2QAAA

Crystal structure of the second tetrahedral intermediates of sgpb at ph 7.3
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin-B
publication title 1.2A-resolution crystal structures reveal the second tetrahedral intermediates of streptogrisin B (SGPB).
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qaaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qaaA01
3IWMA 4HI3A 1NU7B 3UFAA 3UIRA 7LPRA 1HAOH 4JMYA 5A09A 1C1SA 1S83A 1S84A 3HATH 1RGQA 2VIPA 2UUYA 1PQ5A 2VINA 3Q3YA 3OYPA 1GJ6A 2DUCA 1P03A 1TNIA 1HXEH 3DHKH 1ETTH 1FN6A 2CF9H 1HAYB 2AGEX 1AFQB 1HUTH 1HB0B 4FXGH 5FX6A 5JB8S 3U8RH 2BDIA 1GJAB 3RLYH 3W95A 1HAGE 1SMFE 2BQ6B 1VITF 2QIQA 3SU3A 3QGNB 3NK8A 2VIQA 1V3XA 1TFXA 2QF3A 3BTHE 8GCHG 1AWHB 4NWLA 2BZAA 4VGCC 1V2UT 1GHWH 1ZMJA 3KQCA 2CMYA 1DUEA 1MUEB 4A1VA 4MPWA 4YOIA 3UWJH 3RXTA 3RXKA 3UUZA 3A81A 2FX4A 1YCPK 1OX1A 2ODYB 3V7TA 4BXSA 4I8HA 2OBQA 1IAUA 3U9AH 1A5GH 1A3EH 4BAKB 4AG2A 4BAHB 1Q31A 3SGQE 4K3JA 1O3OA 1GGDC 4CRFA 3RU4T 5C1UA 1ZPCA 2HWLB 4O03A 1FY4A 1MKWH 3A89A 2JETB 3A87A 3SJOA 3JZ1B 1F92A 1OPHB 1BDAA 2VIDA 1GHXH 3BTDE 1AO5A 1LPKB 1QBVH 1HDTH 1GBBA 3BN9A 1AIXH 1TGNA 5A8YA 1HAVB 4FU8A 1C4U2 3OX7U 3K6ZA 2ZI2H 1MQ6A 4YESB 1TGBA 2ZO3H 3E1XB 4H4FA 1DY9A 3RU4D 5C1XA 1MCVA 2AMDA 3Q77A 1EZUC 1SPJA 5FCRA 1K9OE 1GBEA 4XOJA 4X6MA 9ESTA 2CHAB 2XC5A 3ZZ3A 1IQFA 2SGAA 4RN6A 2BXTH 1CBWC 2D26C 1O2HA 2C8XB 2ZDKA 5E0JA 1GBCA 1W8BH 4K1EA 4RKOB 3LGTA 1C5YB 3P70B 4CBNA 3A7WA 3GOVB 3SO3A 2UWPA 3CS7A 2ZFQH 4WH6A 2FM2A 1SBWA 4MTBA 1VJ9U 1A61H 4A1XA 3BEFB 1ELEE 3ZZ4A 4TWWA 2ZPQA 2FOBA 3I77A 1FDPA 1P2QA 1SGFA 1AE5A 4FUFA 4NIVA 2BOKA 4XDEA 4IC5A 4AG1A 2OP9A 1C5NH 1W7XH 1WV7H 3PYHA 3JZ2B 1P3EA 2BM2A 1B0EA 1C4Y2 2ZTZA 3OTJE 2ZF0H 2FLBH 4LXBH 1BTPA 2C8YB 4WVPE 2SGDE 4X1RU 3LGUA 1O3IA 4Y8XA 3HKJB 3S9CA 4HTCH 1NZQH 1KLTA 4ISLA 1KLIH 1T8NA 3L3TA 3M61U 3SJKA 1D3QB 4ZXYH 2QCYA 1T8OA 2TGTA 1TBRH 2A1DB 4CBOA 1UTNA 4O3UA 1TBQH 4JK6A 1ESAA 1XXFA 2HNTE 2YNBA 1TA6A 2H5CA 3MNXA 1ETSH 1P2NA 4WH8A 4JZDH 1LHCH 3STIA 1KXCA 2LPRA 2BLQA 2ZFSA 2KAIA 1ZR0A 1D3DB 4E7NA 3P8FA 2FOFA 2I6SA 1WAYB 1YP9A 4I8LA 4NSVA 2PR3A 4CRDA 1GHZA 2NU3E 2ZFPH 3GY6A 1O5AB 3MNSA 3RM2H 2Z94A 3T2NA 2GMTC 1GBJA 1PJPA 4CRBA 1HAPH 3SUGA 1G2LA 2FP7B 1ZHRA 1NRRH 4I32A 1K2I1 3UOUA 4NWKA 3A84A 2ZHFH 3E0PB 1TNJA 4ABHA 5DGJA 5J4SA 1OWHA 2ULLA 1S82A 1BJVA 4BXWA 1C5TA 3MH6A 3I29A 4UFEH 8ESTE 1C5OH 7KMEH 4JZEH 1PPZA 3SU4A 1GI8B 2B8OH 3LT3A 1TQ0B 1YC0A 4MVNA 2HVXA 1FXYA 1KIGH 1LO6A 1Z1JA 4J1YA 3VEQB 2BHGA 3S9AA 2ZGCA 1VGCC 2BDHA 2XYAA 1O38A 2PKAA 2R3YA 4Y7BA 1EJMA 2Z9GA 3A7ZA 1QL7A 1GHAG 2W3KA 2RDLA 5L6NH 3ELAH 1G3DA 1BRBE 1NRNH 3VGCC 1EZQA 4DJZB 4GVUA 5DP8A 1O5CB 3MO3A 4MQAA 2TIOA 2TRMA 4B74A 5C3NA 2A2XH 1THSH 3RXUA 4I31A 2A45B 1YYY1 1DWBH 3SHCH 4A5TS 2C3SA 1BBRE 1UVSH 4NA7A 3DFJA 1C5UA 4NIYA 4AX9H 1TA2A 1TALA 1GBKA 1NFUA 4UFDH 1CHOF 1DLKB 1XX9A 3SI4H 1HRTH 1WOFA 2J94A 1N8OB 2ZPSA 1SLUB 2Y5FA 3LJJA 1FIWA 1NPMA 1KXBA 1ZMNA 1DDJA 1WU1A 2HRVA 2W5EA 3QTOH 5GCHG 5T6FA 4AFSA 1DOJA 1UJ1A 4NIWA 1AZZA 1HGTH 2A7CA 1EKBB 4KTUA 1XVMA 4B1TA 1L0ZA 4K1TA 1NC6A 2FOAA 2G00A 4B73A 1AI8H 2Y81A 4BTIB 2BD7A 2BDYA 5DJ7A 4LZ4B 3MU1A 1SHYA 1SFQB 2PUXB 4FUCA 3T25A 1UVUH 3TH4H 1W7GH 4AB9A 3R0FA 2UWOA 5B6OA 2OQUA 3BIVH 4KP0A 3SORA 1MMJN 2Z9KA 2H2ZA 5TCAA 3F9GA 3BV9B 4IBLH 3ZVCA 2A32A 5EXMA 4INLA 1NS3A 1O2PA 4NIXA 1WQVH 1EJAA 3VB7A 2C8ZB 2XWBI 1C5MD 3ZZ6A 3PROA 1C9TA 1BUIA 1LVMA 3EA8A 3C1KA 2BD4A 1O2UA 2VIWA 3GY3A 2AIPA 3CENA 1TNGA 3QLPH 1HAHH 5CHAC 1C2MA 2F9BH 2Z3EA 2F9VA 3A7VA 1ELDE 1HJAB 1O2ZA 2ZQ1A 2F9PA 2Q1JA 1DFPA 2R2MB 4Y7AA 3Q3XA 2Q6FA 2VWMA 3RXQA 5A0CA 1O2SA 3M7TA 1ELBA 1VITH 5L2YH 2O9QA 4X2XA 1P2OA 1ARBA 2BOHB 2BDCA 1H9IE 1HCGA 4NA9H 1SGQE 2GCHF 1W13U 2W7UA 2Y7ZA 4D7FA 3Q76A 5C5NA 5A8ZA 1QB6A 1O3MA 1JWTA 4OS4A 2OCVB 3M3SA 2A0QB 3SNBA 1QQUA 4X8SH 1YPLH 1NO9H 1C9PA 1SLXB 2V6NA 4Y11E 1SVPA 5DP5A 1UTJA 1T32A 4K69A 1H1BA 4CRGA 2PV9B 4AORA 4O97A 2ANKH 1FN8A 1V2MT 2J2UA 4JZIA 3SU5A 4MNXA 1IOEA 2XC0A 1FAKH 1LTOA 1O3GA 3E6PH 1T4UH 3ZV9A 3DFLA 3E91A 3KNXA 4WJG2 2HNTF 2DE8A 1Y3VA 2XTTB 1LVBA 1F0RA 1J17T 1CHGA 2ALVA 2Z9JA 2P3FH 4YO9A 1P2KA 3GCHB 2EI8A 5CMXH 1IQNA 3HK3B 5AFZH 3SV8A 3AW1A 1GWAA 1LVYA 1ZRBA 2GD4B 2XW9A 1SSXA 3RXSA 2OXSA 3GDUA 5FPSA 4I33A 1TRYA 3H7OA 1GI4A 3GCNA 4X6NA 2GZ8A 3UY9A 2WYGA 1GJ4H 3LC5A 1E35B 2J95A 1Z1IA 3D62A 2OTVA 4ABBA 1A2CH 3RXBA 1ORFA 2H9HA 1MCTA 3RC5A 3UTUH 4KKDA 4CHAC 3HGPA 2Y5HA 2O8UA 1LDTT 1PQAA 3VB3A 1RIWB 1YLCA 1NN6A 5EOKA 3SNEA 1RRKA 3ZZBA 3TLOA 1GHBG 2PTCE 1DWCH 3GYLB 1SGCA 5HM9A 2WPLS 1T7CA 4JZFH 4BAQB 4IMQA 4TPIZ 1VCPA 3SUEA 1JIMA 2A5AA 2Z6BD 4Z6AH 1T8LA 4CREA 1SLWB 2VGCC 1UCYK 2BLWA 5BRRE 1KSNA 1TIOA 1P05A 4CH2B 5FPYA 4JYUH 5EW2H 2BX3A 1P9SA 4Q7YA 1NFXA 1S0QA 4O3TA 1AD8H 3MNBA 1BTZA 1QB9A 4X8VH 1QL8A 1NU9A 3H5CB 1C5WB 1F5LA 3TPIZ 1O5BB 3QTVH 2BY5X 2QN5T 5FHTA 5C20A 1HAVA 1P09A 1ELCA 2AIQA 4ZH8A 1UTOA 1KXEA 4E05H 3RMOH 1QQ4A 2H9TH 1O5GH 4OS6A 1DWEH 3SV6A 3ESTA 2TGPZ 1BRCE 1Z6EA 1O3JA 3NKKA 1DT2A 4XE4A 1YPMH 2Z3DA 2SGQE 1BA8B 1F2SE 1SL3A 2WV4A 3RC4A 1QA7A 2BZ6H 