2QASA

Crystal structure of caulobacter crescentus sspb ortholog
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
PPEDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSVQFALQFSAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of Caulobacter crescentus SspB ortholog
rcsb
source organism Caulobacter vibrioides
molecule tags Hydrolase activator
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2qasA00
1YFNA 1ZSZC 1OU9A 2QASA 1OULA 1OU8A 1OX8A 1ZSZA 1OX9A 1ZSZB 2NYSA 2QAZA 1TWBA
chains in the Genus database with same CATH superfamily
2Z0WA 4F7UF 2VXFA 4OMFB 1WXBA 5I22A 3URGA 1S72Q 3SB2A 1JRIA 2JS0A 4MZTA 4YTLA 3G6EA 2LCLA 5ECAA 4M78F 3OW2P 4C5GA 1HJDA 2A7YA 2F2WA 2KBTA 1W2BP 4M7AF 1AWOA 1YNZA 3JCMe 3CCUA 4JS4A 1FXXA 1M3AA 3TSZA 4A54A 2VASA 4HVVA 1YITQ 1K1ZA 2ZCFB 2ZGWA 4J6WA 4CRIA 3RERA 1U8RA 1RLPC 2DTOA 1UGVA 2EQJA 1HYOA 1OZ3A 3CMAA 3P8HA 2EFIA 2E3IA 2OTJQ 2QAZA 1SHGA 4J9FA 3CC7A 2OI3A 2B86A 2QQAA 1NLPC 2BZYA 1UGQB 2C0IA 3I56A 4XTVA 4JJBA 1I07A 1Y71A 1K73R 3SWNA 4XTWA 4BDZA 3I35A 1UHCA 3TEEA 3OB9A 4BE1A 2HQEA 4HT9A 1SRLA 1Q95G 2YDLA 1WGSA 1IHWA 2LQKA 2ZAEA 2KYBA 3CQTA 5KE3A 2QASA 4RG2A 4PJOE 3CBPA 1E7OA 2L0AA 1SPKA 2E41A 2CP6A 3CCVT 3JCMP 2X4JA 4TVRA 3E9FA 4XU0A 2CYZB 3OSSC 4BB7A 3UA6A 2DX1A 3VKIA 8AT1B 1UGSB 2CP7A 2RPNA 5IN1A 1R0CB 3HFOA 1KJWA 4FYVB 5KYWB 1UFFA 1QVFA 5FU6C 2EIFA 2K3BA 2L2PA 3EG1A 5IH2A 4LDUA 3CCMQ 3CD6Q 4KGZB 1GL5A 2QDLA 4KUDK 4JDSA 2CS7A 3VUZA 4MMKA 2DEUA 3HTRA 1XJWB 5LJ5d 1VQ8Q 1FMWA 2XK0A 3G6ET 1I81A 2Y4XA 4M75G 2GQIA 2RB6A 4XTZA 4FL6A 5CO7A 2GBQA 3JCMh 3JRZA 3CCUT 1VQKQ 4RTWA 3PVLA 5GMKi 4UC4A 4A4EA 3F70A 2LT4A 5GMKm 2D8JA 2PNIA 4N0AC 2NYSA 4BDYA 2F5KA 2VYTA 1OEBA 2KGTA 2E4HA 1GXIE 4F7UG 2KQWA 2KT1A 2DXBA 3PMTA 3CC7T 4PJJA 4PLIA 3SD4A 4EPCA 2DBMA 3HSBA 3M5AA 2QYZA 1VQPA 3RDVA 4C5HA 3OS0A 1T3LA 2YRCA 4C0FA 4MDXA 4M77C 3CCRA 2VGMA 4M7AG 3BDUA 1VQ5Q 1RADB 1RACB 3VUBA 3IQLA 4OMQA 1WXTA 2EJGA 1VA7A 4II1A 3OYKA 4CC3A 4DBRA 1X69A 5CCAA 2HKQB 3CC2Q 3G1JA 1SSHA 2RHIA 1TUCA 5KYUB 1KFZA 3LW5E 3CC4Q 4X34A 5A0DA 1KQ2A 2COYA 2R5MA 5HCKA 1M30A 2PVDB 1JB0E 2P4TA 1M90C 3WVDB 3WVEB 2V8IA 4RTTA 2NUPB 3VRYA 4C92C 1RLQC 3PIOA 1SHFA 1UECA 2NUTB 1GBQA 4HCCA 4C92D 3H8ZA 2XHCA 3QO3A 2KDSA 3A8HB 4DOVA 2ZPBB 3JCMg 3TREA 1C1AA 3HHTB 2K5IA 2NUZA 1EIFA 1GBRA 1ZBJA 4C8QE 2LQNA 2RHXA 4XU1A 4B9XA 1ACMB 5KE2A 4PL6A 1YJWA 3CCSQ 5DLOA 4HXJA 1WHJA 4QQGA 1M2VA 4M7DF 4R0KA 2VUBA 1Y96A 2MMPA 1JXMA 1QWEA 2RNAA 4N4GA 3V8LA 4LE9A 1MNDA 2R57A 4FT4A 2LCCA 2DIGA 3M0RA 4C5IA 3P8DA 2X9HA 3M0UA 2KRMA 1X01A 5CQXA 4IUUA 2CH4W 1VQPT 2J6FA 2M02A 1PM3A 3UATA 3VS1A 5D7UA 3I55A 1IGQA 2YT6A 2GF7A 5LJ3d 3D7SB 3DB4A 2JM8A 3CCRT 1H3HA 1Q82C 4M75B 2X35A 4JJNK 3CCET 3V7CA 3BE3A 1ZUYA 2XD0A 1VYTA 3LGFA 1K0SA 1WHLA 3PNWC 2A28A 1KD1U 1ZSZA 3OYNA 3M9QA 2QGGA 4LDVA 2DXCA 4N0AA 1PSFA 3LGLA 3G7ZA 5KYXA 4FW2A 1Y7XA 2DPPB 4XTUA 1QMCA 1M1KU 1K9AA 3ER0A 3M54A 2H8HA 2AKLA 2DVJA 5FWBA 4E7JA 1WNLA 3GIBA 2QEXQ 3EGDB 3REBB 1VQ4T 1N8RU 4PJOC 2DILA 3JAME 4JRPA 2EKHA 4XQ3A 4CC2A 2JW4A 4ELYC 2DIQA 4OB1B 2DKGA 4PFOA 1G3TA 4PJOD 2EQMA 1TXQA 2DMOA 2DXUA 2KEAA 4E7IA 1RUWA 1GFCA 2FEIA 3LH0A 4E7HA 2EWNA 2RK1A 3CCLQ 1G3WA 2VB6A 1B7TA 2EGEA 1RL2A 3EHRA 1W4SA 3JV3A 1PCXA 3L2ZA 1AZEA 1YJWT 3VS7A 1K76A 1G8XA 2EPDA 2FHDA 4MZPA 1VQNA 4C92A 2VXEA 4BACA 4QQDA 2D9TA 3R6NA 1AEYA 3I5SA 2K5FA 4NOYA 1Q86C 2KVQG 3REAB 1U5SA 2QG9B 3KBGA 1KK7A 1KQSS 1T0JA 1I5LA 2OTLA 2E64A 1B34B 4JRKA 2BIVA 2LDMA 3I55T 4XTXA 2XMFA 4OMNA 5J39A 1QKXA 5CKBA 5GAOl 1VQ6Q 1AZGB 2DF6A 3HRSA 4M7DG 1QKWA 2JOYA 4EMKB 3ZL7C 5CAIA 4BE0A 2RN8A 4MMLA 1W1FA 1OU8A 1UG1A 1YWOA 2QDYB 3M4GA 2LQ8A 5FU7B 4ATOA 1M9SA 2RK2A 3JCMX 3H9NA 