2QA43

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qa4300
2OTJ3 3G713 1VQ53 3CC23 1VQL3 3CCE3 3CPW2 1N8R4 2QEX3 1YJW3 2QA43 3G6E3 1K8A4 1Q824 3CCL3 1QVF2 1YJN3 1VQ73 1NJI4 1VQN3 3CCJ3 1YI23 2OTL3 3CCM3 1VQP3 3I563 1QVG2 1K734 1VQK3 3CD63 1VQ93 3CXC2 1VQM3 1Q7Y4 1K9M4 3CCQ3 1M904 1W2B2 3G4S3 3CC43 3CCR3 1YHQ3 1YIT3 1KD14 3CMA3 3CME3 1S723 3CCU3 1KQS2 1Q864 1VQ83 1Q814 1YJ93 3CCS3 1JJ22 1KC84 1VQO3 3I553 1YIJ3 1VQ43 1VQ63 1M1K4 3OW22 3CC73 3CCV3
chains in the Genus database with same CATH superfamily
1W6YA 3A76A 1RSNA 4H61A 2XSOB 1B2ZA 1EA2A 1T2HA 2XSHB 3KKGA 4MMXB 1GOVA 7RNTA 2D1WA 2CFWA 2F86B 1I8VA 2HMNB 2W2CA 5GSPA 1W4NA 3WOFB 5LC7A 1MGWA 3A5EA 2INXA 3HI7A 3RGAA 2AAEA 1M1XB 3LYGA 1O7GB 4RZMA 1QVG2 4WYKB 1DYUA 1VQ93 4O3VA 3S5CA 1BSBA 3JUQA 3IPTA 1AY7A 3E99A 1OHPA 2RFRA 2V1LA 3DXOA 3MG3A 3QK9A 5IG0A 3CMA3 4FR9A 3B4OA 2C4BA 1NU3A 3F9SA 1RGKA 1T5YA 1A90A 1B20A 2I9WA 3LTDA 3T0UA 4N6TA 5LC6A 3CC73 3X3YA 2HMLB 1EEJA 4JRFA 4U13A 5IEPA 3M8CA 1N5HA 1PY3A 1CQSA 3IMAB 4KFDA 4K61A 1ROAA 1YGEA 1B2MA 1K28A 4HVNA 4CCVA 5D81A 3EB8A 1B27A 1NO3A 4TX4A 1QVF2 1TU5A 3DH2A 1W6CA 3KCHA 4KZ1A 1GSPA 4LEHA 1T2IA 2UGIA 1BOXA 3JUMA 1UCKA 2PNCA 3OXAA 3BIRA 3X40A 2IYJA 3HIGA 4CJNA 1GOYA 5KP4A 4OUQA 4XDVA 1FZUA 2FXTA 4LSOA 1Y4KA 1ROVA 1RN1A 1SIHA 2GU1A 3KSED 3OWSA 2CWVA 3NQZA 1L5GB 4HBRA 4L8PA 1C7HA 5BIRA 3GZYB 1NB5I 1GMRA 5AIIA 3NX0A 2B24B 1I2GA 3EN1B 3Q1CA 4FCJA 3LT9A 1BRKA 2BMRB 1UUWB 2CKFB 2H0HA 3CNMA 3BU4A 3CNXA 2OQEA 2IMJA 2F56A 2OTL3 1A2PA 1Q9EA 2W6JH 4I5QA 4HJLB 4IT7A 1I70A 2C11A 4GB5A 2CC3A 1Q7Y4 1RTUA 2XGLA 4J8TA 3N8BA 1M904 5EQLA 1JKGB 4LMIA 1FW7A 3L0RA 5FW5A 3LOYA 1C54A 2RSXA 2BT3A 4STDA 1TTOA 2RGQA 1MNLA 2MC8A 4G1MB 3WODG 1ULIB 5M18A 3CCS3 1QALA 2BU4A 4RBNA 1DVCA 1OACA 1GY6A 1YIJ3 3CCV3 1SIIA 1R4CA 5KP1A 2OTJ3 2IUJA 3G713 2H0GA 2XF3A 3BB9A 1QAKA 1VQ53 2LYXA 4N6UA 3H51A 2GSPA 3FG1A 1V57A 4FCZA 3LXUX 1CEWI 1X1UA 1V74A 3HK4A 1U8CB 1RCLA 1RGCA 4HOHA 2P0XA 3B8LA 1O7MB 3JUPA 3CCM3 1WTHA 2XGNA 3D3LA 3LTAA 4MMZB 1VQK3 4XBXA 1IQXA 2ZDJA 4N6V0 1G96A 2K3DA 5ELUA 3CCQ3 2CFKA 1O7WB 1B2SA 3PCRA 4XBYA 2KF5A 3EN8A 1NNVA 1GY7A 1FGTA 2W0QA 4XM4A 2E2VA 3F40A 1BNGA 5ELJA 1YVSA 1KC84 1UUGB 4X2HA 3UJMA 3NM7A 1VQQA 2L1SA 1RGGA 2HMOB 3K63A 4AEQA 2CX0A 1LOWA 2CK3H 2BMOB 5M1AA 5CF1A 3CC23 1RCKA 2ML6A 5BVBA 2K54A 4HAAA 1DMNA 1MWUA 1IVXA 6GSPA 5JPUA 1CYUA 2XFSA 4HM0B 1G02A 3BNCA 1E97A 1TJDA 3GSPA 3FSDA 2RBIA 4BTWA 3FH1A 1OHSA 3VF1A 1ASKA 2M7OA 1BAOA 3AMOA 5G2GA 1RN4A 2HMKB 1JBSA 1IT8A 1BSCA 2YFLB 2Z6BA 3DMCA 3G16A 1Q40A 3G4S3 3CCR3 3S67A 5CF2A 3PS8A 2MF7A 1DVDA 1RDSA 1ZO2A 4JF8A 3GZRA 1CYVA 4LZIA 4EW5A 4IPBA 3OWYA 1N8QA 3QRDA 3SXXA 4MJDA 1DMQA 2KF6A 4I4KA 4RNZA 1W01A 3OWUA 1MGRA 5M19A 2ML5A 1T3BA 2F5WA 3FKAA 4N6OB 1GS3A 3X3XA 2RNTA 5A0OB 1FGRA 3WA3A 1DETA 4O02B 4XBTA 1WMOA 3CCL3 1JN5A 2ZHXB 2A15A 3OV4A 4XDWA 1EKMA 1MWTA 2GXFA 4R9KA 2WOFA 2CG1A 1X1XA 5IG3A 1RGHA 3FG3A 5D83A 1IV9A 1BSEA 4HM4B 3MWZA 1QJGA 2BIRA 1BRSA 1RGFA 1NWWA 4EV5A 1JZOA 1JZDA 1D6UA 1KSIA 4L8OA 5TGNA 1CH0A 1JJ22 3I553 5DRVA 3LT8A 3K0ZA 3BNBA 4FMBA 3ECFA 3FLJA 1JBRA 1OF5A 1U5OA 6STDA 2BMQB 2R4IA 4GL6A 1JRQA 3D79A 5JBSA 3EBTA 3NHXA 9RNTA 1RGLA 1D6YA 2XR8B 3G6E3 5IG5A 3V99A 1B21A 2IUKA 1Q824 3TDGA 5D82A 3EHCA 1FUWA 4EXRA 1OH0A 3SYUA 1GY5A 1VQP3 2CW9A 5AIHA 3NXJA 1KWIA 8RNTA 3RDEA 2O3OA 1YHQ3 2UUGC 2PZVA 4R80A 2YX9A 4ORLA 3MKIA 4L7KA 3PXMA 1YVBI 3U97A 2LQVA 2CX1A 3HX8A 3JVCA 3D5IA 4Q53A 5AIFA 7STDA 1TRPA 3N9HA 1OCVA 3J7Yd 2GEYA 3VSYA 4KVHA 6RNTA 2CFDA 3DUKA 1BSAA 3D4AA 3GRDA 3BNDA 5CK6A 2BO9B 2L4VA 3AMOB 4BTYA 1K8A4 3AHSA 1O7NB 4RNYA 3X42A 1JBTA 1Q40B 1VQ73 1RRLA 2STDA 2GU3A 1X1WA 3KSPA 2XFTA 2F4YA 4J5KA 2HMMB 1YIT3 1OGXA 2FGTA 1RNTA 