1RS0A 3MU8A 1M9UA 2DE9A 1OWIA 3V3MA 2OC1A 1ZZZA 2V0BA 3SN8A 1GBAA 2VVVA 2XBVA 4K2YA 5GIBA 2OINA 1FLEE 1E0FD 1EPTC 1IHSH 1K1MA 3P6ZB 4XBBA 8LPRA 3FP6E 5AF9H 4KTSA 3KQBA 4Y76A 2H1UA 1ID5H 4I8JA 4ISOA 4K60A 3P8NA 3GDSA 4AZ2B 1GL0E 1EAXA 2PSXA 2HLCA 3SU2A 1PPCE 4K1SA 3SQEE 2BDAA 1GJ5H 4TY6A 1YF4A 4MNYA 5FPTA 5TCCA 5T3HA 2Q6DA 3GCOA 1DE7H 3T28A 2P3UB 3TNSA 2P95A 3MH5A 1W11U 1GMCF 1A7SA 2XBYA 1FMGA 1YPJH 3U1JB 1TNKA 5GPIB 2IOTA 2QXIA 2ZU3A 4Q7XA 2QXHA 3FVFB 2ZCKP 6GCHG 2BVRH 1GJBB 1AB9B 1RTLA 1MTNC 1AGJA 2C90B 3VB6A 1C1PA 1IQKA 2XRCA 5E2PA 3A80A 1WSSH 1GBHA 3CP7A 4LOYH 2ZP0H 3TJVA 2AS9A 3BTGE 3M37A 2ZHDA 2O8MA 4BTTB 1O3LA 3T5FH 1T8MA 4GHQA 2A4QA 2H5DA 3HKIB 2R3UA 2A2QH 2A7JA 2ZEBA 2WPIS 1EP5A 1WBGB 3ZZ5A 2PKSB 5BPEA 1MZDA 1NFWA 2B0FA 5JBBS 3T29A 5F8ZA 1O3DA 1CSOE 5DKMA 2P8OC 3M7QA 2P93A 1MZAA 3K6YA 1C2KA 3RMLH 3VFEA 2GCTB 2ZPRA 3ZVAA 1PPHE 2WPKS 2ZA5A 1Z8GA 2D8WA 1SLVB 5SGAE 4UD9H 4JZ1A 4Y8YA 1C1OA 3RXEA 3RXOA 1L4DA 5L2ZH 6CHAC 1VJAU 1ELFA 4R8TB 3B9FH 2ZZUH 3ZVEA 1JIRA 5HGGA 4GCHF 1BHXB 2CV3A 2TPIZ 4OS7A 2GP9B 1MAXA 3A85A 3F68H 3E3TA 1A1RA 4ZAEA 1TE0A 3PO1C 4ZXXH 2ANYA 1UK4A 5L30H 3LC3A 1NY22 4DCDA 2VVCA 2Y5GA 3KCGH 4X0WU 3H7TA 1DUAA 3IITA 4YOJA 4MNVA 1LKBA 2FO9A 1QCPA 2A4GA 4BANB 1YBWA 2FX6A 1BIOA 1ELTA 3GY8A 1CA8B 1ANBA 1C1VH 2CF8H 2W7SA 5C67A 4Q2KA 1QR3E 2OLGA 2HNTC 1OYQA 1OWKA 1GJ9B 5DPAA 1S6HA 4ISIH 4XFQA 1O37A 1LPZB 2WPJS 1CT4E 4YT7H 2G51A 2LNCA 2QXGA 3ITIA 3PV4A 3F1SB 3ZZ8A 3S69A 4IMZA 3NPSA 3UQVA 1KXFA 2XWAA 3UOPA 3QWCH 1XUGA 4X2WA 1EJNA 5A8XA 3GICB 1EAIA 5DP7A 1H8DH 1NRQH 1SB1H 5AVDA 2ZDLA 1GVLA 1FPHH 1TONA 1N1LA 2F83A 1ANCA 1ESTA 1YPHC 3FFGA 2F9NA 1D9IA 4WXIA 1O0DH 4B2BA 1ZJDA 1ZTKA 2ZU4A 1C2DA 1G32B 1WCZA 1GDUA 1TRMA 1G3BA 2GTBA 3RUOA 2FXRA 1J16A 2ZDAH 3TNTA 2XBXA 1BITA 2J92A 1C1RA 3PMJA 3TVJB 1FZZA 1HLTH 4VGCB 3ZV8A 4Y79A 3S9BA 2PTNA 2OUAA 1SOZA 2VNTA 3AAUA 1J9CH 4RSPA 1K1IA 3FZDA 1P9UA 1V2KT 4A7IB 1E37B 3E16B 1XVOA 2EI6A 2R0KA 2K1QA 1AZ8A 2F3CE 4AFZA 3NZIA 4GAWA 4D9RA 1BOQA 2PGBB 2VIOA 1C1TA 3MTYA 1CA0C 2O8LA 4H6TA 5GJ4B 1OP2A 4FUEA 1BTHH 1O3AA 3D49H 1CGJE 4ZHMU 4CH8B 3TJUA 1O33A 5AFYH 3BG4B 1GGDB 2BY8X 1RXPA 1Z8RA 2C8WB 1S5SA 2QV1A 1J8AA 4XBCA 1C1QA 1O2WA 1O31A 4ABDA 2ZFTA 9LPRA 4X1SU 3A88A 3UNRA 1FUJA 3VB5A 2ODQA 1GMDG 3FANA 1TMUH 2XCFA 2Z9IA 1UO6A 1RJXB 1IHTH 1OWJA 1CU1A 4HFPB 2SNVA 1VR1H 3W94A 1GBLA 4LZ1H 1QRXA 2FI5E 2FS8A 3SV9A 1LPGB 1C5RA 2ZGJA 1THRH 1G37A 3SQHE 5CE1A 1EAWA 5K7RA 5EXLA 4D7GA 1AY6H 4Y6DA 1O3NA 1DSTA 1HV7A 1CBWB 1EZXC 2IPHA 1GMHF 3UNQA 2FLRH 1IQLA 1D3TB 1MH0A 5LPFA 3QZQA 3ZZ7A 1QA0A 2BQWB 2FS9A 1FV9A 4ABJA 1EQ9A 2WYJA 5FXLA 1H9HE 3GCTF 2THFB 3QUMP 1H4WA 3E90B 1O3PB 1WQSA 1C2FA 1QURH 2SGEE 1EASA 2P16A 3M5MA 1O2GH 2BQ7B 3LU9B 1A0LA 5EW1H 3MNCA 3TJNA 3AVZA 3SOSA 1QTFA 1CQQA 3RM0H 1L1JA 3UQOA 1SGDE 3SUFA 2F9OA 4B2AA 3LKWA 1SGPE 2NWNA 4FU9A 3AASA 3TH3H 1O35A 2XBWA 2EA3A 3M3TA 5HYOA 1HJAC 2GDDA 3HGNA 4AYYB 1BRAA 1H8IH 1K1PA 3UREA 4ZHAA 1P02A 4D76A 2SFAA 1GG6C 3MI4A 2V35A 1GCTC 3LDXH 3RMNH 3SJ8A 1V2LT 1MKWK 4I8GA 3V13A 1O3FA 3LH3A 1NESE 5EQSA 2VWLA 1IQIA 3DD2H 5JDUB 7GCHG 3RU4E 1UCYH 2AGGX 2ZCHP 1V2PT 5A2MH 1LHFH 1PQ8A 3SNAA 1IQGA 1O2MA 2Z7FE 2A7HA 3GY4A 1F7ZA 3L33A 4ISHH 1V2WT 1QRZA 5EGMA 2AH4X 5HXFA 4OS1A 4FUJA 2JH0D 1EOLA 5E8EH 1DSUA 2H6MA 1C2LA 1JOUB 1BRUP 2QC2A 3LGWA 4SGAE 2BVXH 1O36A 3UR9A 2PUQH 1THPB 4ZMAH 2GMTB 1T4VH 1NROH 4UONA 1O30A 4AFUA 4SGBE 3P17H 4B2CA 1VITG 1IQHA 3LGYA 2CXVA 4U30A 3LONA 1KXAA 2A4RA 2FTLE 2GX4A 2UUJB 1YLDA 3A8AA 3IG6B 5C5OA 2W3IA 2PLXA 3MYWA 1HXFH 1MTVA 3C27B 1ANDA 2WUCA 1NRPH 1IQMA 1UTLM 1DICA 1VGCB 2Y80A 1ZGIA 3A83A 4Z0KA 3KIDU 5I25A 1A46H 1VCQA 2BY9X 1P01A 2BMGB 3MHWU 5JBTA 2ZU2A 1P8VC 1O39A 3PMHB 3OY5U 1OS8A 4MPVA 1K1NA 4Y0YE 1W14U 3K65B 1AVGH 2G8TA 2BYAX 2AERH 2TBSA 5A0BA 4A6LA 1UMAH 4ABIA 3TK9A 2H9EH 2A31A 1O3BA 2FOMB 3MOCA 4MPUA 4JYVH 3O8BA 4X6OA 1O2JA 5LGOA 5JBAS 5F8TA 1FAXA 1LHDH 3LIWA 3ZVGA 2F91A 1GVKB 2ZHQH 1V2OT 4LK4A 3MH4A 1GBDA 4TYDA 2D1JA 3ODDA 1DANH 4ABGA 1P06A 2QY0B 1PPGE 1XKBC 3PLPA 3ZVDA 1O34A 1BT7A 4XBDA 4A92A 4BNRA 1TOMH 1SQTA 8KME2 1MTWA 1TMTH 3AAVA 4YTAA 5ESTE 4YT6H 5LH8A 3MU4A 1FY3A 1TB6H 1V2NT 3RXDA 3MU5A 3UNSA 1ZTLA 1C5VA 3ZZCA 1F0SA 1A0HB 1F0UA 2A5IA 3EGKH 1FQ3A 1HJ9A 1YCPH 1OOKB 2G4TA 3BTFE 3G01A 3U8OH 1JMOH 3D65E 2A4OA 3V12A 1GCDA 4MNWA 1AKSB 1QY6A 1UTKA 1UK2A 3N7OA 5G4BA 3RXPA 4ZHLU 2J34A 1AE8H 1KDQB 1GI0A 2D2DA 1RD3B 1V2JT 3PWBA 2VVUA 1L1NA 5JPMH 5F6MA 1MTUA 1N6YA 4NGAH 3VXEH 3GY2A 1K1JA 4DIHH 1Z8IB 1DVAH 4WXVA 3B8JA 4YLQH 5H4IB 5A0AE 4AGKA 2HGTH 3R3GB 3MMGA 3VPKA 4CRAA 5T6DA 3TGIE 1TNLA 1CGIE 1PPBH 4FU7A 1L4ZA 1C5SA 1X7AC 1UTMA 4X6PA 3V0XA 2BXUH 1UHBB 2ANMH 3M5OA 5CHAB 3ZZDA 4U32A 3BTKE 4INHA 1K1LA 1AFQC 1BBRK 1MAYA 3A8BA 3M7UA 1ZPBA 2QGRA 4FUIA 3ODFA 2GV7A 3RC6A 4K5ZA 4O9VA 1C1UH 2GT8A 3NWUA 1PPEE 1LCYA 1GJ8B 3AW0A 3TK5A 1GBMA 1AWFH 3KQEA 4Q80A 3KL6A 1UVOA 4OGYA 2ALPA 3P95A 1MQ5A 3QN7A 1ARCA 5K0HA 2PW8H 5F03A 3LGVA 4R0IA 1DPOA 3O8RA 1V2VT 1EATA 1EP6A 3PMAB 3O8DA 1GBIA 3KN2A 2GCTC 2ZNKH 3FP7E 4ZKSU 2RCEA 2Y82A 1QJ7B 1T31A 3SZNA 