2QARB

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRDLEAEAAAAEAAAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 30
structure length 93
sequence length 93
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarB00
5KNIA 1KW4A 2KE7A 1OXJA 2E8NA 5J8YC 3K1RB 2JV3A 1LKYB 2QARA 2EAPA 2E8OA 3TACB 3BS5B 2FE9A 1COKA 2YTUA 2F44A 2LMRA 2EAMA 2F8KA 1Z1VA 4RQNA 1B0XA 1UCVA 2KG5A 1WWUA 4IS7A 1SXDA 1LKYA 2DKXA 3HILA 3TADC 3BS5A 1PK1B 2QKQA 3KKAC 2DL0A 2GLEA 2KSOB 4PZOA 3IDWA 1WWVA 1PK3A 4NL9A 2KIVA 2F3NA 5JRTA 1DXSA 3BQ7A 1OW5A 2L5YA 4MHVA 4PZNA 3SENA 2Y9TA 2EANA 1SV4A 4RQMA 2LPEA 1JI7A 3BS7A 1UQVA 1X40A 5J8YA 1PK1A 2QB0B 1F0MA 2K4PA 2D8CA 5F3XB 3KKAA 5JTIA 2ES6A 2E8PA 2KMDA 1B4FA 1SV0C 1X9XA 2E8MA 2K60A 2QB1A 3SEIA 3H8MA 2ESEA 2D3DA 2DKZA 1SXEA 2QB0A 1RG6A 2B6GA 3TADA 1SGGA 2QARB 2KSOA 5JU5A 5L1MA 4NJ8A 4NL9C 1SV0A 1V38A 1V85A 2EAOA 2Y9UA 1X66A
chains in the Genus database with same CATH superfamily
2KE7A 4NY8A 4NLZA 1CEZA 3MFIA 1XS9D 4RNOA 4KLFA 3TFRA 4FZLA 2WF9A 1B22A 1NJZA 3NVYA 4M9LA 1LVHA 2W9CB 3BDPA 3QNMA 5L1LA 3PSPA 3M8RA 2NRXA 3IHQB 3OTQA 4MF8A 4J9MA 4NM2A 9ICHA 4DOCA 3QU2A 3CP8A 5HHIA 2KHQA 4F72A 4QZCA 1D9DA 2BZFA 3AM9A 3IDWA 2G5IB 2NO5A 2WF8A 3AL0B 3IRUA 3Q8PB 1JRPA 3GIKA 3M9MB 5EE3A 4F91B 2R8KA 2IHMA 3LYSA 3ALRA 4KMOB 3QZ8A 1F0MA 4C4RA 2E3TA 4I2DA 3N7RC 3JPRA 1FIQA 5ALKA 5KT5A 4UBBA 4E0DA 4Y2JA 2LKYA 4UARA 1S77D 4UAWA 5KFWA 1NK5A 3RBDA 2QLTA 4TURA 1RM6C 2D3DA 2KOBA 2IOHA 3OSPA 3LVVA 3I76A 2Y0SF 3H4BA 2UVVA 1ZETA 3ISCA 1S0OA 5KFLA 4J9LA 2YB4A 8ICPA 2OM6A 2LM1A 2WB1C 4FZNA 5AM0A 5HNKA 2UVRA 4JWMA 3GIMA 2R18A 3RH5A 4X5VA 5CRXA 3R9KA 4U7CA 4YFKA 4ED6A 1SL0A 1LKYB 2XY6A 4M0AA 4FFDA 5KFDA 4IQWA 2AJQA 2KK0A 3H8JA 4QIWF 4FO6A 5ALHA 3JPQA 3NRZA 1ZQBA 7ICNA 1MQ2A 2RLTA 4KMUA 3BJYA 4M2YA 4B9VA 4GIBA 5GTIU 4J03A 1N2XA 5IIMA 1NZBA 3UXNA 2W04A 1SXDA 1WYGA 3SZ2A 1ZQNA 1RXVA 5DKWA 5DG9A 2DL0A 2ZTCA 8ICYA 4O9MA 4P0PB 2W9CA 3O0FA 3L5KA 4NL9A 3V6KA 2W8LA 2KNJA 3F53A 4DS4A 4IR1A 4DSJA 2NV3A 2W03A 5F9LA 3D2SA 9ICEA 5KFRA 4CF5A 5EOZA 2LPEA 4O3QA 1J2NA 5KG7A 5F3XB 1FO4A 3SMVA 2WF5A 4C4TA 3IG8A 4FE3A 1UPHA 1ZQGA 4EENA 4NV0A 5KL1B 3ISDA 9ICFA 2LYAA 4DOAA 3PZPA 8ICWA 5KFYA 4EX7A 2HBKA 4TQSA 5J2HA 4JWNA 1ZQIA 1IXRA 4LZGA 2DGZA 4B9MA 4UASA 5AI9A 3H8SA 3T79A 5J2CA 3NVVA 5IINA 2UVWA 2DPIA 5ALZA 4B9SA 1XU4A 4JV2A 1SKSA 1JMSA 4CCHA 4NLNA 4MFCA 5J0XA 3VC8A 4R64A 4GC7A 3TAQA 5EWFA 3B0XA 3CRXA 4YG2A 5DQHA 4O3PA 1ED1A 3RB4A 1QQ5A 3CYMA 2FPLA 3RAXA 1ZQRA 5EE9A 1ZD5A 2DF4B 3MR6A 2KFZA 4DQQA 5ALGA 3RF9A 5J2EA 1X2IA 4LJXA 1Q3VA 4EEKA 2R8JA 1L5UA 1S76D 1SIJA 2YMQA 2HW3A 2IMWP 5D49A 1XSPA 4US9A 5D46A 1LKYA 2CRXA 2GH1A 2BR0A 3MC1A 4DL6A 2NRWA 2GOLA 1BPYA 4OJPA 5A0LA 1UT5A 3M1YA 4Y2XA 8ICEA 4USAA 1ZOLA 1TE2A 1ZQ1C 1N63A 3HJEA 4Y2SA 2OWOA 3WK7A 2KZZA 2KZ3A 2B21A 4IRDA 5J0RA 5J2AA 3TI0A 2FLNA 1SV4A 3BZKA 2KN7A 5BPCA 4Y2UA 3RJIA 4F4WA 3H0MB 3Q8QB 2OH2A 2RHFA 3AUOA 2AGPA 2E8PA 1N61A 5KAFU 5ALDA 1SB3C 2ZJ8A 1KN5A 2NRZA 3RJFA 1ZD4A 1ZD2P 3CNHA 2HVIA 4UB5A 5F9NA 2W9BB 2PKEA 1U9LA 2KEYA 5C5JA 2AXTU 3IN5A 1QH9A 3M8SA 2ZXIA 3MFHA 5JU5A 3C23A 8ICQA 2F1JA 4G3IA 3GDXA 4KLQA 5AK4A 1L7OA 1BPDA 4O5EA 2ASLA 5KFIA 5GTHU 4C8LA 2HBJA 3E2EA 9ICCA 4EELA 3HKZC 7ICHA 5J2BA 3FM9A 3QEBZ 5J2IA 4F4YA 1JROA 2K4HA 5DQIA 1X9WA 2EH9A 3F2CA 3TQ1A 8ICZA 4DOBA 3PX4A 4J9KA 1KTQA 4KX5A 2KG5A 3KHHA 4KN4A 1RQLA 5KFXA 2DWQA 4BX9C 2V4RA 2EZZA 1FFVA 1MSWD 4PZOA 4QZDA 3VCBA 1JALA 3SAHA 5J0OA 2KV2A 1D8YA 9ICPA 1D8LA 3SENA 3NS1A 4R8UA 3J81j 1ZQSA 2ODGA 9ICRA 4O3OA 3GILA 4LZDA 1TK5A 3OJUA 3Q8LA 5EE0A 4C8KA 4RUAA 3ZDCA 4UW9A 4F5OA 1BPEA 5J0YA 3MGVA 4DFMA 3JPOA 1Z00B 1S8OA 2WFAA 3AQEA 2K4EA 1ZQCA 2HVHA 2MUTB 1WG8A 2G0AA 4J9PA 3C2MA 4RT3A 3ZDBA 3G6YA 4B9LA 2HHQA 4NJ8A 3MBYA 2HHTA 4RNNA 2AQ0A 5KT7A 2Y9UA 3E0FA 2W9BA 1RXWA 5KNIA 5L1IA 3THVA 3OHAA 2IA6A 1L7PA 5HHHA 4C4SA 3NRWA 2RQ5A 3PW0A 2RRDA 4Y2QA 4DL7A 9ICGA 1AQ6A 4R66A 3Q8MA 5AICA 2DBYA 2F77X 3TANA 1NJWA 1XNSA 1TAQA 5KT3A 3LK9A 2YY6A 3I1YA 3ZD9A 3QUQA 2WF6A 2HHUA 4F5NA 1OUQA 2XCAA 