2QARB

Structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
93
structure length
93
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRDLEAEAAAAEAAAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 30
structure length 93
sequence length 93
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qarB00
1SXEA 1UCVA 3TADA 3H8MA 2GLEA 2E8NA 1COKA 5F3XB 3SEIA 1PK1A 2QARB 4RQMA 3BQ7A 2QB0A 3IDWA 1SV0C 2KG5A 2ES6A 2Y9UA 3TADC 3KKAA 2QB0B 2QARA 1PK1B 2ESEA 3TACB 2KE7A 1SXDA 1SGGA 1SV0A 2F3NA 2K60A 2LMRA 5L1MA 1V85A 2KMDA 2F44A 1X9XA 3KKAC 2LPEA 2B6GA 5J8YC 1UQVA 3SENA 2F8KA 5KNIA 2QB1A 2KSOB 2D3DA 1RG6A 2E8PA 2YTUA 2EAPA 3K1RB 4IS7A 4NJ8A 1SV4A 1JI7A 2QKQA 3HILA 1F0MA 1LKYA 4NL9C 1OW5A 2JV3A 1B4FA 1LKYB 1KW4A 1WWVA 1Z1VA 2Y9TA 1DXSA 3BS5A 1OXJA 4PZNA 4NL9A 2KIVA 4MHVA 5JRTA 2E8MA 1V38A 2FE9A 3BS5B 2KSOA 1X40A 1PK3A 2EAOA 5JU5A 2DL0A 2EANA 2EAMA 1B0XA 5JTIA 2L5YA 4RQNA 3BS7A 2K4PA 2DKZA 2E8OA 2D8CA 1X66A 5J8YA 2DKXA 4PZOA 1WWUA
chains in the Genus database with same CATH superfamily
4XUSA 4UB4A 3C29A 2H3FA 4I28A 4ED0A 3F5EA 3B9JA 3A0HU 2MSNA 2ZTEA 2ZIWB 3H8WA 3D2SA 2KG5A 4CRXA 1MQ2A 1RYSA 5EE9A 1RYRA 2W9CB 2VJ4A 2XY7A 2K60A 5L1MA 3RRGA 1QQ5A 4NWIA 5AIBA 4PPXA 1KFTA 4UBCA 4G9BA 4DL5A 3KFUF 1NOMA 3AN1A 4BWJA 3J81j 2WAQC 1SWVA 1UPHA 4GC6A 2FLNA 5ALOA 2K8CB 3HILA 3KHLA 4O3MA 2R8KA 4Q43A 4G3IA 2W8KA 4Q8EA 2KHVA 3KD3A 3L4PA 4F5PA 1BVSA 5J0YA 4XA5A 3RJFA 2YB4A 9ICLA 2KIVA 9ICHA 2BCSA 5KG4A 4ED7A 3G6XA 4I2JA 2J6UA 5HMMA 1XO0A 2BQ3A 4M9NA 1PK3A 1U47A 2JRZA 4PJ0U 2FMQA 3C1YA 2WFAA 4DSEA 1KRPA 3AMZA 8ICOA 2DPJA 5L1LA 2Z7JA 2QLTA 4EEKA 4YFKA 5D4BA 5C0YA 2IBKA 5ALFA 4ECVA 2DKZA 5J0RA 2OHFA 3MFIA 3CYMA 8ICBA 1QTMA 4C8KA 4YG2A 3MDCA 3JPSA 3H8MA 3H0MB 3HWTA 3E2EA 2QARB 4IR1A 3BQ7A 2XCPA 4QWCA 4TUQA 4F93B 1XC9A 1WYGA 4EEYA 9ICPA 2E1FA 2Y0SF 2KD1A 4F5OA 3G6YA 3DV9A 4F3OA 5CHGA 4O5EA 4RQ2A 3NVWA 4RNMA 8ICAA 4KLFA 3OJSA 4J9PA 3NVZA 4UASA 1TAMA 2AXTU 3RJHA 1NZPA 1RG6A 3OHAA 4KN4A 5AK4A 2HBMA 1ZQIA 3PSTA 4B9LA 5ALIA 5ALYA 1LB2B 2KNJA 1NJZA 2QKQA 2G08A 4RPYA 5L1JA 1QQ6A 2KZMA 3PW4A 2FMPA 4UARA 1JROA 2ASJA 5KAFU 2HHSA 4NL9A 1VDVA 4KLHA 4C8NA 3M9NB 3C1ZA 3LK9A 3T5KA 3F53A 7ICMA 1ZQVA 4F5NA 1YT3A 5ALEA 5ALLA 3HW8A 2MUTA 1XSNA 4IQWA 2H3QA 9ICRA 4FS1A 4Q8FA 5HNKA 2OWOA 5J0PA 4DSKA 4K4HA 1KFSA 1KFDA 5J2DA 2BDUA 2WF8A 5DG8A 8ICYA 5AI6A 2IMWP 5HR7A 3QNMA 4BXOB 3I1YA 2JH1A 4YMMA 1XU4A 4I2AA 1X6JA 3RBDA 1UA0A 5EWFA 3V7KA 2MA1A 9ICCA 4JV1A 1UT8A 4ED8A 2KJ8A 2Y9UA 2ZJ8A 4BUGA 9ICMA 4NV0A 3GIJA 4P0QA 2KJ9A 1V85A 4DFJA 2H5XA 3HX0A 4CNQA 2LBOA 5ALXA 4IRDA 1KL9A 2AGOA 4O5KA 2KEYA 4ELVA 5KG3A 2VANA 1MSWD 2WF5A 1BPZA 3N97B 5AI9A 4YR3A 1SL2A 1MN8A 2BCUA 4LZGA 2KIWA 2LKYA 3M9OB 3QEAZ 5ALQA 5KG7A 4QZGA 8ICXA 5HMLA 3JPQA 3M6ZA 2BDPA 3KHGA 4RQ5A 2I9GA 4F8RA 5D46A 2PFQA 1LKYA 3MBYA 2JV3A 2HOQA 3FM9A 1MC8A 3WK6A 2RRDA 4RPXA 5KL8B 1QH9A 4U7CA 3NS1A 2IOFA 5JUMA 7ICPA 3MR5A 3V72A 3RF9A 2IHMA 3WKDA 1NK5A 3RJEA 4KLQA 3IRUA 5JU5A 5CEHA 1JRPA 5DB9A 4MFCA 1NK6A 4ED3A 3LWLA 4CGZA 1JX4A 2GOLA 5DLGA 4I2BA 4F5RA 1S77D 3QU9A 3EPIA 5KG2A 3KHHA 1B22A 5DDYA 2VJ5A 1UHUA 3IG5A 4DFKA 3GFKB 3H4BA 2YQEA 4KLEA 3PW2A 9ICIA 1Q46A 5EE3A 2YMMA 2OYYA 4NLZA 1YZ6A 2M9NA 4M0AA 1HEKA 2HSZA 4TURA 2DWQA 2XVTA 1SGGA 2V9WA 4KX3A 3Q8MA 2LM1A 1ZQUA 2LYBA 4YP3A 1NJYA 2ZG6A 9ICWA 4KLJA 5KFKA 2FMSA 4ECQA 3V6KA 2KN7A 4M6WB 5KFIA 5AKXA 3OPXA 2DF4B 1IM4A 1O08A 4BXOA 1J97A 2DPIA 3UXNA 3M8RA 4F2SA 2EAPA 1KBUA 2FPKA 3HRDD 4EX7A 3M1YA 4YMOA 1GO3F 4QWDA 1VLBA 3T5LA 5DDMA 3BS5A 1UA1A 4IQVA 5AI0A 2XICA 4OJPA 3SD7A 2KFNA 5DGBA 3PX4A 2GH1A 3BQ0A 3TKAA 2HI0A 5KT4A 3BQ1A 5AKHA 5AM3A 5AM2A 3PSFA 2KTQA 4FZNA 3WKAA 2A1AA 1F5SA 1KSPA 1U9LA 4PHPA 3ZDAA 1ZETA 4XQ8A 3KZIU 4I2CA 2AQ0A 1Q3UA 2D8CA 4DQQA 1M6YA 4Y2YA 1SXEA 8ICKA 4X5VA 2HHVA 5G5GA 2G0AA 1WG8A 2YN4A 4B6JA 5ALGA 2W7OA 3EWAA 2KVCA 1PVRA 3RJJA 3SQIA 3RH6A 3HP6A 2KK0A 5ALNA 2QARA 1PK1B 5AI4A 3QU7A 1JXLA 1WCLA 3QE9Y 4MEYA 5DG7A 1DGSA 2PI5A 5KFFA 3V6JA 3QU4A 3RR7A 3UMBA 4C8LA 5AKLA 5TZVA 3IHQB 3M8SA 4QW8A 1Q8KA 3TFRA 