 1OF5A 1QMAA 5D82A 1SPUA 3DGMA 1N8R4 3FKAA 3CC23 1NB5I 1RN7A 1N5PA 2YX9A 2CFGA 3S5CA 4HM7B 3CCL3 2L4VA 1OHOA 1OF5B 3CNXA 3N8BA 3V99A 3KE7A 2MC8A 3LXUX 4FCZA 4RNZA 2F98A 3OX9A 4FR9A 3LZAA 1TFKA 2V1LA 2R4IA 1FGRA 3N54B 2FGTA 1IVUA 2RGQA 3LOYA 5IF6A 2SBLA 4O02B 2GBXB 2XGLA 4HVNA 1W00A 3G16A 3U97A 4J9AA 5KP1A 1Y4KA 1S5AA 3EE1A 2P0XA 3A76A 3MKIA 5IW9A 1SQWA 4KZ1A 1TIJA 1OHSA 3NV0A 1IVXA 2XF3A 3JVCA 3HK4A 3PCRA 4HM8B 4XBXA 1QVF2 4R4KA 3OWUA 5ELUA 2GU1A 1Q40A 1HU9A 2WOHA 3HX8A 3Q90A 4BTXA 3PCSA 2Z76A 1SJWA 4EV2A 4FMBA 3G6E3 1D6ZA 4CCVA 3CPW2 4AKZA 7STDA 2BNGA 1QALA 1ASKA 3KSPA 1GD4A 3S27A 1DVCA 5IERA 1C7HA 3JUNA 5IG5A 4N6UA 4WWUC 3TDGA 5D81A 3CC73 1FGMA 1AV4A 1DYUA 2Q07A 1Q40B 3CNMA 5ELJA 1AVLA 1M1K4 1W2B2 2WO0A 3NM2A 1J2BA 4HBRA 4N6MA 2Y74A 4X2HA 2XH9A 4RNYA 1K9M4 4K1UA 2ZDJA 4Q53A 5FW5A 1W6CA 1WMOA 3K5TA 3S29A 1O7NB 1W7CA 1O7WB 1A67A 1RJOA 2HMMB 1JN5B 4NREA 4EV5A 3SLUA 1IV7A 4R1KA 2W56A 1ZO2A 3DXOA 1QAFA 1NO3A 2W6JH 3F8HA 3JUPA 3LYGA 4WFOA 1JNQA 1N9EA 1VQM3 3S28A 3HZPA 1F8NA 3VSYA 2HMOB 3EHCA 1SIHA 5LC6A 2XRXB 3T8NA 5BVBA 5IEOA 4FCMA 1O7PB 5A0OB 2CWTA 4K1VA 5BXQA 3FGYA 3RGRA 1FA3A 4R9LA 1JKGA 3H3HA 1O7GB 2WOFA 2OOVA 3CCS3 2E2TA 3K9MC 3GZYB 1T5YA 5DREA 2W2CA 2WGQA 1WMNA 2CH9A 4FCJA 3DZLA 3X3YA 1QAKA 3KFQC 5IG3A 1Q864 3EB8A 3G4S3 3PYJA 4O8SA 3WDGB 1ZX2A 2W04A 3SXXA 3MYTA 4BTWA 2P05A 4HYZA 3DM8A 1OUNA 3FZWA 3CCV3 3I0YA 3IJEB 2BHMA 8CHOA 1OHPA 2PNCA 3DGLA 4HM0B 3NUVA 5AI1A 4MEIA 3CCR3 5AIHA 1VQN3 1HKXA 1KWIA 1NDOB 3LTAA 4GB5A 1CYUA 2OQEA 2RFRA 2CG1A 4R9KA 1DMNA 3PGBA 2IUKA 3BB9A 1Q824 2E2UA 2OQEC 1PU4A 1OH0A 2C11A 3HI7A 1ROVA 3G0KA 2Z7AA 5TGNA 4IPBA 2W9PA 4IT7A 1VQO3 1S723 2CFLA 1PFPA 1EG9B 2HMKB 2HMJB 3D3LA 4RZMA 2CFWA 4XM4A 3CPOA 3STDA 5KP3A 5IENA 3V98A 3T8UA 2KXGA 2K0MA 2CW9A 1CEWI 5DRVA 1GY6A 3F14A 4H61A 1JJ22 1IV9A 3ECFA 1U5OA 3N9HA 1VQ53 3X41A 2CWVA 4XBYA 3U1WA 1YIJ3 3OWSA 1YI23 3JUMA 1AR0A 5LC7A 1DMQA 3MHEA 2IA7A 1JV2B 3MG1A 3WMDA 3D9RA 5JPPA 3EC9A 2IMJA 3CMA3 2GEXA 1FUWA 1CQSA 1W6YA 4N6LA 5EEOA 2P38A 3BNDA 1YJ93 4J8TA 4ZM8A 3NX0A 1KSIA 3CCE3 3CU3A 3HIIA 3CCM3 3NM7A 3LMLA 4XB5A 3X42A 1W02A 4WP5A 3JUQA 4JF8A 1RRLA 1US1A 1LNHA 3OW22 3GZRA 1W01A 3NBRA 4HJLB 4CDLA 1A90A 5KP4A 3F7SA 1EKMA 1QVG2 3CD63 4L7KA 4R80A 2BMRB 3B4OA 1Q7Y4 2XFTA 2CIUA 4BTYA 1UI7A 3NV0B 1UUVB 1VQ83 3PZWA 3CME3 4WYKA 4LGQA 1YJN3 2ML5A 4FMAA 3DMCA 1LXEA 2XSOB 3FSDA 4N6V0 5CLKA 1NB3I 2QA43 5G2GA 4N6OB 1UI8A 4JRFA 1JRQA 2LYXA 5IEPA 2CKFB 2A15A 4K61A 3EBTA 3K0ZA 3K7CA 3F7XA 3FG1A 2P09A 2BMQB 3BNBA 4HM5B 2INXA 2KRTA 1GY5A 2UX0A 3NXJA 3MPHA 1K28A 5FGOA 2BT3A 3SX1A 1UW1A 3FF0A 3UB1A 