8ICHA 5CEHA 2XCPA 2MAXA 3ZI4A 2DKXA 3LDAA 1ZD3A 4OJ6A 2XI9A 2CPRA 3QU7A 5KFKA 2CN1A 1GO3F 1WWVA 3MR5A 1S97A 9ICJA 1L3SA 2IOFK 3QUTA 5EWEA 2H3FA 2FMQA 2LI6A 2Y9TA 4RU9A 1NNLA 5KFZA 9ICUA 4ECZA 5AKYA 5KFEA 1JI7A 9ICAA 2FPMA 5J2JA 4PH5A 5ALYA 1YZ6A 3MR3A 4QWBA 4UB2A 1DGJA 2W7PA 4HAIA 3RJHA 4YD2A 1DK3A 2K8BB 2KMDA 2ASJA 1ZQAA 1AROP 4KLHA 1FFUA 4P4PA 1ZQDA 3MR2A 2ESEA 1ZQKA 2FPKA 1SZHA 5K4LA 2PXIA 2FLPA 9ICWA 7ICPA 2BCRA 2NRTA 5ALSA 4J9RA 4XQ8A 3IG5A 2KSOA 5L1MA 7ICKA 4KLUA 5T14A 2JMGA 1JN3A 1QSLA 1Z00A 1SL2A 3EYZA 3WK4A 2MUTA 3Q8KA 4M9NA 3V6JA 5J8YC 3L3FX 3AU6A 4ECVA 4F8RA 4QWEA 2UVUA 3PMLA 3BS5B 1ZQTA 2FE9A 2YN4A 4QJFB 1KEJA 2Y0SC 4K4IA 1L3TA 1RDFA 4NWIA 4UB6U 1B43A 5KT6A 1X6IA 4RQ3A 3RB6A 4WJ3B 1N5XA 4EZ6A 2KHVA 4QWAA 2W11A 5ALFA 1RPLA 1JUDA 3V6HA 2KKVA 4IRKA 2W3SA 1TK0A 5AKHA 4I2CA 4DL5A 3EW9A 3RJGA 4B9UA 5DB8A 7ICLA 5ALVA 2ZIVA 1HJPA 3V72A 8ICOA 2W3RA 3SQIA 8ICVA 3PO4A 4RQMA 1F44A 2AH5A 2FMPA 1L8LA 4FZMA 1QSSA 3JPSA 4I2HA 1CUKA 3KKAA 4J9NA 2P6UA 1TKDA 2ZIWB 4ED0A 4I2IA 3RR8A 3H8MA 2ZJAA 4AYBF 4EZ9A 4Q8EA 5AK5A 4GC6A 5L9XA 2GWSA 1SXEA 4QZEA 1IV8A 5KG6A 1RG6A 1WUDA 4B9TA 4YMMA 4UATA 5CB1A 1BVSA 4PGQA 1Z19A 2KD1A 1KL9A 1JXLA 3Q8RB 5KFUA 5AKKA 5DBBA 5CP2A 2NYVA 1RYUA 4PHEA 5HP4A 2ISOA 3KHGA 1S10A 3ETLA 1Z1BA 1U4BA 3K1RB 1ZJMA 1PVQA 4PJ0U 4ED8A 5ALXA 4RZRA 3JPPA 5KFNA 4YN4A 2EAPA 2Q4TA 5HR6A 4QZFA 1SWWA 3C28A 1T3QA 3C1ZA 2KVSA 4DLEA 1XSNA 2R8GA 2PI5A 5AKZA 1NK9A 1VLBA 1ZQMA 2LMRA 4DQPA 2NRVA 1HIWA 4ICAA 2KJ8A 1DK2A 4UAVA 5ALLA 2BDUA 4CGZA 3T3FA 1ZQEA 4IS7A 4ED1A 2J6SA 3PR4A 1JXEA 3H7IA 3BS5A 3M9NB 2H3QA 1HEKA 4RQ4A 1JX4A 1TFRA 2I6XA 5KFFA 2P66A 3V7JA 3PW7A 3QU4A 5AI5A 4M6WB 2XO7A 5G5HA 3F5EA 4PGXA 2KIVA 5G5GA 2XIDA 4CF4A 2HDOA 1BPXA 1X9SA 3KZIU 1ZQXA 4MEYA 4CNQA 4Z6CA 3ONNA 5KFHA 4F4ZA 4QZ9A 3M6KA 3A0BU 4RQ6A 1ZQUA 3WKAA 5ALMA 5IIKA 4IR9A 3DV9A 2K8CB 3RJJA 2HMXA 1Q3UA 2G5HB 2E8MA 7ICVA 4PHAA 5DB9A 2LYBA 2OYYA 2ZXHA 2PMZF 3OHBA 1ECWA 2H3VA 4I2BA 3QUCA 4P0QB 3GIIA 2F1HA 1FEZA 7ICQA 2B6GA 1ZQYA 4RQ8A 1KKXA 2YMLA 4C80A 2ALZA 1ZXIA 2ZIWA 2CXYA 1C7YA 4ELVA 3PW5A 1ZQVA 5IILA 3T5JA 1UA1A 2VJ4A 5J2KA 4QZGA 2HHWA 3HT3A 2YMPA 4JMUA 3RH6A 1S9FA 2EZXA 4P4OA 5KL8B 1S0MA 3PW4A 2J6TA 3ETRA 3D6JA 2KVCA 4YCXA 4F5PA 1NK7A 3C5GA 1XC9A 2BPFA 5AM4A 1B0XA 3NVZA 3AMZA 4F4XA 4Q8FA 4F93B 8ICLA 2KIWA 1ZQWA 2LBOA 3TADC 4C0ZA 3KBBA 2W43A 3KKAC 4OCZA 5AM5A 4G9BA 3H0LB 2I9GA 9ICLA 4O3NA 2FDRA 4KLDA 1ZQQA 3QYPA 2ASDA 1OW5A 2MRLA 4MF2A 4TUSA 4JB3A 2NO4A 3BS7A 4F50A 3K1ZA 4UQGA 4ECSA 2P35A 4IQTA 4QWDA 3OPXA 2BCQA 9ICKA 3PSTA 3H4DA 3GIJA 5ALQA 3SEIA 2OHFA 3WK8A 4QW9A 5J2GA 8ICJA 4XA5A 4P2HA 4O0IA 2I1QA 4KLGA 2DKZA 3RR7A 1UT8A 5AI8A 5FP0A 3OGUA 2W9AA 4QZBA 2G09A 3PMNA 5BOMA 3NVWA 1NKCA 4P0PA 3TFSA 3AQFA 7ICFA 3QX7A 2WHEA 2F76X 4C8MA 2JGAA 1KLNA 1SWVA 4M9JA 4DQIA 2HBMA 3EZ5A 4P0QA 3K75D 2G08A 1S5LU 4QWCA 2WAQC 2ZUDA 4C8NA 2K89A 4ECQA 8ICCA 4A8EA 1COKA 1RZTA 4PL2A 1X42A 2Z7JA 1Z1VA 1L7NA 5KG4A 5KFOA 5KG2A 2M9NA 4NLKA 2JZBB 1XO1A 3NASA 5J2FA 3KHRA 4RNMA 2YMMA 1YT3A 4QW8A 3S6JA 5JRTA 2VA2A 1DXSA 4JK1A 3C2KA 2KKPA 1KFDA 2C28A 1N48A 3ZDDA 4PHPA 3OJSA 1ZYQA 2XGQA 4OO1J 1X40A 2I5HA 3B9JA 5J8YA 3WK9A 4I2GA 2A19A 2AU0A 3TAPA 3AN1A 4M9GA 1VJ5A 4PGYA 5AKEA 4UAYA 1N62A 2E1FA 2F8LA 2K60A 2W9MA 2GO7A 2ISPA 2AQ4A 4DF4A 1BPZA 4O3SA 2P6RA 8ICXA 5JUMA 1A0PA 4IL6U 5DDYA 4MFAA 1NJXA 4QZIA 1BGXT 2ZTEA 1QSYA 2EQYA 4DCCA 2LHTA 4KN7A 3QU5A 4ZOHC 7ICGA 4UB8U 5TISU 5DLGA 4GXJA 1A6SA 4KLEA 3PW2A 3V7LA 2YQEA 4U6PA 1J97A 3SD7A 2HBLA 4UB4A 5B66U 4EYHB 4CE6A 4Q45A 5DGAA 2PFQA 1XO0A 4RT2A 4PPXA 2R8HA 3KD3A 3ZD8A 2E8OA 4DSEA 3DDHA 3RH4A 4FS2A 4O3RA 4K4GA 5HR7A 2VANA 2JRZA 2IHNA 1V9PA 2KICA 4UBCA 1D9FA 1KFSA 3SI8A 9ICIA 3HWTA 1P7DA 3QU9A 4Q43A 3C5FA 7ICMA 5J0WA 1U47A 3HILA 1KFTA 2M0NA 5AIAA 8ICAA 2BKEA 1PK1B 2HHSA 4BWJA 1X9MA 1XSLA 4ED3A 4MHVA 2MSNA 4PZNA 4YVZA 3JPNA 1S0NA 4ED2A 1O08A 3PO5A 5DB7A 5KFAA 3WK5A 1COOA 2JZBA 1TAUA 2D8CA 4YR3A 1V97A 3QZ7A 2JHDA 4JV1A 2A3VA 2ES6A 1TK8A 1IM4A 3N7SC 2E5SA 5TZVA 4IQVA 1BNPA 2ZTDA 3KFUF 1O03A 