4YCXA 4QZHA 4QZIA 5J8YC 4QZBA 1SZHA 4RT2A 2D3DA 1JN3A 5EWEA 5DQIA 3MR6A 4JWMA 4GXKA 1BPEA 1KN5A 4DSFA 1S8OA 3K1ZA 1CRXA 1X9WA 1XWLA 7ICJA 4RZRA 3WU2U 3AQEA 4PZNA 3Q8RB 1C20A 4KN7A 3I28A 1Y88A 2ASDA 3M9MB 2HHQA 1Z3EB 2DL0A 3JPPA 4JB3A 3OSPA 3EPGA 3QUTA 3H40A 4QZDA 1T94A 2KOBA 1T3QA 1ZQNA 4J03A 4QZ9A 4R63A 3MGVA 3C5FA 4GC7A 3D2NA 5AHXA 5KFRA 4GXJA 3GU3A 2EH9A 2PXIA 2FI1A 4I29A 2PFNA 3U26A 3LYSA 4UB6U 3TADA 2NRWA 3UXPA 3AU6A 1ZQBA 5KT3A 4B9UA 2JEIA 2W9CA 3RH4A 5L1IA 1BPBA 4RQ4A 3UQ0A 4USAA 1PK1A 2KP7A 2RHFA 2DQNB 4CF3A 2EZYA 2QB0B 8ICIA 5J0QA 1TFRA 2ZIVA 3B0YA 5AM0A 3BZCA 2ZJ5A 3GIMA 2F44A 3KKAC 3V7JA 4C80A 4YN4A 5J2AA 3SENA 4DQPA 4DQIA 3K4GA 2ZJAA 4Y2VA 5L1KA 2R8GA 4O3RA 2HHTA 4GIBA 2RDJA 4CF5A 4KLGA 2HHXA 2WAQF 1COOA 1Z00B 3BDPA 3NRZA 1AROP 3PW0A 5ALKA 4DO9A 3GIKA 3RB0A 3PX0A 1RZTA 4CCHA 4Y2QA 3GV8B 2HBJA 1A0PA 3BS5B 3VC8A 4KMOB 1RM6C 4ECXA 1X40A 1P7DA 1ZYQA 1HUOA 4M9LA 1X9SA 4DSJA 1QQ7A 1ZQPA 1L8OA 1KKXA 2VA2A 3JPRA 3F2CA 4F92B 1V9PA 3RAXA 1OUQA 3PO5A 1B0XA 2CPRA 5J2EA 4I2DA 4O5CA 3CP8A 5KAIU 2JEGA 4UB5A 4BX9C 4UBBA 3MC1A 4YR0A 3MABA 3AM9A 2AU0A 1S10A 1RQNA 3T5JA 2FLPA 4BJQA 2NO5A 2OH2A 2PFPA 2XGPA 1ZQDA 4DL6A 4NM2A 5EWGA 1COKA 2XC9A 3QX7A 4O3PA 4TQRA 1ZQEA 2BPGA 3TADC 7ICEA 3SI8A 4C4RA 3EUB2 4RQ3A 1TVAA 4B9SA 1FO4A 3SAGA 2BQUA 2JEFA 2FPMA 5CR0A 4PGXA 1X9XA 1ZQFA 5ALWA 4EELA 7ICRA 2UVRA 2E5SA 3N4MB 3KTQA 4ED2A 3O0FA 2IHNA 3WKBA 2A1JA 1S9FA 2E8PA 4UAZA 3TANA 2W3SA 4NL9C 5AKEA 1Z00A 5H2FU 4DOBA 3RRHA 2KVSA 2KICA 2NV3A 1PVPA 1ZRNA 4QZCA 3SAHA 4QZ8A 4AP9A 4MFAA 5EE1A 5ALDA 1O03A 2XO7A 1NK0A 4XRHA 4EYIB 3AUOA 4UQGA 2KSOA 2VKQA 1ZD3A 1D9FA 1S97A 8ICWA 1T8EA 1MA7A 4Y2JA 4KITB 3HJEA 5KFMA 2AGQA 3SZ2A 4UW9A 4F72A 3DDHA 1SL0A 4YD1A 1ZRMA 4ECUA 4RQ6A 2KJ5A 5J2BA 2JGAA 2V4RA 4P0PB 4K4IA 4O9MA 9ICGA 2ZIVB 2KZ3A 1K1SA 2IOFK 4QWBA 2R8HA 4QNLA 1N60A 4YVZA 1ZQTA 3QZ8A 4F4YA 4PZOA 2UVWA 2HHUA 4JUZA 1UCVA 4PGYA 4P0QB 5AKKA 3PSIA 2RLTA 4B9TA 9ICQA 3S6JA 5DQHA 2BKEA 3AQFA 5J0XA 2BCVA 1FEZA 1SKWA 3MGIA 3QU2A 3GV7B 3KKAA 9ICJA 2ZTDA 4M2YA 2M0NA 4PHAA 1QSSA 1KLNA 3H7IA 3H4DA 5ALRA 4OJOA 7ICUA 5AKZA 5KFUA 2H3IA 4IQTA 9ICVA 2H3ZA 5KFPA 4DOAA 2B6GA 4NLGA 1D8BA 4KLLA 4J9MA 2Y0SC 5KT6A 5KFLA 3MDAA 5KFEA 3OTQA 2F8KA 7ICLA 2A3VA 2BCQA 5CWRA 5KFZA 3GZFA 1N5XA 5CA7A 3EW9A 2Y1JA 2OXOA 1HUZA 1TK8A 4JV2A 3Q8LA 3K75D 4ECZA 3CRXA 2EDUA 4TQSA 1NKBA 2XI9A 4P4PA 7ICIA 1ZQZA 1UT5A 4YXMA 4UATA 5IIIA 1HJPA 4RNNA 3TQ1A 2W55A 2I5HA 2EQYA 5J0OA 5BOLA 3I76A 1ZOLA 2A19A 5J2KA 3SR6A 4RU9A 4CDGA 2HVHA 5AKGA 5ALTA 1KTQA 1Z19A 2W9BA 4NY8A 5ALPA 1A6SA 9ICTA 1XO1A 5IIKA 4Y2RA 3CNHA 3ISBA 3T79A 4F4ZA 2AGPA 2WF6A 4CE6A 1Z4OA 2PKEA 2JHDA 1IIPA 4R8UB 2B21A 4I27A 5IINA 4NLKA 1IG6A 5KL1B 4QZEA 2W54A 4CF4A 2LYAA 5AI5A 3BZKA 1KQQA 4UB1A 2EZXA 4K4GA 5HHHA 4EYHB 2G06A 4US9A 2NRVA 2E8NA 3LVVA 4I2GA 3Q8SB 4UB8U 1J2NA 1NK4A 1U48A 3OGUA 1U4BA 7ICKA 5F9NA 3LVWA 4C7YA 5AICA 3QUQA 4OO1J 1L5UA 4QIWC 4B9NA 9ICKA 5TISU 3ZD8A 2ZIXB 3RB6A 4F50A 1ZQLA 8ICQA 5FP0A 2WB1C 4M9GA 7ICOA 1JALA 3IG8A 1Z1BA 4I2FA 7ICHA 2YX8A 3PMNA 2KSOB 4NLCA 7ICNA 3V7LA 1ZQMA 5KFJA 1D9DA 2AQ4A 2O6KA 1SWWA 3B0XA 3TAPA 4EZ6A 1HIWA 1OW5A 1SIJA 1DXSA 2BGWA 4P4MA 4KLMA 3D2QA 5J0WA 3H0RB 3UM9A 3F2DA 2EZZA 4EZ9A 4B9VA 2ZUDA 3FDSA 2EAOA 2FJ6A 5KFQA 4DLEA 4DFDA 3RJIA 3RTVA 2WHEA 3PZPA 4YD2A 5AKJA 4JV0A 4I2EA 3OHBA 1D8YA 4FO6A 4AYBF 4IRKA 4QW9A 3CW2C 1IXRA 1X42A 2Q0ZX 5DB6A 5KG6A 3THVA 4TUSA 4O3SA 4US8A 2P6UA 4YQWA 3PW5A 1L7NA 4FBTA 1WWUA 2XIDA 1TKDA 2K4IA 2NRTA 1PUZA 5KFYA 1DRGA 3RB4A 2KV2A 4UAUA 5AI8A 2GLEA 4DSLA 3SEIA 2BQRA 4Z6DA 4ED6A 2OEHA 2R8IA 5DG9A 9ICOA 3ZDBA 3PVXA 5L9XA 4Y2UA 1SV0A 1JIHA 4P0PA 5B66U 9ICFA 3JPNA 4KLSA 1ZQCA 4C4TA 4Y2TA 1BNPA 4PL1A 2R18A 4DL2A 2ATLA 2LM4A 4TUPA 5IILA 2K8AA 2DBYA 1ZQXA 1A76A 2W9MA 8ICTA 2F1JA 3M6KA 3KOOA 3C28A 1NJXA 4NJ8A 1RQLA 5IIMA 2AH5A 8ICSA 5CB1A 3MFHA 1BPDA 4FZMA 4ECYA 1LKYB 2W03A 1ZJMA 5AM4A 4RUCA 4NXZA 4DQRA 4DSIA 3UXOA 1TV9A 3Q8KA 2YMLA 2FE9A 2KHQA 2K89A 4BGDA 5AKYA 4PHEA 9ICNA 1U49A 1ZQHA 2GWSA 1X6IA 9ICBA 2RP5A 1D8LA 1S0OA 1ZQ1C 