2R0LA 2WUBA 1SQAA 1MD7A 2SGPE 1BQYA 1TX7A 2RA3A 2VJ1A 1U6QA 4ABFA 1ANEA 4TY7A 3UR6A 3EYDA 3EA7A 4AOQA 2NU4E 4UDWH 2AYWA 1OWEA 3EA9A 2J9NA 2JETC 1GL1A 1ZGVA 2OC8A 1W0ZU 1QBNA 3TK6A 1W10U 3GYMA 1DXPA 4K8BA 1TGTA 1EUFA 3ZYDA 2Q6GA 3T27A 1Y5UT 1AFEH 1ZLRA 4BAOB 1XUFA 1F0TA 1ELGA 5EQQA 1KY9A 1CT2E 1D4PB 4D9QA 2GGVB 2ZDVH 3RXVA 1GI1A 4A1TA 2ZFFH 4CHAB 1ZSLA 2CHAC 1Y3XA 2FTMA 5EG4A 1HBTH 2BX4A 6ESTA 3B23B 1QFKH 1O2VA 4DVAU 3U8TH 1SGRE 7ESTE 2FPZA 1JBUH 2FOCA 2QA9E 2P3TB 2OD3B 1AQ7A 1DM4B 4DT7B 5GCHF 1QJ6B 1F5RA 4NSYA 2ZECA 1CHOG 1OP8A 4Y0ZE 4ASHA 1B5GH 2VGCB 5EPNA 4YZUA 5DP9A 4Y8ZA 1O5FH 1GJ7B 1TABE 5DO4H 4U2WA 3RXLA 1L2EA 3FP8E 1FY5A 1QRWA 2QAAA 4ABEA 2AFQB 1DLEA 4PROA 3Q3KA 3L6PA 1C1NA 1B0FA 1P2JA 1TLDA 1QGFA 1TPSA 4IC6A 1QJ1B 5DK1A 3SJ9A 4ZUHA 3SHAH 1VZQH 2BVSH 1UK3A 2FODA 3SI3H 2ZTYA 4IN1A 3SU1A 1V2QT 3ATWA 4Y71A 5EPYA 3TGJE 1EX3A 1HFDA 5GXPA 2AGIX 1V2ST 1NTPA 1JXPA 2VWNA 1PYTC 1TYNA 2HOBA 5LPEA 1W12U 3FZZA 3SUDA 3T62A 3BG8A 1Y8TA 2BD2A 4F4OC 3Q00A 3PB1E 3M35A 3SNDA 4B76A 1BB0B 1QB1A 1S0RA 4D8NA 4INKA 2FIRH 3RXJA 1GI5A 4KELA 2GVFA 3DUXH 1N6XA 2WPMS 1O32A 2I6QA 4WMFA 2Y6TA 4FUHA 1O3EA 4GUXA 1BTXA 2ZU5A 1RFNA 3BG4C 1TX8A 1OYTH 1EPTB 2BLOA 2ZTXA 1CVWH 6LPRA 2QF0A 3NXPA 2ZU1A 3GDVA 2WINI 1GBTA 1HNEE 3QGJA 4JK5A 4X1QU 1J14A 4X8TH 3ZZ9A 1D6RA 1GI3A 2PSYA 1A0JA 1TNHA 2FI4E 3LH1A 3RLWH 1D3PB 4CR5A 5FBIA 3UWIA 2IN2A 2ZGHA 2ASUB 1O2IA 1HIAB 1SG8B 3RXIA 1SOTA 1YPGH 2GCHG 4QT8C 5T6GA 3BSQA 2JH5D 4DY7B 4FUBA 2ANWA 4WF8A 3ATKA 3U98H 1OKXA 1XM1A 4H42U 1AN1E 2ZWLH 2UWLA 2BB4A 2UUFB 1O5DH 1SGTA 1Y59T 5AHGH 5ETXA 1MTNB 3SV2H 4ZKOU 3PM3A 4YM9A 5LPRA 1AMHA 2WPHS 3M3VA 1MKXK 2AMQA 4KTCA 4ABAA 1C5ZB 4X8UH 1XMNB 3MFJA 3HPTB 1UVTH 1MBMA 2P59A 1GHVH 3D23A 2OC7A 1EB1H 2CN0H 1BCUH 1BTYA 1P10A 4IGDA 1PQ7A 3RXGA 1BZXE 1O2RA 3LOXA 1C2GA 1GBFA 2BD3A 2ODPA 5DP6A 3URCA 1E38B 3BTEE 2R9PA 3P8OA 2P8OB 4H6SB 3E8LA 1GI7B 1TQ7B 2ZCLP 3RDZA 1P0SH 1MU6B 1TWXB 3BIUH 3QZRA 4JYTA 3QDZB 2XCNA 3OSYA 1Y3UA 2G4UA 1YPEH 3F9FA 2BY7X 3PLBA 2HALA 2FEQH 2G52A 4WY3A 1C1WH 2GKVE 1ZHPA 1Z8JB 5DP4A 1MD8A 1SR5C 5GDSH 3ZYEA 6CHAB 3A8DA 2W26A 1C2EA 1GHBF 1ZTJA 2BD9A 4FVBA 4M7GA 3FAOA 3MH7A 1TX6A 3SGBE 2EI7A 3F9HA 4I8KA 2FYRA 1CE5A 1GI6A 1FNIA 3P92A 3PO1B 4MDSA 2FMJA 1N8OC 1ABIH 4ZROA 2ZIQH 3RXRA 4MG3A 4FUGA 4THNH 1TPAE 4RKJB 5DP3A 1BJUA 2FI3E 1ACBE 4UFFH 1V6DA 4DURA 1TAWA 4U01A 1ESBA 2NU0E 3BTTE 1AU8A 2XNIA 1YPHE 2BDBA 3NUMA 4KGAA 4ZKRU 3EE0B 3TH2H 2C4FH 3WY8A 3O8CA 1W3CA 1O2XA 1S6FA 1SGFG 1KYNA 3DA9B 1RTFB 5ABWA 4AFQA 4IW4E 1S81A 1WUNH 3SNCA 1P2IA 4CR9A 3F9EA 2FESH 1O2YA 5TJXA 1AHTH 5EODA 1B7XB 2Z9LA 3VB4A 3F6UH 4DOQA 2XC4A 2V3OH 5JYIA 2VH0A 3RXMA 3A86A 3M36A 3ZVBA 1V2TT 4HZHA 2QYIA 1AVXA 3PTNA 4B71A 1A4WH 1GJDB 2ZQ2A 2VIVA 1NM6A 5F8XA 1SGYE 4X2VA 1C4V2 1ETRH 1RTKA 2WV5A 1OSSA 2ZG0H 3EDXB 1NT1A 1EB2A 2TGAA 2SGFE 2ZC9H 2ZHWH 1C5XB 2B7DH 4UEHH 3RXHA 1EZSC 1K1OA 1O2OA 1CGHA 1BMLA 2ZDMA 2NU1E 3BTWE 3LPRA 2VH6A 1QBOA 1BHXF 2BDGA 1Z6JH 3TGKE 1O2NA 1G9IE 1SFIA 3QK1A 1AKSA 1ZOMA 2ZKSA 4NG9H 4DGJA 4AB8A 2FWWA 1Y5AT 1KDQA 2JKHA 1UCYE 4ISNA 6GCHF 1BBRH 1WTGH 5FCKA 1QHRB 1CA0B 2J4IA 4K8YA 4NFEA 4BTUB 1WYKA 3GISB 1H9LB 4YLUA 2GZ7A 1AVWA 2VWOA 4AGJA 2ZDNA 3A7XA 3NCLA 4Q7ZA 2G55A 1GMCG 3PTBA 1A3BH 4NZQA 3BTQE 5E0HA 4BOHA 5J4QA 2FDAA 5GWZA 1C1MA 4DW2U 4GLYA 1K28D 3S0NA 3TITA 4IN2A 1UHBA 8GCHF 3I78A 1SGIB 2NU2E 5FBEA 1XUKA 5IDKA 1TGSZ 4B75A 1J15A 3GCHC 2FOEA 1E34B 4Y10E 1LQDB 1OP0A 2STAE 3SGAE 1BMNH 1ABJH 2XXLA 4MLFB 2ZFRH 1P04A 1SGEE 1OXGA 4WMEA 2STBE 1W2KH 1GHYH 3BF6H 5FX5A 4J2YB 3KEEA 1O3CA 1HAZB 1TPOA 1JRSA 1BMAA 1G30B 2YNAA 4YOGA 5ESBA 1P2MA 1TGCA 3MU0A 2TGDA 1XKAC 2IJOB 3OU0A 4OS5A 1ZMLA 1QL9A 5I46H 3T26A 2RG3A 3SU6A 1FY1A 1K22H 1VCWA 5E0GA 1L1GA 1TRNA 1GI2A 3ZVFA 1DS2E 3K9XB 2KAIB 5EXNA 3DT0H 5HMAA 3TJOA 1ELVA 1IQEA 1G3CA 1RIWC 2B5TB 3RP2A 3QO6A 5IYTA 1FIZA 2GDEH 4OGXA 2CGAA 3PMBB 1MBQA 1C2IA 1Z71A 3QX5H 1UTQA 1TMBH 1WTHD 1YKTA 4GCHG 1SI5H 3HK6B 5DG6A 3URDA 2HPQH 3VGCB 3KHVA 2G81E 3M5LA 2Z3CA 3BEUA 3PWCA 3MO9A 1KXDA 1O2LA 1A5HA 4DG4A 2BD5A 1FJSA 2PGQB 1QIXB 1C5LH 2QXJA 3EAJA 4UFGH 2BY6X 3M5NA 1AUTC 2OQ5A 4GHTA 4X1PU 2GZ9A 1ZSJA 4MPXA 1NRSH 4DIIH 1GG6B 1O2KA 4XSKU 1P12E 1ZYOA 3K2UA 1GCTB 2UUKB 1ZPZA 2VB0A 1XUJA 3RMMH 1EOJA 1UTPA 3GY5A 5C1YA 1QNJA 1XXDA 3S7KB 4FVDA 2FOHA 1BTWA 1D6WA 2PKAB 3MO6A 3PLKA 1HAXB 1CO7E 1TBZH 4HGCA 3SJIA 1BTUA 2P94A 2RA0A 4NCYA 3SV7A 2CJIA 4WMDA 1HAIH 4TWYA 1DWDH 1SQOA 1Y3YA 2B9LA 1DX5M 1AUJA 1GPZA 3ATMA 2ZGBH 3S7HB 2ESTE 1Y5BT 1INCA 4IS5A 2G5NA 4CRCA 1GDNA 1NFYA 1E36B 2OBOA 1W0YH 1DITH 1C5PA 3BEIB 2FYQA 1SC8U 1C5QA 1YPKH 1HJ8A 1C2JA 5HM2A 5EQRA 3A82A 3RXCA 4NFFA 2HPPH 1LHEH 1O2TA 1TPPA 1O5EH 1HYLA 2PWXA 1HPGA 2PHBA 3ATLA 1MTSA 3UPEA 3TIUA 3ZZAA 1KTSB 2R2WU 1A5IA 3E0NB 3CS0A 1GI9B 2Y7XA 2OC0A 4AYVB 3ENSB 1GMDF 1AB9C 3SW2B 1Z7KA 2SNWA 5C2ZA 1OWDA 1PPFE 1EXFA 1ZJKA 4AN7A 3U69H 4E7RG 1Q2WA 4NA8A 4ESTE 3TU7H 1FY8E 3SU0A 1DY8A 4OS2A 1O3KA 1C2HA 1G36A 2PFEA 3STJA 2O8WA 3ATIA 5EU8A 1P11E 2EEKA 1CT0E 2FZZA 4X1NU 3KGPA 2F9UA 1P3CA 2JH6D 4NZLA 3GY7A 4JCNA 1XUHA 2PKSC 1JRTA 1LMWB 1EPTA 1SHHB 4I7YH 4ZKNU 3OY6U 1O2QA 1MKXH 2C93B 2M5TA 3RXFA 2AMPA 5PTPA 1ELAA 2BD8A 3A8CA 1LVOA 1MU8B 1G3EA 5FAHA 3P8GA 1XUIA 4UE7H 1PYTD 1DXWA 4E06H 1O3HA 1FI8A 1ZHMA 1HIAA 3LJOA 1GMHG 3MWIU 1GHAF 3EQ0H 1FONA 5JB9S 2V3HH 2ILNA 1V2RT 4WWYA 1Y3WA 3A7YA 3SBKA 1GJCB 1FPCH 1LKAA 1PFXC 1YCPM 2BTCE 4X2YA 1P57B 1ZSKA 4BAMB 3GCTG 3KQDA 5JBCS 1TOCB 3LGIA 3RXAA 1GVZA 1UVPA 4GSOA 1KTTB 2ZHEH 1YM0A 1Q3XA 3VXFH 3BTME 2FOGA 1SGNE 4TPYA 2YOLA 1ZRKA 2BLVA 1LHGH 3KF2A 2J38A 4F49A 1YGCH 4GPGA 1LQEA 1BMMH 1K21H 2O8TA 1G2MA 2G5VA 2VU8E 1S85A 2AEIH 2GT7A 1GDQA 1EAUA 5E2OA 4FUDA 2EC9H 2ZGXH 2GV6A 3U1IB 1F5KU 2A5KA 1IQJA 7GCHF 3A7TA 1KLJH