1QTMA 4OD0A 2FMSA 2W55A 3AU2A 3K4GA 1CRXA 2JEFA 5DG8A 3DEEA 4YMNA 5ALEA 3N28A 4I29A 4UAZA 1NOMA 3C21A 4DF8A 3GQCA 4OJOA 3M7DA 5J0SA 3RFAA 4YP3A 5DBCA 4KLMA 4RQ0A 2VA3A 3F2DA 2KZMA 4BWMA 9ICXA 4AP9A 4O5CA 2OEHA 3RJKA 2K8AA 2G07A 1NJYA 2DPJA 4AYBC 3TKAA 2D6FC 7ICTA 1Q8KA 4UAUA 2F44A 3RBEA 4RQ2A 2BPCA 1KQQA 4ELUA 1U48A 2F8KA 4Z6FA 4RQNA 5KFCA 3BQ1A 4C7ZA 3SV3A 4BGDA 5C0YA 3WU2U 8ICGA 4C8OA 5KAIU 4F71A 3NGDA 5IIOA 5ALTA 3HPOA 8ICMA 4DFPA 4CRXA 2WF7A 3ZDEA 1Y88A 4F3OA 1S0VA 2Q0ZX 4YXMA 2BCVA 2JH7A 3TARA 3BQ7A 5ALNA 1URJA 7ICUA 3WKBA 3UQ0A 4P4MA 4I28A 4ECRA 2A1JB 4BXOB 5HMMA 1PK1A 2QB0B 2XY5A 5L1JA 3MABA 4DO9A 2RDJA 9ICNA 1MC8A 1SL1A 1B4FA 2AGQA 4Z6DA 5KG3A 4B9NA 9ICOA 4I2AA 4BUGA 4DS5A 7ICRA 2QB1A 2VA8A 4QZHA 1C20A 5KT4A 1QLNA 5ALPA 2H3ZA 4YR2A 4QIWC 5ALOA 8ICKA 4YMOA 4DSLA 3TADA 5D4BA 1JIHA 2HI0A 4DEZA 8ICUA 2QARB 3KTQA 3ED5A 3HP6A 4NXZA 3GV8B 2ATLA 2JEJA 4RPXA 2ZG6A 3EPGA 1V85A 5AHXA 2VIXA 1PUZA 1XWLA 1A76A 3ORYA 2KJ9A 5J0TA 2JEGA 1NZPA 3L4PA 3PSFA 8ICBA 4CF3A 8ICTA 2A1AA 3M6ZA 3H40A 4O3MA 5AM3A 3HW8A 2PMZC 3Q8SB 4KLSA 1ZRMA 1ZQZA 1M6YA 3BZCA 4CDGA 4TUQA 4MFFA 2BGWA 5AKLA 2EAMA 2AGOA 1T3NA 9ICVA 3NUQA 3SV4A 1UCVA 1QCKA 1VDVA 3V7KA 2PI4A 1NK4A 1ZQLA 2BQ3A 2BCSA 4PHDA 5EWGA 5DLFA 3WKCA 4ELTA 3FYHA 2OCEA 4C7YA 1NKEA 3PVXA 7ICOA 4Q44A 2HSZA 1KDHA 1MA7A 2B0CA 2N1RA 3H8WA 4Y2RA 5ALUA 2YX8A 3PX0A 4RPZA 4KLOA 2LM4A 1PVPA 1PVRA 3I28A 1N60A 4QZ8A 3GZFA 3NTUA 5AKXA 2IBKA 5KFBA 1RYSA 2EDUA 2W8KA 1X9XA 3LVWA 2ZIUB 3FAHA 4RQ7A 3SYZA 4RQ5A 2A1JA 4BXOA 2QB0A 5KFGA 4YQWA 3C2LA 7ICSA 9ICBA 4QNLA 3G6XA 5ALJA 1SKRA 3KOOA 5J29A 2XC9A 3PR5B 4KTQA 4M47A 3IM1A 4R65A 5CJ7A 5ALIA 4O5KA 3MGIA 1ZRNA 3IP4B 2QARA 4FBTA 7ICIA 5J0QA 8ICRA 4DL4A 3UMCA 4EYIB 4DFJA 2Y1IA 1QQ6A 1CI4A 4F2SA 3OSNA 2KFNA 3UM9A 1T94A 5KFQA 2JH1A 1WWUA 1N5WA 5DG7A 4QZAA 2ZJ5A 2AHOB 1T8EA 3RB3A 4DSKA 3WK6A 4ECTA 1N56A 2GLEA 1NK6A 4I2FA 4GXKA 5AK3A 3AEVA 2L5YA 4GFJA 5L1KA 2WB1F 1KRPA 3H0RB 1KSPA 1UQVA 4NLGA 2HHVA 2WTFA 5H2FU 5B5EU 5EE1A 4F5RA 4IC9A 4KLJA 4Y2TA 3G6VA 3EWAA 2H3IA 4DL2A 3WKEA 3UMBA 4GXIA 1U49A 5J2DA 2HOFA 4IRCA 3GFKB 1RQNA 2F2AB 4OJ5A 2KTQA 5E79U 5AI0A 3FC4A 2J6UA 2RDIA 1MQ3A 1K1SA 1F5SA 2PFPA 1T7PA 4M6WA 1ZQFA 5HMLA 4JUZA 2DQNB 2ZIUA 5AKIA 2EAOA 1PZNA 2V9WA 3ZDAA 8ICNA 1X66A 3C29A 4R8UB 4TQRA 4DFKA 4RPYA 3BQ2A 1TAMA 9ICTA 4FBUA 1WCLA 1L7MA 2BCUA 5AM1A 3TACB 4KX3A 5KFVA 4Y2YA 2YTUA 1YZ7A 1HUOA 3LWLA 4YD1A 4XRHA 4LVSA 5DDMA 3MGHA 1NKBA 5ALWA 1L3VA 3F5AA 2ZUCA 2YB1A 4RQ1A 4R63A 8ICFA 1NI3A 3EUB2 4KITB 3RB0A 3N4MB 5AIBA 9ICQA 4JV0A 1Z3EB 4ECUA 2EANA 1H38A 7ICJA 2C22A 1D8BA 3IV6A 2BHNA 1UA0A 1K5OA 5J0UA 1IIPA 1ZQJA 5AKJA 5DQGA 2K4PA 1TV9A 2JXJA 4PL1A 3C1YA 2HOQA 3RRHA 2XICA 1DOQA 5CHGA 2HHXA 1IG6A 4F2RA 2RP5A 4ZH4A 2C2RA 4EBCA 5DBAA 4EEYA 5IIJA 5KFJA 5KFPA 3BQ0A 1X6JA 3HX0A 5KG1A 3U26A 2HCFA 4B6JA 1HUZA 4ED7A 3F2BA 4F5QA 2FJ6A 1SGGA 4F92B 2V4QA 1ZQHA 2KJ5A 1DRGA 1Z4NA 2H5XA 4NL9C 2FI1A 1QQ7A 1SV0A 1V38A 5CA7A 2XGPA 3GV7B 1ZJNA 4Y2VA 1LV5A 4UB3A 1T4GA 2C2DA 5DGBA 3M9OB 3LWMA 3PNCA 2FLLA 4RUCA 4MEXA 2MA1A 4K4HA 4DQRA 2PFNA 3T5KA 2JV3A 5KFSA 7ICEA 3QEAZ 3JPTA 4YR0A 2VJ5A 3T5LA 4TUPA 4M9HA 1NK8A 3E58A 4DL3A 4J9OA 4BJQA 2BQRA 4XUSA 4EBDA 3SR6A 4KLLA 2E1EA 1TVAA 3RJEA 2OXOA 2BQUA 4I27A 4ECXA 5DB6A 9ICSA 2QKQA 2W54A 2ZUBA 2KSOB 3T5HA 1PK3A 2IOFA 2ZIXB 2F1IA 2WAQF 9ICMA 4DLGA 5AI4A 5AKGA 4EX6A 5BOLA 2DFLA 3MDCA 4KLIA 5AK6A 4ACOA 3WKDA 2JR5A 5CWRA 4I2EA 3UQ2A 4Y2PA 1A77A 3UXPA 2EZYA 5CR0A 3RAQA 3PV8A 4US8A 3N97B 1J2MA 4KLTA 4DSFA 4ECWA 4UB1A 1ZQOA 4DWIA 1KBUA 1K1QA 1LB2B 3SAFA 3HKZF 1EXNA 5AI6A 1L6NA 5KG5A 3GU3A 2O6KA 2C2EA 1NK0A 3UPQA 1Q46A 4FS1A 3UXOA 3UMGA 4NM1A 1RYRA 3N7PD 4NLCA 4J9SA 2BDPA 2ZIVB 8ICSA 2R8IA 2JEIA 1KW4A 3D2NA 1OXJA 4EBEA 2E8NA 2VKQA 1ZQPA 4J9QA 2DUYA 4F4KA 4DSIA 3EPIA 2G06A 3PY8A 1BNOA 5IIIA 5KT2A 3D2QA 3A0HU 1BPBA 3KZXA 5KFMA 1DGSA 1WCNA 4OJLA 3HRDD 3RRGA 3ISBA 3QUBA 3KHLA 8ICIA 5KTQA 1SZPA 2F3NA 3RTVA 1UHUA 3ICXA 3SAGA 3CW2C 3PSIA 3FDSA 2BPGA 5ALRA 4DQSA 1SKWA 1L3UA 1U45A 5KFTA 3GV5B 2MU2A 4M04A 3MDAA 3BQTA 5JTIA 3PX6A 2ZIXA 3QXGA 1MN8A 2HOIA 1SV0C 5J0PA 4ECYA 4DFDA 4GLXA 2Y1JA 4IQUA 2XY7A 2PFOA 4Z6EA 5KG0A 4NLBA 3B0YA 2LYHA 2KP7A 1L8OA 4I2JA 4BDPA 2K4IA 4HYKA 4YXJA 2XVTA 5AM2A 1Z4OA 2W7OA 3QE9Y