1ZQSA 3QUCA 4MF8A 4DCCA 5D49A 1ZQRA 2D6FC 1ZQJA 7ICVA 3BQ2A 2ISOA 2F2AB 1XNSA 5HP4A 4QZAA 5KT2A 1NK8A 4B9MA 1K5OA 2VA3A 3EZ5A 1SKSA 3WK5A 5J8YA 5DBBA 3T5HA 1TE2A 1CEZA 3KHRA 3AL0B 4UB3A 1C7YA 4RQ0A 2E3TA 2CXYA 3M7DA 8ICJA 1NKCA 4DOCA 4DFMA 3JPTA 4ED1A 3GDXA 1JMSA 4P4OA 4DL3A 4ELUA 2HBKA 1S76D 1Q3VA 5ALHA 3MR2A 4NLNA 3OJUA 3EYZA 2KMDA 4I2HA 2GO7A 2XCAA 5HHIA 3T3FA 5DB7A 3WK9A 4Y2XA 8ICGA 2PI4A 9ICSA 2LYHA 4O3QA 2HW3A 2P66A 4DEZA 5AK5A 4ACOA 3WK8A 1JXEA 1N5WA 3C5GA 4J9SA 2C2RA 8ICVA 2K4HA 2YY6A 2JH7A 4OJ5A 3RH5A 2I1QA 2WF9A 3RJGA 4Q45A 1TAUA 1RYUA 4MEXA 1NI3A 2FDRA 3N28A 2AJQA 3KZXA 1EXNA 4O0IA 2KFZA 1S0VA 8ICFA 2LHTA 4BWMA 8ICCA 8ICHA 4U6PA 3MR3A 3GV5B 2WTFA 5E79U 3NVVA 4UAVA 5ALUA 3NTUA 5T14A 2W43A 1LVHA 2XY5A 7ICQA 2E8OA 3WK7A 3V6HA 3ORYA 2W11A 1L7PA 5AM5A 1TAQA 2DKXA 3GIIA 1NKEA 5K4LA 3TARA 5ALSA 2G5IB 4NLBA 3PSPA 1ZQGA 4RQ1A 3UMGA 3QU5A 2W04A 2FLLA 2Q4TA 4DS5A 2B0CA 3SV3A 2FPLA 5J2FA 3RR8A 2F1IA 3RFAA 5GTHU 8ICMA 1DGJA 3HKZC 4R8UA 4RQ8A 3PO4A 2IOHA 4GLXA 4P2HA 2ZXHA 1NZBA 4Z6FA 3OSNA 4AYBC 1V97A 3PNCA 2W9BB 4M04A 1J2MA 2LI6A 5DB8A 1URJA 3A0BU 2ODGA 4IL6U 4JMUA 4R64A 1QLNA 1ZD4A 2KKPA 4IRCA 5KFNA 2C22A 4PGQA 2ISPA 4F5QA 4O3OA 4M47A 4OCZA 1WWVA 3E0FA 4ICAA 3PX6A 4DL7A 4DF8A 5KFCA 2MRLA 5GTIU 2F76X 5CJ7A 1NJWA 3KBBA 5DKWA 1KDHA 1BGXT 4A8EA 5KFOA 1XSPA 3QXGA 4KLDA 5G5HA 5EE0A 4ZH4A 3ISDA 3AEVA 3FYHA 5ALVA 4OD0A 1JUDA 5JTIA 9ICEA 2KZZA 2R8JA 1DK2A 1ZQYA 2MAXA 3TFSA 2C28A 4KMUA 3F2BA 4O3NA 5J29A 3H8JA 4J9QA 2CN1A 3AU2A 2VIXA 1TK0A 1QSYA 4FZLA 2H3VA 4ECRA 3ONNA 1ZQWA 4C8OA 3IDWA 4J9OA 5KT7A 5J0UA 2DGZA 5DQGA 5J2HA 2ES6A 3GQCA 2PFOA 5KG5A 3SMVA 3TACB 1SKRA 4UAYA 4J9RA 4C4SA 5DBAA 3TI0A 2XY6A 3ZDCA 1CUKA 2RDIA 1N63A 1ZXIA 1K1QA 5AK3A 4RT3A 4WJ3B 1T7PA 1NK7A 4C0ZA 3UMCA 3HKZF 2HOFA 4EBDA 2Y1IA 5KNIA 4KLOA 7ICGA 1N61A 4KLIA 4ECWA 2YTUA 2K4EA 2K8BB 1L6NA 3FAHA 5KFTA 3Q8PB 1WUDA 2W3RA 2AHOB 1SV4A 2G07A 1JI7A 1ZQOA 2V4QA 4Y2SA 5KT5A 1ED1A 3RB3A 1Z1VA 3RJKA 1YZ7A 4FFDA 4Y2PA 4E0DA 4QZFA 1V38A 3PR5B 3ISCA 4EBCA 2JR5A 2W7PA 2HVIA 4EBEA 3QYPA 3N7SC 5BOMA 1ZJNA 4M6WA 2EAMA 1BPXA 1ZD5A 1X2IA 2PMZF 3C2MA 5AKIA 2NRZA 3C23A 1RPLA 2NYVA 3NRWA 5J2JA 3DEEA 2K4PA 1AQ6A 4F91B 5CRXA 3NVYA 5KFVA 5AM1A 2F77X 1RXWA 2P6RA 3ZI4A 3ETRA 1N56A 1VJ5A 2ZIXA 2VA8A 3G6VA 4GXIA 3ETLA 3NUQA 1N48A 1X9MA 1S0MA 2J6TA 1SL1A 3N7RC 3Q8QB 2C2EA 2QB0A 5KFAA 2YB1A 1SV0C 4C7ZA 1RXVA 5KFGA 2G5HB 2DFLA 4YMNA 2ZXIA 2ESEA 2YMPA 2KE7A 1SXDA 3RBEA 2HHWA 1A77A 4Z6CA 1L3TA 3TAQA 4PL2A 1QCKA 1S0NA 1L3UA 5CP2A 4IR9A 1DK3A 3PR4A 8ICEA 2ZUBA 1UQVA 2N1RA 3WK4A 1RDFA 3IM1A 4ECSA 2JZBA 3H8SA 1WCNA 4HAIA 3L3FX 2WB1F 1XSLA 2ZUCA 4UAWA 2OM6A 1N62A 5KG1A 3E58A 8ICNA 1KW4A 5KFSA 3PMLA 5DBCA 1FFVA 1OXJA 3IV6A 5J2GA 3BJYA 4MHVA 5B5EU 5JRTA 4J9NA 4Q44A 5IIOA 3SYZA 1Z4NA 1LV5A 4HYKA 2W9AA 1T3NA 1S5LU 4IQUA 2XGQA 1U45A 1PZNA 5A0LA 1L3VA 2HCFA 2ZIUB 4DS4A 5KFWA 5J0SA 1H38A 5KG0A 7ICFA 3NGDA 5J0TA 4YXJA 5J2CA 5EOZA 1QSLA 1FFUA 1ZQQA 3ZDEA 3C2KA 3ALRA 3SV4A 3L5KA 7ICSA 4RQMA 8ICPA 4F4WA 4F4XA 2F3NA 9ICUA 1KEJA 2LMRA 4F71A 4QJFB 3F5AA 4UB2A 2ZIUA 2BHNA 4R66A 3BQTA 4IC9A 2LPEA 5KFHA 1ZD2P 2MUTB 4DQSA 4QIWF 1XS9D 3H0LB 3FC4A 9ICAA 3WKCA 4J9KA 4RQ7A 2ALZA 4QWEA 1F44A 2W8LA 5ALJA 2G09A 2BZFA 8ICRA 4PH5A 4PHDA 2BPFA 1F0MA 2DUYA 1FIQA 3MGHA 5DLFA 1NNLA 2Y9TA 1B43A 2HDOA 4KTQA 2HMXA 8ICLA 2WF7A 4F4KA 2KKVA 2JZBB 4LVSA 5KTQA 3UPQA 4FBUA 1L3SA 2HBLA 4C8MA 3WKEA 2BPCA 1T4GA 4DWIA 1SB3C 1CI4A 2EANA 2C2DA 4RNOA 4M9JA 1DOQA 1TK5A 2F8LA 3R9KA 1MQ3A 2A1JB 4KLTA 4RUAA 3PW7A 3BS7A 3QZ7A 2BR0A 3SAFA 1X66A 3ED5A 2YMQA 2NRXA 3IP4B 2HOIA 9ICXA 4KLUA 1ZQAA 2JXJA 5DGAA 2ZTCA 2RQ5A 3QUBA 5F3XB 2NO4A 4ZOHC 5C5JA 4DLGA 4YR2A 1L8LA 1NK9A 2JEJA 4Z6EA 4LZDA 2MU2A 4MF2A 2IA6A 2JMGA 2CRXA 4DL4A 2BCRA 5ALMA 1BNOA 2PMZC 3C2LA 5KFXA 4QWAA 4J9LA 2ASLA 3LWMA 4DF4A 2UVVA 4OJLA 8ICZA 5AIAA 3ZD9A 3QEBZ 2QB1A 1L7MA 5J2IA 3ICXA 3ZDDA 4R65A 5KFBA 4F2RA 4EENA 2OCEA 3K1RB 4IS7A 5AK6A 1L7OA 3JPOA 4GFJA 2J6SA 2P35A 4ECTA 2E1EA 4ELTA 1N2XA 4FE3A 3UQ2A 1B4FA 1PVQA 1BPYA 3PY8A 5F9LA 2UVUA 5KFDA 2I6XA 3IN5A 3HT3A 4OJ6A 7ICTA 2E8MA 4JWNA 3HPOA 4FS2A 5BPCA 4NM1A 4BDPA 3VCBA 3LDAA 3PV8A 1IV8A 4EX6A 4I2IA 4KX5A 1ZQKA 5ALZA 5HR6A 2F1HA 4M9HA 4DFPA 3GILA 4LJXA 4RPZA 8ICUA 1SZPA 3C21A 4JK1A 5IIJA 2L5YA 4RQNA 3NASA 3RAQA 1ECWA 3N7PD 3D6JA 2ZIWA 4MFFA