2XU8A 2QXFA 4PLLA 4M77F 1YIJA 3LWHA 4BY6C 3G4SA 4OB0B 1N27A 2K5LA 2HQHA 2PTKA 2EJ9A 4BI8B 2P0PA 4IUQA 1OV3A 5A2QE 3JSCA 2JVVA 1YWPA 2FPDA 3A98A 2CP5A 3X25B 4ZNXA 2LX7A 2DTIA 1K73C 4FYXB 2E5KA 2DL4A 3QG1A 2E1HA 2K3XA 1ZHIA 3JCMf 4LXCA 4HCBA 3SWNB 3MP8A 1QCNA 2YRDA 1Q86U 2DE0X 3KUFA 2AZVA 2JM9A 3FC3A 2CUDA 2H3JA 1UGPB 1NYFA 3U23A 3CCQA 2K6DA 2K3YA 2PVGB 3GPLA 5GAN4 2M1HA 1NZ9A 4PJNA 4D8DA 5GAN3 2ZPHB 4PJOA 1W6XA 3OW2A 1JJ2S 1QVGS 1QVPA 2JJ9A 2LZ6B 5L23A 2AHJB 3RIRA 2CUBA 1ZSGA 1BIAA 1K8AU 2MWPA 1UEBA 4C8QC 4QKUA 1UB4A 1TU0B 5EG2A 2OTLT 4FCYA 1F1BB 1VQLQ 4C8QD 1VQ9A 4JUVA 2LP5A 4HKEA 5AYFA 3QDRB 1M1FA 2X3WD 3UF4A 1C6VX 1WQ7A 3ZFJA 1KHCA 2KMTA 1E6HA 2L8DA 5KYNA 5CKFA 2A37A 4D6WA 2M51A 1ZLMA 1AWXA 3CCVQ 1K73U 2KYMA 5A0LA 4CI0C 5GAMd 4C92E 1M1GA 1YIJT 3G4ST 3ME9A 4LUEA 4QVZA 1XQHA 2DTHA 2O4XA 2PU9B 2VKNA 3OYBA 2COZA 4DQ2A 1TWBA 2YUPA 2HQXA 1PD1A 4M75F 2PUKB 2EYXA 3FEOA 1OULA 4FYYB 2DNUA 2YXYA 1LVKA 3VU3C 5I21A 2QI2A 4B6MA 5DM7R 5D6YA 2M0OA 2DEQA 1ZUKA 1IZ6A 3X28B 3CMEQ 1VQOA 1OX8A 1RAHB 2HKNA 3NTIA 2O2OA 5GAMe 1M3CA 3QJYA 1PKSA 2MCNA 4Y28E 1V29B 2W0ZA 1IO6A 3M53A 2EYWA 3H6ZA 2V8JA 4M77G 3G6EQ 3O5ZA 2YUQA 5C6SA 2FZGB 3NMZC 1Y0MA 4RMOA 1KQSP 5GANj 4KULA 2HD0A 2RMOA 5GAOn 3CCUQ 3BY7A 1K8AR 3X24B 3L2RA 1FMKA 4KH1B 3MEUA 3C12A 2X3XD 2P84A 1PD0A 2DL8A 4OP0A 1WHGA 2KXCA 4J83A 3CC7Q 2ZPGB 1YJ9Q 3SEMA 3NFCA 1S72A 3A5ZB 2MOXA 2QTVA 3M58A 4F04B 2QA4A 3QYGB 1OX9A 5GANh 1D3BA 3CPWS 3S6WA 5IAYA 5GMKe 3C95A 1BI3A 2FZCB 1YITA 1NYGA 3J7AF 2RD1A 3E1SA 1O75A 2LJ0A 4CC7A 1X2KA 2WACA 1AT1B 3V8KA 3OMGA 4R55A 5FRMA 4C8QA 2YUOA 4HVUA 2QQSA 1Y96B 2J06A 2EGCA 1R77A 2D1XA 5FU6B 5HKCA 2KNBB 3BFMA 4O5VA 4DBHA 2KRNA 2XDDA 1AD5A 5AT1B 3A1PA 4XK8E 5GJWB 1ZA2B 4M78E 2CP3A 3L2QA 3EFRA 4OMPA 5IHIA 1JJ2P 4M7AE 3DLMA 4NL3A 4PKCC 1QVGP 1YI2A 2XICA 5J26A 3JB9F 3WXMB 2RM4A 5FW9A 3V8JA 3G71A 4RCBA 3H0FA 1I1JA 2ABLA 1ZBXA 3THKA 1MHNA 3I5RA 1WHHA 4HA8A 2JTEA 5KYXB 3CCMA 3CD6A 4N4IA 4HCKA 5C0MA 2RJDA 2LT1A 1ZSZC 5GANg 4IUPA 3CMAT 2RA2A 2XDBA 5LJ5e 4FYWB 2RQRA 1S72T 4AG1C 1VQ8A 1OQKA 2M16A 4Z02A 1Q7YR 2QA4T 2HSEB 2LX9A 4M77B 3I56T 3CCRQ 3PTAA 4RTUA 3CCEQ 3A8MB 3EFOB 4IURA 4HT8A 1VQKA 3MPUB 3Q1JA 3OYHA 4DA4A 1YITT 2DRKA 1BB9A 2L89A 2JT4A 2BTTA 4FSXA 2J6OA 2ZPEB 4C0DC 1OPKA 3OYDA 3LWIA 3L1AA 4OGEA 2KR3A 4FM4B 1K9MR 2XG8D 4ANJA 2QQ9A 1MNEA 1VQ4Q 1X6BA 4A4FA 4RTYA 1VQ5A 3UDCA 2JMAA 2E3HA 4C92B 2OJ2A 2XDPA 4PFZA 1NPRA 4KGXB 2FZKB 2RH2A 4GY5A 1KD1C 5DY9A 1RABB 1G2BA 4X1VA 3BDLA 4D8KA 2E12A 2JTMA 2XI9A 3INZA 1XOVA 3OYAA 1M8MA 1YI2T 2IVWA 4F14A 1M1KC 2DERA 4WF2A 2HL5C 2DXTA 2L3SA 1NJIR 1OU9A 5LJ5j 3L2UA 1D1BA 2BKDN 1RAEB 1OI1A 5GAN2 4AFQC 2A08A 5FWCA 1YJNQ 4OF1A 1N8RC 3G71T 1G5VA 1Y57A 2DL5A 2FRWA 4XU2A 2J6KA 1YHQA 1ARKA 3CPWP 3QUIA 1TUDA 4E7KA 3FB9A 2XKOC 3JCMb 2EQUA 1XNIA 4KH0B 1BBZA 3FLGA 2P4RA 2EGAA 4RTXA 5GMKl 5LJ5h 5CKHA 1WHKA 4J7FA 1VOMA 1E6GA 1NLOC 3RR6A 3I55Q 2FO0A 5GAN7 2LNVA 4HCZA 2O9VA 2NWMA 3H0IA 2DZ9A 1M5Q1 1WJRA 2H3EB 3JB9G 2Y90A 4JZ3A 5L8RE 1OYXA 3E19A 1PWTA 2RI2A 4E7SA 2LC4A 2BZ8A 3EHQA 4Z8AA 2RJEA 4QVCA 1MV3A 1ZX6A 5EC7A 1YCSB 1EFNA 2ECZA 2MF2A 1PRMC 3TCJA 2A3LA 1UHFA 4RG8A 1VQMA 2YLBA 1I5OB 1D0YA 4KGVB 2D6FA 4DBFA 2YWWA 1Z9ZA 1K4US 3OYGA 2W10A 5LJ3e 1N6AA 2NLUA 1WPYA 2JXBA 5CQYA 4PJOB 1VQ5T 3S3NA 1D1AA 3ULRB 2AKKA 2FL7A 3LLRA 3RMSA 2K2VA 2BE9B 2R5AA 4DEYA 2YSQA 2VC8A 2DK3A 4C8QG 3QSUA 3SFMA 2CZ7B 1X6OA 1M27C 1YP5A 4FT2A 2PQWA 1BCOA 3EGUA 3DLLA 1NPPA 3EGXA 8ATCB 2CDTA 2QEXA 4JPBW 1UTIA 2R58A 3VYGA 2KROA 1YHQT 4RTVA 4M78C 1X6GA 2FYKA 1Y07A 3J80E 3CPFA 1AWWA 1B3QA 3OYLA 5LJ5g 5KCHA 4M7AC 3V7SA 5GANf 2SRCA 1NEGA 3MP1A 1V1CA 4M78D 4OMMA 3M55A 3RNJA 1MV0B 3L42A 4M7AD 2DD4A 1WDXA 