2XH9A 1I0XA 1KQS2 4R9LA 2BHMA 4EV2A 5BXQA 5IEOA 3V98A 3K7CA 1GMQA 3CU3A 2W56A 7GSPA 1B3SA 2H0IA 1Q42A 2KXGA 2KAAA 4J9AA 1A2VA 1NB3I 1JN5B 3F14A 2W9QA 2HOHA 4HKVB 3GWRA 1N8R4 2QEX3 2KF3A 4HM3B 2OWPA 1W00A 3DM8A 3DGMA 1J2BA 1VQN3 4MMYB 1V58A 2WGQA 3G0KA 3ROBA 3CCJ3 4NPBA 4OK0A 2Z76A 3UB1A 3CXC2 4NREA 4HZBB 4FMCA 3EE1A 1W02A 1F8NA 2FNQA 4HM2B 2CHCA 1SJWA 1W2ZA 3ZG0A 1IVWA 1IU7A 5DREA 1QAFA 1BNSA 1OF5B 1MOLA 1UI7A 1LQGC 3WOEB 4BL3A 3SLUA 1GMPA 2W9PA 4DKIA 3DGNA 3KIIA 3F7XA 3SOYA 3HIIA 2CWTA 1FUTA 1LOXA 2P05A 1O7PB 2WOHA 2CG0A 2AADA 3CPW2 2KCDA 1LNHA 1LNIA 3PCSA 1MWRA 1VZZA 1W5ZA 2W03A 4LYLB 3WA2X 1STFI 2CFGA 5HGRA 3DGYA 2CWUA 3DZLA 1PU4A 1SPUA 1G0TA 4ILFA 2BNGA 3ZG5A 1D6ZA 2OCTA 3URPA 5I97A 4R1KA 4NHFA 5AEWB 3WDGB 1IV7A 4WP5A 1TFOA 3CCU3 1ZX2A 1EUIC 2QIYA 4O2HA 1BIRA 4GHOA 1Q864 1BANA 1YJ93 5CXOA 1W7CA 1N5PA 1Q7HA 2C10A 3EX9A 1N9JA 3KZTA 4BTXA 1VQ43 1IYYA 1BNJA 1JV2B 3BNEA 3OX9A 2ZL8A 5EVHA 3V92A 3EQQB 3UL5A 1RGAA 3RGRA 2IY2A 2KF4A 1TFKA 3B7CA 3DGOA 1BNIA 3DY5A 4K1VA 1JKGA 5FGOA 1A67A 4FMAA 1FGOA 4RNTA 1BUQA 1AV4A 1IQYA 1UCLA 3ZFZA 3JUOA 2F98A 1BRNL 5KP3A 5AYRB 4HM5B 4CDLA 1UCJA 5IF6A 1HZ1A 3WR2A 2P0MA 1GYBA 2W56B 1US1A 1O7HB 1TRQA 1ZGXA 3T8UA 1OUNA 1AVLA 1I3IA 1HU9A 1AVKA 3LTBA 1JB2A 3RNTA 2XRXB 2D42A 1PYLA 2IA7A 5G1LA 8CHOA 2XEPA 2B1XB 1BUJA 4CPKA 4EC6A 4BU4A 1DE3A 1BNEA 1RN7A 1TP6A 3FF0A 1UGIA 3CCE3 1RRHA 1LOYA 1YNVX 1JB5A 1BRGA 3H3HA 4EBGA 5IG4A 3EJVA 2HMJB 3F8HA 2K0MA 1YJN3 1NJI4 1HYFA 3KN4A 3EC9A 3ER7A 1IVVA 2JQ5A 4HM7B 3NUVA 4N6NB 3HZPA 1STDA 4R4KA 1WNHA 4AKZA 1KD14 1IQ8A 1B2UA 1I3FA 3NQYA 5IENA 4FMDA 1RNBA 1Q814 1RLSA 2GBWB 2OQEC 1R4YA 1ISKA 1RJOA 3F8XA 1M1K4 4HM1B 3SEDA 5HOHA 1M9GA 4HZ9B 1ZS7A 3DGLA 3NBRA 2ZA4A 3FZWA 1RKYA 1VQL3 1GD3A 3MHEA 5RNTA 1N9EA 1YJW3 2QA43 3F7SA 3HOHA 1WQLB 1EQKA 3Q2PA 3X41A 4X2OA 3FCSB 1YI23 4XB5A 3I563 4EYCA 2Z77A 4HM8B 5G1KA 1RMSA 1BRIA 3U1WA 4WWUC 5STDA 3PYJA 1TUHA 4LGQA 3NV0A 1JNQA 1LOVA 3GZBA 4BIRA 2P09A 4PEJA 1BNRA 3EBYA 2CIUA 2GBXB 1IDPA 1UDII 1DMMA 1LQMB 4IIAA 1UCIA 2R41A 1GD4A 1UGHI 3LH4A 5JPPA 1FGMA 3X3ZA 3LTCA 2Q07A 2SBLA 3FGYA 1QMAA 2E2TA 1I0VA 3SOAA 2W04A 3AGNA 1AQZA 3MG1A 2QGUA 2RCDA 3NM2A 4GSPA 1WMNA 3FG4A 3LMLA 3CD63 3IJEB 3PZWA 1RHLA 2CH9A 2O9UX 1PFPA 3CPOA 4MEIA 5EEOA 1IK3A 1K734 5AI1A 4FCMA 3UL6A 2YFJB 1A2KA 2Y73A 4HYZA 5BU4A 1EG9B 1HKXA 1LXEA 3MPHA 5AYSC 1I2FA 2E2UA 1SARA 4WYKA 2Y74A 4OVMA 1FUSA 1BRJA 1B2XA 3G8ZA 3D9RA 4O8SA 4BL2A 3STDA 2GEXA 4N3VA 1K41A 3PGBA 1IT7A 4KFEA 2WGOA 3NBJA 3S29A 5IERA 4N6LA 3S27A 3K9MC 4K90B 3WHOA 1LRAA 1OGZA 2OOVC 3EF8A 4WHAA 1LVNA 3K5TA 3O8YA 3WMDA 2F99A 2J8XB 3Q90A 1UUVB 3B4PA 1OPYA 4AKYA 3SX1A 4KFFA 3I0YA 2SARA 2YFIB 2WO0A 1TIJA 1VQM3 1AR0A 3NBBA 4N6MA 1K9M4 3KE7A 4J5GA 1W2B2 3VGNA 2CFLA 3CME3 3UNLA 4ZM8A 1JB4A 1X1YA 3GAXA 1ULJB 1FYSA 3T8NA 3AHWA 3FF2A 4KT3B 2F5MA 5CLKA 3MYTA 3OW22 1RGEA 4WFOA 1MWSA 1S5AA 5AEUB 1NDOB 1UW1A 1Z1SA 1BVIA 4HM6B 1GOUA 3S28A 3GZXB 1BRHA 2Z7AA 1W6GA 3Q3FA 3KFQC 1I2EA 1E3RA 5IW9A 3ALAA 3D5GA 3NV0B 2KRTA 1UI8A 2OOVA 5AIGA 3MG2A 4K1UA 3AGOA 1YGWA 1BSDA 3BLZA 3N54B 1IVUA 1FGQA 1BNFA 4QWTA 3CC43 3MSOA 3SVAA 2JDIH 1S723 3JUNA 3LZAA 1VQ83 1SQWA 1WMPA 2UX0A 1E3VA 4H3UA 1VQO3 1BU4A 1VQ63 1OHOA 2P38A 1FA3A 1BGSA
chains in the Genus database with same CATH topology