chains in the Genus database with same CATH topology
1SXEA 1UCVA 3TADA 3H8MA 2GLEA 2E8NA 1COKA 5F3XB 3SEIA 1PK1A 2QARB 4RQMA 3BQ7A 2QB0A 3IDWA 1SV0C 2KG5A 2ES6A 2Y9UA 3TADC 3KKAA 2QB0B 2QARA 1PK1B 2ESEA 3TACB 2KE7A 1SXDA 1SGGA 1SV0A 2F3NA 2K60A 2LMRA 5L1MA 1V85A 2KMDA 2F44A 1X9XA 3KKAC 2LPEA 2B6GA 5J8YC 1UQVA 3SENA 2F8KA 5KNIA 2QB1A 2KSOB 2D3DA 1RG6A 2E8PA 2YTUA 2EAPA 3K1RB 4IS7A 4NJ8A 1SV4A 1JI7A 2QKQA 3HILA 1F0MA 1LKYA 4NL9C 1OW5A 2JV3A 1B4FA 1LKYB 1KW4A 1WWVA 1Z1VA 2Y9TA 1DXSA 3BS5A 1OXJA 4PZNA 4NL9A 2KIVA 4MHVA 5JRTA 2E8MA 1V38A 2FE9A 3BS5B 2KSOA 1X40A 1PK3A 2EAOA 5JU5A 2DL0A 2EANA 2EAMA 1B0XA 5JTIA 2L5YA 4RQNA 3BS7A 2K4PA 2DKZA 2E8OA 2D8CA 1X66A 5J8YA 2DKXA 4PZOA 1WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXE A;  1UCV A;  3TAD A;  3H8M A;  2GLE A;  2E8N A;  1COK A;  5F3X B;  3SEI A;  1PK1 A;  2QAR B;  4RQM A;  3BQ7 A;  2QB0 A;  3IDW A;  1SV0 C;  2KG5 A;  2ES6 A;  2Y9U A;  3TAD C;  3KKA A;  2QB0 B;  2QAR A;  1PK1 B;  2ESE A;  3TAC B;  2KE7 A;  1SXD A;  1SGG A;  1SV0 A;  2F3N A;  2K60 A;  2LMR A;  5L1M A;  1V85 A;  2KMD A;  2F44 A;  1X9X A;  3KKA C;  2LPE A;  2B6G A;  5J8Y C;  1UQV A;  3SEN A;  2F8K A;  5KNI A;  2QB1 A;  2KSO B;  2D3D A;  1RG6 A;  2E8P A;  2YTU A;  2EAP A;  3K1R B;  4IS7 A;  4NJ8 A;  1SV4 A;  1JI7 A;  2QKQ A;  3HIL A;  1F0M A;  1LKY A;  4NL9 C;  1OW5 A;  2JV3 A;  1B4F A;  1LKY B;  1KW4 A;  1WWV A;  1Z1V A;  2Y9T A;  1DXS A;  3BS5 A;  1OXJ A;  4PZN A;  4NL9 A;  2KIV A;  4MHV A;  5JRT A;  2E8M A;  1V38 A;  2FE9 A;  3BS5 B;  2KSO A;  1X40 A;  1PK3 A;  2EAO A;  5JU5 A;  2DL0 A;  2EAN A;  2EAM A;  1B0X A;  5JTI A;  2L5Y A;  4RQN A;  3BS7 A;  2K4P A;  2DKZ A;  2E8O A;  2D8C A;  1X66 A;  5J8Y A;  2DKX A;  4PZO A;  1WWU A; 
#chains in the Genus database with same CATH topology
 4XUS A;  4UB4 A;  3C29 A;  2H3F A;  4I28 A;  4ED0 A;  3F5E A;  3B9J A;  3A0H U;  2MSN A;  2ZTE A;  2ZIW B;  3H8W A;  3D2S A;  2KG5 A;  4CRX A;  1MQ2 A;  1RYS A;  5EE9 A;  1RYR A;  2W9C B;  2VJ4 A;  2XY7 A;  2K60 A;  5L1M A;  3RRG A;  1QQ5 A;  4NWI A;  5AIB A;  4PPX A;  1KFT A;  4UBC A;  4G9B A;  4DL5 A;  3KFU F;  1NOM A;  3AN1 A;  4BWJ A;  3J81 j;  2WAQ C;  1SWV A;  1UPH A;  4GC6 A;  2FLN A;  5ALO A;  2K8C B;  3HIL A;  3KHL A;  4O3M A;  2R8K A;  4Q43 A;  4G3I A;  2W8K A;  4Q8E A;  2KHV A;  3KD3 A;  3L4P A;  4F5P A;  1BVS A;  5J0Y A;  4XA5 A;  3RJF A;  2YB4 A;  9ICL A;  2KIV A;  9ICH A;  2BCS A;  5KG4 A;  4ED7 A;  3G6X A;  4I2J A;  2J6U A;  5HMM A;  1XO0 A;  2BQ3 A;  4M9N A;  1PK3 A;  1U47 A;  2JRZ A;  4PJ0 U;  2FMQ A;  3C1Y A;  2WFA A;  4DSE A;  1KRP A;  3AMZ A;  8ICO A;  2DPJ A;  5L1L A;  2Z7J A;  2QLT A;  4EEK A;  4YFK A;  5D4B A;  5C0Y A;  2IBK A;  5ALF A;  4ECV A;  2DKZ A;  5J0R A;  2OHF A;  3MFI A;  3CYM A;  8ICB A;  1QTM A;  4C8K A;  4YG2 A;  3MDC A;  3JPS A;  3H8M A;  3H0M B;  3HWT A;  3E2E A;  2QAR B;  4IR1 A;  3BQ7 A;  2XCP A;  4QWC A;  4TUQ A;  4F93 B;  1XC9 A;  1WYG A;  4EEY A;  9ICP A;  2E1F A;  2Y0S F;  2KD1 A;  4F5O A;  3G6Y A;  3DV9 A;  4F3O A;  5CHG A;  4O5E A;  4RQ2 A;  3NVW A;  4RNM A;  8ICA A;  4KLF A;  3OJS A;  4J9P A;  3NVZ A;  4UAS A;  1TAM A;  2AXT U;  3RJH A;  1NZP A;  1RG6 A;  3OHA A;  4KN4 A;  5AK4 A;  2HBM A;  1ZQI A;  3PST A;  4B9L A;  5ALI A;  5ALY A;  1LB2 B;  2KNJ A;  1NJZ A;  2QKQ A;  2G08 A;  4RPY A;  5L1J A;  1QQ6 A;  2KZM A;  3PW4 A;  2FMP A;  4UAR A;  1JRO A;  2ASJ A;  5KAF U;  2HHS A;  4NL9 A;  1VDV A;  4KLH A;  4C8N A;  3M9N B;  3C1Z A;  3LK9 A;  3T5K A;  3F53 A;  7ICM A;  1ZQV A;  4F5N A;  1YT3 A;  5ALE A;  5ALL A;  3HW8 A;  2MUT A;  1XSN A;  4IQW A;  2H3Q A;  9ICR A;  4FS1 A;  4Q8F A;  5HNK A;  2OWO A;  5J0P A;  4DSK A;  4K4H A;  1KFS A;  1KFD A;  5J2D A;  2BDU A;  2WF8 A;  5DG8 A;  