chains in the Genus database with same CATH superfamily
3IWMA 3DCLA 4HI3A 1NU7B 5EJ1A 3UFAA 3UIRA 7LPRA 1HAOH 4JMYA 5A09A 1C1SA 1S83A 1S84A 3HATH 1RGQA 2QE7D 2VIPA 2UUYA 1PQ5A 4F55A 2VINA 3Q3YA 3OYPA 1GJ6A 2DUCA 1P03A 1TNIA 1HXEH 3DHKH 1ETTH 1FN6A 2CF9H 1HAYB 5EIYA 2AGEX 1AFQB 1HUTH 1HB0B 4FXGH 5FX6A 5JB8S 3U8RH 2BDIA 1GJAB 3RLYH 5CHBA 3W95A 1HAGE 1SMFE 4XRNA 2BQ6B 1VITF 2QIQA 3SU3A 1MABB 3QGNB 3NK8A 2VIQA 1V3XA 1TFXA 2QF3A 3BTHE 8GCHG 1AWHB 4NWLA 2BZAA 4VGCC 1V2UT 1GHWH 1ZMJA 4P02A 3KQCA 2CMYA 1DUEA 1MUEB 2KCYA 4A1VA 4MPWA 4YOIA 3UWJH 3RXTA 3RXKA 3UUZA 3A81A 2FX4A 5EJZA 1YCPK 1OX1A 2ODYB 3V7TA 4BXSA 4I8HA 5IK2D 2OBQA 1IAUA 3U9AH 1A5GH 1A3EH 4BAKB 4AG2A 4BAHB 1Q31A 3SGQE 4K3JA 1O3OA 1GGDC 4CRFA 3RU4T 5C1UA 1ZPCA 2HWLB 4O03A 1FY4A 1MKWH 3A89A 2JETB 3A87A 3SJOA 3JZ1B 1F92A 1OPHB 1BDAA 2VIDA 1GHXH 1S6LA 1AO5A 1LPKB 3BTDE 1QBVH 1HDTH 1GBBA 3BN9A 1AIXH 1TGNA 5A8YA 1HAVB 4FU8A 1C4U2 3OX7U 3K6ZA 2ZI2H 1MQ6A 4YESB 1TGBA 2ZO3H 3E1XB 4H4FA 1DY9A 3RU4D 5C1XA 1MCVA 2AMDA 3Q77A 1EZUC 1SPJA 5FCRA 1K9OE 1GBEA 4XOJA 4X6MA 9ESTA 2CHAB 2XC5A 3ZZ3A 1IQFA 2SGAA 4RN6A 2BXTH 1CBWC 2D26C 1O2HA 2C8XB 2ZDKA 5E0JA 1GBCA 3DSPA 1W8BH 4K1EA 4RKOB 3LGTA 1C5YB 3P70B 4CBNA 3A7WA 3GOVB 3SO3A 2UWPA 3CS7A 2ZFQH 4WH6A 2FM2A 4Z1MD 1SBWA 4MTBA 1VJ9U 1A61H 4A1XA 3BEFB 1ELEE 3ZZ4A 4TWWA 2ZPQA 2FOBA 2AHME 1FDPA 1P2QA 1SGFA 3I77A 1AE5A 4FUFA 4NIVA 3WW7A 2BOKA 4XDEA 4IC5A 4AG1A 2OP9A 1W0KD 1C5NH 1W7XH 1WV7H 3PYHA 3JZ2B 1P3EA 2BM2A 1COWD 1B0EA 1C4Y2 2ZTZA 3OTJE 2ZF0H 2FLBH 4LXBH 1BTPA 2C8YB 4Q4LA 4WVPE 2SGDE 4X1RU 3LGUA 1O3IA 4Y8XA 3HKJB 3S9CA 4HTCH 1NZQH 1KLTA 4ISLA 1KLIH 1T8NA 3L3TA 3M61U 3SJKA 1D3QB 4ZXYH 2QCYA 1T8OA 2TGTA 1TBRH 2A1DB 4CBOA 1UTNA 4O3UA 1TBQH 4JK6A 1ESAA 1XXFA 2HNTE 2YNBA 1TA6A 2H5CA 3MNXA 1ETSH 1P2NA 4WH8A 4JZDH 1LHCH 3STIA 1KXCA 2LPRA 2BLQA 2ZFSA 2KAIA 1ZR0A 1D3DB 4E7NA 3P8FA 2FOFA 2I6SA 1WAYB 1YP9A 4I8LA 4NSVA 2PR3A 4CRDA 1GHZA 2NU3E 2ZFPH 3GY6A 1O5AB 3MNSA 3RM2H 2Z94A 3T2NA 2GMTC 1GBJA 1PJPA 4CRBA 1HAPH 3SUGA 2LP6A 2JJ2D 1G2LA 2FP7B 1ZHRA 3KQ5A 1NRRH 4I32A 4P00A 1K2I1 3UOUA 5B6LA 4NWKA 3A84A 2ZHFH 3E0PB 1TNJA 4ABHA 5DGJA 5J4SA 1OWHA 2ULLA 1S82A 2JDID 1BJVA 4BXWA 1C5TA 3MH6A 3I29A 2JJ1D 4UFEH 8ESTE 1C5OH 3GS9A 7KMEH 4JZEH 1PPZA 3SU4A 1GI8B 2B8OH 3LT3A 1TQ0B 1YC0A 4MVNA 2HVXA 1FXYA 1KIGH 1LO6A 1Z1JA 3NRLA 4J1YA 3VEQB 2BHGA 3SZEA 3S9AA 2ZGCA 1VGCC 2BDHA 2XYAA 2XNDD 1O38A 2PKAA 1W0JD 2R3YA 4Y7BA 1EJMA 2Z9GA 3A7ZA 1QL7A 1GHAG 2W3KA 2IPQX 2RDLA 5L6NH 3ELAH 1G3DA 1BRBE 1NRNH 3VGCC 1EZQA 2EQNA 3CNRA 4DJZB 4GVUA 5DP8A 1O5CB 3MO3A 4MQAA 2KX4A 2TIOA 2TRMA 4B74A 5C3NA 2A2XH 1THSH 3RXUA 4I31A 2A45B 1YYY1 2WV9A 1DWBH 3SHCH 4A5TS 2C3SA 1BBRE 1UVSH 4NA7A 3DFJA 1C5UA 4NIYA 4AX9H 1TA2A 1TALA 1GBKA 1NFUA 4UFDH 1CHOF 1DLKB 1XX9A 3SI4H 1HRTH 1WOFA 2J94A 1N8OB 2ZPSA 1SLUB 2Y5FA 3LJJA 4DT4A 1FIWA 2YMSC 1NPMA 1KXBA 1ZMNA 1DDJA 1WU1A 2HRVA 2W5EA 3QTOH 5GCHG 5T6FA 4AFSA 1DOJA 1UJ1A 4NIWA 1AZZA 1HGTH 2A7CA 1EKBB 4KTUA 1XVMA 4B1TA 1L0ZA 4K1TA 1NC6A 2FOAA 2G00A 1WXRA 4B73A 1AI8H 2Y81A 4BTIB 2BD7A 2BDYA 5DJ7A 4LZ4B 3MU1A 5EJLA 1SHYA 1SFQB 2PUXB 4FUCA 3T25A 1UVUH 3TH4H 1W7GH 4AB9A 3R0FA 2UWOA 5B6OA 2OQUA 3BIVH 4KP0A 3SORA 1MMJN 2Z9KA 2H2ZA 5TCAA 3F9GA 3BV9B 4IBLH 3ZVCA 2A32A 5EXMA 4INLA 1NS3A 1O2PA 4NIXA 1WQVH 1EJAA 3VB7A 2C8ZB 2XWBI 1C5MD 3ZZ6A 3PROA 1C9TA 2K8IA 1BUIA 1LVMA 3EA8A 3C1KA 2BD4A 5DN6D 1O2UA 2VIWA 3GY3A 2AIPA 3CENA 1TNGA 3QLPH 1HAHH 5CHAC 1C2MA 2F9BH 2Z3EA 2F9VA 3A7VA 1ELDE 1HJAB 1O2ZA 2ZQ1A 2F9PA 2Q1JA 1DFPA 2R2MB 4Y7AA 3Q3XA 2Q6FA 2VWMA 3RXQA 5A0CA 1O2SA 3M7TA 1ELBA 1VITH 5L2YH 2O9QA 4X2XA 1P2OA 1ARBA 2BOHB 2BDCA 1H9IE 1HCGA 4NA9H 1SGQE 2GCHF 1W13U 2W7UA 2Y7ZA 4D7FA 3Q76A 5C5NA 5A8ZA 1QB6A 1O3MA 1JWTA 3PV5A 4OS4A 2OCVB 3M3SA 2A0QB 3SNBA 1QQUA 4X8SH 1YPLH 1NO9H 1C9PA 1SLXB 2V6NA 4Y11E 1SVPA 5DP5A 1UTJA 2QF5A 1T32A 4K69A 1H1BA 4CRGA 2PV9B 4AORA 1YWUA 4O97A 2ANKH 1FN8A 1V2MT 2J2UA 4JZIA 3SU5A 4MNXA 1IOEA 2XC0A 1FAKH 1LTOA 1O3GA 3E6PH 1T4UH 4XD7D 3DFLA 3E91A 3ZV9A 3KNXA 4WJG2 2HNTF 2DE8A 1Y3VA 2XTTB 1LVBA 1F0RA 1J17T 1CHGA 2ALVA 2Z9JA 2P3FH 4YO9A 1P2KA 3GCHB 2EI8A 5CMXH 1IQNA 3HK3B 5AFZH 3SV8A 3AW1A 1GWAA 1LVYA 1ZRBA 2GD4B 2XW9A 1SSXA 1VKYA 3RXSA 2OXSA 3GDUA 5FPSA 4I33A 1TRYA 3H7OA 1GI4A 3GCNA 4X6NA 2GZ8A 3UY9A 2WYGA 1GJ4H 3LC5A 1E35B 2J95A 1Z1IA 3D62A 2OTVA 4ABBA 1A2CH 3RXBA 1ORFA 2H9HA 1MCTA 3RC5A 3UTUH 4KKDA 4CHAC 3HGPA 2Y5HA 