3MEWA 4NL2A 2JUFA 2RO0A 3EH1A 2OTLQ 2QTXA 3BW1A 1JO8A 3UT1A 3CCLA 3QZ5B 4RCCA 5KYUA 5LJ3j 1VQ7Q 2F1LA 2QQRA 1VIFA 3PE0A 2KRSA 1HD3A 1M4ZA 1TSFA 2CSIA 5IT9E 1BK2A 4R56A 4ESRA 1J3TA 5GJVB 3VS5A 4GBQA 5KYYB 3OQ5A 5CK9A 5GAN8 2CP2A 1M90R 3HPWA 1VQMT 4BY6B 1K8AC 3O8VA 3G4SQ 3GNGA 1GCQA 4LDXA 1W2BS 4QW2A 4ME7A 1BI2A 1O9SA 1BYMA 4DOWA 4RTZA 2EJFA 4J9BA 2DD5A 5LJ3h 2KK4A 4MZMA 4Z89A 2GFAA 4JRQA 3QYHB 1VQ6A 4NS5A 4ZTJA 1IXDA 4X9CA 4LDYA 3GBQA 5FLXE 2E70A 1NBEB 2JS2A 7AT1B 4JLIA 2Y4YA 2LNHB 3HKSA 2WSEE 3E2UA 1TH7A 1MMAA 3FJ5A 2RJCA 1K0XA 2F2XA 4IUTA 2QEXT 2HAXA 1NG2A 3T9NA 1ZA1B 2X4WA 1D0XA 3ZBDA 4C92F 1WIEA 4P5NA 5HY6A 4N4HA 3EG0A 1KQSA 4E7ZA 4OB2B 4WCIA 3CBMA 3JB9H 1OZ2A 3RBBB 2MYSA 1VQNT 2ENMA 3VYHB 3L2WA 1Q82R 4MDWA 4C8QB 2HNIA 4J9CA 1TOVA 3A8GB 3QBYA 1VIEA 1ZQ1A 2P0QA 3CCLT 2EVRA 3PT9A 4X9DA 5D6XA 4F7UA 2E5QA 1KG1A 5M9OA 4JZ4A 1KC8U 1IGUA 1AOJA 2L3RA 5HK3A 5CIUA 5FROA 4M78A 1P92A 2RHYA 2P0KA 4WTOB 4M7AA 3MHXA 1X75C 2VVKA 4OB3B 1GCPA 3PVQA 5LJ3g 2VWFA 2WSFE 3ASKA 1YN8A 4J9IA 1CSKA 3OYFA 1PHTA 5GAOq 4DEXA 2RI3A 2CT3A 3PFSA 2C06A 3HL8A 1VQLA 1AHJB 1WXUA 2DL7A 3M57A 3JCMQ 2KY9A 3S3MA 4LD6A 4CC4B 2ROLA 3GF5A 2EW3A 3JB9I 3EAEA 2DRMA 1UJ0A 3META 3OYIA 4C5EA 2GGRA 2HL3A 1Q7YC 4C0GA 1RI9A 1FX7A 2K2MA 4K11A 4PJMA 2ED0A 1Q81R 2YLCA 4KRTA 1M8VA 1X27A 2EYZA 1RI0A 4LN2A 4J6YA 3I9QA 2IPOB 2CREA 3JB9J 3LYIA 2X51A 2KAFA 1JJ2A 1QVGA 2X4XA 1WHMA 4Y91A 4PJOF 2GCXA 4EMHA 1WA7A 3GOXA 1WFWA 3CCQT 2E6ZA 4O6JA 5LJ5f 1G83A 3FIFA 3SDZA 3JCMd 1D0ZA 1PKTA 2HCKA 4JLGA 3CMEA 1D09B 3OY9A 1KC8R 2DETA 3NHNA 1QQJA 3CMAQ 4PFPA 4A53A 4BI4A 2DAQA 2MK5A 2ZPFB 2DJZA 5GAN6 1V76A 2HBWA 3MCAB 4ELZC 3EG9A 3CCJA 1QVFS 4M7DD 1IB8A 1AWJA 2QA4Q 3DKMA 3QHSA 2ROTA 3FDRA 3I56Q 3AHUA 1QLYA 3P8BB 3HRTA 3OYCA 1KHIA 2RHZA 1YCYA 1UDLA 2ESWA 2YHTA 1LJOA 3EG2A 3KXTA 4BE2A 3OYYA 2CH4A 1NJIC 4C92G 1VQ9T 4ZTFA 1SG5A 3M0QA 2FPEA 3MKDA 2E6NA 3PIPA 2RJFA 1X2QA 3VS4A 1Q7YU 2KE9A 4M75E 2HBPA 1YJ9A 2M0YA 3PGGA 5GAMj 2OTJA 4A4KA 2EQKA 2ZPIB 1A0NB 1OOTA 1HK9A 3A8OB 1VQLT 2LTOA 4E47A 4FW1A 4B9WA 4QT7A 4E6RA 5CKDA 1M2VB 4GLMA 3CXCS 4F7UE 4JJDA 2V26A 2COWA 1HSQA 1D1CA 2RQWA 4IIOA 4J9DA 2GTOA 1PNJA 1VQOT 4J6XA 1YI2Q 1RAGB 3OA6A 1NEBA 4J8OA 3C94A 5A0GA 5GAMh 1K9MU 3JCMc 1CKBA 2KT8A 3X26B 2KI7A 1LCKA 2QQBA 1MUZA 3QZ9B 1YBYA 3M0PA 2I2LA 4ZGJB 3G71Q 2LRQA 2PZ1A 4LD9K 2V1QA 3E9GA 3VS0A 1KQ1A 1UJYA 3DB3A 1MMDA 4FIBA 1FYNA 1JQQA 2I0NA 4J9GA 5GMKj 1ZSZB 4ZGDB 3CMET 4JS5A 1ABOA 2JN0A 3FJPA 1NJIU 1U3OA 2LJ3A 1I4K1 1N9SA 2O88A 3CEYA 1SSFA 1H641 3CPWA 4OMLA 4L5GA 1B07A 4XAXB 1SRMA 3NTKA 3CCJT 3C0CA 3N5BB 3HRUA 2F2VA 3AT1B 2FRYA 2X4YA 2HZYA 2F5TX 1C0MA 1BCMA 3CBOA 2LVMA 1VQPQ 2L3QA 4PJOG 3OYMA 4Z88A 1JEGA 5GMKh 2O9SA 2RHUA 4C0DB 4L6V5 1JXOA 5LJ3f 3GNFB 2PVOB 3GLXA 4M7DA 3EGXB 1Z9QA 3CXCA 2KSSA 4C8QF 1YJ9T 2OTJT 2JZ2A 4PNOA 2D0NA 1WJQA 5CKEA 2YRVA 2DFUA 4M78G 3VS2A 4VUBA 3TVTA 2A36A 4LDWA 2WSCE 4J5YA 3FRNA 5I2MA 2EQIA 3CCEA 2AT1B 2DL3A 4EMGA 2K9GA 2DO3A 1PG5B 4AG2C 1WX6A 3OS2A 4M77D 5GAMg 2AK5A 1AVZC 1UE9A 2KXDA 1JU5C 3MEAA 1U1TA 2QGFB 3CC2A 2OAWA 2HMAA 1X43A 2G3RA 3EH2A 3JCMW 4JRIA 2HSPA 1IRXA 4A4HA 4C0ZA 2LMJA 1QVFP 3LX7A 1LNXA 1QP3A 4HVWA 3OS1A 2B8AA 1VQ4A 3CC4A 1YHQQ 1DJ7B 5KCOA 3VRZA 2BUDA 3OBYA 1YJWQ 4GLKA 1BI0A 2OAUA 3MJXA 1HXDA 1IHVA 1TG0A 4F17A 3M0SA 3CCMT 3CD6T 2K4YA 1EX4A 4XTYA 1SF9A 4KT0E 5CR2A 1LOJA 2VGNA 1QCOA 2F69A 2MWOA 1SEMA 1RAIB 1M2OA 1GCQC 1VQ8T 1YJNA 2IIMA 3H41A 2CZ6B 4EIKA 2BZXA 2CGHA 3OSVA 2SEMA 5DLQE 2QK0A 3RKYA 3RKWA 1CKAA 4AFUC 3H0HA 4E7LA 1T0HA 3CCSA 5IXBA 1VQKT 1I8FA 3CXCP 5KYWA 5KH6A 1MMGA 5GAOp 4M4ZA 4L59A 5GAOr 1H8KA 1VQMQ 2HDAA 3QDFA 2K7AA 2EYYA 2J05A 2DYBA 1R8OB 2AZSA 2CZ1B 5GAOm 4IKFA 