8ICY A;  5AI6 A;  2IMW P;  5HR7 A;  3QNM A;  4BXO B;  3I1Y A;  2JH1 A;  4YMM A;  1XU4 A;  4I2A A;  1X6J A;  3RBD A;  1UA0 A;  5EWF A;  3V7K A;  2MA1 A;  9ICC A;  4JV1 A;  1UT8 A;  4ED8 A;  2KJ8 A;  2Y9U A;  2ZJ8 A;  4BUG A;  9ICM A;  4NV0 A;  3GIJ A;  4P0Q A;  2KJ9 A;  1V85 A;  4DFJ A;  2H5X A;  3HX0 A;  4CNQ A;  2LBO A;  5ALX A;  4IRD A;  1KL9 A;  2AGO A;  4O5K A;  2KEY A;  4ELV A;  5KG3 A;  2VAN A;  1MSW D;  2WF5 A;  1BPZ A;  3N97 B;  5AI9 A;  4YR3 A;  1SL2 A;  1MN8 A;  2BCU A;  4LZG A;  2KIW A;  2LKY A;  3M9O B;  3QEA Z;  5ALQ A;  5KG7 A;  4QZG A;  8ICX A;  5HML A;  3JPQ A;  3M6Z A;  2BDP A;  3KHG A;  4RQ5 A;  2I9G A;  4F8R A;  5D46 A;  2PFQ A;  1LKY A;  3MBY A;  2JV3 A;  2HOQ A;  3FM9 A;  1MC8 A;  3WK6 A;  2RRD A;  4RPX A;  5KL8 B;  1QH9 A;  4U7C A;  3NS1 A;  2IOF A;  5JUM A;  7ICP A;  3MR5 A;  3V72 A;  3RF9 A;  2IHM A;  3WKD A;  1NK5 A;  3RJE A;  4KLQ A;  3IRU A;  5JU5 A;  5CEH A;  1JRP A;  5DB9 A;  4MFC A;  1NK6 A;  4ED3 A;  3LWL A;  4CGZ A;  1JX4 A;  2GOL A;  5DLG A;  4I2B A;  4F5R A;  1S77 D;  3QU9 A;  3EPI A;  5KG2 A;  3KHH A;  1B22 A;  5DDY A;  2VJ5 A;  1UHU A;  3IG5 A;  4DFK A;  3GFK B;  3H4B A;  2YQE A;  4KLE A;  3PW2 A;  9ICI A;  1Q46 A;  5EE3 A;  2YMM A;  2OYY A;  4NLZ A;  1YZ6 A;  2M9N A;  4M0A A;  1HEK A;  2HSZ A;  4TUR A;  2DWQ A;  2XVT A;  1SGG A;  2V9W A;  4KX3 A;  3Q8M A;  2LM1 A;  1ZQU A;  2LYB A;  4YP3 A;  1NJY A;  2ZG6 A;  9ICW A;  4KLJ A;  5KFK A;  2FMS A;  4ECQ A;  3V6K A;  2KN7 A;  4M6W B;  5KFI A;  5AKX A;  3OPX A;  2DF4 B;  1IM4 A;  1O08 A;  4BXO A;  1J97 A;  2DPI A;  3UXN A;  3M8R A;  4F2S A;  2EAP A;  1KBU A;  2FPK A;  3HRD D;  4EX7 A;  3M1Y A;  4YMO A;  1GO3 F;  4QWD A;  1VLB A;  3T5L A;  5DDM A;  3BS5 A;  1UA1 A;  4IQV A;  5AI0 A;  2XIC A;  4OJP A;  3SD7 A;  2KFN A;  5DGB A;  3PX4 A;  2GH1 A;  3BQ0 A;  3TKA A;  2HI0 A;  5KT4 A;  3BQ1 A;  5AKH A;  5AM3 A;  5AM2 A;  3PSF A;  2KTQ A;  4FZN A;  3WKA A;  2A1A A;  1F5S A;  1KSP A;  1U9L A;  4PHP A;  3ZDA A;  1ZET A;  4XQ8 A;  3KZI U;  4I2C A;  2AQ0 A;  1Q3U A;  2D8C A;  4DQQ A;  1M6Y A;  4Y2Y A;  1SXE A;  8ICK A;  4X5V A;  2HHV A;  5G5G A;  2G0A A;  1WG8 A;  2YN4 A;  4B6J A;  5ALG A;  2W7O A;  3EWA A;  2KVC A;  1PVR A;  3RJJ A;  3SQI A;  3RH6 A;  3HP6 A;  2KK0 A;  5ALN A;  2QAR A;  1PK1 B;  5AI4 A;  3QU7 A;  1JXL A;  1WCL A;  3QE9 Y;  4MEY A;  5DG7 A;  1DGS A;  2PI5 A;  5KFF A;  3V6J A;  3QU4 A;  3RR7 A;  3UMB A;  4C8L A;  5AKL A;  5TZV A;  3IHQ B;  3M8S A;  4QW8 A;  1Q8K A;  3TFR A;  4YCX A;  4QZH A;  4QZI A;  5J8Y C;  4QZB A;  1SZH A;  4RT2 A;  2D3D A;  1JN3 A;  5EWE A;  5DQI A;  3MR6 A;  4JWM A;  4GXK A;  1BPE A;  1KN5 A;  4DSF A;  1S8O A;  3K1Z A;  1CRX A;  1X9W A;  1XWL A;  7ICJ A;  4RZR A;  3WU2 U;  3AQE A;  4PZN A;  3Q8R B;  1C20 A;  4KN7 A;  3I28 A;  1Y88 A;  2ASD A;  3M9M B;  2HHQ A;  1Z3E B;  2DL0 A;  3JPP A;  4JB3 A;  3OSP A;  3EPG A;  3QUT A;  3H40 A;  4QZD A;  1T94 A;  2KOB A;  1T3Q A;  1ZQN A;  4J03 A;  4QZ9 A;  4R63 A;  3MGV A;  3C5F A;  4GC7 A;  3D2N A;  5AHX A;  5KFR A;  4GXJ A;  3GU3 A;  2EH9 A;  2PXI A;  2FI1 A;  4I29 A;  2PFN A;  3U26 A;  3LYS A;  4UB6 U;  3TAD A;  2NRW A;  3UXP A;  3AU6 A;  1ZQB A;  5KT3 A;  4B9U A;  2JEI A;  2W9C A;  3RH4 A;  5L1I A;  1BPB A;  4RQ4 A;  3UQ0 A;  4USA A;  1PK1 A;  2KP7 A;  2RHF A;  2DQN B;  4CF3 A;  2EZY A;  2QB0 B;  8ICI A;  5J0Q A;  1TFR A;  2ZIV A;  3B0Y A;  5AM0 A;  3BZC A;  2ZJ5 A;  3GIM A;  2F44 A;  3KKA C;  3V7J A;  4C80 A;  4YN4 A;  5J2A A;  3SEN A;  4DQP A;  4DQI A;  3K4G A;  2ZJA A;  4Y2V A;  5L1K A;  2R8G A;  4O3R A;  2HHT A;  4GIB A;  2RDJ A;  4CF5 A;  4KLG A;  2HHX A;  2WAQ F;  1COO A;  1Z00 B;  3BDP A;  3NRZ A;  1ARO P;  3PW0 A;  5ALK A;  4DO9 A;  3GIK A;  3RB0 A;  3PX0 A;  1RZT A;  4CCH A;  4Y2Q A;  3GV8 B;  2HBJ A;  1A0P A;  3BS5 B;  3VC8 A;  4KMO B;  1RM6 C;  4ECX A;  1X40 A;  1P7D A;  1ZYQ A;  1HUO A;  4M9L A;  1X9S A;  4DSJ A;  1QQ7 A;  1ZQP A;  1L8O A;  1KKX A;  2VA2 A;  3JPR A;  3F2C A;  4F92 B;  1V9P A;  3RAX A;  