2O8UA 1LDTT 1PQAA 3VB3A 1RIWB 1YLCA 1NN6A 5EOKA 3SNEA 1RRKA 3ZZBA 3TLOA 1GHBG 2PTCE 1DWCH 3GYLB 1SGCA 2KFWA 5HM9A 2WPLS 1T7CA 4JZFH 4BAQB 4IMQA 4TPIZ 1VCPA 3SUEA 1JIMA 2A5AA 2Z6BD 4Z6AH 1T8LA 4CREA 1SLWB 2VGCC 5C94A 1UCYK 2BLWA 5BRRE 1KSNA 1TIOA 2HLDD 1P05A 4CH2B 5FPYA 4JYUH 5EW2H 2BX3A 1P9SA 4Q7YA 1NFXA 1S0QA 4O3TA 1AD8H 3MNBA 1BTZA 1QB9A 4X8VH 1QL8A 1NU9A 3H5CB 2F4LA 2J98B 1C5WB 1F5LA 3TPIZ 3KYGA 2CK3D 1O5BB 3QTVH 2BY5X 2QN5T 5FHTA 5C20A 1HAVA 1P09A 1ELCA 2AIQA 4ZH8A 1UTOA 1KXEA 4E05H 3RMOH 1QQ4A 3PRDA 2H9TH 1O5GH 4OS6A 1DWEH 3SV6A 3ESTA 2TGPZ 1BRCE 1Z6EA 1O3JA 3NKKA 1DT2A 4XE4A 1YPMH 2Z3DA 2SGQE 1BA8B 1F2SE 1SL3A 2WV4A 3RC4A 1QA7A 2BZ6H 1RS0A 3MU8A 1M9UA 2DE9A 1OWIA 3V3MA 2V7QD 2OC1A 1ZZZA 2V0BA 3SN8A 1GBAA 2VVVA 2XBVA 4K2YA 5GIBA 2OINA 1FLEE 1E0FD 1EPTC 1IHSH 1K1MA 3P6ZB 4XBBA 8LPRA 3FP6E 5AF9H 4KTSA 3KQBA 4Y76A 2H1UA 1ID5H 4I8JA 4ISOA 4K60A 1OHHD 3P8NA 3GDSA 4AZ2B 1GL0E 1EAXA 2PSXA 2HLCA 3SU2A 1PPCE 4K1SA 3SQEE 2BDAA 1GJ5H 4TY6A 1YF4A 4MNYA 5FPTA 3U28C 1KMHB 5TCCA 5T3HA 2Q6DA 3GCOA 1DE7H 4TT3D 3T28A 2P3UB 3TNSA 2P95A 3MH5A 1W11U 1GMCF 1A7SA 2XBYA 1FMGA 1YPJH 3U1JB 2KCPA 1TNKA 5GPIB 3SYJA 2IOTA 2QXIA 2ZU3A 4Q7XA 2QXHA 3FVFB 2ZCKP 2IJD1 6GCHG 2BVRH 1GJBB 1AB9B 2KCOA 1RTLA 1MTNC 1AGJA 2C90B 3VB6A 1C1PA 1IQKA 2XRCA 5E2PA 3A80A 1WSSH 1GBHA 3CP7A 4LOYH 2ZP0H 3TJVA 2AS9A 3BTGE 3M37A 2ZHDA 2O8MA 3OEED 4BTTB 1O3LA 3T5FH 1T8MA 4GHQA 2A4QA 2H5DA 3HKIB 2R3UA 2A2QH 2A7JA 2ZEBA 2WPIS 1EP5A 1WBGB 3ZZ5A 2PKSB 5BPEA 1MZDA 1NFWA 2B0FA 5JBBS 3T29A 5F8ZA 1O3DA 1CSOE 5DKMA 2P8OC 3M7QA 2P93A 1MZAA 3K6YA 1C2KA 3RMLH 3VFEA 2GCTB 2ZPRA 3WWFA 3ZVAA 1PPHE 2WPKS 2ZA5A 1Z8GA 2D8WA 1SLVB 3UB0A 5SGAE 4UD9H 4JZ1A 4Y8YA 1C1OA 3RXEA 3RXOA 1L4DA 5L2ZH 6CHAC 1VJAU 1ELFA 4R8TB 3B9FH 2ZZUH 3ZVEA 1JIRA 5HGGA 4GCHF 1BHXB 2CV3A 2TPIZ 4OS7A 2GP9B 1MAXA 3A85A 3F68H 2J97A 3E3TA 1A1RA 4ZAEA 1TE0A 3PO1C 4ZXXH 4RT0A 2ANYA 1UK4A 5L30H 3LC3A 1NY22 3F0OA 4DCDA 2VVCA 2Y5GA 3KCGH 4X0WU 3H7TA 1DUAA 3IITA 4YOJA 4MNVA 1LKBA 2FO9A 1QCPA 2A4GA 4BANB 1YBWA 4RI0A 2FX6A 1BIOA 1ELTA 3GY8A 1CA8B 1ANBA 1C1VH 2CF8H 2W7SA 5C67A 4Q2KA 1QR3E 2OLGA 2HNTC 1OYQA 4OM9A 1OWKA 1GJ9B 5DPAA 1S6HA 4ISIH 4XFQA 1O37A 1LPZB 2WPJS 1CT4E 4YT7H 2G51A 2LNCA 2QXGA 3ITIA 3PV4A 2KCAA 3F1SB 3S69A 4IMZA 3NPSA 3ZZ8A 1KXFA 2XWAA 3UQVA 1NBME 3UOPA 3QWCH 1XUGA 4X2WA 1EJNA 5A8XA 3GICB 1EAIA 5DP7A 1H8DH 1NRQH 1SB1H 5AVDA 2ZDLA 1GVLA 1FPHH 1TONA 1N1LA 2F83A 1ANCA 1ESTA 1YPHC 3FFGA 3EE7A 2F9NA 1D9IA 4WXIA 1O0DH 4B2BA 1ZJDA 1ZTKA 2ZU4A 1C2DA 1G32B 1WCZA 1GDUA 1TRMA 1G3BA 2GTBA 3RUOA 2FXRA 1J16A 2ZDAH 3TNTA 2XBXA 1BITA 2J92A 1C1RA 3PMJA 3TVJB 1FZZA 1HLTH 1SQRA 4VGCB 3ZV8A 4Y79A 3S9BA 2PTNA 2OUAA 1SOZA 2VNTA 3AAUA 1J9CH 4RSPA 1K1IA 3FZDA 1P9UA 1V2KT 4A7IB 1E37B 4I86A 3E16B 1XVOA 2EI6A 2R0KA 2K1QA 1AZ8A 2F3CE 3WWBA 4AFZA 3NZIA 4GAWA 4D9RA 4M9FA 1BOQA 2PGBB 2VIOA 1C1TA 3MTYA 1CA0C 2O8LA 4H6TA 5GJ4B 1OP2A 4FUEA 1BTHH 3MQKC 1O3AA 3D49H 1CGJE 4ZHMU 4CH8B 3TJUA 1O33A 5C0TA 5AFYH 3BG4B 1GGDB 2BY8X 1RXPA 1Z8RA 2C8WB 1S5SA 2QV1A 1J8AA 4XBCA 1C1QA 4FETA 2YMSD 1O2WA 1O31A 4ABDA 2ZFTA 9LPRA 4X1SU 3DSOA 3A88A 3UNRA 1FUJA 3VB5A 2ODQA 1GMDG 3FANA 1TMUH 2XCFA 2Z9IA 1UO6A 3N99A 1RJXB 1IHTH 1OWJA 1CU1A 4HFPB 2SNVA 1VR1H 3W94A 1GBLA 2RDEA 4LZ1H 1QRXA 2FI5E 2FS8A 3SV9A 1LPGB 1C5RA 2ZGJA 1THRH 1G37A 3SQHE 5CE1A 1EAWA 5K7RA 5EXLA 4D7GA 1AY6H 4Y6DA 1O3NA 1DSTA 1HV7A 1CBWB 1EZXC 4B6FA 3H09A 2IPHA 1GMHF 3UNQA 2FLRH 1IQLA 1D3TB 1MH0A 5LPFA 3QZQA 3ZZ7A 1QA0A 2BQWB 2FS9A 1FV9A 4ABJA 1EQ9A 2WYJA 5FXLA 1H9HE 3GCTF 2L74A 2THFB 3QUMP 1H4WA 1EFRD 3AK5A 3E90B 1O3PB 1WQSA 1C2FA 1QURH 2SGEE 1EASA 2P16A 3M5MA 1O2GH 2BQ7B 3LU9B 1A0LA 5EW1H 3MNCA 3TJNA 3AVZA 3SOSA 1QTFA 1CQQA 3RM0H 1L1JA 3OEHD 3UQOA 1SGDE 3SUFA 2F9OA 4B2AA 3LKWA 1SGPE 2NWNA 4FU9A 3AASA 3TH3H 1O35A 2XBWA 2EA3A 3M3TA 5HYOA 1HJAC 2GDDA 3HGNA 4AYYB 1BRAA 1H8IH 1K1PA 3UREA 4ZCNA 4ZHAA 1P02A 4D76A 2SFAA 1GG6C 3MI4A 2V35A 1GCTC 3LDXH 3RMNH 3SJ8A 1V2LT 1MKWK 4I8GA 3V13A 1O3FA 3LH3A 1NESE 5EQSA 2VWLA 1IQIA 3DD2H 5JDUB 7GCHG 3RU4E 1UCYH 2AGGX 2ZCHP 1V2PT 5A2MH 1LHFH 1PQ8A 3SNAA 1IQGA 1O2MA 2Z7FE 2A7HA 3F2HA 3GY4A 1F7ZA 3L33A 4ISHH 1V2WT 1QRZA 5EGMA 2AH4X 5HXFA 4OS1A 4FUJA 2JH0D 1EOLA 5E8EH 1DSUA 2H6MA 1C2LA 1JOUB 1BRUP 2QC2A 3LGWA 4SGAE 5KEDA 2BVXH 1O36A 3UR9A 3KYFA 2PUQH 1THPB 4ZMAH 2GMTB 1T4VH 1NROH 4UONA 1O30A 4AFUA 4SGBE 3P17H 4B2CA 1VITG 1IQHA 2K0QA 3LGYA 2CXVA 4U30A 3LONA 1KXAA 2A4RA 2FTLE 2GX4A 2J98A 2UUJB 1YLDA 3A8AA 3IG6B 3N7EA 5C5OA 2W3IA 2PLXA 3MYWA 1HXFH 1MTVA 3C27B 1ANDA 2WUCA 1NRPH 1IQMA 1UTLM 1DICA 1VGCB 2Y80A 1ZGIA 3A83A 4Z0KA 3KIDU 5I25A 1A46H 1VCQA 2BY9X 1P01A 3F2GA 2BMGB 3MHWU 5JBTA 2ZU2A 1P8VC 1O39A 3PMHB 3OY5U 1OS8A 4MPVA 1K1NA 4Y0YE 1W14U 3K65B 1AVGH 5C17A 2G8TA 2BYAX 2AERH 2TBSA 5A0BA 4A6LA 1UMAH 4ABIA 3TK9A 2H9EH 2A31A 1O3BA 2FOMB 3MOCA 4MPUA 4JYVH 3O8BA 4X6OA 1O2JA 5LGOA 5JBAS 5F8TA 1FAXA 1LHDH 3LIWA 3ZVGA 2F91A 1GVKB 2ZHQH 1V2OT 4LK4A 3MH4A 1GBDA 4TYDA 2D1JA 3ODDA 1DANH 4ABGA 1P06A 2QY0B 1PPGE 1XKBC 3PLPA 3ZVDA 1O34A 1BT7A 4XBDA 4A92A 4BNRA 1TOMH 1SQTA 8KME2 