1ZUUA 1BIBA 1TS9A 1WJSA 3J81E 2C0TA 4A4GA 2M9UA 1M90U 5FRNA 2E65A 3V7RA 3HFNA 4JJCA 4M75C 3RKXA 3QWYA 2FVUA 2CKKA 4AFSC 1VYUA 1LPLA 2ED1A 3UWNA 4J9HA 1T3SA 5LL6S 4AMCA 3CC2T 4OMOA 4M75D 1G3YA 4F7UB 4Q5WA 2V1RA 3MO8A 5I11A 4M7DE 1FMVA 2LJ1A 3NPFA 4M78B 3CC4T 2GFUA 4M77A 3M56A 2CP0A 3KFVA 3UA7A 2K79A 3OS5A 4M7AB 1OPLA 5GAN5 3EFOA 5D6WA 2FB7A 3M59A 3MEVA 1JBMA 4QVDA 1VQNQ 3TU4K 6AT1B 3VS6A 3OYJA 3RUXA 3L2VA 5CVIA 2DJQA 2L3PA 2ZZDA 1RAFB 2EBPA 3SHWA 2O4XB 3NTHA 3OBWA 1YJNT 5I2SA 2MI6A 4XU3A 1NM7A 2DVEA 1Q81C 1PSEA 2RQUA 4AT1B 1VYVA 1Q82U 2HEQA 3CCST 1KSWA 4KUIA 3QWXX 2RQTA 3LH5A 2E10A 2YUNA 4ZN1A 2NUPA 2JNGA 2JMCA 4ZGEB 1NE8A 1KD1R 1QW1A 1I0CA 2MPXC 2NUTA 1YIJQ 3OW2S 4PK4A 1KC8C 4EDUA 1IREB 1VQ7A 4BUGA 4DBQA 1BKBA 4E2FB 1M1KR 1QP2A 4RUGA 4PJLA 4A63B 5GAMf 5J3BA 1UGRB 1U06A 2VV5A 4FSSA 4AFZC 2DYIA 2DBKA 1WZOA 3R6OA 1N8RR 2RI5A 1FWZA 2BE7D 3EG9B 2LCSA 4EMKC 2CSQA 2XIDA 1YFNA 1UUEA 1PC0A 5FU7C 2EYQA 4RKUE 3JCMV 1D3BB 2MIOA 3CCQQ 1R0BG 1H3ZA 1PRLC 3OMCA 1W70A 1GRIA 1TUGB 1EZZB 3HP9A 1QWFA 2PUOB 1Q81U 2DLPA 4M75A 1KIKA 1G3SA 2RQVA 4F16A 3OYEA 3JB9D 4BD3A 1WLPB 2EKOA 4OGCA 5IHNA 3RESA 4J7IA 3S3OA 1U1SA 3MP6A 2JTFA 2O31A 3VS3A 3SWNC 3X20B 2FG0A 3VJPA 5GANd 1ABQA 4FU6A 2L5QA 4LUDA 2MAMA 1N5ZA 1WQWA 3M4YA 2IG0A 1VQ9Q 3UPUA 2GTJA 1XTDA 3EFSA 1SKUB 2C0OA 1W2BA 3EGDA 1WI7A 4M77E 4J9EA 5IHKA 4V2SA 1N9RA 3C4SA 2RF0A 3M0TA 3JCMJ 4Y92A 2DM1A 1VUBA 2LQWA 3NGPA 5GANe 3A8LB 2CZ0B 2A0FB 1MMNA 1VQ7T 1TTHB 2K57A 3QIIA 9ATCB 2OX7A 3QKJA 3TQ7P 1S1NA 4BI3A 4ZN3A 3ZEHA 2DZCA 2D8HA 4IUVA 1VQ6T 1BU1A 2AIRB 1QCFA 2FPFA 4KBMB 3QPHA 1MGQA 5HK0A 1VQOQ 4IIMA 2GQVA 2G6FX 4QQ6A 2D0QB 4LNPA 3CCVA 1H92A 2V8KA 2DA9A 3TSWA 3QXEB 4ORZA 2EAYA 3GP8A 2CT4A 1Q86R 1BI1A 1B34A 1WYXA 4OVAA 3PMIA 4M7DB 1RAAB 2ATCB 2J7IA 4M7DC 5KYYA 1GFDA 1K9MC 2GNCA 3QJ6A 3RMQA 3VV0A 4EMKA 3EG3A 3CCJQ 5IXFA 2O01E 1M3BA
chains in the Genus database with same CATH topology
1YFNA 1ZSZC 1OU9A 2QASA 1OULA 1OU8A 1OX8A 1ZSZA 1OX9A 1ZSZB 2NYSA 2QAZA 1TWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  1ZSZ C;  1OU9 A;  2QAS A;  1OUL A;  1OU8 A;  1OX8 A;  1ZSZ A;  1OX9 A;  1ZSZ B;  2NYS A;  2QAZ A;  1TWB A; 
#chains in the Genus database with same CATH topology
 2Z0W A;  4F7U F;  2VXF A;  4OMF B;  1WXB A;  5I22 A;  3URG A;  1S72 Q;  3SB2 A;  1JRI A;  2JS0 A;  4MZT A;  4YTL A;  3G6E A;  2LCL A;  5ECA A;  4M78 F;  3OW2 P;  4C5G A;  1HJD A;  2A7Y A;  2F2W A;  2KBT A;  1W2B P;  4M7A F;  1AWO A;  1YNZ A;  3JCM e;  3CCU A;  4JS4 A;  1FXX A;  1M3A A;  3TSZ A;  4A54 A;  2VAS A;  4HVV A;  1YIT Q;  1K1Z A;  2ZCF B;  2ZGW A;  4J6W A;  4CRI A;  3RER A;  1U8R A;  1RLP C;  2DTO A;  1UGV A;  2EQJ A;  1HYO A;  1OZ3 A;  3CMA A;  3P8H A;  2EFI A;  2E3I A;  2OTJ Q;  2QAZ A;  1SHG A;  4J9F A;  3CC7 A;  2OI3 A;  2B86 A;  2QQA A;  1NLP C;  2BZY A;  1UGQ B;  2C0I A;  3I56 A;  4XTV A;  4JJB A;  1I07 A;  1Y71 A;  1K73 R;  3SWN A;  4XTW A;  4BDZ A;  3I35 A;  1UHC A;  3TEE A;  3OB9 A;  4BE1 A;  2HQE A;  4HT9 A;  1SRL A;  1Q95 G;  2YDL A;  1WGS A;  1IHW A;  2LQK A;  2ZAE A;  2KYB A;  3CQT A;  5KE3 A;  2QAS A;  4RG2 A;  4PJO E;  3CBP A;  1E7O A;  2L0A A;  1SPK A;  2E41 A;  2CP6 A;  3CCV T;  3JCM P;  2X4J A;  4TVR A;  3E9F A;  4XU0 A;  2CYZ B;  3OSS C;  4BB7 A;  3UA6 A;  2DX1 A;  3VKI A;  8AT1 B;  1UGS B;  2CP7 A;  2RPN A;  5IN1 A;  1R0C B;  3HFO A;  1KJW A;  4FYV B;  5KYW B;  1UFF A;  1QVF A;  5FU6 C;  2EIF A;  2K3B A;  2L2P A;  3EG1 A;  5IH2 A;  4LDU A;  3CCM Q;  3CD6 Q;  4KGZ B;  1GL5 A;  2QDL A;  4KUD K;  4JDS A;  2CS7 A;  3VUZ A;  4MMK A;  2DEU A;  3HTR A;  1XJW B;  5LJ5 d;  1VQ8 Q;  1FMW A;  2XK0 A;  3G6E T;  1I81 A;  2Y4X A;  