1OUQ A;  3PO5 A;  1B0X A;  2CPR A;  5J2E A;  4I2D A;  4O5C A;  3CP8 A;  5KAI U;  2JEG A;  4UB5 A;  4BX9 C;  4UBB A;  3MC1 A;  4YR0 A;  3MAB A;  3AM9 A;  2AU0 A;  1S10 A;  1RQN A;  3T5J A;  2FLP A;  4BJQ A;  2NO5 A;  2OH2 A;  2PFP A;  2XGP A;  1ZQD A;  4DL6 A;  4NM2 A;  5EWG A;  1COK A;  2XC9 A;  3QX7 A;  4O3P A;  4TQR A;  1ZQE A;  2BPG A;  3TAD C;  7ICE A;  3SI8 A;  4C4R A;  3EUB 2;  4RQ3 A;  1TVA A;  4B9S A;  1FO4 A;  3SAG A;  2BQU A;  2JEF A;  2FPM A;  5CR0 A;  4PGX A;  1X9X A;  1ZQF A;  5ALW A;  4EEL A;  7ICR A;  2UVR A;  2E5S A;  3N4M B;  3KTQ A;  4ED2 A;  3O0F A;  2IHN A;  3WKB A;  2A1J A;  1S9F A;  2E8P A;  4UAZ A;  3TAN A;  2W3S A;  4NL9 C;  5AKE A;  1Z00 A;  5H2F U;  4DOB A;  3RRH A;  2KVS A;  2KIC A;  2NV3 A;  1PVP A;  1ZRN A;  4QZC A;  3SAH A;  4QZ8 A;  4AP9 A;  4MFA A;  5EE1 A;  5ALD A;  1O03 A;  2XO7 A;  1NK0 A;  4XRH A;  4EYI B;  3AUO A;  4UQG A;  2KSO A;  2VKQ A;  1ZD3 A;  1D9F A;  1S97 A;  8ICW A;  1T8E A;  1MA7 A;  4Y2J A;  4KIT B;  3HJE A;  5KFM A;  2AGQ A;  3SZ2 A;  4UW9 A;  4F72 A;  3DDH A;  1SL0 A;  4YD1 A;  1ZRM A;  4ECU A;  4RQ6 A;  2KJ5 A;  5J2B A;  2JGA A;  2V4R A;  4P0P B;  4K4I A;  4O9M A;  9ICG A;  2ZIV B;  2KZ3 A;  1K1S A;  2IOF K;  4QWB A;  2R8H A;  4QNL A;  1N60 A;  4YVZ A;  1ZQT A;  3QZ8 A;  4F4Y A;  4PZO A;  2UVW A;  2HHU A;  4JUZ A;  1UCV A;  4PGY A;  4P0Q B;  5AKK A;  3PSI A;  2RLT A;  4B9T A;  9ICQ A;  3S6J A;  5DQH A;  2BKE A;  3AQF A;  5J0X A;  2BCV A;  1FEZ A;  1SKW A;  3MGI A;  3QU2 A;  3GV7 B;  3KKA A;  9ICJ A;  2ZTD A;  4M2Y A;  2M0N A;  4PHA A;  1QSS A;  1KLN A;  3H7I A;  3H4D A;  5ALR A;  4OJO A;  7ICU A;  5AKZ A;  5KFU A;  2H3I A;  4IQT A;  9ICV A;  2H3Z A;  5KFP A;  4DOA A;  2B6G A;  4NLG A;  1D8B A;  4KLL A;  4J9M A;  2Y0S C;  5KT6 A;  5KFL A;  3MDA A;  5KFE A;  3OTQ A;  2F8K A;  7ICL A;  2A3V A;  2BCQ A;  5CWR A;  5KFZ A;  3GZF A;  1N5X A;  5CA7 A;  3EW9 A;  2Y1J A;  2OXO A;  1HUZ A;  1TK8 A;  4JV2 A;  3Q8L A;  3K75 D;  4ECZ A;  3CRX A;  2EDU A;  4TQS A;  1NKB A;  2XI9 A;  4P4P A;  7ICI A;  1ZQZ A;  1UT5 A;  4YXM A;  4UAT A;  5III A;  1HJP A;  4RNN A;  3TQ1 A;  2W55 A;  2I5H A;  2EQY A;  5J0O A;  5BOL A;  3I76 A;  1ZOL A;  2A19 A;  5J2K A;  3SR6 A;  4RU9 A;  4CDG A;  2HVH A;  5AKG A;  5ALT A;  1KTQ A;  1Z19 A;  2W9B A;  4NY8 A;  5ALP A;  1A6S A;  9ICT A;  1XO1 A;  5IIK A;  4Y2R A;  3CNH A;  3ISB A;  3T79 A;  4F4Z A;  2AGP A;  2WF6 A;  4CE6 A;  1Z4O A;  2PKE A;  2JHD A;  1IIP A;  4R8U B;  2B21 A;  4I27 A;  5IIN A;  4NLK A;  1IG6 A;  5KL1 B;  4QZE A;  2W54 A;  4CF4 A;  2LYA A;  5AI5 A;  3BZK A;  1KQQ A;  4UB1 A;  2EZX A;  4K4G A;  5HHH A;  4EYH B;  2G06 A;  4US9 A;  2NRV A;  2E8N A;  3LVV A;  4I2G A;  3Q8S B;  4UB8 U;  1J2N A;  1NK4 A;  1U48 A;  3OGU A;  1U4B A;  7ICK A;  5F9N A;  3LVW A;  4C7Y A;  5AIC A;  3QUQ A;  4OO1 J;  1L5U A;  4QIW C;  4B9N A;  9ICK A;  5TIS U;  3ZD8 A;  2ZIX B;  3RB6 A;  4F50 A;  1ZQL A;  8ICQ A;  5FP0 A;  2WB1 C;  4M9G A;  7ICO A;  1JAL A;  3IG8 A;  1Z1B A;  4I2F A;  7ICH A;  2YX8 A;  3PMN A;  2KSO B;  4NLC A;  7ICN A;  3V7L A;  1ZQM A;  5KFJ A;  1D9D A;  2AQ4 A;  2O6K A;  1SWW A;  3B0X A;  3TAP A;  4EZ6 A;  1HIW A;  1OW5 A;  1SIJ A;  1DXS A;  2BGW A;  4P4M A;  4KLM A;  3D2Q A;  5J0W A;  3H0R B;  3UM9 A;  3F2D A;  2EZZ A;  4EZ9 A;  4B9V A;  2ZUD A;  3FDS A;  2EAO A;  2FJ6 A;  5KFQ A;  4DLE A;  4DFD A;  3RJI A;  3RTV A;  2WHE A;  3PZP A;  4YD2 A;  5AKJ A;  4JV0 A;  4I2E A;  3OHB A;  1D8Y A;  4FO6 A;  4AYB F;  4IRK A;  4QW9 A;  3CW2 C;  1IXR A;  1X42 A;  2Q0Z X;  5DB6 A;  5KG6 A;  3THV A;  4TUS A;  4O3S A;  4US8 A;  2P6U A;  4YQW A;  3PW5 A;  1L7N A;  4FBT A;  1WWU A;  2XID A;  1TKD A;  2K4I A;  2NRT A;  1PUZ A;  5KFY A;  1DRG A;  3RB4 A;  2KV2 A;  4UAU A;  5AI8 A;  2GLE A;  4DSL A;  3SEI A;  2BQR A;  4Z6D A;  4ED6 A;  2OEH A;  2R8I A;  5DG9 A;  9ICO A;  3ZDB A;  3PVX A;  5L9X A;  4Y2U A;  1SV0 A;  1JIH A;  4P0P A;  5B66 U;  9ICF A;  3JPN A;  4KLS A;  1ZQC A;  4C4T A;  4Y2T A;  1BNP A;  4PL1 A;  2R18 