1W6YA 3A76A 4H61A 2XSOB 1EA2A 2XSHB 3KKGA 4MMXB 2D1WA 2F86B 2HMNB 3WOFB 2W2CA 1W4NA 5LC7A 3RGAA 2INXA 3HI7A 1M1XB 3LYGA 1O7GB 4RZMA 1QVG2 4WYKB 1DYUA 1VQ93 4O3VA 3S5CA 3JUQA 3IPTA 3E99A 1OHPA 2RFRA 2V1LA 3DXOA 3MG3A 3QK9A 5IG0A 3CMA3 4FR9A 3B4OA 1NU3A 3F9SA 1T5YA 1A90A 2I9WA 3LTDA 3T0UA 4N6TA 5LC6A 3CC73 3X3YA 2HMLB 4JRFA 4U13A 5IEPA 3M8CA 1N5HA 3IMAB 1CQSA 4KFDA 4K61A 1ROAA 1YGEA 1K28A 4HVNA 4CCVA 5D81A 3EB8A 1NO3A 4TX4A 1QVF2 1TU5A 1W6CA 4KZ1A 4LEHA 3JUMA 2PNCA 3OXAA 3X40A 3HIGA 5KP4A 4OUQA 4XDVA 2FXTA 4LSOA 1Y4KA 1ROVA 1SIHA 2GU1A 3KSED 3OWSA 2CWVA 3NQZA 1L5GB 4HBRA 4L8PA 1C7HA 3GZYB 1NB5I 5AIIA 3NX0A 2B24B 3EN1B 3Q1CA 4FCJA 3LT9A 2IUJA 2BMRB 1UUWB 2CKFB 3CNMA 2OQEA 3CNXA 2IMJA 2OTL3 2W6JH 4HJLB 4IT7A 1Q7Y4 2C11A 4GB5A 2CC3A 2XGLA 1M904 4J8TA 3N8BA 5EQLA 1JKGB 4LMIA 3L0RA 5FW5A 3LOYA 2RSXA 2BT3A 4STDA 2RGQA 1MNLA 2MC8A 4G1MB 3WODG 1ULIB 3CCS3 1QALA 4RBNA 1DVCA 1OACA 1GY6A 1YIJ3 3CCV3 1SIIA 1R4CA 5KP1A 2OTJ3 3G713 2XF3A 3BB9A 1VQ53 1QAKA 2LYXA 4N6UA 3H51A 3FG1A 4FCZA 3LXUX 1CEWI 3HK4A 1V74A 1U8CB 2P0XA 3B8LA 1O7MB 3JUPA 3CCM3 1WTHA 2XGNA 3D3LA 3LTAA 4MMZB 1VQK3 4XBXA 1IQXA 2ZDJA 4N6V0 1G96A 5ELUA 3CCQ3 2CFKA 1O7WB 3PCRA 4XBYA 3EN8A 2W0QA 1GY7A 1FGTA 4XM4A 2E2VA 3F40A 5ELJA 1KC84 4X2HA 3NM7A 2HMOB 3K63A 4AEQA 2CK3H 2BMOB 3CC23 5CF1A 2ML6A 5BVBA 2K54A 1DMNA 1IVXA 5JPUA 1CYUA 2XFSA 4HM0B 3BNCA 1E97A 3FSDA 4BTWA 3FH1A 1OHSA 3VF1A 1ASKA 2M7OA 3AMOA 5G2GA 2HMKB 1IT8A 2YFLB 2Z6BA 3G4S3 3DMCA 3G16A 1Q40A 3CCR3 3S67A 5CF2A 3PS8A 2MF7A 1DVDA 1ZO2A 4JF8A 3GZRA 1CYVA 4LZIA 4IPBA 3OWYA 1N8QA 3QRDA 3SXXA 4MJDA 1DMQA 4I4KA 4RNZA 1W01A 3OWUA 2ML5A 3FKAA 4N6OB 1GS3A 3X3XA 5A0OB 3WA3A 1FGRA 4O02B 4XBTA 1WMOA 3CCL3 1JN5A 2A15A 3OV4A 4XDWA 1EKMA 2GXFA 4R9KA 2WOFA 2CG1A 5IG3A 3FG3A 5D83A 1IV9A 4HM4B 3MWZA 1QJGA 1NWWA 4EV5A 1D6UA 1KSIA 4L8OA 5TGNA 1JJ22 3I553 5DRVA 3LT8A 3K0ZA 3BNBA 4FMBA 3ECFA 3FLJA 1OF5A 1U5OA 6STDA 2BMQB 2R4IA 4GL6A 1JRQA 5JBSA 3EBTA 3NHXA 1D6YA 2XR8B 3G6E3 5IG5A 3V99A 2IUKA 1Q824 3TDGA 5D82A 3EHCA 1FUWA 4EXRA 1OH0A 1GY5A 1VQP3 2CW9A 5AIHA 3NXJA 1KWIA 3RDEA 2O3OA 1YHQ3 2PZVA 4R80A 2YX9A 4ORLA 3MKIA 4L7KA 3PXMA 1YVBI 3U97A 2LQVA 3JVCA 3HX8A 4Q53A 5AIFA 7STDA 3N9HA 1OCVA 3J7Yd 2GEYA 3VSYA 4KVHA 2CFDA 3DUKA 3GRDA 3BNDA 5CK6A 2BO9B 2L4VA 3AMOB 4BTYA 1K8A4 1O7NB 4RNYA 3X42A 1Q40B 1VQ73 1RRLA 2STDA 2GU3A 3KSPA 2XFTA 2HMMB 1YIT3 1OGXA 2FGTA 2XH9A 1KQS2 4R9LA 2BHMA 4EV2A 5BXQA 5IEOA 3V98A 3K7CA 3CU3A 2W56A 1Q42A 2KXGA 4J9AA 1A2VA 1NB3I 1JN5B 3F14A 2W9QA 4HKVB 3GWRA 1N8R4 2QEX3 4HM3B 2OWPA 1W00A 3DM8A 3DGMA 1J2BA 1VQN3 4MMYB 2WGQA 3G0KA 3ROBA 3CCJ3 4OK0A 2Z76A 3UB1A 3CXC2 4NREA 4HZBB 4FMCA 3EE1A 1W02A 1F8NA 2FNQA 4HM2B 2CHCA 1SJWA 1W2ZA 1IVWA 1IU7A 5DREA 1QAFA 1OF5B 1UI7A 1MOLA 3WOEB 3SLUA 2W9PA 3DGNA 3KIIA 3F7XA 3SOYA 3HIIA 2CWTA 1LOXA 2P05A 2WOHA 1O7PB 2CG0A 3CPW2 2KCDA 1LNHA 3PCSA 1OHOA 1VZZA 1W5ZA 2W03A 3WA2X 1STFI 2CFGA 5HGRA 2CWUA 3DZLA 1PU4A 1SPUA 2BNGA 1D6ZA 2OCTA 5I97A 4R1KA 4NHFA 5AEWB 3WDGB 1IV7A 4WP5A 1TFOA 3CCU3 1ZX2A 2QIYA 4O2HA 1Q864 1YJ93 5CXOA 1W7CA 1N5PA 2C10A 3EX9A 4BTXA 1N9JA 3KZTA 1VQ43 1JV2B 3BNEA 3OX9A 2ZL8A 5EVHA 3V92A 3EQQB 3UL5A 3RGRA 3B7CA 1TFKA 3DY5A 3DGOA 4K1VA 1JKGA 5FGOA 1A67A 4FMAA 1FGOA 1BUQA 1AV4A 1IQYA 3JUOA 2F98A 5KP3A 5AYRB 4HM5B 4CDLA 5IF6A 2P0MA 1GYBA 2W56B 1US1A 1O7HB 3T8UA 1OUNA 1AVLA 1HU9A 1AVKA 3LTBA 1JB2A 2XRXB 2D42A 2IA7A 8CHOA 2XEPA 2B1XB 4EC6A 1RN7A 1TP6A 3FF0A 3CCE3 1RRHA 1JB5A 3H3HA 4EBGA 5IG4A 3EJVA 2HMJB 3F8HA 2K0MA 1YJN3 1NJI4 3KN4A 3EC9A 3ER7A 1IVVA 2JQ5A 4HM7B 3NUVA 4N6NB 3HZPA 1STDA 4R4KA 1WNHA 4AKZA 1KD14 1IQ8A 3NQYA 5IENA 4FMDA 1Q814 2GBWB 2OQEC 1ISKA 1RJOA 3F8XA 1M1K4 4HM1B 3SEDA 1M9GA 4HZ9B 3DGLA 3NBRA 3FZWA 1RKYA 1VQL3 1GD3A 3MHEA 1N9EA 1YJW3 2QA43 3F7SA 1WQLB 1EQKA 3Q2PA 3X41A 4X2OA 3FCSB 1YI23 4XB5A 3I563 4EYCA 2Z77A 4HM8B 3U1WA 4WWUC 5STDA 3PYJA 1TUHA 4LGQA 3NV0A 1JNQA 3GZBA 2P09A 4PEJA 3EBYA 2CIUA 2GBXB 1IDPA 1DMMA 4IIAA 1GD4A 3LH4A 5JPPA 1FGMA 3X3ZA 3LTCA 2Q07A 2SBLA 3FGYA 1QMAA 2E2TA 3SOAA 2W04A 3MG1A 2QGUA 2RCDA 3NM2A 1WMNA 3FG4A 3LMLA 3CD63 3IJEB 3PZWA 2CH9A 2O9UX 4MEIA 1PFPA 3CPOA 5EEOA 1IK3A 