chains in the Genus database with same CATH topology
5KNIA 1KW4A 2KE7A 1OXJA 2E8NA 5J8YC 3K1RB 2JV3A 1LKYB 2QARA 2EAPA 2E8OA 3TACB 3BS5B 2FE9A 1COKA 2YTUA 2F44A 2LMRA 2EAMA 2F8KA 1Z1VA 4RQNA 1B0XA 1UCVA 2KG5A 1WWUA 4IS7A 1SXDA 1LKYA 2DKXA 3HILA 3TADC 3BS5A 1PK1B 2QKQA 3KKAC 2DL0A 2GLEA 2KSOB 4PZOA 3IDWA 1WWVA 1PK3A 4NL9A 2KIVA 2F3NA 5JRTA 1DXSA 3BQ7A 1OW5A 2L5YA 4MHVA 4PZNA 3SENA 2Y9TA 2EANA 1SV4A 4RQMA 2LPEA 1JI7A 3BS7A 1UQVA 1X40A 5J8YA 1PK1A 2QB0B 1F0MA 2K4PA 2D8CA 5F3XB 3KKAA 5JTIA 2ES6A 2E8PA 2KMDA 1B4FA 1SV0C 1X9XA 2E8MA 2K60A 2QB1A 3SEIA 3H8MA 2ESEA 2D3DA 2DKZA 1SXEA 2QB0A 1RG6A 2B6GA 3TADA 1SGGA 2QARB 2KSOA 5JU5A 5L1MA 4NJ8A 4NL9C 1SV0A 1V38A 1V85A 2EAOA 2Y9UA 1X66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNI A;  1KW4 A;  2KE7 A;  1OXJ A;  2E8N A;  5J8Y C;  3K1R B;  2JV3 A;  1LKY B;  2QAR A;  2EAP A;  2E8O A;  3TAC B;  3BS5 B;  2FE9 A;  1COK A;  2YTU A;  2F44 A;  2LMR A;  2EAM A;  2F8K A;  1Z1V A;  4RQN A;  1B0X A;  1UCV A;  2KG5 A;  1WWU A;  4IS7 A;  1SXD A;  1LKY A;  2DKX A;  3HIL A;  3TAD C;  3BS5 A;  1PK1 B;  2QKQ A;  3KKA C;  2DL0 A;  2GLE A;  2KSO B;  4PZO A;  3IDW A;  1WWV A;  1PK3 A;  4NL9 A;  2KIV A;  2F3N A;  5JRT A;  1DXS A;  3BQ7 A;  1OW5 A;  2L5Y A;  4MHV A;  4PZN A;  3SEN A;  2Y9T A;  2EAN A;  1SV4 A;  4RQM A;  2LPE A;  1JI7 A;  3BS7 A;  1UQV A;  1X40 A;  5J8Y A;  1PK1 A;  2QB0 B;  1F0M A;  2K4P A;  2D8C A;  5F3X B;  3KKA A;  5JTI A;  2ES6 A;  2E8P A;  2KMD A;  1B4F A;  1SV0 C;  1X9X A;  2E8M A;  2K60 A;  2QB1 A;  3SEI A;  3H8M A;  2ESE A;  2D3D A;  2DKZ A;  1SXE A;  2QB0 A;  1RG6 A;  2B6G A;  3TAD A;  1SGG A;  2QAR B;  2KSO A;  5JU5 A;  5L1M A;  4NJ8 A;  4NL9 C;  1SV0 A;  1V38 A;  1V85 A;  2EAO A;  2Y9U A;  1X66 A; 
#chains in the Genus database with same CATH topology
 2KE7 A;  4NY8 A;  4NLZ A;  1CEZ A;  3MFI A;  1XS9 D;  4RNO A;  4KLF A;  3TFR A;  4FZL A;  2WF9 A;  1B22 A;  1NJZ A;  3NVY A;  4M9L A;  1LVH A;  2W9C B;  3BDP A;  3QNM A;  5L1L A;  3PSP A;  3M8R A;  2NRX A;  3IHQ B;  3OTQ A;  4MF8 A;  4J9M A;  4NM2 A;  9ICH A;  4DOC A;  3QU2 A;  3CP8 A;  5HHI A;  2KHQ A;  4F72 A;  4QZC A;  1D9D A;  2BZF A;  3AM9 A;  3IDW A;  2G5I B;  2NO5 A;  2WF8 A;  3AL0 B;  3IRU A;  3Q8P B;  1JRP A;  3GIK A;  3M9M B;  5EE3 A;  4F91 B;  2R8K A;  2IHM A;  3LYS A;  3ALR A;  4KMO B;  3QZ8 A;  1F0M A;  4C4R A;  2E3T A;  4I2D A;  3N7R C;  3JPR A;  1FIQ A;  5ALK A;  5KT5 A;  4UBB A;  4E0D A;  4Y2J A;  2LKY A;  4UAR A;  1S77 D;  4UAW A;  5KFW A;  1NK5 A;  3RBD A;  2QLT A;  4TUR A;  1RM6 C;  2D3D A;  2KOB A;  2IOH A;  3OSP A;  3LVV A;  3I76 A;  2Y0S F;  3H4B A;  2UVV A;  1ZET A;  3ISC A;  1S0O A;  5KFL A;  4J9L A;  2YB4 A;  8ICP A;  2OM6 A;  2LM1 A;  2WB1 C;  4FZN A;  5AM0 A;  5HNK A;  2UVR A;  4JWM A;  3GIM A;  2R18 A;  3RH5 A;  4X5V A;  5CRX A;  3R9K A;  4U7C A;  4YFK A;  4ED6 A;  1SL0 A;  1LKY B;  2XY6 A;  4M0A A;  4FFD A;  5KFD A;  4IQW A;  2AJQ A;  2KK0 A;  3H8J A;  4QIW F;  4FO6 A;  5ALH A;  3JPQ A;  3NRZ A;  1ZQB A;  7ICN A;  1MQ2 A;  2RLT A;  4KMU A;  3BJY A;  4M2Y A;  4B9V A;  4GIB A;  5GTI U;  4J03 A;  1N2X A;  5IIM A;  1NZB A;  3UXN A;  2W04 A;  1SXD A;  1WYG A;  3SZ2 A;  1ZQN A;  1RXV A;  5DKW A;  5DG9 A;  2DL0 A;  2ZTC A;  8ICY A;  4O9M A;  4P0P B;  2W9C A;  3O0F A;  3L5K A;  4NL9 A;  3V6K A;  2W8L A;  2KNJ A;  3F53 A;  4DS4 A;  4IR1 A;  4DSJ A;  2NV3 A;  2W03 A;  5F9L A;  3D2S A;  9ICE A;  5KFR A;  4CF5 A;  5EOZ A;  2LPE A;  4O3Q A;  1J2N A;  5KG7 A;  5F3X B;  1FO4 A;  3SMV A;  2WF5 A;  4C4T A;  3IG8 A;  4FE3 A;  1UPH A;  1ZQG A;  4EEN A;  4NV0 A;  5KL1 B;  3ISD A;  9ICF A;  2LYA A;  4DOA A;  3PZP A;  8ICW A;  5KFY A;  4EX7 A;  2HBK A;  4TQS A;  5J2H A;  4JWN A;  1ZQI A;  1IXR A;  4LZG A;  2DGZ A;  4B9M A;  4UAS A;  5AI9 A;  3H8S A;  3T79 