3NBJA 1D6UA 4U13A 2ML6A 1MNLA 2D1WA 2HMNB 3CXC2 3MSOA 1VQ73 2W56B 2YFJB 1ULIB 1R4CA 2OTJ3 4XBTA 3NBBA 1OGZA 2IUJA 2CHCA 5AIIA 1N9JA 2O3OA 3B8LA 1M904 2YFIB 1LOXA 5I97A 3CC43 2MF7A 2C10A 2K54A 4OVMA 1JB5A 1JKGB 1STDA 1TFOA 1NWWA 1L5GB 3WOEB 3MG2A 3UNLA 1ROAA 2WGOA 1FGOA 3LTBA 4LEHA 1DVDA 4O2HA 3VF1A 3H51A 1NJI4 4TX4A 3LTDA 4XDWA 1YIT3 3IPTA 3SOYA 4NHFA 1BUQA 1IT7A 2B1XB 3EX9A 3LT8A 5JBSA 1W2ZA 4KFFA 5STDA 1AVKA 1N5HA 3J7Yd 1TP6A 3AMOA 1GY7A 1W4NA 2GBWB 3NQYA 1QJGA 2BO9B 1VQ63 1IU7A 2Z6BA 3CCQ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 3;  3G6E 3;  1YJW 3;  1QVG 2;  1KC8 4;  3CD6 3;  3CPW 2;  1VQP 3;  3CCJ 3;  1VQ9 3;  1VQO 3;  2OTL 3;  1S72 3;  3CCV 3;  1Q7Y 4;  3CMA 3;  1KD1 4;  1VQ8 3;  1NJI 4;  3CME 3;  3CC7 3;  1K73 4;  1N8R 4;  3CCR 3;  3CXC 2;  1YIT 3;  1YJ9 3;  1YJN 3;  2QEX 3;  1VQ7 3;  3CC2 3;  1VQK 3;  1W2B 2;  1K8A 4;  1M1K 4;  1VQN 3;  2QA4 3;  1YHQ 3;  3CCE 3;  2OTJ 3;  1K9M 4;  3CCM 3;  3CCS 3;  3I56 3;  1JJ2 2;  3CCU 3;  3CCL 3;  1VQ5 3;  1QVF 2;  1VQ4 3;  1Q82 4;  3G71 3;  1M90 4;  1YIJ 3;  1Q81 4;  1VQL 3;  1YI2 3;  1Q86 4;  3OW2 2;  1KQS 2;  3G4S 3;  3I55 3;  1VQ6 3;  3CCQ 3;  3CC4 3; 
#chains in the Genus database with same CATH topology
 1M9G A;  1YJW 3;  1WTH A;  1KC8 4;  4MJD A;  3CCJ 3;  5AEW B;  1BNS A;  3B4P A;  3O8Y A;  3GZB A;  1O7H B;  3KII A;  3DUK A;  1RGH A;  1RDS A;  2OWP A;  5HGR A;  3AMO B;  1BNF A;  3WA2 X;  3EN1 B;  1JB4 A;  3X3Z A;  5BU4 A;  1GS3 A;  2GU3 A;  3FLJ A;  1X1X A;  1IT8 A;  1E3V A;  2XSH B;  4HZB B;  4XDV A;  1YVB I;  1OAC A;  3DY5 A;  3NHX A;  5D83 A;  1V58 A;  2P0M A;  1SAR A;  3GAX A;  1UGI A;  1RSN A;  1GOU A;  1W6G A;  1UCJ A;  2H0I A;  2JQ5 A;  3DH2 A;  3NQZ A;  3G8Z A;  3OWY A;  3FF2 A;  2PZV A;  3Q1C A;  2XEP A;  1E3R A;  3FH1 A;  2KCD A;  4PEJ A;  1KQS 2;  1UCK A;  2IYJ A;  1GYB A;  2LQV A;  3VGN A;  1MOL A;  1SII A;  1TUH A;  2RSX A;  2XFS A;  4EC6 A;  4OK0 A;  5EQL A;  1IQX A;  2OTL 3;  1BRI A;  2CFD A;  1RNT A;  3F9S A;  1A2K A;  4FMD A;  3WA3 A;  1YVS A;  1FYS A;  3ALA A;  4KFD A;  1BRJ A;  1DMM A;  3S67 A;  5CF1 A;  3X40 A;  4MMX B;  2HML B;  2Y73 A;  1JBR A;  1OGX A;  5CK6 A;  1M1X B;  3F40 A;  1RRH A;  2KAA A;  3QK9 A;  3RGA A;  1K41 A;  4BL2 A;  3FG3 A;  1G0T A;  1BGS A;  3SED A;  3I56 3;  3WOF B;  1ULJ B;  1V74 A;  1CYV A;  1TRQ A;  1RCL A;  2M7O A;  2B24 B;  3WOD G;  1BSC A;  1NNV A;  1RGF A;  1X1Y A;  1HZ1 A;  4H3U A;  4GHO A;  1Q81 4;  2E2V A;  3K63 A;  1ZS7 A;  2C4B A;  1FGT A;  2FXT A;  1VZZ A;  1LOW A;  4BL3 A;  1A2V A;  1OCV A;  2HOH A;  2BMO B;  5JPU A;  