1K734 5AI1A 4FCMA 3UL6A 2YFJB 1A2KA 2Y73A 4HYZA 1EG9B 1HKXA 1LXEA 3MPHA 5AYSC 2E2UA 4WYKA 2Y74A 4OVMA 4O8SA 3G8ZA 3D9RA 3STDA 2GEXA 4N3VA 1K41A 3PGBA 1IT7A 4KFEA 2WGOA 3NBJA 3S29A 5IERA 4N6LA 3S27A 3K9MC 4K90B 1OGZA 2OOVC 4WHAA 3EF8A 1LVNA 3K5TA 3O8YA 3WMDA 2F99A 3Q90A 1UUVB 3B4PA 1OPYA 4AKYA 3SX1A 4KFFA 3I0YA 2YFIB 2WO0A 1TIJA 1VQM3 1AR0A 3NBBA 4N6MA 1K9M4 3KE7A 1W2B2 3VGNA 2CFLA 3CME3 3UNLA 4ZM8A 1JB4A 3GAXA 1ULJB 3T8NA 3FF2A 5CLKA 3MYTA 3OW22 4WFOA 1S5AA 5AEUB 1NDOB 1UW1A 1Z1SA 4HM6B 3S28A 3GZXB 2Z7AA 1W6GA 3KFQC 1E3RA 5IW9A 3ALAA 3NV0B 2KRTA 1UI8A 2OOVA 5AIGA 3MG2A 4K1UA 3BLZA 3N54B 1IVUA 1FGQA 4QWTA 3CC43 3MSOA 3SVAA 2JDIH 1S723 3JUNA 3LZAA 1VQ83 1SQWA 1WMPA 2UX0A 1E3VA 4H3UA 1VQO3 1VQ63 2CFWA 2P38A 1FA3A 3UJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 3;  3G71 3;  1VQ5 3;  3CC2 3;  1VQL 3;  3CCE 3;  3CPW 2;  1N8R 4;  2QEX 3;  1YJW 3;  2QA4 3;  3G6E 3;  1K8A 4;  1Q82 4;  3CCL 3;  1QVF 2;  1YJN 3;  1VQ7 3;  1NJI 4;  1VQN 3;  3CCJ 3;  1YI2 3;  2OTL 3;  3CCM 3;  1VQP 3;  3I56 3;  1QVG 2;  1K73 4;  1VQK 3;  3CD6 3;  1VQ9 3;  3CXC 2;  1VQM 3;  1Q7Y 4;  1K9M 4;  3CCQ 3;  1M90 4;  1W2B 2;  3G4S 3;  3CC4 3;  3CCR 3;  1YHQ 3;  1YIT 3;  1KD1 4;  3CMA 3;  3CME 3;  1S72 3;  3CCU 3;  1KQS 2;  1Q86 4;  1VQ8 3;  1Q81 4;  1YJ9 3;  3CCS 3;  1JJ2 2;  1KC8 4;  1VQO 3;  3I55 3;  1YIJ 3;  1VQ4 3;  1VQ6 3;  1M1K 4;  3OW2 2;  3CC7 3;  3CCV 3; 
#chains in the Genus database with same CATH topology
 1W6Y A;  3A76 A;  1RSN A;  4H61 A;  2XSO B;  1B2Z A;  1EA2 A;  1T2H A;  2XSH B;  3KKG A;  4MMX B;  1GOV A;  7RNT A;  2D1W A;  2CFW A;  2F86 B;  1I8V A;  2HMN B;  2W2C A;  5GSP A;  1W4N A;  3WOF B;  5LC7 A;  1MGW A;  3A5E A;  2INX A;  3HI7 A;  3RGA A;  2AAE A;  1M1X B;  3LYG A;  1O7G B;  4RZM A;  1QVG 2;  4WYK B;  1DYU A;  1VQ9 3;  4O3V A;  3S5C A;  1BSB A;  3JUQ A;  3IPT A;  1AY7 A;  3E99 A;  1OHP A;  2RFR A;  2V1L A;  3DXO A;  3MG3 A;  3QK9 A;  5IG0 A;  3CMA 3;  4FR9 A;  3B4O A;  2C4B A;  1NU3 A;  3F9S A;  1RGK A;  1T5Y A;  1A90 A;  1B20 A;  2I9W A;  3LTD A;  3T0U A;  4N6T A;  5LC6 A;  3CC7 3;  3X3Y A;  2HML B;  1EEJ A;  4JRF A;  4U13 A;  5IEP A;  3M8C A;  1N5H A;  1PY3 A;  1CQS A;  3IMA B;  4KFD A;  4K61 A;  1ROA A;  1YGE A;  1B2M A;  1K28 A;  4HVN A;  4CCV A;  5D81 A;  3EB8 A;  1B27 A;  1NO3 A;  4TX4 A;  1QVF 2;  1TU5 A;  3DH2 A;  1W6C A;  3KCH A;  4KZ1 A;  1GSP A;  4LEH A;  1T2I A;  2UGI A;  1BOX A;  3JUM A;  1UCK A;  2PNC A;  3OXA A;  3BIR A;  3X40 A;  2IYJ A;  3HIG A;  4CJN A;  1GOY A;  5KP4 A;  4OUQ A;  4XDV A;  1FZU A;  2FXT A;  4LSO A;  1Y4K A;  1ROV A;  1RN1 A;  1SIH A;  2GU1 A;  3KSE D;  3OWS A;  2CWV A;  3NQZ A;  1L5G B;  4HBR A;  4L8P A;  1C7H A;  5BIR A;  3GZY B;  1NB5 I;  1GMR A;  5AII A;  3NX0 A;  2B24 B;  1I2G A;  3EN1 B;  3Q1C A;  4FCJ A;  3LT9 A;  1BRK A;  2BMR B;  1UUW B;  2CKF B;  2H0H A;  3CNM A;  3BU4 A;  3CNX A;  2OQE A;  2IMJ A;  2F56 A;  2OTL 3;  1A2P A;  1Q9E A;  2W6J H;  4I5Q A;  4HJL B;  4IT7 A;  1I70 A;  2C11 A;  4GB5 A;  2CC3 A;  1Q7Y 4;  1RTU A;  2XGL A;  4J8T A;  3N8B A;  1M90 4;  5EQL A;  1JKG B;  4LMI A;  1FW7 A;  3L0R A;  5FW5 A;  3LOY A;  1C54 A;  2RSX A;  2BT3 A;  4STD A;  1TTO A;  2RGQ A;  1MNL A;  2MC8 A;  4G1M B;  3WOD G;  1ULI B;  5M18 A;  3CCS 3;  1QAL A;  2BU4 A;  4RBN A;  1DVC A;  1OAC A;  1GY6 A;  1YIJ 3;  3CCV 3;  1SII A;  1R4C A;  5KP1 A;  2OTJ 3;  2IUJ A;  3G71 3;  2H0G A;  2XF3 A;  3BB9 A;  1QAK A;  1VQ5 3;  2LYX A;  4N6U A;  3H51 A;  2GSP A;  3FG1 A;  1V57 A;  4FCZ A;  3LXU X;  1CEW I;  1X1U A;  1V74 A;  3HK4 A;  1U8C B;  1RCL A;  1RGC A;  4HOH A;  2P0X A;  3B8L A;  1O7M B;  3JUP A;  3CCM 3;  1WTH A;  2XGN A;  3D3L A;  