4M75 G;  2GQI A;  2RB6 A;  4XTZ A;  4FL6 A;  5CO7 A;  2GBQ A;  3JCM h;  3JRZ A;  3CCU T;  1VQK Q;  4RTW A;  3PVL A;  5GMK i;  4UC4 A;  4A4E A;  3F70 A;  2LT4 A;  5GMK m;  2D8J A;  2PNI A;  4N0A C;  2NYS A;  4BDY A;  2F5K A;  2VYT A;  1OEB A;  2KGT A;  2E4H A;  1GXI E;  4F7U G;  2KQW A;  2KT1 A;  2DXB A;  3PMT A;  3CC7 T;  4PJJ A;  4PLI A;  3SD4 A;  4EPC A;  2DBM A;  3HSB A;  3M5A A;  2QYZ A;  1VQP A;  3RDV A;  4C5H A;  3OS0 A;  1T3L A;  2YRC A;  4C0F A;  4MDX A;  4M77 C;  3CCR A;  2VGM A;  4M7A G;  3BDU A;  1VQ5 Q;  1RAD B;  1RAC B;  3VUB A;  3IQL A;  4OMQ A;  1WXT A;  2EJG A;  1VA7 A;  4II1 A;  3OYK A;  4CC3 A;  4DBR A;  1X69 A;  5CCA A;  2HKQ B;  3CC2 Q;  3G1J A;  1SSH A;  2RHI A;  1TUC A;  5KYU B;  1KFZ A;  3LW5 E;  3CC4 Q;  4X34 A;  5A0D A;  1KQ2 A;  2COY A;  2R5M A;  5HCK A;  1M30 A;  2PVD B;  1JB0 E;  2P4T A;  1M90 C;  3WVD B;  3WVE B;  2V8I A;  4RTT A;  2NUP B;  3VRY A;  4C92 C;  1RLQ C;  3PIO A;  1SHF A;  1UEC A;  2NUT B;  1GBQ A;  4HCC A;  4C92 D;  3H8Z A;  2XHC A;  3QO3 A;  2KDS A;  3A8H B;  4DOV A;  2ZPB B;  3JCM g;  3TRE A;  1C1A A;  3HHT B;  2K5I A;  2NUZ A;  1EIF A;  1GBR A;  1ZBJ A;  4C8Q E;  2LQN A;  2RHX A;  4XU1 A;  4B9X A;  1ACM B;  5KE2 A;  4PL6 A;  1YJW A;  3CCS Q;  5DLO A;  4HXJ A;  1WHJ A;  4QQG A;  1M2V A;  4M7D F;  4R0K A;  2VUB A;  1Y96 A;  2MMP A;  1JXM A;  1QWE A;  2RNA A;  4N4G A;  3V8L A;  4LE9 A;  1MND A;  2R57 A;  4FT4 A;  2LCC A;  2DIG A;  3M0R A;  4C5I A;  3P8D A;  2X9H A;  3M0U A;  2KRM A;  1X01 A;  5CQX A;  4IUU A;  2CH4 W;  1VQP T;  2J6F A;  2M02 A;  1PM3 A;  3UAT A;  3VS1 A;  5D7U A;  3I55 A;  1IGQ A;  2YT6 A;  2GF7 A;  5LJ3 d;  3D7S B;  3DB4 A;  2JM8 A;  3CCR T;  1H3H A;  1Q82 C;  4M75 B;  2X35 A;  4JJN K;  3CCE T;  3V7C A;  3BE3 A;  1ZUY A;  2XD0 A;  1VYT A;  3LGF A;  1K0S A;  1WHL A;  3PNW C;  2A28 A;  1KD1 U;  1ZSZ A;  3OYN A;  3M9Q A;  2QGG A;  4LDV A;  2DXC A;  4N0A A;  1PSF A;  3LGL A;  3G7Z A;  5KYX A;  4FW2 A;  1Y7X A;  2DPP B;  4XTU A;  1QMC A;  1M1K U;  1K9A A;  3ER0 A;  3M54 A;  2H8H A;  2AKL A;  2DVJ A;  5FWB A;  4E7J A;  1WNL A;  3GIB A;  2QEX Q;  3EGD B;  3REB B;  1VQ4 T;  1N8R U;  4PJO C;  2DIL A;  3JAM E;  4JRP A;  2EKH A;  4XQ3 A;  4CC2 A;  2JW4 A;  4ELY C;  2DIQ A;  4OB1 B;  2DKG A;  4PFO A;  1G3T A;  4PJO D;  2EQM A;  1TXQ A;  2DMO A;  2DXU A;  2KEA A;  4E7I A;  1RUW A;  1GFC A;  2FEI A;  3LH0 A;  4E7H A;  2EWN A;  2RK1 A;  3CCL Q;  1G3W A;  2VB6 A;  1B7T A;  2EGE A;  1RL2 A;  3EHR A;  1W4S A;  3JV3 A;  1PCX A;  3L2Z A;  1AZE A;  1YJW T;  3VS7 A;  1K76 A;  1G8X A;  2EPD A;  2FHD A;  4MZP A;  1VQN A;  4C92 A;  2VXE A;  4BAC A;  4QQD A;  2D9T A;  3R6N A;  1AEY A;  3I5S A;  2K5F A;  4NOY A;  1Q86 C;  2KVQ G;  3REA B;  1U5S A;  2QG9 B;  3KBG A;  1KK7 A;  1KQS S;  1T0J A;  1I5L A;  2OTL A;  2E64 A;  1B34 B;  4JRK A;  2BIV A;  2LDM A;  3I55 T;  4XTX A;  2XMF A;  4OMN A;  5J39 A;  1QKX A;  5CKB A;  5GAO l;  1VQ6 Q;  1AZG B;  2DF6 A;  3HRS A;  4M7D G;  1QKW A;  2JOY A;  4EMK B;  3ZL7 C;  5CAI A;  4BE0 A;  2RN8 A;  4MML A;  1W1F A;  1OU8 A;  1UG1 A;  1YWO A;  2QDY B;  3M4G A;  2LQ8 A;  5FU7 B;  4ATO A;  1M9S A;  2RK2 A;  3JCM X;  3H9N A;  2XU8 A;  2QXF A;  4PLL A;  4M77 F;  1YIJ A;  3LWH A;  4BY6 C;  3G4S A;  4OB0 B;  1N27 A;  2K5L A;  2HQH A;  2PTK A;  2EJ9 A;  4BI8 B;  2P0P A;  4IUQ A;  1OV3 A;  5A2Q E;  3JSC A;  2JVV A;  1YWP A;  2FPD A;  3A98 A;  2CP5 A;  3X25 B;  4ZNX A;  2LX7 A;  2DTI A;  1K73 C;  4FYX B;  2E5K A;  2DL4 A;  3QG1 A;  2E1H A;  2K3X A;  1ZHI A;  3JCM f;  4LXC A;  4HCB A;  3SWN B;  3MP8 A;  1QCN A;  2YRD A;  1Q86 U;  2DE0 X;  3KUF A;  2AZV A;  2JM9 A;  3FC3 A;  