A;  5J2C A;  3NVV A;  5IIN A;  2UVW A;  2DPI A;  5ALZ A;  4B9S A;  1XU4 A;  4JV2 A;  1SKS A;  1JMS A;  4CCH A;  4NLN A;  4MFC A;  5J0X A;  3VC8 A;  4R64 A;  4GC7 A;  3TAQ A;  5EWF A;  3B0X A;  3CRX A;  4YG2 A;  5DQH A;  4O3P A;  1ED1 A;  3RB4 A;  1QQ5 A;  3CYM A;  2FPL A;  3RAX A;  1ZQR A;  5EE9 A;  1ZD5 A;  2DF4 B;  3MR6 A;  2KFZ A;  4DQQ A;  5ALG A;  3RF9 A;  5J2E A;  1X2I A;  4LJX A;  1Q3V A;  4EEK A;  2R8J A;  1L5U A;  1S76 D;  1SIJ A;  2YMQ A;  2HW3 A;  2IMW P;  5D49 A;  1XSP A;  4US9 A;  5D46 A;  1LKY A;  2CRX A;  2GH1 A;  2BR0 A;  3MC1 A;  4DL6 A;  2NRW A;  2GOL A;  1BPY A;  4OJP A;  5A0L A;  1UT5 A;  3M1Y A;  4Y2X A;  8ICE A;  4USA A;  1ZOL A;  1TE2 A;  1ZQ1 C;  1N63 A;  3HJE A;  4Y2S A;  2OWO A;  3WK7 A;  2KZZ A;  2KZ3 A;  2B21 A;  4IRD A;  5J0R A;  5J2A A;  3TI0 A;  2FLN A;  1SV4 A;  3BZK A;  2KN7 A;  5BPC A;  4Y2U A;  3RJI A;  4F4W A;  3H0M B;  3Q8Q B;  2OH2 A;  2RHF A;  3AUO A;  2AGP A;  2E8P A;  1N61 A;  5KAF U;  5ALD A;  1SB3 C;  2ZJ8 A;  1KN5 A;  2NRZ A;  3RJF A;  1ZD4 A;  1ZD2 P;  3CNH A;  2HVI A;  4UB5 A;  5F9N A;  2W9B B;  2PKE A;  1U9L A;  2KEY A;  5C5J A;  2AXT U;  3IN5 A;  1QH9 A;  3M8S A;  2ZXI A;  3MFH A;  5JU5 A;  3C23 A;  8ICQ A;  2F1J A;  4G3I A;  3GDX A;  4KLQ A;  5AK4 A;  1L7O A;  1BPD A;  4O5E A;  2ASL A;  5KFI A;  5GTH U;  4C8L A;  2HBJ A;  3E2E A;  9ICC A;  4EEL A;  3HKZ C;  7ICH A;  5J2B A;  3FM9 A;  3QEB Z;  5J2I A;  4F4Y A;  1JRO A;  2K4H A;  5DQI A;  1X9W A;  2EH9 A;  3F2C A;  3TQ1 A;  8ICZ A;  4DOB A;  3PX4 A;  4J9K A;  1KTQ A;  4KX5 A;  2KG5 A;  3KHH A;  4KN4 A;  1RQL A;  5KFX A;  2DWQ A;  4BX9 C;  2V4R A;  2EZZ A;  1FFV A;  1MSW D;  4PZO A;  4QZD A;  3VCB A;  1JAL A;  3SAH A;  5J0O A;  2KV2 A;  1D8Y A;  9ICP A;  1D8L A;  3SEN A;  3NS1 A;  4R8U A;  3J81 j;  1ZQS A;  2ODG A;  9ICR A;  4O3O A;  3GIL A;  4LZD A;  1TK5 A;  3OJU A;  3Q8L A;  5EE0 A;  4C8K A;  4RUA A;  3ZDC A;  4UW9 A;  4F5O A;  1BPE A;  5J0Y A;  3MGV A;  4DFM A;  3JPO A;  1Z00 B;  1S8O A;  2WFA A;  3AQE A;  2K4E A;  1ZQC A;  2HVH A;  2MUT B;  1WG8 A;  2G0A A;  4J9P A;  3C2M A;  4RT3 A;  3ZDB A;  3G6Y A;  4B9L A;  2HHQ A;  4NJ8 A;  3MBY A;  2HHT A;  4RNN A;  2AQ0 A;  5KT7 A;  2Y9U A;  3E0F A;  2W9B A;  1RXW A;  5KNI A;  5L1I A;  3THV A;  3OHA A;  2IA6 A;  1L7P A;  5HHH A;  4C4S A;  3NRW A;  2RQ5 A;  3PW0 A;  2RRD A;  4Y2Q A;  4DL7 A;  9ICG A;  1AQ6 A;  4R66 A;  3Q8M A;  5AIC A;  2DBY A;  2F77 X;  3TAN A;  1NJW A;  1XNS A;  1TAQ A;  5KT3 A;  3LK9 A;  2YY6 A;  3I1Y A;  3ZD9 A;  3QUQ A;  2WF6 A;  2HHU A;  4F5N A;  1OUQ A;  2XCA A;  8ICH A;  5CEH A;  2XCP A;  2MAX A;  3ZI4 A;  2DKX A;  3LDA A;  1ZD3 A;  4OJ6 A;  2XI9 A;  2CPR A;  3QU7 A;  5KFK A;  2CN1 A;  1GO3 F;  1WWV A;  3MR5 A;  1S97 A;  9ICJ A;  1L3S A;  2IOF K;  3QUT A;  5EWE A;  2H3F A;  2FMQ A;  2LI6 A;  2Y9T A;  4RU9 A;  1NNL A;  5KFZ A;  9ICU A;  4ECZ A;  5AKY A;  5KFE A;  1JI7 A;  9ICA A;  2FPM A;  5J2J A;  4PH5 A;  5ALY A;  1YZ6 A;  3MR3 A;  4QWB A;  4UB2 A;  1DGJ A;  2W7P A;  4HAI A;  3RJH A;  4YD2 A;  1DK3 A;  2K8B B;  2KMD A;  2ASJ A;  1ZQA A;  1ARO P;  4KLH A;  1FFU A;  4P4P A;  1ZQD A;  3MR2 A;  2ESE A;  1ZQK A;  2FPK A;  1SZH A;  5K4L A;  2PXI A;  2FLP A;  9ICW A;  7ICP A;  2BCR A;  2NRT A;  5ALS A;  4J9R A;  4XQ8 A;  3IG5 A;  2KSO A;  5L1M A;  7ICK A;  4KLU A;  5T14 A;  2JMG A;  1JN3 A;  1QSL A;  1Z00 A;  1SL2 A;  3EYZ A;  3WK4 A;  2MUT A;  3Q8K A;  4M9N A;  3V6J A;  5J8Y C;  3L3F X;  3AU6 A;  4ECV A;  4F8R A;  4QWE A;  2UVU A;  3PML A;  3BS5 B;  1ZQT A;  2FE9 A;  2YN4 A;  4QJF B;  1KEJ A;  2Y0S C;  4K4I A;  1L3T A;  1RDF A;  4NWI A;  4UB6 U;  1B43 A;  5KT6 A;  1X6I A;  4RQ3 A;  3RB6 A;  4WJ3 B;  1N5X A;  4EZ6 A;  2KHV A;  4QWA A;  2W11 A;  5ALF A;  1RPL A;  1JUD A;  3V6H A;  2KKV A;  4IRK A;  2W3S A;  1TK0 A;  5AKH A;  4I2C A;  4DL5 A;  3EW9 A;  3RJG A;  4B9U A;  5DB8 A;  7ICL A;  5ALV A;  2ZIV A;  1HJP A;  3V72 A;  8ICO A;  2W3R A;  3SQI A;  8ICV A;  3PO4 A;  4RQM A;  1F44 A;  2AH5 A;  2FMP A;  