1MTWA 1TMTH 3AAVA 4YTAA 5ESTE 2YMSB 4YT6H 5LH8A 3MU4A 1FY3A 1TB6H 1V2NT 3RXDA 3MU5A 3UNSA 1ZTLA 1C5VA 3ZZCA 4AC9A 1F0SA 1A0HB 1F0UA 2A5IA 3EGKH 1FQ3A 1HJ9A 1YCPH 1OOKB 2G4TA 3BTFE 3G01A 5KGOA 3U8OH 1JMOH 2LELA 3D65E 2A4OA 3V12A 1GCDA 4MNWA 1AKSB 1QY6A 1UTKA 1UK2A 3N7OA 5G4BA 3RXPA 4ZHLU 2J34A 1AE8H 1KDQB 1GI0A 2D2DA 1RD3B 1V2JT 3PWBA 2VVUA 1L1NA 5JPMH 5F6MA 1MTUA 1N6YA 4NGAH 3VXEH 3GY2A 1K1JA 4DIHH 1Z8IB 1DVAH 4WXVA 3B8JA 1E1QD 4YLQH 5H4IB 1K0HA 5A0AE 4AGKA 2HGTH 3R3GB 3MMGA 3VPKA 4CRAA 5T6DA 3TGIE 1TNLA 1CGIE 1PPBH 4FU7A 1L4ZA 1C5SA 1H8HD 1X7AC 1UTMA 4X6PA 3V0XA 2BXUH 1UHBB 2ANMH 3M5OA 5CHAB 3ZZDA 4U32A 4Q63A 3BTKE 4INHA 1K1LA 1AFQC 1BBRK 1MAYA 3A8BA 3DSGA 3M7UA 1ZPBA 2QGRA 4FUIA 3ODFA 2KM0A 2GV7A 3RC6A 4K5ZA 4O9VA 1C1UH 2GT8A 3NWUA 1PPEE 1LCYA 1GJ8B 3AW0A 3TK5A 1GBMA 1AWFH 3KQEA 4Q80A 3KL6A 1UVOA 4OGYA 2ALPA 3P95A 1MQ5A 3QN7A 1ARCA 5K0HA 2PW8H 5F03A 3LGVA 4R0IA 1DPOA 3O8RA 1V2VT 1EATA 1EP6A 3PMAB 3O8DA 1GBIA 3KN2A 2GCTC 2ZNKH 3FP7E 4ZKSU 2RCEA 3W1EA 2Y82A 1QJ7B 3F3BA 1T31A 3SZNA 2R0LA 2WUBA 5HIZA 1SQAA 1MD7A 2SGPE 1BQYA 1TX7A 2RA3A 2VJ1A 1U6QA 4ABFA 3PRBA 1ANEA 4TY7A 3UR6A 3EYDA 3EA7A 4AOQA 2NU4E 4UDWH 1SKYE 2AYWA 1OWEA 3EA9A 2J9NA 2JETC 1GL1A 1ZGVA 2OC8A 1W0ZU 1QBNA 3TK6A 2HVYB 1W10U 3GYMA 1YY3A 1DXPA 4K8BA 1TGTA 1EUFA 3ZYDA 2Q6GA 4F48B 3T27A 1Y5UT 1AFEH 1ZLRA 4BAOB 1XUFA 1F0TA 1ELGA 5EQQA 1KY9A 1CT2E 3OTPA 3FOAA 1D4PB 4D9QA 2GGVB 2ZDVH 3RXVA 1GI1A 4A1TA 2ZFFH 2F43B 4CHAB 1ZSLA 2CHAC 1Y3XA 2FTMA 5EG4A 1HBTH 2BX4A 6ESTA 1H8ED 3B23B 1QFKH 1O2VA 4DVAU 3U8TH 1SGRE 7ESTE 2FPZA 1JBUH 2FOCA 2QA9E 2P3TB 2OD3B 1AQ7A 1DM4B 4DT7B 5GCHF 1QJ6B 1F5RA 4NSYA 2ZECA 1CHOG 1OP8A 4Y0ZE 4ASHA 1B5GH 2VGCB 5EPNA 4YZUA 5DP9A 4Y8ZA 1O5FH 3ZIAD 4FOUC 1GJ7B 1TABE 5DO4H 4U2WA 3RXLA 1L2EA 3FP8E 1FY5A 1QRWA 2QAAA 4ABEA 2AFQB 1DLEA 4ASUD 4PROA 3Q3KA 3L6PA 1C1NA 1B0FA 1P2JA 1TLDA 1QGFA 1TPSA 4IC6A 3PV2A 1QJ1B 5DK1A 3SJ9A 4ZUHA 3SHAH 1VZQH 2BVSH 1UK3A 2FODA 4HG6A 3SI3H 2ZTYA 4IN1A 3SU1A 1V2QT 3ATWA 2WPDD 4Y71A 5EPYA 3TGJE 4B6EA 1EX3A 1HFDA 5GXPA 2AGIX 1V2ST 1NTPA 1JXPA 2VWNA 1PYTC 1TYNA 2HOBA 5LPEA 1W12U 3FZZA 3SUDA 3T62A 3BG8A 1Y8TA 2BD2A 4F4OC 3Q00A 3PB1E 3M35A 3SNDA 4B76A 1BB0B 1QB1A 1S0RA 4D8NA 4INKA 2FIRH 3RXJA 1GI5A 4KELA 2GVFA 3DUXH 1N6XA 2WPMS 1O32A 2I6QA 4WMFA 2Y6TA 2KR7A 4FUHA 1O3EA 4GUXA 1BTXA 2ZU5A 1RFNA 3BG4C 1TX8A 1OYTH 1EPTB 2BLOA 2ZTXA 1CVWH 6LPRA 2QF0A 3NXPA 2ZU1A 3GDVA 2WINI 1GBTA 1HNEE 3QGJA 4JK5A 4X1QU 1J14A 4X8TH 3ZZ9A 1D6RA 1GI3A 2PSYA 1A0JA 1TNHA 2FI4E 3LH1A 3RLWH 1D3PB 4CR5A 5FBIA 3UWIA 2IN2A 2ZGHA 2ASUB 1O2IA 1HIAB 1SG8B 3RXIA 1SOTA 1YPGH 2GCHG 4QT8C 5T6GA 3BSQA 2JH5D 4DY7B 4FUBA 2ANWA 4WF8A 3ATKA 3U98H 1OKXA 1XM1A 4H42U 1AN1E 2ZWLH 3UAIC 2UWLA 2BB4A 2UUFB 1O5DH 1SGTA 1Y59T 5AHGH 5ETXA 1MTNB 3SV2H 4ZKOU 3PM3A 4YM9A 5LPRA 1AMHA 2WPHS 3M3VA 1MKXK 2AMQA 4KTCA 4ABAA 3FN8A 1C5ZB 4X8UH 1XMNB 3MFJA 3HPTB 1UVTH 1MBMA 4RT1A 2P59A 1GHVH 3D23A 1E1RD 2OC7A 2J5UA 1EB1H 2CN0H 1BCUH 1BTYA 1P10A 4IGDA 1PQ7A 3RXGA 1BZXE 1O2RA 3LOXA 1C2GA 1GBFA 1YLNA 2BD3A 2ODPA 5DP6A 3URCA 2L6OA 1E38B 3BTEE 2R9PA 3P8OA 2P8OB 4H6SB 3E8LA 1GI7B 1TQ7B 2ZCLP 3RDZA 1P0SH 1MU6B 1TWXB 3BIUH 3QZRA 4JYTA 3QDZB 2XCNA 3OSYA 1Y3UA 2G4UA 1YPEH 3F9FA 2BY7X 3PLBA 1UW7A 3F2FA 2HALA 5FL7D 2FEQH 2G52A 4WY3A 1C1WH 2GKVE 1ZHPA 1Z8JB 5DP4A 1MD8A 1SR5C 5GDSH 3ZYEA 6CHAB 3A8DA 2W26A 1C2EA 1GHBF 1ZTJA 2BD9A 4FVBA 4M7GA 3FAOA 3MH7A 1TX6A 3SGBE 2EI7A 3F9HA 4I8KA 2FYRA 1CE5A 3VG8A 1GI6A 2PP6A 2WHXA 1FNIA 3P92A 3PO1B 4MDSA 2FMJA 1N8OC 1ABIH 4ZROA 2ZIQH 3RXRA 4MG3A 4FUGA 4THNH 1TPAE 4RKJB 5DP3A 1BJUA 2FI3E 1ACBE 4UFFH 1V6DA 4DURA 1TAWA 4U01A 1ESBA 2NU0E 3BTTE 1AU8A 2XNIA 1YPHE 2BDBA 3NUMA 4KGAA 4ZKRU 3EE0B 3TH2H 2C4FH 3WY8A 3O8CA 1W3CA 5HKKD 1O2XA 1S6FA 1SGFG 1KYNA 4ACAA 3DA9B 1RTFB 5ABWA 4YXWD 4AFQA 4IW4E 1S81A 1WUNH 3SNCA 1P2IA 4CR9A 3F9EA 2FESH 1O2YA 5TJXA 1AHTH 5EODA 2EY4C 1B7XB 2Z9LA 3VB4A 3F6UH 4DOQA 2XC4A 2V3OH 5JYIA 2VH0A 3RXMA 3A86A 3M36A 3ZVBA 1V2TT 4HZHA 2QYIA 1AVXA 3PTNA 4B71A 1A4WH 1GJDB 2ZQ2A 3OFND 2VIVA 1NM6A 5F8XA 1SGYE 4X2VA 1C4V2 1ETRH 1RTKA 2WV5A 1OSSA 2ZG0H 3EDXB 1NT1A 1EB2A 2TGAA 2SGFE 2VBCA 2ZC9H 2ZHWH 1C5XB 2B7DH 4UEHH 3RXHA 1EZSC 1K1OA 1O2OA 1CGHA 1BMLA 2ZDMA 2NU1E 3BTWE 3LPRA 2VH6A 1QBOA 1BHXF 2BDGA 1Z6JH 3TGKE 1O2NA 1WDIA 1G9IE 1SFIA 3QK1A 1AKSA 1ZOMA 2ZKSA 4NG9H 3OAAD 3F0PA 4AB8A 4DGJA 2FWWA 1Y5AT 1KDQA 2JKHA 1UCYE 4ACBA 4ISNA 6GCHF 1BBRH 1WTGH 5FCKA 1QHRB 1CA0B 2J4IA 4K8YA 4NFEA 4BTUB 1WYKA 3GISB 1H9LB 4YLUA 2GZ7A 1AVWA 2VWOA 4AGJA 2ZDNA 3A7XA 3NCLA 4Q7ZA 2G55A 1GMCG 3PTBA 1A3BH 4NZQA 3FKSD 3BTQE 5E0HA 4BOHA 5J4QA 2FDAA 5GWZA 1C1MA 4DW2U 4GLYA 1K28D 3S0NA 3TITA 4IN2A 1UHBA 8GCHF 3I78A 1SGIB 2NU2E 5FBEA 3OE7D 1XUKA 5IDKA 1TGSZ 4B75A 1J15A 3GCHC 2FOEA 1E34B 4Y10E 1LQDB 1OP0A 2STAE 3SGAE 1BMNH 1ABJH 2XXLA 4MLFB 2ZFRH 1P04A 1SGEE 1OXGA 4WMEA 2STBE 1W2KH 1GHYH 3BF6H 5FX5A 4J2YB 3KEEA 1O3CA 1HAZB 1TPOA 1JRSA 1BMAA 1G30B 2YNAA 4YOGA 5ESBA 1P2MA 1TGCA 3MU0A 2TGDA 1XKAC 2IJOB 3OU0A 4OS5A 1ZMLA 1QL9A 5I46H 3T26A 2RG3A 3SU6A 1FY1A 1K22H 1VCWA 5E0GA 1L1GA 1TRNA 