2CUD A;  2H3J A;  1UGP B;  1NYF A;  3U23 A;  3CCQ A;  2K6D A;  2K3Y A;  2PVG B;  3GPL A;  5GAN 4;  2M1H A;  1NZ9 A;  4PJN A;  4D8D A;  5GAN 3;  2ZPH B;  4PJO A;  1W6X A;  3OW2 A;  1JJ2 S;  1QVG S;  1QVP A;  2JJ9 A;  2LZ6 B;  5L23 A;  2AHJ B;  3RIR A;  2CUB A;  1ZSG A;  1BIA A;  1K8A U;  2MWP A;  1UEB A;  4C8Q C;  4QKU A;  1UB4 A;  1TU0 B;  5EG2 A;  2OTL T;  4FCY A;  1F1B B;  1VQL Q;  4C8Q D;  1VQ9 A;  4JUV A;  2LP5 A;  4HKE A;  5AYF A;  3QDR B;  1M1F A;  2X3W D;  3UF4 A;  1C6V X;  1WQ7 A;  3ZFJ A;  1KHC A;  2KMT A;  1E6H A;  2L8D A;  5KYN A;  5CKF A;  2A37 A;  4D6W A;  2M51 A;  1ZLM A;  1AWX A;  3CCV Q;  1K73 U;  2KYM A;  5A0L A;  4CI0 C;  5GAM d;  4C92 E;  1M1G A;  1YIJ T;  3G4S T;  3ME9 A;  4LUE A;  4QVZ A;  1XQH A;  2DTH A;  2O4X A;  2PU9 B;  2VKN A;  3OYB A;  2COZ A;  4DQ2 A;  1TWB A;  2YUP A;  2HQX A;  1PD1 A;  4M75 F;  2PUK B;  2EYX A;  3FEO A;  1OUL A;  4FYY B;  2DNU A;  2YXY A;  1LVK A;  3VU3 C;  5I21 A;  2QI2 A;  4B6M A;  5DM7 R;  5D6Y A;  2M0O A;  2DEQ A;  1ZUK A;  1IZ6 A;  3X28 B;  3CME Q;  1VQO A;  1OX8 A;  1RAH B;  2HKN A;  3NTI A;  2O2O A;  5GAM e;  1M3C A;  3QJY A;  1PKS A;  2MCN A;  4Y28 E;  1V29 B;  2W0Z A;  1IO6 A;  3M53 A;  2EYW A;  3H6Z A;  2V8J A;  4M77 G;  3G6E Q;  3O5Z A;  2YUQ A;  5C6S A;  2FZG B;  3NMZ C;  1Y0M A;  4RMO A;  1KQS P;  5GAN j;  4KUL A;  2HD0 A;  2RMO A;  5GAO n;  3CCU Q;  3BY7 A;  1K8A R;  3X24 B;  3L2R A;  1FMK A;  4KH1 B;  3MEU A;  3C12 A;  2X3X D;  2P84 A;  1PD0 A;  2DL8 A;  4OP0 A;  1WHG A;  2KXC A;  4J83 A;  3CC7 Q;  2ZPG B;  1YJ9 Q;  3SEM A;  3NFC A;  1S72 A;  3A5Z B;  2MOX A;  2QTV A;  3M58 A;  4F04 B;  2QA4 A;  3QYG B;  1OX9 A;  5GAN h;  1D3B A;  3CPW S;  3S6W A;  5IAY A;  5GMK e;  3C95 A;  1BI3 A;  2FZC B;  1YIT A;  1NYG A;  3J7A F;  2RD1 A;  3E1S A;  1O75 A;  2LJ0 A;  4CC7 A;  1X2K A;  2WAC A;  1AT1 B;  3V8K A;  3OMG A;  4R55 A;  5FRM A;  4C8Q A;  2YUO A;  4HVU A;  2QQS A;  1Y96 B;  2J06 A;  2EGC A;  1R77 A;  2D1X A;  5FU6 B;  5HKC A;  2KNB B;  3BFM A;  4O5V A;  4DBH A;  2KRN A;  2XDD A;  1AD5 A;  5AT1 B;  3A1P A;  4XK8 E;  5GJW B;  1ZA2 B;  4M78 E;  2CP3 A;  3L2Q A;  3EFR A;  4OMP A;  5IHI A;  1JJ2 P;  4M7A E;  3DLM A;  4NL3 A;  4PKC C;  1QVG P;  1YI2 A;  2XIC A;  5J26 A;  3JB9 F;  3WXM B;  2RM4 A;  5FW9 A;  3V8J A;  3G71 A;  4RCB A;  3H0F A;  1I1J A;  2ABL A;  1ZBX A;  3THK A;  1MHN A;  3I5R A;  1WHH A;  4HA8 A;  2JTE A;  5KYX B;  3CCM A;  3CD6 A;  4N4I A;  4HCK A;  5C0M A;  2RJD A;  2LT1 A;  1ZSZ C;  5GAN g;  4IUP A;  3CMA T;  2RA2 A;  2XDB A;  5LJ5 e;  4FYW B;  2RQR A;  1S72 T;  4AG1 C;  1VQ8 A;  1OQK A;  2M16 A;  4Z02 A;  1Q7Y R;  2QA4 T;  2HSE B;  2LX9 A;  4M77 B;  3I56 T;  3CCR Q;  3PTA A;  4RTU A;  3CCE Q;  3A8M B;  3EFO B;  4IUR A;  4HT8 A;  1VQK A;  3MPU B;  3Q1J A;  3OYH A;  4DA4 A;  1YIT T;  2DRK A;  1BB9 A;  2L89 A;  2JT4 A;  2BTT A;  4FSX A;  2J6O A;  2ZPE B;  4C0D C;  1OPK A;  3OYD A;  3LWI A;  3L1A A;  4OGE A;  2KR3 A;  4FM4 B;  1K9M R;  2XG8 D;  4ANJ A;  2QQ9 A;  1MNE A;  1VQ4 Q;  1X6B A;  4A4F A;  4RTY A;  1VQ5 A;  3UDC A;  2JMA A;  2E3H A;  4C92 B;  2OJ2 A;  2XDP A;  4PFZ A;  1NPR A;  4KGX B;  2FZK B;  2RH2 A;  4GY5 A;  1KD1 C;  5DY9 A;  1RAB B;  1G2B A;  4X1V A;  3BDL A;  4D8K A;  2E12 A;  2JTM A;  2XI9 A;  3INZ A;  1XOV A;  3OYA A;  1M8M A;  1YI2 T;  2IVW A;  4F14 A;  1M1K C;  2DER A;  4WF2 A;  2HL5 C;  2DXT A;  2L3S A;  1NJI R;  1OU9 A;  5LJ5 j;  3L2U A;  1D1B A;  2BKD N;  1RAE B;  1OI1 A;  5GAN 2;  4AFQ C;  2A08 A;  5FWC A;  1YJN Q;  4OF1 A;  1N8R C;  3G71 T;  1G5V A;  1Y57 A;  2DL5 A;  2FRW A;  4XU2 A;  2J6K A;  1YHQ A;  1ARK A;  3CPW P;  3QUI A;  1TUD A;  4E7K