1U8C B;  2RCD A;  1TU5 A;  1KD1 4;  1B2U A;  2W0Q A;  4HM3 B;  3IMA B;  3DGO A;  4HOH A;  3F8X A;  3MG3 A;  5AYS C;  3HIG A;  5IG4 A;  1EA2 A;  2YFL B;  1BAN A;  3FG4 A;  3GWR A;  3ROB A;  3GZX B;  1X1U A;  1IVW A;  2QGU A;  3KN4 A;  6STD A;  1PY3 A;  1PYL A;  1CH0 A;  3GRD A;  4FMC A;  4O3V A;  1WMP A;  1I2G A;  1MWT A;  1LRA A;  2ZL8 A;  4KFE A;  4X2O A;  1STF I;  1RGE A;  5CF2 A;  3EBY A;  4MMZ B;  1VQ4 3;  4EBG A;  2O9U X;  1VQL 3;  2FNQ A;  3KKG A;  4WYK B;  2STD A;  1MWS A;  3DGN A;  1IVV A;  4HKV B;  3DGY A;  1VQP 3;  6GSP A;  1VQ9 3;  3AGO A;  1BNR A;  3JUO A;  1YGE A;  1JN5 A;  3LTC A;  1LVN A;  4LZI A;  4MMY B;  1UDI I;  3UL5 A;  3WOE B;  3FCS B;  2H0G A;  1IK3 A;  2D42 A;  1W5Z A;  2F4Y A;  2QIY A;  4STD A;  1VQK 3;  4HM1 B;  1K8A 4;  2F56 A;  1EQK A;  1I2E A;  1JB2 A;  1YHQ 3;  2F86 B;  2L1S A;  5EVH A;  5M1A A;  6RNT A;  1E97 A;  1NU3 A;  4G1M B;  3LH4 A;  2F99 A;  4HM4 B;  3G71 3;  4ORL A;  5CXO A;  1B2Z A;  2CFK A;  2XGN A;  4HM2 B;  4RBN A;  3D79 A;  4L8P A;  4K90 B;  1G96 A;  3BNC A;  3OV4 A;  4L8O A;  3SVA A;  4N6T A;  4N3V A;  3LT9 A;  2W03 A;  1YGW A;  1IQY A;  4EXR A;  2XR8 B;  4KVH A;  9RNT A;  3EF8 A;  3UJM A;  3HOH A;  1RGK A;  3ZFZ A;  1Z1S A;  3EN8 A;  4OUQ A;  1T2I A;  1UUW B;  2CG0 A;  2W9Q A;  1WNH A;  2RNT A;  1FW7 A;  5AIF A;  4AKY A;  1B20 A;  2H0H A;  4WHA A;  1IDP A;  3Q2P A;  1RKY A;  3CCU 3;  3EQQ B;  4IIA A;  4LMI A;  2F5M A;  4BIR A;  3X3X A;  2OCT A;  1B3S A;  2OOV C;  3Q3F A;  3BU4 A;  4GL6 A;  3BLZ A;  3KSE D;  4N6N B;  3I55 3;  1IQ8 A;  1GD3 A;  2CK3 H;  3KCH A;  1D6Y A;  1FGQ A;  2CC3 A;  1N8Q A;  3KZT A;  5AIG A;  3T0U A;  3EJV A;  3QRD A;  1MWR A;  4ILF A;  2BU4 A;  3PS8 A;  4QWT A;  4AEQ A;  2GXF A;  1Q42 A;  1LQM B;  1K73 4;  3E99 A;  1ISK A;  1RN1 A;  2QEX 3;  2JDI H;  3B7C A;  4HAA A;  5AYR B;  1BSA A;  1RGG A;  2GEY A;  1OPY A;  1GSP A;  3M8C A;  5IG0 A;  1LQG C;  2Z77 A;  3PXM A;  1WQL B;  3ZG5 A;  2CWU A;  3ER7 A;  4HM6 B;  1BNI A;  3RDE A;  3SOA A;  3BNE A;  2I9W A;  3V92 A;  4LSO A;  1O7M B;  3UL6 A;  5AEU B;  3MWZ A;  3L0R A;  4HZ9 B;  4I4K A;  4EYC A;  2KF6 A;  3OXA A;  1OF5 A;  1QMA A;  2UUG C;  5D82 A;  1SPU A;  2CX0 A;  3DGM A;  1JBT A;  7GSP A;  1N8R 4;  3FKA A;  1B2M A;  3CC2 3;  1NB5 I;  1RN7 A;  1N5P A;  2YX9 A;  2CFG A;  3S5C A;  4HM7 B;  1B21 A;  2L4V A;  1BRK A;  1OHO A;  5G1K A;  1OF5 B;  3CCL 3;  3CNX A;  3N8B A;  3WR2 A;  3V99 A;  1Q7H A;  3KE7 A;  2MC8 A;  1RCK A;  3LXU X;  4FCZ A;  4RNZ A;  2CX1 A;  4NPB A;  1A2P A;  3ZG0 A;  2F98 A;  1I2F A;  3OX9 A;  4FR9 A;  3LZA A;  