1GI2A 3ZVFA 1DS2E 3K9XB 2KAIB 5EXNA 3DT0H 5HMAA 3TJOA 1ELVA 1IQEA 1G3CA 3N7DA 1RIWC 2B5TB 3RP2A 3QO6A 5IYTA 1FIZA 2GDEH 4OGXA 2CGAA 3PMBB 1MBQA 1C2IA 1Z71A 3QX5H 1UTQA 1TMBH 1WTHD 1YKTA 4GCHG 1SI5H 3HK6B 1QZ8A 5DG6A 3URDA 2HPQH 3VGCB 2QF4A 3KHVA 2G81E 2KZ4A 3M5LA 2V3MA 2Z3CA 3BEUA 3PWCA 3MO9A 1KXDA 1O2LA 1A5HA 4DG4A 2BD5A 1FJSA 2PGQB 1QIXB 1C5LH 2QXJA 3EAJA 4UFGH 2BY6X 3M5NA 1AUTC 2OQ5A 4GHTA 4X1PU 2GZ9A 1ZSJA 4MPXA 1NRSH 4DIIH 1GG6B 1O2KA 4XSKU 1P12E 1ZYOA 5T1VA 3K2UA 1GCTB 2UUKB 1ZPZA 2VB0A 1XUJA 3RMMH 1EOJA 1UTPA 3GY5A 2OK5A 2GJGA 5C1YA 1QNJA 1XXDA 3S7KB 4FVDA 2FOHA 1BTWA 1D6WA 2XOKD 2PKAB 3MO6A 3PLKA 1HAXB 1CO7E 1TBZH 4HGCA 3SJIA 1BTUA 2P94A 1E79D 2RA0A 4NCYA 3SV7A 3FO8D 2CJIA 4WMDA 1HAIH 4TSFD 4TWYA 5HIYA 1DWDH 1SQOA 1Y3YA 2B9LA 1DX5M 1AUJA 1GPZA 3ATMA 2ZGBH 2M2AA 3S7HB 2ESTE 1Y5BT 1INCA 4IS5A 2G5NA 4CRCA 1GDNA 5DSFA 1NFYA 1E36B 2OBOA 1W0YH 1DITH 1C5PA 3BEIB 2FYQA 1SC8U 1C5QA 1YPKH 1HJ8A 1C2JA 5HM2A 5EQRA 3A82A 3RXCA 4NFFA 2HPPH 1LHEH 1O2TA 1TPPA 1O5EH 1HYLA 2PWXA 1HPGA 2JIZD 2PHBA 3ATLA 1MTSA 3UPEA 1FX0B 5F53A 3TIUA 3ZZAA 1KTSB 2R2WU 1A5IA 3E0NB 5KECA 3CS0A 1GI9B 2Y7XA 2WZQA 2OC0A 4AYVB 3ENSB 1GMDF 1AB9C 3SW2B 1Z7KA 2SNWA 5C2ZA 1OWDA 1PPFE 1EXFA 1ZJKA 4AN7A 3U69H 4E7RG 1Q2WA 4NA8A 4ESTE 3TU7H 1FY8E 3SU0A 1DY8A 4OS2A 1O3KA 1C2HA 1G36A 2PFEA 3STJA 2O8WA 3ATIA 5EU8A 1P11E 2EEKA 1CT0E 2FZZA 4X1NU 3KGPA 2F9UA 1P3CA 2JH6D 4NZLA 3GY7A 4JCNA 1BMFD 1XUHA 1NBMD 2PKSC 2RFKC 1JRTA 1LMWB 1EPTA 1SHHB 4I7YH 4ZKNU 3OY6U 1O2QA 1MKXH 2C93B 2M5TA 3RXFA 2AMPA 5PTPA 1ELAA 2BD8A 3A8CA 1LVOA 1MU8B 1G3EA 5FAHA 3P8GA 1XUIA 4UE7H 1PYTD 1DXWA 2W6ID 4E06H 1O3HA 1FI8A 1ZHMA 1HIAA 3LJOA 1GMHG 3MWIU 1GHAF 3EQ0H 1FONA 2W6JD 5CDFE 5JB9S 2V3HH 2ILNA 1V2RT 4WWYA 1Y3WA 3A7YA 3SBKA 1GJCB 1FPCH 1LKAA 1PFXC 1YCPM 2BTCE 4X2YA 1P57B 1ZSKA 4BAMB 5GNDA 2WSSD 3GCTG 3KQDA 1TOCB 3LGIA 5JBCS 3RXAA 1GVZA 1UVPA 4GSOA 1KTTB 2ZHEH 1YM0A 1Q3XA 3VXFH 3BTME 2FOGA 1SGNE 4TPYA 2YOLA 1ZRKA 2BLVA 1LHGH 3KF2A 2J38A 4F49A 1YGCH 4GPGA 1LQEA 1BMMH 1K21H 2O8TA 1G2MA 2G5VA 2VU8E 1S85A 2AEIH 2GT7A 5C0UA 1GDQA 1EAUA 5E2OA 4FUDA 2EC9H 2ZGXH 2GV6A 3U1IB 1F5KU 2A5KA 1IQJA 7GCHF 3A7TA 1KLJH
chains in the Genus database with same CATH topology
3IWMA 4HI3A 1NU7B 3UFAA 3UIRA 7LPRA 1HAOH 4JMYA 5A09A 1C1SA 1S83A 1S84A 3HATH 1RGQA 2VIPA 2UUYA 1PQ5A 2VINA 3Q3YA 3OYPA 1GJ6A 2DUCA 1P03A 1TNIA 1HXEH 3DHKH 1ETTH 1FN6A 2CF9H 1HAYB 2AGEX 1AFQB 1HUTH 1HB0B 4FXGH 5FX6A 5JB8S 3U8RH 2BDIA 1GJAB 3RLYH 3W95A 1HAGE 1SMFE 2BQ6B 1VITF 2QIQA 3SU3A 3QGNB 3NK8A 2VIQA 1V3XA 1TFXA 2QF3A 3BTHE 8GCHG 1AWHB 4NWLA 2BZAA 4VGCC 1V2UT 1GHWH 1ZMJA 3KQCA 2CMYA 1DUEA 1MUEB 4A1VA 4MPWA 4YOIA 3UWJH 3RXTA 3RXKA 3UUZA 3A81A 2FX4A 1YCPK 1OX1A 2ODYB 3V7TA 4BXSA 4I8HA 2OBQA 1IAUA 3U9AH 1A5GH 1A3EH 4BAKB 4AG2A 4BAHB 1Q31A 3SGQE 4K3JA 1O3OA 1GGDC 4CRFA 3RU4T 5C1UA 1ZPCA 2HWLB 4O03A 1FY4A 1MKWH 3A89A 2JETB 3A87A 3SJOA 3JZ1B 1F92A 1OPHB 1BDAA 2VIDA 1GHXH 3BTDE 1AO5A 1LPKB 1QBVH 1HDTH 1GBBA 3BN9A 1AIXH 1TGNA 5A8YA 1HAVB 4FU8A 1C4U2 3OX7U 3K6ZA 2ZI2H 1MQ6A 4YESB 1TGBA 2ZO3H 3E1XB 4H4FA 1DY9A 3RU4D 5C1XA 1MCVA 2AMDA 3Q77A 1EZUC 1SPJA 5FCRA 1K9OE 1GBEA 4XOJA 4X6MA 9ESTA 2CHAB 2XC5A 3ZZ3A 1IQFA 2SGAA 4RN6A 2BXTH 1CBWC 2D26C 1O2HA 2C8XB 2ZDKA 5E0JA 1GBCA 1W8BH 4K1EA 4RKOB 3LGTA 1C5YB 3P70B 4CBNA 3A7WA 3GOVB 3SO3A 2UWPA 3CS7A 2ZFQH 4WH6A 2FM2A 1SBWA 4MTBA 1VJ9U 1A61H 4A1XA 3BEFB 1ELEE 3ZZ4A 4TWWA 2ZPQA 2FOBA 3I77A 1FDPA 1P2QA 1SGFA 1AE5A 4FUFA 4NIVA 2BOKA 4XDEA 4IC5A 4AG1A 2OP9A 1C5NH 1W7XH 1WV7H 3PYHA 3JZ2B 1P3EA 2BM2A 1B0EA 1C4Y2 2ZTZA 3OTJE 2ZF0H 2FLBH 4LXBH 1BTPA 2C8YB 4WVPE 2SGDE 4X1RU 3LGUA 1O3IA 4Y8XA 3HKJB 3S9CA 4HTCH 1NZQH 1KLTA 4ISLA 1KLIH 1T8NA 3L3TA 3M61U 3SJKA 1D3QB 4ZXYH 2QCYA 1T8OA 2TGTA 1TBRH 2A1DB 4CBOA 1UTNA 4O3UA 1TBQH 4JK6A 1ESAA 1XXFA 2HNTE 2YNBA 1TA6A 2H5CA 3MNXA 1ETSH 1P2NA 4WH8A 4JZDH 1LHCH 3STIA 1KXCA 2LPRA 2BLQA 2ZFSA 2KAIA 1ZR0A 1D3DB 4E7NA 3P8FA 2FOFA 2I6SA 1WAYB 1YP9A 4I8LA 4NSVA 2PR3A 4CRDA 1GHZA 2NU3E 2ZFPH 3GY6A 1O5AB 3MNSA 3RM2H 2Z94A 3T2NA 2GMTC 1GBJA 1PJPA 4CRBA 1HAPH 3SUGA 1G2LA 2FP7B 1ZHRA 1NRRH 4I32A 1K2I1 3UOUA 4NWKA 3A84A 2ZHFH 3E0PB 1TNJA 4ABHA 5DGJA 5J4SA 1OWHA 2ULLA 1S82A 1BJVA 4BXWA 1C5TA 3MH6A 3I29A 4UFEH 8ESTE 1C5OH 7KMEH 4JZEH 1PPZA 3SU4A 1GI8B 2B8OH 3LT3A 1TQ0B 1YC0A 4MVNA 2HVXA 1FXYA 1KIGH 1LO6A 1Z1JA 4J1YA 3VEQB 2BHGA 3S9AA 2ZGCA 1VGCC 2BDHA 2XYAA 1O38A 2PKAA 2R3YA 4Y7BA 1EJMA 2Z9GA 3A7ZA 1QL7A 1GHAG 2W3KA 2RDLA 5L6NH 3ELAH 1G3DA 1BRBE 1NRNH 3VGCC 1EZQA 4DJZB 4GVUA 5DP8A 1O5CB 3MO3A 4MQAA 2TIOA 2TRMA 4B74A 5C3NA 2A2XH 1THSH 3RXUA 4I31A 2A45B 1YYY1 1DWBH 3SHCH 4A5TS 2C3SA 1BBRE 1UVSH 4NA7A 3DFJA 1C5UA 4NIYA 4AX9H 1TA2A 1TALA 1GBKA 1NFUA 4UFDH 1CHOF 1DLKB 1XX9A 3SI4H 1HRTH 1WOFA 2J94A 1N8OB 2ZPSA 1SLUB 2Y5FA 3LJJA 1FIWA 1NPMA 1KXBA 1ZMNA 1DDJA 1WU1A 2HRVA 2W5EA 3QTOH 5GCHG 5T6FA 4AFSA 1DOJA 1UJ1A 4NIWA 1AZZA 1HGTH 2A7CA 1EKBB 4KTUA 1XVMA 4B1TA 1L0ZA 4K1TA 1NC6A 2FOAA 2G00A 4B73A 1AI8H 2Y81A 4BTIB 2BD7A 2BDYA 5DJ7A 4LZ4B 3MU1A 1SHYA 1SFQB 2PUXB 4FUCA 3T25A 1UVUH 3TH4H 1W7GH 4AB9A 3R0FA 