A;  4DL2 A;  2ATL A;  2LM4 A;  4TUP A;  5IIL A;  2K8A A;  2DBY A;  1ZQX A;  1A76 A;  2W9M A;  8ICT A;  2F1J A;  3M6K A;  3KOO A;  3C28 A;  1NJX A;  4NJ8 A;  1RQL A;  5IIM A;  2AH5 A;  8ICS A;  5CB1 A;  3MFH A;  1BPD A;  4FZM A;  4ECY A;  1LKY B;  2W03 A;  1ZJM A;  5AM4 A;  4RUC A;  4NXZ A;  4DQR A;  4DSI A;  3UXO A;  1TV9 A;  3Q8K A;  2YML A;  2FE9 A;  2KHQ A;  2K89 A;  4BGD A;  5AKY A;  4PHE A;  9ICN A;  1U49 A;  1ZQH A;  2GWS A;  1X6I A;  9ICB A;  2RP5 A;  1D8L A;  1S0O A;  1ZQ1 C;  1ZQS A;  3QUC A;  4MF8 A;  4DCC A;  5D49 A;  1ZQR A;  2D6F C;  1ZQJ A;  7ICV A;  3BQ2 A;  2ISO A;  2F2A B;  1XNS A;  5HP4 A;  4QZA A;  5KT2 A;  1NK8 A;  4B9M A;  1K5O A;  2VA3 A;  3EZ5 A;  1SKS A;  3WK5 A;  5J8Y A;  5DBB A;  3T5H A;  1TE2 A;  1CEZ A;  3KHR A;  3AL0 B;  4UB3 A;  1C7Y A;  4RQ0 A;  2E3T A;  2CXY A;  3M7D A;  8ICJ A;  1NKC A;  4DOC A;  4DFM A;  3JPT A;  4ED1 A;  3GDX A;  1JMS A;  4P4O A;  4DL3 A;  4ELU A;  2HBK A;  1S76 D;  1Q3V A;  5ALH A;  3MR2 A;  4NLN A;  3OJU A;  3EYZ A;  2KMD A;  4I2H A;  2GO7 A;  2XCA A;  5HHI A;  3T3F A;  5DB7 A;  3WK9 A;  4Y2X A;  8ICG A;  2PI4 A;  9ICS A;  2LYH A;  4O3Q A;  2HW3 A;  2P66 A;  4DEZ A;  5AK5 A;  4ACO A;  3WK8 A;  1JXE A;  1N5W A;  3C5G A;  4J9S A;  2C2R A;  8ICV A;  2K4H A;  2YY6 A;  2JH7 A;  4OJ5 A;  3RH5 A;  2I1Q A;  2WF9 A;  3RJG A;  4Q45 A;  1TAU A;  1RYU A;  4MEX A;  1NI3 A;  2FDR A;  3N28 A;  2AJQ A;  3KZX A;  1EXN A;  4O0I A;  2KFZ A;  1S0V A;  8ICF A;  2LHT A;  4BWM A;  8ICC A;  8ICH A;  4U6P A;  3MR3 A;  3GV5 B;  2WTF A;  5E79 U;  3NVV A;  4UAV A;  5ALU A;  3NTU A;  5T14 A;  2W43 A;  1LVH A;  2XY5 A;  7ICQ A;  2E8O A;  3WK7 A;  3V6H A;  3ORY A;  2W11 A;  1L7P A;  5AM5 A;  1TAQ A;  2DKX A;  3GII A;  1NKE A;  5K4L A;  3TAR A;  5ALS A;  2G5I B;  4NLB A;  3PSP A;  1ZQG A;  4RQ1 A;  3UMG A;  3QU5 A;  2W04 A;  2FLL A;  2Q4T A;  4DS5 A;  2B0C A;  3SV3 A;  2FPL A;  5J2F A;  3RR8 A;  2F1I A;  3RFA A;  5GTH U;  8ICM A;  1DGJ A;  3HKZ C;  4R8U A;  4RQ8 A;  3PO4 A;  2IOH A;  4GLX A;  4P2H A;  2ZXH A;  1NZB A;  4Z6F A;  3OSN A;  4AYB C;  1V97 A;  3PNC A;  2W9B B;  4M04 A;  1J2M A;  2LI6 A;  5DB8 A;  1URJ A;  3A0B U;  2ODG A;  4IL6 U;  4JMU A;  4R64 A;  1QLN A;  1ZD4 A;  2KKP A;  4IRC A;  5KFN A;  2C22 A;  4PGQ A;  2ISP A;  4F5Q A;  4O3O A;  4M47 A;  4OCZ A;  1WWV A;  3E0F A;  4ICA A;  3PX6 A;  4DL7 A;  4DF8 A;  5KFC A;  2MRL A;  5GTI U;  2F76 X;  5CJ7 A;  1NJW A;  3KBB A;  5DKW A;  1KDH A;  1BGX T;  4A8E A;  5KFO A;  1XSP A;  3QXG A;  4KLD A;  5G5H A;  5EE0 A;  4ZH4 A;  3ISD A;  3AEV A;  3FYH A;  5ALV A;  4OD0 A;  1JUD A;  5JTI A;  9ICE A;  2KZZ A;  2R8J A;  1DK2 A;  1ZQY A;  2MAX A;  3TFS A;  2C28 A;  4KMU A;  3F2B A;  4O3N A;  5J29 A;  3H8J A;  4J9Q A;  2CN1 A;  3AU2 A;  2VIX A;  1TK0 A;  1QSY A;  4FZL A;  2H3V A;  4ECR A;  3ONN A;  1ZQW A;  4C8O A;  3IDW A;  4J9O A;  5KT7 A;  5J0U A;  2DGZ A;  5DQG A;  5J2H A;  2ES6 A;  3GQC A;  2PFO A;  5KG5 A;  3SMV A;  3TAC B;  1SKR A;  4UAY A;  4J9R A;  4C4S A;  5DBA A;  3TI0 A;  2XY6 A;  3ZDC A;  1CUK A;  2RDI A;  1N63 A;  1ZXI A;  1K1Q A;  5AK3 A;  4RT3 A;  4WJ3 B;  1T7P A;  1NK7 A;  4C0Z A;  3UMC A;  3HKZ F;  2HOF A;  4EBD A;  2Y1I A;  5KNI A;  4KLO A;  7ICG A;  1N61 A;  4KLI A;  4ECW A;  2YTU A;  2K4E A;  2K8B B;  1L6N A;  3FAH A;  5KFT A;  3Q8P B;  1WUD A;  2W3R A;  2AHO B;  1SV4 A;  2G07 A;  1JI7 A;  1ZQO A;  2V4Q A;  4Y2S A;  5KT5 A;  1ED1 A;  3RB3 A;  1Z1V A;  3RJK A;  1YZ7 A;  4FFD A;  4Y2P A;  4E0D A;  4QZF A;  1V38 A;  3PR5 B;  3ISC A;  4EBC A;  2JR5 A;  2W7P A;  2HVI A;  4EBE A;  3QYP A;  3N7S C;  5BOM A;  1ZJN A;  4M6W A;  2EAM A;  1BPX A;  1ZD5 A;  1X2I A;  2PMZ F;  3C2M A;  5AKI A;  2NRZ A;  3C23 A;  1RPL A;  2NYV A;  3NRW A;  5J2J A;  3DEE A;  2K4P A;  1AQ6 A;  4F91 B;  5CRX A;  3NVY A;  5KFV A;  5AM1 A;  2F77 X;  1RXW A;  2P6R A;  3ZI4 A;  3ETR A;  1N56 A;  1VJ5 A;  2ZIX A;  2VA8 A;  3G6V A;  4GXI A;  3ETL A;  3NUQ A;  1N48 A;  1X9M A;  1S0M A;  2J6T A;  1SL1 A;  3N7R C;  3Q8Q B;  