3LTA A;  4MMZ B;  1VQK 3;  4XBX A;  1IQX A;  2ZDJ A;  4N6V 0;  1G96 A;  2K3D A;  5ELU A;  3CCQ 3;  2CFK A;  1O7W B;  1B2S A;  3PCR A;  4XBY A;  2KF5 A;  3EN8 A;  1NNV A;  1GY7 A;  1FGT A;  2W0Q A;  4XM4 A;  2E2V A;  3F40 A;  1BNG A;  5ELJ A;  1YVS A;  1KC8 4;  1UUG B;  4X2H A;  3UJM A;  3NM7 A;  1VQQ A;  2L1S A;  1RGG A;  2HMO B;  3K63 A;  4AEQ A;  2CX0 A;  1LOW A;  2CK3 H;  2BMO B;  5M1A A;  5CF1 A;  3CC2 3;  1RCK A;  2ML6 A;  5BVB A;  2K54 A;  4HAA A;  1DMN A;  1MWU A;  1IVX A;  6GSP A;  5JPU A;  1CYU A;  2XFS A;  4HM0 B;  1G02 A;  3BNC A;  1E97 A;  1TJD A;  3GSP A;  3FSD A;  2RBI A;  4BTW A;  3FH1 A;  1OHS A;  3VF1 A;  1ASK A;  2M7O A;  1BAO A;  3AMO A;  5G2G A;  1RN4 A;  2HMK B;  1JBS A;  1IT8 A;  1BSC A;  2YFL B;  2Z6B A;  3DMC A;  3G16 A;  1Q40 A;  3G4S 3;  3CCR 3;  3S67 A;  5CF2 A;  3PS8 A;  2MF7 A;  1DVD A;  1RDS A;  1ZO2 A;  4JF8 A;  3GZR A;  1CYV A;  4LZI A;  4EW5 A;  4IPB A;  3OWY A;  1N8Q A;  3QRD A;  3SXX A;  4MJD A;  1DMQ A;  2KF6 A;  4I4K A;  4RNZ A;  1W01 A;  3OWU A;  1MGR A;  5M19 A;  2ML5 A;  1T3B A;  2F5W A;  3FKA A;  4N6O B;  1GS3 A;  3X3X A;  2RNT A;  5A0O B;  1FGR A;  3WA3 A;  1DET A;  4O02 B;  4XBT A;  1WMO A;  3CCL 3;  1JN5 A;  2ZHX B;  2A15 A;  3OV4 A;  4XDW A;  1EKM A;  1MWT A;  2GXF A;  4R9K A;  2WOF A;  2CG1 A;  1X1X A;  5IG3 A;  1RGH A;  3FG3 A;  5D83 A;  1IV9 A;  1BSE A;  4HM4 B;  3MWZ A;  1QJG A;  2BIR A;  1BRS A;  1RGF A;  1NWW A;  4EV5 A;  1JZO A;  1JZD A;  1D6U A;  1KSI A;  4L8O A;  5TGN A;  1CH0 A;  1JJ2 2;  3I55 3;  5DRV A;  3LT8 A;  3K0Z A;  3BNB A;  4FMB A;  3ECF A;  3FLJ A;  1JBR A;  1OF5 A;  1U5O A;  6STD A;  2BMQ B;  2R4I A;  4GL6 A;  1JRQ A;  3D79 A;  5JBS A;  3EBT A;  3NHX A;  9RNT A;  1RGL A;  1D6Y A;  2XR8 B;  3G6E 3;  5IG5 A;  3V99 A;  1B21 A;  2IUK A;  1Q82 4;  3TDG A;  5D82 A;  3EHC A;  1FUW A;  4EXR A;  1OH0 A;  3SYU A;  1GY5 A;  1VQP 3;  2CW9 A;  5AIH A;  3NXJ A;  1KWI A;  8RNT A;  3RDE A;  2O3O A;  1YHQ 3;  2UUG C;  2PZV A;  4R80 A;  2YX9 A;  4ORL A;  3MKI A;  4L7K A;  3PXM A;  1YVB I;  3U97 A;  2LQV A;  2CX1 A;  3HX8 A;  3JVC A;  3D5I A;  4Q53 A;  5AIF A;  7STD A;  1TRP A;  3N9H A;  1OCV A;  3J7Y d;  2GEY A;  3VSY A;  4KVH A;  6RNT A;  2CFD A;  3DUK A;  1BSA A;  3D4A A;  3GRD A;  3BND A;  5CK6 A;  2BO9 B;  2L4V A;  3AMO B;  4BTY A;  1K8A 4;  3AHS A;  1O7N B;  4RNY A;  3X42 A;  1JBT A;  1Q40 B;  1VQ7 3;  1RRL A;  2STD A;  2GU3 A;  1X1W A;  3KSP A;  2XFT A;  2F4Y A;  4J5K A;  2HMM B;  1YIT 3;  1OGX A;  2FGT A;  1RNT A;  2XH9 A;  1I0X A;  1KQS 2;  4R9L A;  2BHM A;  4EV2 A;  5BXQ A;  5IEO A;  3V98 A;  3K7C A;  1GMQ A;  3CU3 A;  2W56 A;  7GSP A;  1B3S A;  2H0I A;  1Q42 A;  2KXG A;  2KAA A;  4J9A A;  1A2V A;  1NB3 I;  1JN5 B;  3F14 A;  2W9Q A;  2HOH A;  4HKV B;  3GWR A;  1N8R 4;  2QEX 3;  2KF3 A;  4HM3 B;  2OWP A;  1W00 A;  3DM8 A;  3DGM A;  1J2B A;  1VQN 3;  4MMY B;  1V58 A;  2WGQ A;  3G0K A;  3ROB A;  3CCJ 3;  4NPB A;  4OK0 A;  2Z76 A;  3UB1 A;  3CXC 2;  4NRE A;  4HZB B;  4FMC A;  3EE1 A;  1W02 A;  1F8N A;  2FNQ A;  4HM2 B;  2CHC A;  1SJW A;  1W2Z A;  3ZG0 A;  1IVW A;  1IU7 A;  5DRE A;  1QAF A;  1BNS A;  1OF5 B;  1MOL A;  1UI7 A;  1LQG C;  3WOE B;  4BL3 A;  3SLU A;  1GMP A;  2W9P A;  4DKI A;  3DGN A;  3KII A;  3F7X A;  3SOY A;  3HII A;  2CWT A;  1FUT A;  1LOX A;  2P05 A;  1O7P B;  2WOH A;  2CG0 A;  2AAD A;  3CPW 2;  2KCD A;  1LNH A;  1LNI A;  3PCS A;  1MWR A;  1VZZ A;  1W5Z A;  2W03 A;  4LYL B;  3WA2 X;  1STF I;  2CFG A;  5HGR A;  3DGY A;  2CWU A;  3DZL A;  1PU4 A;  1SPU A;  1G0T A;  4ILF A;  2BNG A;  3ZG5 A;  1D6Z A;  2OCT A;  3URP A;  5I97 A;  4R1K A;  4NHF A;  5AEW B;  3WDG B;  1IV7 A;  4WP5 A;  1TFO A;  3CCU 