1L8L A;  4FZM A;  1QSS A;  3JPS A;  4I2H A;  1CUK A;  3KKA A;  4J9N A;  2P6U A;  1TKD A;  2ZIW B;  4ED0 A;  4I2I A;  3RR8 A;  3H8M A;  2ZJA A;  4AYB F;  4EZ9 A;  4Q8E A;  5AK5 A;  4GC6 A;  5L9X A;  2GWS A;  1SXE A;  4QZE A;  1IV8 A;  5KG6 A;  1RG6 A;  1WUD A;  4B9T A;  4YMM A;  4UAT A;  5CB1 A;  1BVS A;  4PGQ A;  1Z19 A;  2KD1 A;  1KL9 A;  1JXL A;  3Q8R B;  5KFU A;  5AKK A;  5DBB A;  5CP2 A;  2NYV A;  1RYU A;  4PHE A;  5HP4 A;  2ISO A;  3KHG A;  1S10 A;  3ETL A;  1Z1B A;  1U4B A;  3K1R B;  1ZJM A;  1PVQ A;  4PJ0 U;  4ED8 A;  5ALX A;  4RZR A;  3JPP A;  5KFN A;  4YN4 A;  2EAP A;  2Q4T A;  5HR6 A;  4QZF A;  1SWW A;  3C28 A;  1T3Q A;  3C1Z A;  2KVS A;  4DLE A;  1XSN A;  2R8G A;  2PI5 A;  5AKZ A;  1NK9 A;  1VLB A;  1ZQM A;  2LMR A;  4DQP A;  2NRV A;  1HIW A;  4ICA A;  2KJ8 A;  1DK2 A;  4UAV A;  5ALL A;  2BDU A;  4CGZ A;  3T3F A;  1ZQE A;  4IS7 A;  4ED1 A;  2J6S A;  3PR4 A;  1JXE A;  3H7I A;  3BS5 A;  3M9N B;  2H3Q A;  1HEK A;  4RQ4 A;  1JX4 A;  1TFR A;  2I6X A;  5KFF A;  2P66 A;  3V7J A;  3PW7 A;  3QU4 A;  5AI5 A;  4M6W B;  2XO7 A;  5G5H A;  3F5E A;  4PGX A;  2KIV A;  5G5G A;  2XID A;  4CF4 A;  2HDO A;  1BPX A;  1X9S A;  3KZI U;  1ZQX A;  4MEY A;  4CNQ A;  4Z6C A;  3ONN A;  5KFH A;  4F4Z A;  4QZ9 A;  3M6K A;  3A0B U;  4RQ6 A;  1ZQU A;  3WKA A;  5ALM A;  5IIK A;  4IR9 A;  3DV9 A;  2K8C B;  3RJJ A;  2HMX A;  1Q3U A;  2G5H B;  2E8M A;  7ICV A;  4PHA A;  5DB9 A;  2LYB A;  2OYY A;  2ZXH A;  2PMZ F;  3OHB A;  1ECW A;  2H3V A;  4I2B A;  3QUC A;  4P0Q B;  3GII A;  2F1H A;  1FEZ A;  7ICQ A;  2B6G A;  1ZQY A;  4RQ8 A;  1KKX A;  2YML A;  4C80 A;  2ALZ A;  1ZXI A;  2ZIW A;  2CXY A;  1C7Y A;  4ELV A;  3PW5 A;  1ZQV A;  5IIL A;  3T5J A;  1UA1 A;  2VJ4 A;  5J2K A;  4QZG A;  2HHW A;  3HT3 A;  2YMP A;  4JMU A;  3RH6 A;  1S9F A;  2EZX A;  4P4O A;  5KL8 B;  1S0M A;  3PW4 A;  2J6T A;  3ETR A;  3D6J A;  2KVC A;  4YCX A;  4F5P A;  1NK7 A;  3C5G A;  1XC9 A;  2BPF A;  5AM4 A;  1B0X A;  3NVZ A;  3AMZ A;  4F4X A;  4Q8F A;  4F93 B;  8ICL A;  2KIW A;  1ZQW A;  2LBO A;  3TAD C;  4C0Z A;  3KBB A;  2W43 A;  3KKA C;  4OCZ A;  5AM5 A;  4G9B A;  3H0L B;  2I9G A;  9ICL A;  4O3N A;  2FDR A;  4KLD A;  1ZQQ A;  3QYP A;  2ASD A;  1OW5 A;  2MRL A;  4MF2 A;  4TUS A;  4JB3 A;  2NO4 A;  3BS7 A;  4F50 A;  3K1Z A;  4UQG A;  4ECS A;  2P35 A;  4IQT A;  4QWD A;  3OPX A;  2BCQ A;  9ICK A;  3PST A;  3H4D A;  3GIJ A;  5ALQ A;  3SEI A;  2OHF A;  3WK8 A;  4QW9 A;  5J2G A;  8ICJ A;  4XA5 A;  4P2H A;  4O0I A;  2I1Q A;  4KLG A;  2DKZ A;  3RR7 A;  1UT8 A;  5AI8 A;  5FP0 A;  3OGU A;  2W9A A;  4QZB A;  2G09 A;  3PMN A;  5BOM A;  3NVW A;  1NKC A;  4P0P A;  3TFS A;  3AQF A;  7ICF A;  3QX7 A;  2WHE A;  2F76 X;  4C8M A;  2JGA A;  1KLN A;  1SWV A;  4M9J A;  4DQI A;  2HBM A;  3EZ5 A;  4P0Q A;  3K75 D;  2G08 A;  1S5L U;  4QWC A;  2WAQ C;  2ZUD A;  4C8N A;  2K89 A;  4ECQ A;  8ICC A;  4A8E A;  1COK A;  1RZT A;  4PL2 A;  1X42 A;  2Z7J A;  1Z1V A;  1L7N A;  5KG4 A;  5KFO A;  5KG2 A;  2M9N A;  4NLK A;  2JZB B;  1XO1 A;  3NAS A;  5J2F A;  3KHR A;  4RNM A;  2YMM A;  1YT3 A;  4QW8 A;  3S6J A;  5JRT A;  2VA2 A;  1DXS A;  4JK1 A;  3C2K A;  2KKP A;  1KFD A;  2C28 A;  1N48 A;  3ZDD A;  4PHP A;  3OJS A;  1ZYQ A;  2XGQ A;  4OO1 J;  1X40 A;  2I5H A;  3B9J A;  5J8Y A;  3WK9 A;  4I2G A;  2A19 A;  2AU0 A;  3TAP A;  3AN1 A;  4M9G A;  1VJ5 A;  4PGY A;  5AKE A;  4UAY A;  1N62 A;  2E1F A;  2F8L A;  2K60 A;  2W9M A;  2GO7 A;  2ISP A;  2AQ4 A;  4DF4 A;  1BPZ A;  4O3S A;  2P6R A;  8ICX A;  5JUM A;  1A0P A;  4IL6 U;  5DDY A;  4MFA A;  1NJX A;  4QZI A;  1BGX T;  2ZTE A;  1QSY A;  2EQY A;  4DCC A;  2LHT A;  4KN7 A;  3QU5 A;  4ZOH C;  7ICG A;  4UB8 U;  5TIS U;  5DLG A;  4GXJ A;  1A6S A;  4KLE A;  3PW2 A;  3V7L A;  2YQE A;  4U6P A;  1J97 A;  3SD7 A;  2HBL A;  4UB4 A;  5B66 U;  4EYH B;  4CE6 A;  4Q45 A;  5DGA A;  2PFQ A;  1XO0 A;  4RT2 A;  4PPX A;  2R8H A;  3KD3 A;  3ZD8 A;  2E8O A;  4DSE A;  3DDH A;  3RH4 A;  4FS2 A;  4O3R A;  4K4G A;  5HR7 A;  2VAN A;  