2C2E A;  2QB0 A;  5KFA A;  2YB1 A;  1SV0 C;  4C7Z A;  1RXV A;  5KFG A;  2G5H B;  2DFL A;  4YMN A;  2ZXI A;  2ESE A;  2YMP A;  2KE7 A;  1SXD A;  3RBE A;  2HHW A;  1A77 A;  4Z6C A;  1L3T A;  3TAQ A;  4PL2 A;  1QCK A;  1S0N A;  1L3U A;  5CP2 A;  4IR9 A;  1DK3 A;  3PR4 A;  8ICE A;  2ZUB A;  1UQV A;  2N1R A;  3WK4 A;  1RDF A;  3IM1 A;  4ECS A;  2JZB A;  3H8S A;  1WCN A;  4HAI A;  3L3F X;  2WB1 F;  1XSL A;  2ZUC A;  4UAW A;  2OM6 A;  1N62 A;  5KG1 A;  3E58 A;  8ICN A;  1KW4 A;  5KFS A;  3PML A;  5DBC A;  1FFV A;  1OXJ A;  3IV6 A;  5J2G A;  3BJY A;  4MHV A;  5B5E U;  5JRT A;  4J9N A;  4Q44 A;  5IIO A;  3SYZ A;  1Z4N A;  1LV5 A;  4HYK A;  2W9A A;  1T3N A;  1S5L U;  4IQU A;  2XGQ A;  1U45 A;  1PZN A;  5A0L A;  1L3V A;  2HCF A;  2ZIU B;  4DS4 A;  5KFW A;  5J0S A;  1H38 A;  5KG0 A;  7ICF A;  3NGD A;  5J0T A;  4YXJ A;  5J2C A;  5EOZ A;  1QSL A;  1FFU A;  1ZQQ A;  3ZDE A;  3C2K A;  3ALR A;  3SV4 A;  3L5K A;  7ICS A;  4RQM A;  8ICP A;  4F4W A;  4F4X A;  2F3N A;  9ICU A;  1KEJ A;  2LMR A;  4F71 A;  4QJF B;  3F5A A;  4UB2 A;  2ZIU A;  2BHN A;  4R66 A;  3BQT A;  4IC9 A;  2LPE A;  5KFH A;  1ZD2 P;  2MUT B;  4DQS A;  4QIW F;  1XS9 D;  3H0L B;  3FC4 A;  9ICA A;  3WKC A;  4J9K A;  4RQ7 A;  2ALZ A;  4QWE A;  1F44 A;  2W8L A;  5ALJ A;  2G09 A;  2BZF A;  8ICR A;  4PH5 A;  4PHD A;  2BPF A;  1F0M A;  2DUY A;  1FIQ A;  3MGH A;  5DLF A;  1NNL A;  2Y9T A;  1B43 A;  2HDO A;  4KTQ A;  2HMX A;  8ICL A;  2WF7 A;  4F4K A;  2KKV A;  2JZB B;  4LVS A;  5KTQ A;  3UPQ A;  4FBU A;  1L3S A;  2HBL A;  4C8M A;  3WKE A;  2BPC A;  1T4G A;  4DWI A;  1SB3 C;  1CI4 A;  2EAN A;  2C2D A;  4RNO A;  4M9J A;  1DOQ A;  1TK5 A;  2F8L A;  3R9K A;  1MQ3 A;  2A1J B;  4KLT A;  4RUA A;  3PW7 A;  3BS7 A;  3QZ7 A;  2BR0 A;  3SAF A;  1X66 A;  3ED5 A;  2YMQ A;  2NRX A;  3IP4 B;  2HOI A;  9ICX A;  4KLU A;  1ZQA A;  2JXJ A;  5DGA A;  2ZTC A;  2RQ5 A;  3QUB A;  5F3X B;  2NO4 A;  4ZOH C;  5C5J A;  4DLG A;  4YR2 A;  1L8L A;  1NK9 A;  2JEJ A;  4Z6E A;  4LZD A;  2MU2 A;  4MF2 A;  2IA6 A;  2JMG A;  2CRX A;  4DL4 A;  2BCR A;  5ALM A;  1BNO A;  2PMZ C;  3C2L A;  5KFX A;  4QWA A;  4J9L A;  2ASL A;  3LWM A;  4DF4 A;  2UVV A;  4OJL A;  8ICZ A;  5AIA A;  3ZD9 A;  3QEB Z;  2QB1 A;  1L7M A;  5J2I A;  3ICX A;  3ZDD A;  4R65 A;  5KFB A;  4F2R A;  4EEN A;  2OCE A;  3K1R B;  4IS7 A;  5AK6 A;  1L7O A;  3JPO A;  4GFJ A;  2J6S A;  2P35 A;  4ECT A;  2E1E A;  4ELT A;  1N2X A;  4FE3 A;  3UQ2 A;  1B4F A;  1PVQ A;  1BPY A;  3PY8 A;  5F9L A;  2UVU A;  5KFD A;  2I6X A;  3IN5 A;  3HT3 A;  4OJ6 A;  7ICT A;  2E8M A;  4JWN A;  3HPO A;  4FS2 A;  5BPC A;  4NM1 A;  4BDP A;  3VCB A;  3LDA A;  3PV8 A;  1IV8 A;  4EX6 A;  4I2I A;  4KX5 A;  1ZQK A;  5ALZ A;  5HR6 A;  2F1H A;  4M9H A;  4DFP A;  3GIL A;  4LJX A;  4RPZ A;  8ICU A;  1SZP A;  3C21 A;  4JK1 A;  5IIJ A;  2L5Y A;  4RQN A;  3NAS A;  3RAQ A;  1ECW A;  3N7P D;  3D6J A;  2ZIW A;  4MFF A; 
#chains in the Genus database with same CATH homology
 1SXE A;  1UCV A;  3TAD A;  3H8M A;  2GLE A;  2E8N A;  1COK A;  5F3X B;  3SEI A;  1PK1 A;  2QAR B;  4RQM A;  3BQ7 A;  2QB0 A;  3IDW A;  1SV0 C;  2KG5 A;  2ES6 A;  2Y9U A;  3TAD C;  3KKA A;  2QB0 B;  2QAR A;  1PK1 B;  2ESE A;  3TAC B;  2KE7 A;  1SXD A;  1SGG A;  1SV0 A;  2F3N A;  2K60 A;  2LMR A;  5L1M A;  1V85 A;  2KMD A;  2F44 A;  1X9X A;  3KKA C;  2LPE A;  2B6G A;  5J8Y C;  1UQV A;  3SEN A;  2F8K A;  5KNI A;  2QB1 A;  2KSO B;  2D3D A;  1RG6 A;  2E8P A;  2YTU A;  2EAP A;  3K1R B;  4IS7 A;  4NJ8 A;  1SV4 A;  1JI7 A;  2QKQ A;  3HIL A;  1F0M A;  1LKY A;  4NL9 C;  1OW5 A;  2JV3 A;  1B4F A;  1LKY B;  1KW4 A;  1WWV A;  1Z1V A;  2Y9T A;  1DXS A;  3BS5 A;  1OXJ A;  4PZN A;  4NL9 A;  2KIV A;  4MHV A;  5JRT A;  2E8M A;  1V38 A;  2FE9 A;  3BS5 B;  2KSO A;  1X40 A;  1PK3 A;  2EAO A;  5JU5 A;  2DL0 A;  2EAN A;  2EAM A;  1B0X A;  5JTI A;  2L5Y A;  4RQN A;  3BS7 A;  2K4P A;  2DKZ A;  2E8O A;  2D8C A;  1X66 A;  5J8Y A;  2DKX A;  4PZO A;  1WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...