1TFK A;  2V1L A;  5M18 A;  1LOY A;  2R4I A;  1FGR A;  3N54 B;  5M19 A;  2FGT A;  1IVU A;  2K3D A;  2RGQ A;  3LOY A;  5IF6 A;  2SBL A;  4O02 B;  2GBX B;  2XGL A;  4HVN A;  1W00 A;  3G16 A;  1UCI A;  3U97 A;  4J9A A;  5KP1 A;  1Y4K A;  1S5A A;  3EE1 A;  2P0X A;  3A76 A;  3MKI A;  5IW9 A;  1SQW A;  4KZ1 A;  1BOX A;  1TIJ A;  1OHS A;  1IYY A;  3NV0 A;  1IVX A;  1T2H A;  2XF3 A;  3JVC A;  3HK4 A;  3PCR A;  4HM8 B;  4XBX A;  1QVF 2;  4R4K A;  3OWU A;  5ELU A;  2GU1 A;  1FUS A;  4GSP A;  1Q40 A;  1HU9 A;  2WOH A;  3HX8 A;  3Q90 A;  4BTX A;  3PCS A;  2Z76 A;  1SJW A;  4EV2 A;  4FMB A;  3G6E 3;  1D6Z A;  4CCV A;  3CPW 2;  4AKZ A;  7STD A;  2BNG A;  1QAL A;  2RBI A;  1ASK A;  1B2X A;  1EUI C;  4BU4 A;  1MGW A;  3KSP A;  1GD4 A;  1BNJ A;  1DVC A;  3S27 A;  5IER A;  1C7H A;  1BSB A;  1I0V A;  3JUN A;  5IG5 A;  4N6U A;  4WWU C;  3TDG A;  5D81 A;  3CC7 3;  1FGM A;  1AV4 A;  1DYU A;  2Q07 A;  1Q40 B;  3CNM A;  5ELJ A;  1AVL A;  1M1K 4;  1W2B 2;  2WO0 A;  3NM2 A;  1BRN L;  1J2B A;  4HBR A;  4N6M A;  2Y74 A;  4X2H A;  2XH9 A;  4RNY A;  1K9M 4;  5BIR A;  4K1U A;  2ZDJ A;  4Q53 A;  5FW5 A;  1W6C A;  1RLS A;  1I3I A;  1WMO A;  2KF5 A;  1O7N B;  1W7C A;  1O7W B;  3K5T A;  3AGN A;  1RJO A;  3S29 A;  2HMM B;  1RNB A;  1JN5 B;  4NRE A;  4EV5 A;  1DE3 A;  3SLU A;  1IV7 A;  4R1K A;  2W56 A;  1ZO2 A;  3DXO A;  1QAF A;  1NO3 A;  2W6J H;  3F8H A;  3JUP A;  3LYG A;  4WFO A;  1JNQ A;  1N9E A;  1VQM 3;  3S28 A;  3HZP A;  1F8N A;  3VSY A;  2HMO B;  3EHC A;  1SIH A;  5LC6 A;  2XRX B;  3T8N A;  5BVB A;  4LYL B;  1FZU A;  5IEO A;  4FCM A;  1GMR A;  1O7P B;  5A0O B;  2CWT A;  1BSD A;  4K1V A;  5BXQ A;  3FGY A;  3RGR A;  1FA3 A;  4R9L A;  1JKG A;  3H3H A;  1O7G B;  2WOF A;  2OOV A;  1FUT A;  2E2T A;  3K9M C;  1UCL A;  3GZY B;  1RGL A;  1T5Y A;  3CCS 3;  5DRE A;  1BUJ A;  2W2C A;  2WGQ A;  1WMN A;  2CH9 A;  3AHW A;  1MWU A;  2AAD A;  1RGA A;  3DZL A;  4FCJ A;  3X3Y A;  1QAK A;  3KFQ C;  5IG3 A;  1Q86 4;  3EB8 A;  3BIR A;  1I70 A;  3G4S 3;  3PYJ A;  4O8S A;  3WDG B;  1ZX2 A;  2W04 A;  3SXX A;  3MYT A;  4BTW A;  2P05 A;  4HYZ A;  3DM8 A;  1OUN A;  3FZW A;  3CCV 3;  3I0Y A;  1EEJ A;  3IJE B;  1RMS A;  2BHM A;  8CHO A;  1OHP A;  2PNC A;  3DGL A;  1V57 A;  4HM0 B;  3NUV A;  5AI1 A;  4MEI A;  3CCR 3;  5AIH A;  1VQN 3;  1HKX A;  1KWI A;  1NDO B;  3LTA A;  4GB5 A;  1CYU A;  2OQE A;  2RFR A;  2CG1 A;  1UUG B;  4R9K A;  1DMN A;  3AHS A;  3PGB A;  1A67 A;  2IUK A;  3BB9 A;  1C54 A;  1Q82 4;  2E2U A;  3D5I A;  2OQE C;  1PU4 A;  1OH0 A;  2C11 A;  3HI7 A;  4CPK A;  1GOY A;  1ROV A;  1X1W A;  