A;  3FB9 A;  2XKO C;  3JCM b;  2EQU A;  1XNI A;  4KH0 B;  1BBZ A;  3FLG A;  2P4R A;  2EGA A;  4RTX A;  5GMK l;  5LJ5 h;  5CKH A;  1WHK A;  4J7F A;  1VOM A;  1E6G A;  1NLO C;  3RR6 A;  3I55 Q;  2FO0 A;  5GAN 7;  2LNV A;  4HCZ A;  2O9V A;  2NWM A;  3H0I A;  2DZ9 A;  1M5Q 1;  1WJR A;  2H3E B;  3JB9 G;  2Y90 A;  4JZ3 A;  5L8R E;  1OYX A;  3E19 A;  1PWT A;  2RI2 A;  4E7S A;  2LC4 A;  2BZ8 A;  3EHQ A;  4Z8A A;  2RJE A;  4QVC A;  1MV3 A;  1ZX6 A;  5EC7 A;  1YCS B;  1EFN A;  2ECZ A;  2MF2 A;  1PRM C;  3TCJ A;  2A3L A;  1UHF A;  4RG8 A;  1VQM A;  2YLB A;  1I5O B;  1D0Y A;  4KGV B;  2D6F A;  4DBF A;  2YWW A;  1Z9Z A;  1K4U S;  3OYG A;  2W10 A;  5LJ3 e;  1N6A A;  2NLU A;  1WPY A;  2JXB A;  5CQY A;  4PJO B;  1VQ5 T;  3S3N A;  1D1A A;  3ULR B;  2AKK A;  2FL7 A;  3LLR A;  3RMS A;  2K2V A;  2BE9 B;  2R5A A;  4DEY A;  2YSQ A;  2VC8 A;  2DK3 A;  4C8Q G;  3QSU A;  3SFM A;  2CZ7 B;  1X6O A;  1M27 C;  1YP5 A;  4FT2 A;  2PQW A;  1BCO A;  3EGU A;  3DLL A;  1NPP A;  3EGX A;  8ATC B;  2CDT A;  2QEX A;  4JPB W;  1UTI A;  2R58 A;  3VYG A;  2KRO A;  1YHQ T;  4RTV A;  4M78 C;  1X6G A;  2FYK A;  1Y07 A;  3J80 E;  3CPF A;  1AWW A;  1B3Q A;  3OYL A;  5LJ5 g;  5KCH A;  4M7A C;  3V7S A;  5GAN f;  2SRC A;  1NEG A;  3MP1 A;  1V1C A;  4M78 D;  4OMM A;  3M55 A;  3RNJ A;  1MV0 B;  3L42 A;  4M7A D;  2DD4 A;  1WDX A;  3MEW A;  4NL2 A;  2JUF A;  2RO0 A;  3EH1 A;  2OTL Q;  2QTX A;  3BW1 A;  1JO8 A;  3UT1 A;  3CCL A;  3QZ5 B;  4RCC A;  5KYU A;  5LJ3 j;  1VQ7 Q;  2F1L A;  2QQR A;  1VIF A;  3PE0 A;  2KRS A;  1HD3 A;  1M4Z A;  1TSF A;  2CSI A;  5IT9 E;  1BK2 A;  4R56 A;  4ESR A;  1J3T A;  5GJV B;  3VS5 A;  4GBQ A;  5KYY B;  3OQ5 A;  5CK9 A;  5GAN 8;  2CP2 A;  1M90 R;  3HPW A;  1VQM T;  4BY6 B;  1K8A C;  3O8V A;  3G4S Q;  3GNG A;  1GCQ A;  4LDX A;  1W2B S;  4QW2 A;  4ME7 A;  1BI2 A;  1O9S A;  1BYM A;  4DOW A;  4RTZ A;  2EJF A;  4J9B A;  2DD5 A;  5LJ3 h;  2KK4 A;  4MZM A;  4Z89 A;  2GFA A;  4JRQ A;  3QYH B;  1VQ6 A;  4NS5 A;  4ZTJ A;  1IXD A;  4X9C A;  4LDY A;  3GBQ A;  5FLX E;  2E70 A;  1NBE B;  2JS2 A;  7AT1 B;  4JLI A;  2Y4Y A;  2LNH B;  3HKS A;  2WSE E;  3E2U A;  1TH7 A;  1MMA A;  3FJ5 A;  2RJC A;  1K0X A;  2F2X A;  4IUT A;  2QEX T;  2HAX A;  1NG2 A;  3T9N A;  1ZA1 B;  2X4W A;  1D0X A;  3ZBD A;  4C92 F;  1WIE A;  4P5N A;  5HY6 A;  4N4H A;  3EG0 A;  1KQS A;  4E7Z A;  4OB2 B;  4WCI A;  3CBM A;  3JB9 H;  1OZ2 A;  3RBB B;  2MYS A;  1VQN T;  2ENM A;  3VYH B;  3L2W A;  1Q82 R;  4MDW A;  4C8Q B;  2HNI A;  4J9C A;  1TOV A;  3A8G B;  3QBY A;  1VIE A;  1ZQ1 A;  2P0Q A;  3CCL T;  2EVR A;  3PT9 A;  4X9D A;  5D6X A;  4F7U A;  2E5Q A;  1KG1 A;  5M9O A;  4JZ4 A;  1KC8 U;  1IGU A;  1AOJ A;  2L3R A;  5HK3 A;  5CIU A;  5FRO A;  4M78 A;  1P92 A;  2RHY A;  2P0K A;  4WTO B;  4M7A A;  3MHX A;  1X75 C;  2VVK A;  4OB3 B;  1GCP A;  3PVQ A;  5LJ3 g;  2VWF A;  2WSF E;  3ASK A;  1YN8 A;  4J9I A;  1CSK A;  3OYF A;  1PHT A;  5GAO q;  4DEX A;  2RI3 A;  2CT3 A;  3PFS A;  2C06 A;  3HL8 A;  1VQL A;  1AHJ B;  1WXU A;  2DL7 A;  3M57 A;  3JCM Q;  2KY9 A;  3S3M A;  4LD6 A;  4CC4 B;  2ROL A;  3GF5 A;  2EW3 A;  3JB9 I;  3EAE A;  2DRM A;  1UJ0 A;  3MET A;  3OYI A;  4C5E A;  2GGR A;  2HL3 A;  1Q7Y C;  4C0G A;  1RI9 A;  1FX7 A;  2K2M A;  4K11 A;  4PJM A;  2ED0 A;  1Q81 R;  2YLC A;  4KRT A;  1M8V A;  1X27 A;  2EYZ A;  1RI0 A;  4LN2 A;  4J6Y A;  3I9Q A;  2IPO B;  2CRE A;  3JB9 J;  3LYI A;  2X51 A;  2KAF A;  1JJ2 A;  1QVG A;  2X4X A;  1WHM A;  4Y91 A;  4PJO F;  2GCX A;  4EMH A;  1WA7 A;  3GOX A;  1WFW A;  3CCQ T;  2E6Z A;  4O6J A;  5LJ5 f;  1G83 A;  3FIF A;  3SDZ A;  3JCM d;  1D0Z A;  1PKT A;  2HCK A;  4JLG A;  3CME A;  