3;  1ZX2 A;  1EUI C;  2QIY A;  4O2H A;  1BIR A;  4GHO A;  1Q86 4;  1BAN A;  1YJ9 3;  5CXO A;  1W7C A;  1N5P A;  1Q7H A;  2C10 A;  3EX9 A;  1N9J A;  3KZT A;  4BTX A;  1VQ4 3;  1IYY A;  1BNJ A;  1JV2 B;  3BNE A;  3OX9 A;  2ZL8 A;  5EVH A;  3V92 A;  3EQQ B;  3UL5 A;  1RGA A;  3RGR A;  2IY2 A;  2KF4 A;  1TFK A;  3B7C A;  3DGO A;  1BNI A;  3DY5 A;  4K1V A;  1JKG A;  5FGO A;  1A67 A;  4FMA A;  1FGO A;  4RNT A;  1BUQ A;  1AV4 A;  1IQY A;  1UCL A;  3ZFZ A;  3JUO A;  2F98 A;  1BRN L;  5KP3 A;  5AYR B;  4HM5 B;  4CDL A;  1UCJ A;  5IF6 A;  1HZ1 A;  3WR2 A;  2P0M A;  1GYB A;  2W56 B;  1US1 A;  1O7H B;  1TRQ A;  1ZGX A;  3T8U A;  1OUN A;  1AVL A;  1I3I A;  1HU9 A;  1AVK A;  3LTB A;  1JB2 A;  3RNT A;  2XRX B;  2D42 A;  1PYL A;  2IA7 A;  5G1L A;  8CHO A;  2XEP A;  2B1X B;  1BUJ A;  4CPK A;  4EC6 A;  4BU4 A;  1DE3 A;  1BNE A;  1RN7 A;  1TP6 A;  3FF0 A;  1UGI A;  3CCE 3;  1RRH A;  1LOY A;  1YNV X;  1JB5 A;  1BRG A;  3H3H A;  4EBG A;  5IG4 A;  3EJV A;  2HMJ B;  3F8H A;  2K0M A;  1YJN 3;  1NJI 4;  1HYF A;  3KN4 A;  3EC9 A;  3ER7 A;  1IVV A;  2JQ5 A;  4HM7 B;  3NUV A;  4N6N B;  3HZP A;  1STD A;  4R4K A;  1WNH A;  4AKZ A;  1KD1 4;  1IQ8 A;  1B2U A;  1I3F A;  3NQY A;  5IEN A;  4FMD A;  1RNB A;  1Q81 4;  1RLS A;  2GBW B;  2OQE C;  1R4Y A;  1ISK A;  1RJO A;  3F8X A;  1M1K 4;  4HM1 B;  3SED A;  5HOH A;  1M9G A;  4HZ9 B;  1ZS7 A;  3DGL A;  3NBR A;  2ZA4 A;  3FZW A;  1RKY A;  1VQL 3;  1GD3 A;  3MHE A;  5RNT A;  1N9E A;  1YJW 3;  2QA4 3;  3F7S A;  3HOH A;  1WQL B;  1EQK A;  3Q2P A;  3X41 A;  4X2O A;  3FCS B;  1YI2 3;  4XB5 A;  3I56 3;  4EYC A;  2Z77 A;  4HM8 B;  5G1K A;  1RMS A;  1BRI A;  3U1W A;  4WWU C;  5STD A;  3PYJ A;  1TUH A;  4LGQ A;  3NV0 A;  1JNQ A;  1LOV A;  3GZB A;  4BIR A;  2P09 A;  4PEJ A;  1BNR A;  3EBY A;  2CIU A;  2GBX B;  1IDP A;  1UDI I;  1DMM A;  1LQM B;  4IIA A;  1UCI A;  2R41 A;  1GD4 A;  1UGH I;  3LH4 A;  5JPP A;  1FGM A;  3X3Z A;  3LTC A;  2Q07 A;  2SBL A;  3FGY A;  1QMA A;  2E2T A;  1I0V A;  3SOA A;  2W04 A;  3AGN A;  1AQZ A;  3MG1 A;  2QGU A;  2RCD A;  3NM2 A;  4GSP A;  1WMN A;  3FG4 A;  3LML A;  3CD6 3;  3IJE B;  3PZW A;  1RHL A;  2CH9 A;  2O9U X;  1PFP A;  3CPO A;  4MEI A;  5EEO A;  1IK3 A;  1K73 4;  5AI1 A;  4FCM A;  3UL6 A;  2YFJ B;  1A2K A;  2Y73 A;  4HYZ A;  5BU4 A;  1EG9 B;  1HKX A;  1LXE A;  3MPH A;  5AYS C;  1I2F A;  2E2U A;  1SAR A;  4WYK A;  2Y74 A;  4OVM A;  1FUS A;  1BRJ A;  1B2X A;  3G8Z A;  3D9R A;  4O8S A;  4BL2 A;  3STD A;  2GEX A;  4N3V A;  1K41 A;  3PGB A;  1IT7 A;  4KFE A;  2WGO A;  3NBJ A;  3S29 A;  5IER A;  4N6L A;  3S27 A;  3K9M C;  4K90 B;  3WHO A;  1LRA A;  1OGZ A;  2OOV C;  3EF8 A;  4WHA A;  1LVN A;  3K5T A;  3O8Y A;  3WMD A;  2F99 A;  2J8X B;  3Q90 A;  1UUV B;  3B4P A;  1OPY A;  4AKY A;  3SX1 A;  4KFF A;  3I0Y A;  2SAR A;  2YFI B;  2WO0 A;  1TIJ A;  1VQM 3;  1AR0 A;  3NBB A;  4N6M A;  1K9M 4;  3KE7 A;  4J5G A;  1W2B 2;  3VGN A;  2CFL A;  3CME 3;  3UNL A;  4ZM8 A;  1JB4 A;  1X1Y A;  3GAX A;  1ULJ B;  1FYS A;  3T8N A;  3AHW A;  3FF2 A;  4KT3 B;  2F5M A;  5CLK A;  3MYT A;  3OW2 2;  1RGE A;  4WFO A;  1MWS A;  1S5A A;  5AEU B;  1NDO B;  1UW1 A;  1Z1S A;  1BVI A;  4HM6 B;  1GOU A;  3S28 A;  3GZX B;  1BRH A;  2Z7A A;  1W6G A;  3Q3F A;  3KFQ C;  1I2E A;  1E3R A;  5IW9 A;  3ALA A;  3D5G A;  3NV0 B;  2KRT A;  1UI8 A;  2OOV A;  5AIG A;  3MG2 A;  4K1U A;  3AGO A;  1YGW A;  1BSD A;  3BLZ A;  3N54 B;  1IVU A;  1FGQ A;  1BNF A;  4QWT A;  3CC4 3;  3MSO A;  3SVA A;  2JDI H;  1S72 3;  3JUN A;  3LZA A;  1VQ8 3;  1SQW A;  1WMP A;  2UX0 A;  1E3V A;  4H3U A;  1VQO 3;  1BU4 A;  1VQ6 3;  1OHO A;  2P38 A;  1FA3 A;  1BGS A; 
#chains in the Genus database with same CATH homology