3G0K A;  1LNI A;  2Z7A A;  5TGN A;  4EW5 A;  5HOH A;  4IPB A;  2W9P A;  4IT7 A;  1VQO 3;  1S72 3;  2CFL A;  1PFP A;  1DET A;  1EG9 B;  2HMK B;  2HMJ B;  3D3L A;  4RZM A;  2UGI A;  2CFW A;  1TJD A;  4XM4 A;  2ZA4 A;  3CPO A;  3STD A;  5KP3 A;  5IEN A;  2GSP A;  3V98 A;  3T8U A;  2KXG A;  1I3F A;  2K0M A;  2CW9 A;  1CEW I;  1GMQ A;  5DRV A;  1GY6 A;  3F14 A;  3A5E A;  4H61 A;  1JJ2 2;  1IV9 A;  3ECF A;  1U5O A;  3N9H A;  1VQ5 3;  4DKI A;  2BIR A;  3X41 A;  1RN4 A;  1I0X A;  2CWV A;  4XBY A;  3U1W A;  1YIJ 3;  3OWS A;  1YI2 3;  2KF4 A;  3JUM A;  1AR0 A;  1AY7 A;  1DMQ A;  3MHE A;  2IA7 A;  5LC7 A;  1JV2 B;  3MG1 A;  3WMD A;  3D9R A;  5JPP A;  3EC9 A;  2IMJ A;  3CMA 3;  2GEX A;  1FUW A;  1I8V A;  1CQS A;  1W6Y A;  1BIR A;  4J5K A;  4N6L A;  5EEO A;  2P38 A;  3BND A;  1YJ9 3;  4J8T A;  4ZM8 A;  5G1L A;  3NX0 A;  3GSP A;  1KSI A;  3CCE 3;  3CU3 A;  2KF3 A;  3HII A;  1BRH A;  3CCM 3;  1JZO A;  3NM7 A;  3LML A;  4XB5 A;  3X42 A;  1W02 A;  4WP5 A;  4CJN A;  3JUQ A;  4JF8 A;  1RRL A;  1US1 A;  1T3B A;  1LNH A;  3OW2 2;  3GZR A;  1W01 A;  3NBR A;  4HJL B;  2F5W A;  4CDL A;  1A90 A;  5KP4 A;  3F7S A;  1EKM A;  1QVG 2;  3CD6 3;  4L7K A;  4R80 A;  2BMR B;  3B4O A;  1Q7Y 4;  2XFT A;  2CIU A;  4BTY A;  1UI7 A;  3NV0 B;  1UUV B;  4KT3 B;  1VQ8 3;  3PZW A;  3CME 3;  4WYK A;  4LGQ A;  1YJN 3;  1AQZ A;  2ML5 A;  5GSP A;  4FMA A;  1BNE A;  3DMC A;  1LXE A;  2XSO B;  3FSD A;  4N6V 0;  5CLK A;  1NB3 I;  2QA4 3;  5G2G A;  4N6O B;  1R4Y A;  1UI8 A;  4JRF A;  1JRQ A;  2LYX A;  5IEP A;  2CKF B;  3D4A A;  2A15 A;  1GMP A;  4K61 A;  1B2S A;  3EBT A;  3K0Z A;  1HYF A;  1UGH I;  3F7X A;  3K7C A;  3FG1 A;  2P09 A;  2BMQ B;  1B27 A;  3BNB A;  4HM5 B;  2INX A;  1VQQ A;  4J5G A;  2KRT A;  1GY5 A;  2UX0 A;  3NXJ A;  3MPH A;  1K28 A;  3URP A;  5FGO A;  2BT3 A;  1BAO A;  1UW1 A;  3FF0 A;  1LOV A;  3RNT A;  3SX1 A;  1BVI A;  3UB1 A;  3NBJ A;  1D6U A;  4U13 A;  2ML6 A;  1MNL A;  2D1W A;  1MGR A;  1TTO A;  3SYU A;  2HMN B;  3CXC 2;  3MSO A;  1VQ7 3;  2W56 B;  1BSE A;  1BU4 A;  1GOV A;  2YFJ B;  2IY2 A;  1ULI B;  1R4C A;  2SAR A;  2OTJ 3;  1Q9E A;  4XBT A;  3NBB A;  1OGZ A;  2IUJ A;  2CHC A;  5AII A;  1N9J A;  2O3O A;  3B8L A;  1M90 4;  2YFI B;  3WHO A;  1LOX A;  8RNT A;  2J8X B;  5I97 A;  1JBS A;  2MF7 A;  2C10 A;  3CC4 3;  1RTU A;  2K54 A;  2AAE A;  4OVM A;  1JB5 A;  1JKG B;  1STD A;  1BRG A;  1NWW A;  1G02 A;  1TFO A;  3MG2 A;  1L5G B;  1ROA A;  3UNL A;  1BNG A;  1FGO A;  2WGO A;  3LTB A;  4LEH A;  1DVD A;  1ZGX A;  4O2H A;  2ZHX B;  4I5Q A;  3H51 A;  3VF1 A;  1NJI 4;  5RNT A;  4TX4 A;  3LTD A;  1TRP A;  3D5G A;  4XDW A;  1YIT 3;  3IPT A;  3SOY A;  4NHF A;  1BUQ A;  1YNV X;  1IT7 A;  1BRS A;  2B1X B;  2R41 A;  3EX9 A;  3LT8 A;  7RNT A;  5JBS A;  1W2Z A;  1RGC A;  4KFF A;  5STD A;  1AVK A;  1N5H A;  1RHL A;  3J7Y d;  1TP6 A;  3AMO A;  1GY7 A;  4RNT A;  1W4N A;  2GBW B;  3NQY A;  1QJG A;  2BO9 B;  1VQ6 3;  1IU7 A;  2Z6B A;  3CCQ 3;  1JZD A; 