2UWOA 5B6OA 2OQUA 3BIVH 4KP0A 3SORA 1MMJN 2Z9KA 2H2ZA 5TCAA 3F9GA 3BV9B 4IBLH 3ZVCA 2A32A 5EXMA 4INLA 1NS3A 1O2PA 4NIXA 1WQVH 1EJAA 3VB7A 2C8ZB 2XWBI 1C5MD 3ZZ6A 3PROA 1C9TA 1BUIA 1LVMA 3EA8A 3C1KA 2BD4A 1O2UA 2VIWA 3GY3A 2AIPA 3CENA 1TNGA 3QLPH 1HAHH 5CHAC 1C2MA 2F9BH 2Z3EA 2F9VA 3A7VA 1ELDE 1HJAB 1O2ZA 2ZQ1A 2F9PA 2Q1JA 1DFPA 2R2MB 4Y7AA 3Q3XA 2Q6FA 2VWMA 3RXQA 5A0CA 1O2SA 3M7TA 1ELBA 1VITH 5L2YH 2O9QA 4X2XA 1P2OA 1ARBA 2BOHB 2BDCA 1H9IE 1HCGA 4NA9H 1SGQE 2GCHF 1W13U 2W7UA 2Y7ZA 4D7FA 3Q76A 5C5NA 5A8ZA 1QB6A 1O3MA 1JWTA 4OS4A 2OCVB 3M3SA 2A0QB 3SNBA 1QQUA 4X8SH 1YPLH 1NO9H 1C9PA 1SLXB 2V6NA 4Y11E 1SVPA 5DP5A 1UTJA 1T32A 4K69A 1H1BA 4CRGA 2PV9B 4AORA 4O97A 2ANKH 1FN8A 1V2MT 2J2UA 4JZIA 3SU5A 4MNXA 1IOEA 2XC0A 1FAKH 1LTOA 1O3GA 3E6PH 1T4UH 3ZV9A 3DFLA 3E91A 3KNXA 4WJG2 2HNTF 2DE8A 1Y3VA 2XTTB 1LVBA 1F0RA 1J17T 1CHGA 2ALVA 2Z9JA 2P3FH 4YO9A 1P2KA 3GCHB 2EI8A 5CMXH 1IQNA 3HK3B 5AFZH 3SV8A 3AW1A 1GWAA 1LVYA 1ZRBA 2GD4B 2XW9A 1SSXA 3RXSA 2OXSA 3GDUA 5FPSA 4I33A 1TRYA 3H7OA 1GI4A 3GCNA 4X6NA 2GZ8A 3UY9A 2WYGA 1GJ4H 3LC5A 1E35B 2J95A 1Z1IA 3D62A 2OTVA 4ABBA 1A2CH 3RXBA 1ORFA 2H9HA 1MCTA 3RC5A 3UTUH 4KKDA 4CHAC 3HGPA 2Y5HA 2O8UA 1LDTT 1PQAA 3VB3A 1RIWB 1YLCA 1NN6A 5EOKA 3SNEA 1RRKA 3ZZBA 3TLOA 1GHBG 2PTCE 1DWCH 3GYLB 1SGCA 5HM9A 2WPLS 1T7CA 4JZFH 4BAQB 4IMQA 4TPIZ 1VCPA 3SUEA 1JIMA 2A5AA 2Z6BD 4Z6AH 1T8LA 4CREA 1SLWB 2VGCC 1UCYK 2BLWA 5BRRE 1KSNA 1TIOA 1P05A 4CH2B 5FPYA 4JYUH 5EW2H 2BX3A 1P9SA 4Q7YA 1NFXA 1S0QA 4O3TA 1AD8H 3MNBA 1BTZA 1QB9A 4X8VH 1QL8A 1NU9A 3H5CB 1C5WB 1F5LA 3TPIZ 1O5BB 3QTVH 2BY5X 2QN5T 5FHTA 5C20A 1HAVA 1P09A 1ELCA 2AIQA 4ZH8A 1UTOA 1KXEA 4E05H 3RMOH 1QQ4A 2H9TH 1O5GH 4OS6A 1DWEH 3SV6A 3ESTA 2TGPZ 1BRCE 1Z6EA 1O3JA 3NKKA 1DT2A 4XE4A 1YPMH 2Z3DA 2SGQE 1BA8B 1F2SE 1SL3A 2WV4A 3RC4A 1QA7A 2BZ6H 1RS0A 3MU8A 1M9UA 2DE9A 1OWIA 3V3MA 2OC1A 1ZZZA 2V0BA 3SN8A 1GBAA 2VVVA 2XBVA 4K2YA 5GIBA 2OINA 1FLEE 1E0FD 1EPTC 1IHSH 1K1MA 3P6ZB 4XBBA 8LPRA 3FP6E 5AF9H 4KTSA 3KQBA 4Y76A 2H1UA 1ID5H 4I8JA 4ISOA 4K60A 3P8NA 3GDSA 4AZ2B 1GL0E 1EAXA 2PSXA 2HLCA 3SU2A 1PPCE 4K1SA 3SQEE 2BDAA 1GJ5H 4TY6A 1YF4A 4MNYA 5FPTA 5TCCA 5T3HA 2Q6DA 3GCOA 1DE7H 3T28A 2P3UB 3TNSA 2P95A 3MH5A 1W11U 1GMCF 1A7SA 2XBYA 1FMGA 1YPJH 3U1JB 1TNKA 5GPIB 2IOTA 2QXIA 2ZU3A 4Q7XA 2QXHA 3FVFB 2ZCKP 6GCHG 2BVRH 1GJBB 1AB9B 1RTLA 1MTNC 1AGJA 2C90B 3VB6A 1C1PA 1IQKA 2XRCA 5E2PA 3A80A 1WSSH 1GBHA 3CP7A 4LOYH 2ZP0H 3TJVA 2AS9A 3BTGE 3M37A 2ZHDA 2O8MA 4BTTB 1O3LA 3T5FH 1T8MA 4GHQA 2A4QA 2H5DA 3HKIB 2R3UA 2A2QH 2A7JA 2ZEBA 2WPIS 1EP5A 1WBGB 3ZZ5A 2PKSB 5BPEA 1MZDA 1NFWA 2B0FA 5JBBS 3T29A 5F8ZA 1O3DA 1CSOE 5DKMA 2P8OC 3M7QA 2P93A 1MZAA 3K6YA 1C2KA 3RMLH 3VFEA 2GCTB 2ZPRA 3ZVAA 1PPHE 2WPKS 2ZA5A 1Z8GA 2D8WA 1SLVB 5SGAE 4UD9H 4JZ1A 4Y8YA 1C1OA 3RXEA 3RXOA 1L4DA 5L2ZH 6CHAC 1VJAU 1ELFA 4R8TB 3B9FH 2ZZUH 3ZVEA 1JIRA 5HGGA 4GCHF 1BHXB 2CV3A 2TPIZ 4OS7A 2GP9B 1MAXA 3A85A 3F68H 3E3TA 1A1RA 4ZAEA 1TE0A 3PO1C 4ZXXH 2ANYA 1UK4A 5L30H 3LC3A 1NY22 4DCDA 2VVCA 2Y5GA 3KCGH 4X0WU 3H7TA 1DUAA 3IITA 4YOJA 4MNVA 1LKBA 2FO9A 1QCPA 2A4GA 4BANB 1YBWA 2FX6A 1BIOA 1ELTA 3GY8A 1CA8B 1ANBA 1C1VH 2CF8H 2W7SA 5C67A 4Q2KA 1QR3E 2OLGA 2HNTC 1OYQA 1OWKA 1GJ9B 5DPAA 1S6HA 4ISIH 4XFQA 1O37A 1LPZB 2WPJS 1CT4E 4YT7H 2G51A 2LNCA 2QXGA 3ITIA 3PV4A 3F1SB 3ZZ8A 3S69A 4IMZA 3NPSA 3UQVA 1KXFA 2XWAA 3UOPA 3QWCH 1XUGA 4X2WA 1EJNA 5A8XA 3GICB 1EAIA 5DP7A 1H8DH 1NRQH 1SB1H 5AVDA 2ZDLA 1GVLA 1FPHH 1TONA 1N1LA 2F83A 1ANCA 1ESTA 1YPHC 3FFGA 2F9NA 1D9IA 4WXIA 1O0DH 4B2BA 1ZJDA 1ZTKA 2ZU4A 1C2DA 1G32B 1WCZA 1GDUA 1TRMA 1G3BA 2GTBA 3RUOA 2FXRA 1J16A 2ZDAH 3TNTA 2XBXA 1BITA 2J92A 1C1RA 3PMJA 3TVJB 1FZZA 1HLTH 4VGCB 3ZV8A 4Y79A 3S9BA 2PTNA 2OUAA 1SOZA 2VNTA 3AAUA 1J9CH 4RSPA 1K1IA 3FZDA 1P9UA 1V2KT 4A7IB 1E37B 3E16B 1XVOA 2EI6A 2R0KA 2K1QA 1AZ8A 2F3CE 4AFZA 3NZIA 4GAWA 4D9RA 1BOQA 2PGBB 2VIOA 1C1TA 3MTYA 1CA0C 2O8LA 4H6TA 5GJ4B 1OP2A 4FUEA 1BTHH 1O3AA 3D49H 1CGJE 4ZHMU 4CH8B 3TJUA 1O33A 5AFYH 3BG4B 1GGDB 2BY8X 1RXPA 1Z8RA 2C8WB 1S5SA 2QV1A 1J8AA 4XBCA 1C1QA 1O2WA 1O31A 4ABDA 2ZFTA 9LPRA 4X1SU 3A88A 3UNRA 1FUJA 3VB5A 2ODQA 1GMDG 3FANA 1TMUH 2XCFA 2Z9IA 1UO6A 1RJXB 1IHTH 1OWJA 1CU1A 4HFPB 2SNVA 1VR1H 3W94A 1GBLA 4LZ1H 1QRXA 2FI5E 2FS8A 3SV9A 1LPGB 1C5RA 2ZGJA 1THRH 1G37A 3SQHE 5CE1A 1EAWA 5K7RA 5EXLA 4D7GA 1AY6H 4Y6DA 1O3NA 1DSTA 1HV7A 1CBWB 1EZXC 2IPHA 1GMHF 3UNQA 2FLRH 1IQLA 1D3TB 1MH0A 5LPFA 3QZQA 3ZZ7A 1QA0A 2BQWB 2FS9A 1FV9A 4ABJA 1EQ9A 2WYJA 5FXLA 1H9HE 3GCTF 2THFB 3QUMP 1H4WA 3E90B 1O3PB 1WQSA 1C2FA 1QURH 2SGEE 1EASA 2P16A 3M5MA 1O2GH 2BQ7B 3LU9B 1A0LA 5EW1H 3MNCA 3TJNA 3AVZA 3SOSA 1QTFA 1CQQA 3RM0H 1L1JA 3UQOA 1SGDE 3SUFA 2F9OA 4B2AA 3LKWA 1SGPE 2NWNA 4FU9A 3AASA 3TH3H 1O35A 2XBWA 2EA3A 3M3TA 5HYOA 1HJAC 2GDDA 3HGNA 4AYYB 1BRAA 1H8IH 1K1PA 3UREA 4ZHAA 1P02A 4D76A 2SFAA 1GG6C 3MI4A 2V35A 1GCTC 3LDXH 3RMNH 3SJ8A 1V2LT 1MKWK 4I8GA 3V13A 1O3FA 3LH3A 1NESE 5EQSA 2VWLA 1IQIA 3DD2H 5JDUB 7GCHG 3RU4E 1UCYH 2AGGX 2ZCHP 1V2PT 5A2MH 1LHFH 1PQ8A 3SNAA 1IQGA 1O2MA 2Z7FE 2A7HA 3GY4A 1F7ZA 3L33A 4ISHH 1V2WT 1QRZA 5EGMA