 1W6Y A;  3A76 A;  4H61 A;  2XSO B;  1EA2 A;  2XSH B;  3KKG A;  4MMX B;  2D1W A;  2F86 B;  2HMN B;  3WOF B;  2W2C A;  1W4N A;  5LC7 A;  3RGA A;  2INX A;  3HI7 A;  1M1X B;  3LYG A;  1O7G B;  4RZM A;  1QVG 2;  4WYK B;  1DYU A;  1VQ9 3;  4O3V A;  3S5C A;  3JUQ A;  3IPT A;  3E99 A;  1OHP A;  2RFR A;  2V1L A;  3DXO A;  3MG3 A;  3QK9 A;  5IG0 A;  3CMA 3;  4FR9 A;  3B4O A;  1NU3 A;  3F9S A;  1T5Y A;  1A90 A;  2I9W A;  3LTD A;  3T0U A;  4N6T A;  5LC6 A;  3CC7 3;  3X3Y A;  2HML B;  4JRF A;  4U13 A;  5IEP A;  3M8C A;  1N5H A;  3IMA B;  1CQS A;  4KFD A;  4K61 A;  1ROA A;  1YGE A;  1K28 A;  4HVN A;  4CCV A;  5D81 A;  3EB8 A;  1NO3 A;  4TX4 A;  1QVF 2;  1TU5 A;  1W6C A;  4KZ1 A;  4LEH A;  3JUM A;  2PNC A;  3OXA A;  3X40 A;  3HIG A;  5KP4 A;  4OUQ A;  4XDV A;  2FXT A;  4LSO A;  1Y4K A;  1ROV A;  1SIH A;  2GU1 A;  3KSE D;  3OWS A;  2CWV A;  3NQZ A;  1L5G B;  4HBR A;  4L8P A;  1C7H A;  3GZY B;  1NB5 I;  5AII A;  3NX0 A;  2B24 B;  3EN1 B;  3Q1C A;  4FCJ A;  3LT9 A;  2IUJ A;  2BMR B;  1UUW B;  2CKF B;  3CNM A;  2OQE A;  3CNX A;  2IMJ A;  2OTL 3;  2W6J H;  4HJL B;  4IT7 A;  1Q7Y 4;  2C11 A;  4GB5 A;  2CC3 A;  2XGL A;  1M90 4;  4J8T A;  3N8B A;  5EQL A;  1JKG B;  4LMI A;  3L0R A;  5FW5 A;  3LOY A;  2RSX A;  2BT3 A;  4STD A;  2RGQ A;  1MNL A;  2MC8 A;  4G1M B;  3WOD G;  1ULI B;  3CCS 3;  1QAL A;  4RBN A;  1DVC A;  1OAC A;  1GY6 A;  1YIJ 3;  3CCV 3;  1SII A;  1R4C A;  5KP1 A;  2OTJ 3;  3G71 3;  2XF3 A;  3BB9 A;  1VQ5 3;  1QAK A;  2LYX A;  4N6U A;  3H51 A;  3FG1 A;  4FCZ A;  3LXU X;  1CEW I;  3HK4 A;  1V74 A;  1U8C B;  2P0X A;  3B8L A;  1O7M B;  3JUP A;  3CCM 3;  1WTH A;  2XGN A;  3D3L A;  3LTA A;  4MMZ B;  1VQK 3;  4XBX A;  1IQX A;  2ZDJ A;  4N6V 0;  1G96 A;  5ELU A;  3CCQ 3;  2CFK A;  1O7W B;  3PCR A;  4XBY A;  3EN8 A;  2W0Q A;  1GY7 A;  1FGT A;  4XM4 A;  2E2V A;  3F40 A;  5ELJ A;  1KC8 4;  4X2H A;  3NM7 A;  2HMO B;  3K63 A;  4AEQ A;  2CK3 H;  2BMO B;  3CC2 3;  5CF1 A;  2ML6 A;  5BVB A;  2K54 A;  1DMN A;  1IVX A;  5JPU A;  1CYU A;  2XFS A;  4HM0 B;  3BNC A;  1E97 A;  3FSD A;  4BTW A;  3FH1 A;  1OHS A;  3VF1 A;  1ASK A;  2M7O A;  3AMO A;  5G2G A;  2HMK B;  1IT8 A;  2YFL B;  2Z6B A;  3G4S 3;  3DMC A;  3G16 A;  1Q40 A;  3CCR 3;  3S67 A;  5CF2 A;  3PS8 A;  2MF7 A;  1DVD A;  1ZO2 A;  4JF8 A;  3GZR A;  1CYV A;  4LZI A;  4IPB A;  3OWY A;  1N8Q A;  3QRD A;  3SXX A;  4MJD A;  1DMQ A;  4I4K A;  4RNZ A;  1W01 A;  3OWU A;  2ML5 A;  3FKA A;  4N6O B;  1GS3 A;  3X3X A;  5A0O B;  3WA3 A;  1FGR A;  4O02 B;  4XBT A;  1WMO A;  3CCL 3;  1JN5 A;  2A15 A;  3OV4 A;  4XDW A;  1EKM A;  2GXF A;  4R9K A;  2WOF A;  2CG1 A;  5IG3 A;  3FG3 A;  5D83 A;  1IV9 A;  4HM4 B;  3MWZ A;  1QJG A;  1NWW A;  4EV5 A;  1D6U A;  1KSI A;  4L8O A;  5TGN A;  1JJ2 2;  3I55 3;  5DRV A;  3LT8 A;  3K0Z A;  3BNB A;  4FMB A;  3ECF A;  3FLJ A;  1OF5 A;  1U5O A;  6STD A;  2BMQ B;  2R4I A;  4GL6 A;  1JRQ A;  5JBS A;  3EBT A;  3NHX A;  1D6Y A;  2XR8 B;  3G6E 3;  5IG5 A;  3V99 A;  2IUK A;  1Q82 4;  3TDG A;  5D82 A;  3EHC A;  1FUW A;  4EXR A;  1OH0 A;  1GY5 A;  1VQP 3;  2CW9 A;  5AIH A;  3NXJ A;  1KWI A;  3RDE A;  2O3O A;  1YHQ 3;  2PZV A;  4R80 A;  2YX9 A;  4ORL A;  3MKI A;  4L7K A;  3PXM A;  1YVB I;  3U97 A;  2LQV A;  3JVC A;  3HX8 A;  4Q53 A;  5AIF A;  7STD A;  3N9H A;  1OCV A;  3J7Y d;  2GEY A;  3VSY A;  4KVH A;  2CFD A;  3DUK A;  3GRD A;  3BND A;  5CK6 A;  2BO9 B;  2L4V A;  3AMO B;  4BTY A;  1K8A 4;  1O7N B;  4RNY A;  3X42 A;  1Q40 B;  1VQ7 3;  1RRL A;  2STD A;  2GU3 A;  3KSP A;  2XFT A;  2HMM B;  1YIT 3;  1OGX A;  2FGT A;  2XH9 A;  1KQS 2;  4R9L A;  2BHM A;  4EV2 A;  5BXQ A;  5IEO A;  3V98 A;  3K7C A;  3CU3 A;  