#chains in the Genus database with same CATH homology
 1M9G A;  1YJW 3;  1WTH A;  1KC8 4;  4MJD A;  3CCJ 3;  5AEW B;  3B4P A;  3O8Y A;  3GZB A;  1O7H B;  3KII A;  3DUK A;  2OWP A;  5HGR A;  3AMO B;  3WA2 X;  3EN1 B;  1JB4 A;  3X3Z A;  1GS3 A;  2GU3 A;  3FLJ A;  1IT8 A;  1E3V A;  2XSH B;  4HZB B;  4XDV A;  1YVB I;  1OAC A;  3DY5 A;  3NHX A;  5D83 A;  2P0M A;  3GAX A;  1W6G A;  2JQ5 A;  3NQZ A;  3G8Z A;  3OWY A;  3FF2 A;  2PZV A;  3Q1C A;  2XEP A;  1E3R A;  3FH1 A;  2KCD A;  4PEJ A;  1KQS 2;  1GYB A;  2LQV A;  3VGN A;  1MOL A;  1SII A;  1TUH A;  2RSX A;  2XFS A;  4EC6 A;  4OK0 A;  5EQL A;  1IQX A;  2OTL 3;  2CFD A;  3F9S A;  1A2K A;  4FMD A;  3WA3 A;  3ALA A;  4KFD A;  1DMM A;  3S67 A;  5CF1 A;  3X40 A;  4MMX B;  2HML B;  2Y73 A;  1OGX A;  5CK6 A;  1M1X B;  3F40 A;  1RRH A;  3QK9 A;  3RGA A;  1K41 A;  3FG3 A;  3SED A;  3I56 3;  3WOF B;  1ULJ B;  1V74 A;  1CYV A;  2M7O A;  2B24 B;  3WOD G;  4H3U A;  1Q81 4;  2E2V A;  3K63 A;  2FXT A;  1FGT A;  1VZZ A;  1A2V A;  1OCV A;  2BMO B;  5JPU A;  1U8C B;  2RCD A;  1TU5 A;  1KD1 4;  2W0Q A;  4HM3 B;  3IMA B;  3DGO A;  3F8X A;  3MG3 A;  5AYS C;  3HIG A;  5IG4 A;  1EA2 A;  2YFL B;  3FG4 A;  3ROB A;  3GWR A;  3GZX B;  1IVW A;  2QGU A;  3KN4 A;  6STD A;  3GRD A;  4FMC A;  4O3V A;  1WMP A;  2ZL8 A;  4KFE A;  4X2O A;  5CF2 A;  1STF I;  3EBY A;  4MMZ B;  1VQ4 3;  4EBG A;  2O9U X;  1VQL 3;  2FNQ A;  3KKG A;  4WYK B;  2STD A;  3DGN A;  1IVV A;  4HKV B;  1VQP 3;  1VQ9 3;  3JUO A;  1YGE A;  1JN5 A;  3LTC A;  1LVN A;  4LZI A;  4MMY B;  3UL5 A;  1IK3 A;  3FCS B;  2D42 A;  1W5Z A;  2QIY A;  4STD A;  1VQK 3;  4HM1 B;  1K8A 4;  1EQK A;  1JB2 A;  1YHQ 3;  2F86 B;  5EVH A;  1E97 A;  1NU3 A;  4G1M B;  3LH4 A;  2F99 A;  4HM4 B;  3G71 3;  4ORL A;  5CXO A;  2CFK A;  2XGN A;  4HM2 B;  4RBN A;  4L8P A;  4K90 B;  1G96 A;  3BNC A;  3OV4 A;  4L8O A;  3SVA A;  4N6T A;  4N3V A;  3LT9 A;  2W03 A;  1IQY A;  4EXR A;  2XR8 B;  4KVH A;  3EF8 A;  3UJM A;  1Z1S A;  3EN8 A;  4OUQ A;  1UUW B;  2CG0 A;  2W9Q A;  1WNH A;  5AIF A;  4AKY A;  4WHA A;  1IDP A;  3Q2P A;  1RKY A;  3CCU 3;  3EQQ B;  4IIA A;  4LMI A;  3X3X A;  2OCT A;  4GL6 A;  2OOV C;  3BLZ A;  3KSE D;  4N6N B;  3I55 