2JRZ A;  2IHN A;  1V9P A;  2KIC A;  4UBC A;  1D9F A;  1KFS A;  3SI8 A;  9ICI A;  3HWT A;  1P7D A;  3QU9 A;  4Q43 A;  3C5F A;  7ICM A;  5J0W A;  1U47 A;  3HIL A;  1KFT A;  2M0N A;  5AIA A;  8ICA A;  2BKE A;  1PK1 B;  2HHS A;  4BWJ A;  1X9M A;  1XSL A;  4ED3 A;  4MHV A;  2MSN A;  4PZN A;  4YVZ A;  3JPN A;  1S0N A;  4ED2 A;  1O08 A;  3PO5 A;  5DB7 A;  5KFA A;  3WK5 A;  1COO A;  2JZB A;  1TAU A;  2D8C A;  4YR3 A;  1V97 A;  3QZ7 A;  2JHD A;  4JV1 A;  2A3V A;  2ES6 A;  1TK8 A;  1IM4 A;  3N7S C;  2E5S A;  5TZV A;  4IQV A;  1BNP A;  2ZTD A;  3KFU F;  1O03 A;  1QTM A;  4OD0 A;  2FMS A;  2W55 A;  3AU2 A;  3K4G A;  1CRX A;  2JEF A;  5DG8 A;  3DEE A;  4YMN A;  5ALE A;  3N28 A;  4I29 A;  4UAZ A;  1NOM A;  3C21 A;  4DF8 A;  3GQC A;  4OJO A;  3M7D A;  5J0S A;  3RFA A;  4YP3 A;  5DBC A;  4KLM A;  4RQ0 A;  2VA3 A;  3F2D A;  2KZM A;  4BWM A;  9ICX A;  4AP9 A;  4O5C A;  2OEH A;  3RJK A;  2K8A A;  2G07 A;  1NJY A;  2DPJ A;  4AYB C;  3TKA A;  2D6F C;  7ICT A;  1Q8K A;  4UAU A;  2F44 A;  3RBE A;  4RQ2 A;  2BPC A;  1KQQ A;  4ELU A;  1U48 A;  2F8K A;  4Z6F A;  4RQN A;  5KFC A;  3BQ1 A;  4C7Z A;  3SV3 A;  4BGD A;  5C0Y A;  3WU2 U;  8ICG A;  4C8O A;  5KAI U;  4F71 A;  3NGD A;  5IIO A;  5ALT A;  3HPO A;  8ICM A;  4DFP A;  4CRX A;  2WF7 A;  3ZDE A;  1Y88 A;  4F3O A;  1S0V A;  2Q0Z X;  4YXM A;  2BCV A;  2JH7 A;  3TAR A;  3BQ7 A;  5ALN A;  1URJ A;  7ICU A;  3WKB A;  3UQ0 A;  4P4M A;  4I28 A;  4ECR A;  2A1J B;  4BXO B;  5HMM A;  1PK1 A;  2QB0 B;  2XY5 A;  5L1J A;  3MAB A;  4DO9 A;  2RDJ A;  9ICN A;  1MC8 A;  1SL1 A;  1B4F A;  2AGQ A;  4Z6D A;  5KG3 A;  4B9N A;  9ICO A;  4I2A A;  4BUG A;  4DS5 A;  7ICR A;  2QB1 A;  2VA8 A;  4QZH A;  1C20 A;  5KT4 A;  1QLN A;  5ALP A;  2H3Z A;  4YR2 A;  4QIW C;  5ALO A;  8ICK A;  4YMO A;  4DSL A;  3TAD A;  5D4B A;  1JIH A;  2HI0 A;  4DEZ A;  8ICU A;  2QAR B;  3KTQ A;  3ED5 A;  3HP6 A;  4NXZ A;  3GV8 B;  2ATL A;  2JEJ A;  4RPX A;  2ZG6 A;  3EPG A;  1V85 A;  5AHX A;  2VIX A;  1PUZ A;  1XWL A;  1A76 A;  3ORY A;  2KJ9 A;  5J0T A;  2JEG A;  1NZP A;  3L4P A;  3PSF A;  8ICB A;  4CF3 A;  8ICT A;  2A1A A;  3M6Z A;  3H40 A;  4O3M A;  5AM3 A;  3HW8 A;  2PMZ C;  3Q8S B;  4KLS A;  1ZRM A;  1ZQZ A;  1M6Y A;  3BZC A;  4CDG A;  4TUQ A;  4MFF A;  2BGW A;  5AKL A;  2EAM A;  2AGO A;  1T3N A;  9ICV A;  3NUQ A;  3SV4 A;  1UCV A;  1QCK A;  1VDV A;  3V7K A;  2PI4 A;  1NK4 A;  1ZQL A;  2BQ3 A;  2BCS A;  4PHD A;  5EWG A;  5DLF A;  3WKC A;  4ELT A;  3FYH A;  2OCE A;  4C7Y A;  1NKE A;  3PVX A;  7ICO A;  4Q44 A;  2HSZ A;  1KDH A;  1MA7 A;  2B0C A;  2N1R A;  3H8W A;  4Y2R A;  5ALU A;  2YX8 A;  3PX0 A;  4RPZ A;  4KLO A;  2LM4 A;  1PVP A;  1PVR A;  3I28 A;  1N60 A;  4QZ8 A;  3GZF A;  3NTU A;  5AKX A;  2IBK A;  5KFB A;  1RYS A;  2EDU A;  2W8K A;  1X9X A;  3LVW A;  2ZIU B;  3FAH A;  4RQ7 A;  3SYZ A;  4RQ5 A;  2A1J A;  4BXO A;  2QB0 A;  5KFG A;  4YQW A;  3C2L A;  7ICS A;  9ICB A;  4QNL A;  3G6X A;  5ALJ A;  1SKR A;  3KOO A;  5J29 A;  2XC9 A;  3PR5 B;  4KTQ A;  4M47 A;  3IM1 A;  4R65 A;  5CJ7 A;  5ALI A;  4O5K A;  3MGI A;  1ZRN A;  3IP4 B;  2QAR A;  4FBT A;  7ICI A;  5J0Q A;  8ICR A;  4DL4 A;  3UMC A;  4EYI B;  4DFJ A;  2Y1I A;  1QQ6 A;  1CI4 A;  4F2S A;  3OSN A;  2KFN A;  3UM9 A;  1T94 A;  5KFQ A;  2JH1 A;  1WWU A;  1N5W A;  5DG7 A;  4QZA A;  2ZJ5 A;  2AHO B;  1T8E A;  3RB3 A;  4DSK A;  3WK6 A;  4ECT A;  1N56 A;  2GLE A;  1NK6 A;  4I2F A;  4GXK A;  5AK3 A;  3AEV A;  2L5Y A;  4GFJ A;  5L1K A;  2WB1 F;  1KRP A;  3H0R B;  1KSP A;  1UQV A;  4NLG A;  2HHV A;  2WTF A;  5H2F U;  5B5E U;  5EE1 A;  4F5R A;  4IC9 A;  4KLJ A;  4Y2T A;  3G6V A;  3EWA A;  2H3I A;  4DL2 A;  3WKE A;  3UMB A;  4GXI A;  1U49 A;  5J2D A;  2HOF A;  4IRC A;  3GFK B;  1RQN A;  2F2A B;  4OJ5 A;  2KTQ A;  5E79 U;  5AI0 A;  3FC4 A;  2J6U A;  2RDI A;  1MQ3 A;  1K1S A;  1F5S A;  2PFP A;  1T7P A;  4M6W A;  1ZQF A;  5HML A;  4JUZ A;  2DQN B;  2ZIU A;  5AKI A;  2EAO A;  1PZN A;  2V9W A;  3ZDA A;  8ICN A;  1X66 A;  3C29 A;  4R8U B;  4TQR