2W56 A;  1Q42 A;  2KXG A;  4J9A A;  1A2V A;  1NB3 I;  1JN5 B;  3F14 A;  2W9Q A;  4HKV B;  3GWR A;  1N8R 4;  2QEX 3;  4HM3 B;  2OWP A;  1W00 A;  3DM8 A;  3DGM A;  1J2B A;  1VQN 3;  4MMY B;  2WGQ A;  3G0K A;  3ROB A;  3CCJ 3;  4OK0 A;  2Z76 A;  3UB1 A;  3CXC 2;  4NRE A;  4HZB B;  4FMC A;  3EE1 A;  1W02 A;  1F8N A;  2FNQ A;  4HM2 B;  2CHC A;  1SJW A;  1W2Z A;  1IVW A;  1IU7 A;  5DRE A;  1QAF A;  1OF5 B;  1UI7 A;  1MOL A;  3WOE B;  3SLU A;  2W9P A;  3DGN A;  3KII A;  3F7X A;  3SOY A;  3HII A;  2CWT A;  1LOX A;  2P05 A;  2WOH A;  1O7P B;  2CG0 A;  3CPW 2;  2KCD A;  1LNH A;  3PCS A;  1OHO A;  1VZZ A;  1W5Z A;  2W03 A;  3WA2 X;  1STF I;  2CFG A;  5HGR A;  2CWU A;  3DZL A;  1PU4 A;  1SPU A;  2BNG A;  1D6Z A;  2OCT A;  5I97 A;  4R1K A;  4NHF A;  5AEW B;  3WDG B;  1IV7 A;  4WP5 A;  1TFO A;  3CCU 3;  1ZX2 A;  2QIY A;  4O2H A;  1Q86 4;  1YJ9 3;  5CXO A;  1W7C A;  1N5P A;  2C10 A;  3EX9 A;  4BTX A;  1N9J A;  3KZT A;  1VQ4 3;  1JV2 B;  3BNE A;  3OX9 A;  2ZL8 A;  5EVH A;  3V92 A;  3EQQ B;  3UL5 A;  3RGR A;  3B7C A;  1TFK A;  3DY5 A;  3DGO A;  4K1V A;  1JKG A;  5FGO A;  1A67 A;  4FMA A;  1FGO A;  1BUQ A;  1AV4 A;  1IQY A;  3JUO A;  2F98 A;  5KP3 A;  5AYR B;  4HM5 B;  4CDL A;  5IF6 A;  2P0M A;  1GYB A;  2W56 B;  1US1 A;  1O7H B;  3T8U A;  1OUN A;  1AVL A;  1HU9 A;  1AVK A;  3LTB A;  1JB2 A;  2XRX B;  2D42 A;  2IA7 A;  8CHO A;  2XEP A;  2B1X B;  4EC6 A;  1RN7 A;  1TP6 A;  3FF0 A;  3CCE 3;  1RRH A;  1JB5 A;  3H3H A;  4EBG A;  5IG4 A;  3EJV A;  2HMJ B;  3F8H A;  2K0M A;  1YJN 3;  1NJI 4;  3KN4 A;  3EC9 A;  3ER7 A;  1IVV A;  2JQ5 A;  4HM7 B;  3NUV A;  4N6N B;  3HZP A;  1STD A;  4R4K A;  1WNH A;  4AKZ A;  1KD1 4;  1IQ8 A;  3NQY A;  5IEN A;  4FMD A;  1Q81 4;  2GBW B;  2OQE C;  1ISK A;  1RJO A;  3F8X A;  1M1K 4;  4HM1 B;  3SED A;  1M9G A;  4HZ9 B;  3DGL A;  3NBR A;  3FZW A;  1RKY A;  1VQL 3;  1GD3 A;  3MHE A;  1N9E A;  1YJW 3;  2QA4 3;  3F7S A;  1WQL B;  1EQK A;  3Q2P A;  3X41 A;  4X2O A;  3FCS B;  1YI2 3;  4XB5 A;  3I56 3;  4EYC A;  2Z77 A;  4HM8 B;  3U1W A;  4WWU C;  5STD A;  3PYJ A;  1TUH A;  4LGQ A;  3NV0 A;  1JNQ A;  3GZB A;  2P09 A;  4PEJ A;  3EBY A;  2CIU A;  2GBX B;  1IDP A;  1DMM A;  4IIA A;  1GD4 A;  3LH4 A;  5JPP A;  1FGM A;  3X3Z A;  3LTC A;  2Q07 A;  2SBL A;  3FGY A;  1QMA A;  2E2T A;  3SOA A;  2W04 A;  3MG1 A;  2QGU A;  2RCD A;  3NM2 A;  1WMN A;  3FG4 A;  3LML A;  3CD6 3;  3IJE B;  3PZW A;  2CH9 A;  2O9U X;  4MEI A;  1PFP A;  3CPO A;  5EEO A;  1IK3 A;  1K73 4;  5AI1 A;  4FCM A;  3UL6 A;  2YFJ B;  1A2K A;  2Y73 A;  4HYZ A;  1EG9 B;  1HKX A;  1LXE A;  3MPH A;  5AYS C;  2E2U A;  4WYK A;  2Y74 A;  4OVM A;  4O8S A;  3G8Z A;  3D9R A;  3STD A;  2GEX A;  4N3V A;  1K41 A;  3PGB A;  1IT7 A;  4KFE A;  2WGO A;  3NBJ A;  3S29 A;  5IER A;  4N6L A;  3S27 A;  3K9M C;  4K90 B;  1OGZ A;  2OOV C;  4WHA A;  3EF8 A;  1LVN A;  3K5T A;  3O8Y A;  3WMD A;  2F99 A;  3Q90 A;  1UUV B;  3B4P A;  1OPY A;  4AKY A;  3SX1 A;  4KFF A;  3I0Y A;  2YFI B;  2WO0 A;  1TIJ A;  1VQM 3;  1AR0 A;  3NBB A;  4N6M A;  1K9M 4;  3KE7 A;  1W2B 2;  3VGN A;  2CFL A;  3CME 3;  3UNL A;  4ZM8 A;  1JB4 A;  3GAX A;  1ULJ B;  3T8N A;  3FF2 A;  5CLK A;  3MYT A;  3OW2 2;  4WFO A;  1S5A A;  5AEU B;  1NDO B;  1UW1 A;  1Z1S A;  4HM6 B;  3S28 A;  3GZX B;  2Z7A A;  1W6G A;  3KFQ C;  1E3R A;  5IW9 A;  3ALA A;  3NV0 B;  2KRT A;  1UI8 A;  2OOV A;  5AIG A;  3MG2 A;  4K1U A;  3BLZ A;  3N54 B;  1IVU A;  1FGQ A;  4QWT A;  3CC4 3;  3MSO A;  3SVA A;  2JDI H;  1S72 3;  3JUN A;  3LZA A;  1VQ8 3;  1SQW A;  1WMP A;  2UX0 A;  1E3V A;  4H3U A;  1VQO 3;  1VQ6 3;  2CFW A;  2P38 A;  1FA3 A;  3UJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...