3;  1IQ8 A;  1GD3 A;  2CK3 H;  1D6Y A;  1FGQ A;  2CC3 A;  1N8Q A;  3KZT A;  5AIG A;  3T0U A;  3EJV A;  3QRD A;  3PS8 A;  4QWT A;  4AEQ A;  2GXF A;  1Q42 A;  1K73 4;  3E99 A;  1ISK A;  2QEX 3;  2JDI H;  3B7C A;  5AYR B;  2GEY A;  1OPY A;  3M8C A;  5IG0 A;  2Z77 A;  3PXM A;  1WQL B;  2CWU A;  3ER7 A;  4HM6 B;  3RDE A;  3SOA A;  3BNE A;  2I9W A;  3V92 A;  4LSO A;  1O7M B;  3UL6 A;  5AEU B;  3MWZ A;  3L0R A;  4HZ9 B;  4I4K A;  4EYC A;  3OXA A;  1OF5 A;  1QMA A;  5D82 A;  1SPU A;  3DGM A;  1N8R 4;  3FKA A;  3CC2 3;  1NB5 I;  1RN7 A;  1N5P A;  2YX9 A;  2CFG A;  3S5C A;  4HM7 B;  3CCL 3;  2L4V A;  1OHO A;  1OF5 B;  3CNX A;  3N8B A;  3V99 A;  3KE7 A;  2MC8 A;  3LXU X;  4FCZ A;  4RNZ A;  2F98 A;  3OX9 A;  4FR9 A;  3LZA A;  1TFK A;  2V1L A;  2R4I A;  1FGR A;  3N54 B;  2FGT A;  1IVU A;  2RGQ A;  3LOY A;  5IF6 A;  2SBL A;  4O02 B;  2GBX B;  2XGL A;  4HVN A;  1W00 A;  3G16 A;  3U97 A;  4J9A A;  5KP1 A;  1Y4K A;  1S5A A;  3EE1 A;  2P0X A;  3A76 A;  3MKI A;  5IW9 A;  1SQW A;  4KZ1 A;  1TIJ A;  1OHS A;  3NV0 A;  1IVX A;  2XF3 A;  3JVC A;  3HK4 A;  3PCR A;  4HM8 B;  4XBX A;  1QVF 2;  4R4K A;  3OWU A;  5ELU A;  2GU1 A;  1Q40 A;  1HU9 A;  2WOH A;  3HX8 A;  3Q90 A;  4BTX A;  3PCS A;  2Z76 A;  1SJW A;  4EV2 A;  4FMB A;  3G6E 3;  1D6Z A;  4CCV A;  3CPW 2;  4AKZ A;  7STD A;  2BNG A;  1QAL A;  1ASK A;  3KSP A;  1GD4 A;  3S27 A;  1DVC A;  5IER A;  1C7H A;  3JUN A;  5IG5 A;  4N6U A;  4WWU C;  3TDG A;  5D81 A;  3CC7 3;  1FGM A;  1AV4 A;  1DYU A;  2Q07 A;  1Q40 B;  3CNM A;  5ELJ A;  1AVL A;  1M1K 4;  1W2B 2;  2WO0 A;  3NM2 A;  1J2B A;  4HBR A;  4N6M A;  2Y74 A;  4X2H A;  2XH9 A;  4RNY A;  1K9M 4;  4K1U A;  2ZDJ A;  4Q53 A;  5FW5 A;  1W6C A;  1WMO A;  3K5T A;  3S29 A;  1O7N B;  1W7C A;  1O7W B;  1A67 A;  1RJO A;  2HMM B;  1JN5 B;  4NRE A;  4EV5 A;  3SLU A;  1IV7 A;  4R1K A;  2W56 A;  1ZO2 A;  3DXO A;  1QAF A;  1NO3 A;  2W6J H;  3F8H A;  3JUP A;  3LYG A;  4WFO A;  1JNQ A;  1N9E A;  1VQM 3;  3S28 A;  3HZP A;  1F8N A;  3VSY A;  2HMO B;  3EHC A;  1SIH A;  5LC6 A;  2XRX B;  3T8N A;  5BVB A;  5IEO A;  4FCM A;  1O7P B;  5A0O B;  2CWT A;  4K1V A;  5BXQ A;  3FGY A;  3RGR A;  1FA3 A;  4R9L A;  1JKG A;  3H3H A;  1O7G B;  2WOF A;  2OOV A;  3CCS 3;  2E2T A;  3K9M C;  3GZY B;  1T5Y A;  5DRE A;  2W2C A;  2WGQ A;  1WMN A;  2CH9 A;  4FCJ A;  3DZL A;  3X3Y A;  1QAK A;  3KFQ C;  5IG3 A;  1Q86 4;  3EB8 A;  3G4S 3;  3PYJ A;  4O8S A;  3WDG B;  1ZX2 A;  2W04 A;  3SXX A;  3MYT A;  4BTW A;  2P05 A;  4HYZ A;  3DM8 A;  1OUN A;  3FZW A;  3CCV 3;  3I0Y A;  3IJE B;  2BHM A;  8CHO A;  1OHP A;  2PNC