A;  4DFK A;  4RPY A;  3BQ2 A;  1TAM A;  9ICT A;  4FBU A;  1WCL A;  1L7M A;  2BCU A;  5AM1 A;  3TAC B;  4KX3 A;  5KFV A;  4Y2Y A;  2YTU A;  1YZ7 A;  1HUO A;  3LWL A;  4YD1 A;  4XRH A;  4LVS A;  5DDM A;  3MGH A;  1NKB A;  5ALW A;  1L3V A;  3F5A A;  2ZUC A;  2YB1 A;  4RQ1 A;  4R63 A;  8ICF A;  1NI3 A;  3EUB 2;  4KIT B;  3RB0 A;  3N4M B;  5AIB A;  9ICQ A;  4JV0 A;  1Z3E B;  4ECU A;  2EAN A;  1H38 A;  7ICJ A;  2C22 A;  1D8B A;  3IV6 A;  2BHN A;  1UA0 A;  1K5O A;  5J0U A;  1IIP A;  1ZQJ A;  5AKJ A;  5DQG A;  2K4P A;  1TV9 A;  2JXJ A;  4PL1 A;  3C1Y A;  2HOQ A;  3RRH A;  2XIC A;  1DOQ A;  5CHG A;  2HHX A;  1IG6 A;  4F2R A;  2RP5 A;  4ZH4 A;  2C2R A;  4EBC A;  5DBA A;  4EEY A;  5IIJ A;  5KFJ A;  5KFP A;  3BQ0 A;  1X6J A;  3HX0 A;  5KG1 A;  3U26 A;  2HCF A;  4B6J A;  1HUZ A;  4ED7 A;  3F2B A;  4F5Q A;  2FJ6 A;  1SGG A;  4F92 B;  2V4Q A;  1ZQH A;  2KJ5 A;  1DRG A;  1Z4N A;  2H5X A;  4NL9 C;  2FI1 A;  1QQ7 A;  1SV0 A;  1V38 A;  5CA7 A;  2XGP A;  3GV7 B;  1ZJN A;  4Y2V A;  1LV5 A;  4UB3 A;  1T4G A;  2C2D A;  5DGB A;  3M9O B;  3LWM A;  3PNC A;  2FLL A;  4RUC A;  4MEX A;  2MA1 A;  4K4H A;  4DQR A;  2PFN A;  3T5K A;  2JV3 A;  5KFS A;  7ICE A;  3QEA Z;  3JPT A;  4YR0 A;  2VJ5 A;  3T5L A;  4TUP A;  4M9H A;  1NK8 A;  3E58 A;  4DL3 A;  4J9O A;  4BJQ A;  2BQR A;  4XUS A;  4EBD A;  3SR6 A;  4KLL A;  2E1E A;  1TVA A;  3RJE A;  2OXO A;  2BQU A;  4I27 A;  4ECX A;  5DB6 A;  9ICS A;  2QKQ A;  2W54 A;  2ZUB A;  2KSO B;  3T5H A;  1PK3 A;  2IOF A;  2ZIX B;  2F1I A;  2WAQ F;  9ICM A;  4DLG A;  5AI4 A;  5AKG A;  4EX6 A;  5BOL A;  2DFL A;  3MDC A;  4KLI A;  5AK6 A;  4ACO A;  3WKD A;  2JR5 A;  5CWR A;  4I2E A;  3UQ2 A;  4Y2P A;  1A77 A;  3UXP A;  2EZY A;  5CR0 A;  3RAQ A;  3PV8 A;  4US8 A;  3N97 B;  1J2M A;  4KLT A;  4DSF A;  4ECW A;  4UB1 A;  1ZQO A;  4DWI A;  1KBU A;  1K1Q A;  1LB2 B;  3SAF A;  3HKZ F;  1EXN A;  5AI6 A;  1L6N A;  5KG5 A;  3GU3 A;  2O6K A;  2C2E A;  1NK0 A;  3UPQ A;  1Q46 A;  4FS1 A;  3UXO A;  3UMG A;  4NM1 A;  1RYR A;  3N7P D;  4NLC A;  4J9S A;  2BDP A;  2ZIV B;  8ICS A;  2R8I A;  2JEI A;  1KW4 A;  3D2N A;  1OXJ A;  4EBE A;  2E8N A;  2VKQ A;  1ZQP A;  4J9Q A;  2DUY A;  4F4K A;  4DSI A;  3EPI A;  2G06 A;  3PY8 A;  1BNO A;  5III A;  5KT2 A;  3D2Q A;  3A0H U;  1BPB A;  3KZX A;  5KFM A;  1DGS A;  1WCN A;  4OJL A;  3HRD D;  3RRG A;  3ISB A;  3QUB A;  3KHL A;  8ICI A;  5KTQ A;  1SZP A;  2F3N A;  3RTV A;  1UHU A;  3ICX A;  3SAG A;  3CW2 C;  3PSI A;  3FDS A;  2BPG A;  5ALR A;  4DQS A;  1SKW A;  1L3U A;  1U45 A;  5KFT A;  3GV5 B;  2MU2 A;  4M04 A;  3MDA A;  3BQT A;  5JTI A;  3PX6 A;  2ZIX A;  3QXG A;  1MN8 A;  2HOI A;  1SV0 C;  5J0P A;  4ECY A;  4DFD A;  4GLX A;  2Y1J A;  4IQU A;  2XY7 A;  2PFO A;  4Z6E A;  5KG0 A;  4NLB A;  3B0Y A;  2LYH A;  2KP7 A;  1L8O A;  4I2J A;  4BDP A;  2K4I A;  4HYK A;  4YXJ A;  2XVT A;  5AM2 A;  1Z4O A;  2W7O A;  3QE9 Y; 
#chains in the Genus database with same CATH homology
 5KNI A;  1KW4 A;  2KE7 A;  1OXJ A;  2E8N A;  5J8Y C;  3K1R B;  2JV3 A;  1LKY B;  2QAR A;  2EAP A;  2E8O A;  3TAC B;  3BS5 B;  2FE9 A;  1COK A;  2YTU A;  2F44 A;  2LMR A;  2EAM A;  2F8K A;  1Z1V A;  4RQN A;  1B0X A;  1UCV A;  2KG5 A;  1WWU A;  4IS7 A;  1SXD A;  1LKY A;  2DKX A;  3HIL A;  3TAD C;  3BS5 A;  1PK1 B;  2QKQ A;  3KKA C;  2DL0 A;  2GLE A;  2KSO B;  4PZO A;  3IDW A;  1WWV A;  1PK3 A;  4NL9 A;  2KIV A;  2F3N A;  5JRT A;  1DXS A;  3BQ7 A;  1OW5 A;  2L5Y A;  4MHV A;  4PZN A;  3SEN A;  2Y9T A;  2EAN A;  1SV4 A;  4RQM A;  2LPE A;  1JI7 A;  3BS7 A;  1UQV A;  1X40 A;  5J8Y A;  1PK1 A;  2QB0 B;  1F0M A;  2K4P A;  2D8C A;  5F3X B;  3KKA A;  5JTI A;  2ES6 A;  2E8P A;  2KMD A;  1B4F A;  1SV0 C;  1X9X A;  2E8M A;  2K60 A;  2QB1 A;  3SEI A;  3H8M A;  2ESE A;  2D3D A;  2DKZ A;  1SXE A;  2QB0 A;  1RG6 A;  2B6G A;  3TAD A;  1SGG A;  2QAR B;  2KSO A;  5JU5 A;  5L1M A;  4NJ8 A;  4NL9 C;  1SV0 A;  1V38 A;  1V85 A;  2EAO A;  2Y9U A;  1X66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...