A;  3DGL A;  4HM0 B;  3NUV A;  5AI1 A;  4MEI A;  3CCR 3;  5AIH A;  1VQN 3;  1HKX A;  1KWI A;  1NDO B;  3LTA A;  4GB5 A;  1CYU A;  2OQE A;  2RFR A;  2CG1 A;  4R9K A;  1DMN A;  3PGB A;  2IUK A;  3BB9 A;  1Q82 4;  2E2U A;  2OQE C;  1PU4 A;  1OH0 A;  2C11 A;  3HI7 A;  1ROV A;  3G0K A;  2Z7A A;  5TGN A;  4IPB A;  2W9P A;  4IT7 A;  1VQO 3;  1S72 3;  2CFL A;  1PFP A;  1EG9 B;  2HMK B;  2HMJ B;  3D3L A;  4RZM A;  2CFW A;  4XM4 A;  3CPO A;  3STD A;  5KP3 A;  5IEN A;  3V98 A;  3T8U A;  2KXG A;  2K0M A;  2CW9 A;  1CEW I;  5DRV A;  1GY6 A;  3F14 A;  4H61 A;  1JJ2 2;  1IV9 A;  3ECF A;  1U5O A;  3N9H A;  1VQ5 3;  3X41 A;  2CWV A;  4XBY A;  3U1W A;  1YIJ 3;  3OWS A;  1YI2 3;  3JUM A;  1AR0 A;  5LC7 A;  1DMQ A;  3MHE A;  2IA7 A;  1JV2 B;  3MG1 A;  3WMD A;  3D9R A;  5JPP A;  3EC9 A;  2IMJ A;  3CMA 3;  2GEX A;  1FUW A;  1CQS A;  1W6Y A;  4N6L A;  5EEO A;  2P38 A;  3BND A;  1YJ9 3;  4J8T A;  4ZM8 A;  3NX0 A;  1KSI A;  3CCE 3;  3CU3 A;  3HII A;  3CCM 3;  3NM7 A;  3LML A;  4XB5 A;  3X42 A;  1W02 A;  4WP5 A;  3JUQ A;  4JF8 A;  1RRL A;  1US1 A;  1LNH A;  3OW2 2;  3GZR A;  1W01 A;  3NBR A;  4HJL B;  4CDL A;  1A90 A;  5KP4 A;  3F7S A;  1EKM A;  1QVG 2;  3CD6 3;  4L7K A;  4R80 A;  2BMR B;  3B4O A;  1Q7Y 4;  2XFT A;  2CIU A;  4BTY A;  1UI7 A;  3NV0 B;  1UUV B;  1VQ8 3;  3PZW A;  3CME 3;  4WYK A;  4LGQ A;  1YJN 3;  2ML5 A;  4FMA A;  3DMC A;  1LXE A;  2XSO B;  3FSD A;  4N6V 0;  5CLK A;  1NB3 I;  2QA4 3;  5G2G A;  4N6O B;  1UI8 A;  4JRF A;  1JRQ A;  2LYX A;  5IEP A;  2CKF B;  2A15 A;  4K61 A;  3EBT A;  3K0Z A;  3K7C A;  3F7X A;  3FG1 A;  2P09 A;  2BMQ B;  3BNB A;  4HM5 B;  2INX A;  2KRT A;  1GY5 A;  2UX0 A;  3NXJ A;  3MPH A;  1K28 A;  5FGO A;  2BT3 A;  3SX1 A;  1UW1 A;  3FF0 A;  3UB1 A;  3NBJ A;  1D6U A;  4U13 A;  2ML6 A;  1MNL A;  2D1W A;  2HMN B;  3CXC 2;  3MSO A;  1VQ7 3;  2W56 B;  2YFJ B;  1ULI B;  1R4C A;  2OTJ 3;  4XBT A;  3NBB A;  1OGZ A;  2IUJ A;  2CHC A;  5AII A;  1N9J A;  2O3O A;  3B8L A;  1M90 4;  2YFI B;  1LOX A;  5I97 A;  3CC4 3;  2MF7 A;  2C10 A;  2K54 A;  4OVM A;  1JB5 A;  1JKG B;  1STD A;  1TFO A;  1NWW A;  1L5G B;  3WOE B;  3MG2 A;  3UNL A;  1ROA A;  2WGO A;  1FGO A;  3LTB A;  4LEH A;  1DVD A;  4O2H A;  3VF1 A;  3H51 A;  1NJI 4;  4TX4 A;  3LTD A;  4XDW A;  1YIT 3;  3IPT A;  3SOY A;  4NHF A;  1BUQ A;  1IT7 A;  2B1X B;  3EX9 A;  3LT8 A;  5JBS A;  1W2Z A;  4KFF A;  5STD A;  1AVK A;  1N5H A;  3J7Y d;  1TP6 A;  3AMO A;  1GY7 A;  1W4N A;  2GBW B;  3NQY A;  1QJG A;  2BO9 B;  1VQ6 3;  1IU7 A;  2Z6B A;  3CCQ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...