1D09 B;  3OY9 A;  1KC8 R;  2DET A;  3NHN A;  1QQJ A;  3CMA Q;  4PFP A;  4A53 A;  4BI4 A;  2DAQ A;  2MK5 A;  2ZPF B;  2DJZ A;  5GAN 6;  1V76 A;  2HBW A;  3MCA B;  4ELZ C;  3EG9 A;  3CCJ A;  1QVF S;  4M7D D;  1IB8 A;  1AWJ A;  2QA4 Q;  3DKM A;  3QHS A;  2ROT A;  3FDR A;  3I56 Q;  3AHU A;  1QLY A;  3P8B B;  3HRT A;  3OYC A;  1KHI A;  2RHZ A;  1YCY A;  1UDL A;  2ESW A;  2YHT A;  1LJO A;  3EG2 A;  3KXT A;  4BE2 A;  3OYY A;  2CH4 A;  1NJI C;  4C92 G;  1VQ9 T;  4ZTF A;  1SG5 A;  3M0Q A;  2FPE A;  3MKD A;  2E6N A;  3PIP A;  2RJF A;  1X2Q A;  3VS4 A;  1Q7Y U;  2KE9 A;  4M75 E;  2HBP A;  1YJ9 A;  2M0Y A;  3PGG A;  5GAM j;  2OTJ A;  4A4K A;  2EQK A;  2ZPI B;  1A0N B;  1OOT A;  1HK9 A;  3A8O B;  1VQL T;  2LTO A;  4E47 A;  4FW1 A;  4B9W A;  4QT7 A;  4E6R A;  5CKD A;  1M2V B;  4GLM A;  3CXC S;  4F7U E;  4JJD A;  2V26 A;  2COW A;  1HSQ A;  1D1C A;  2RQW A;  4IIO A;  4J9D A;  2GTO A;  1PNJ A;  1VQO T;  4J6X A;  1YI2 Q;  1RAG B;  3OA6 A;  1NEB A;  4J8O A;  3C94 A;  5A0G A;  5GAM h;  1K9M U;  3JCM c;  1CKB A;  2KT8 A;  3X26 B;  2KI7 A;  1LCK A;  2QQB A;  1MUZ A;  3QZ9 B;  1YBY A;  3M0P A;  2I2L A;  4ZGJ B;  3G71 Q;  2LRQ A;  2PZ1 A;  4LD9 K;  2V1Q A;  3E9G A;  3VS0 A;  1KQ1 A;  1UJY A;  3DB3 A;  1MMD A;  4FIB A;  1FYN A;  1JQQ A;  2I0N A;  4J9G A;  5GMK j;  1ZSZ B;  4ZGD B;  3CME T;  4JS5 A;  1ABO A;  2JN0 A;  3FJP A;  1NJI U;  1U3O A;  2LJ3 A;  1I4K 1;  1N9S A;  2O88 A;  3CEY A;  1SSF A;  1H64 1;  3CPW A;  4OML A;  4L5G A;  1B07 A;  4XAX B;  1SRM A;  3NTK A;  3CCJ T;  3C0C A;  3N5B B;  3HRU A;  2F2V A;  3AT1 B;  2FRY A;  2X4Y A;  2HZY A;  2F5T X;  1C0M A;  1BCM A;  3CBO A;  2LVM A;  1VQP Q;  2L3Q A;  4PJO G;  3OYM A;  4Z88 A;  1JEG A;  5GMK h;  2O9S A;  2RHU A;  4C0D B;  4L6V 5;  1JXO A;  5LJ3 f;  3GNF B;  2PVO B;  3GLX A;  4M7D A;  3EGX B;  1Z9Q A;  3CXC A;  2KSS A;  4C8Q F;  1YJ9 T;  2OTJ T;  2JZ2 A;  4PNO A;  2D0N A;  1WJQ A;  5CKE A;  2YRV A;  2DFU A;  4M78 G;  3VS2 A;  4VUB A;  3TVT A;  2A36 A;  4LDW A;  2WSC E;  4J5Y A;  3FRN A;  5I2M A;  2EQI A;  3CCE A;  2AT1 B;  2DL3 A;  4EMG A;  2K9G A;  2DO3 A;  1PG5 B;  4AG2 C;  1WX6 A;  3OS2 A;  4M77 D;  5GAM g;  2AK5 A;  1AVZ C;  1UE9 A;  2KXD A;  1JU5 C;  3MEA A;  1U1T A;  2QGF B;  3CC2 A;  2OAW A;  2HMA A;  1X43 A;  2G3R A;  3EH2 A;  3JCM W;  4JRI A;  2HSP A;  1IRX A;  4A4H A;  4C0Z A;  2LMJ A;  1QVF P;  3LX7 A;  1LNX A;  1QP3 A;  4HVW A;  3OS1 A;  2B8A A;  1VQ4 A;  3CC4 A;  1YHQ Q;  1DJ7 B;  5KCO A;  3VRZ A;  2BUD A;  3OBY A;  1YJW Q;  4GLK A;  1BI0 A;  2OAU A;  3MJX A;  1HXD A;  1IHV A;  1TG0 A;  4F17 A;  3M0S A;  3CCM T;  3CD6 T;  2K4Y A;  1EX4 A;  4XTY A;  1SF9 A;  4KT0 E;  5CR2 A;  1LOJ A;  2VGN A;  1QCO A;  2F69 A;  2MWO A;  1SEM A;  1RAI B;  1M2O A;  1GCQ C;  1VQ8 T;  1YJN A;  2IIM A;  3H41 A;  2CZ6 B;  4EIK A;  2BZX A;  2CGH A;  3OSV A;  2SEM A;  5DLQ E;  2QK0 A;  3RKY A;  3RKW A;  1CKA A;  4AFU C;  3H0H A;  4E7L A;  1T0H A;  3CCS A;  5IXB A;  1VQK T;  1I8F A;  3CXC P;  5KYW A;  5KH6 A;  1MMG A;  5GAO p;  4M4Z A;  4L59 A;  5GAO r;  1H8K A;  1VQM Q;  2HDA A;  3QDF A;  2K7A A;  2EYY A;  2J05 A;  2DYB A;  1R8O B;  2AZS A;  2CZ1 B;  5GAO m;  4IKF A;  1ZUU A;  1BIB A;  1TS9 A;  1WJS A;  3J81 E;  2C0T A;  4A4G A;  2M9U A;  1M90 U;  5FRN A;  2E65 A;  3V7R A;  3HFN A;  4JJC A;  4M75 C;  3RKX A;  3QWY A;  2FVU A;  2CKK A;  4AFS C;  1VYU A;  1LPL A;  2ED1 A;  3UWN A;  4J9H A;  1T3S A;  5LL6 S;  4AMC A;  3CC2 T;  4OMO A;  4M75 D;  1G3Y A;  4F7U B;  4Q5W A;  2V1R A;  3MO8 A;  5I11 A;  4M7D E;  1FMV A;  2LJ1 A;  3NPF A;  4M78 B;  3CC4 T;  2GFU A;  4M77 A;  3M56 A;  2CP0 A;  3KFV A;  3UA7 A;  2K79 A;  3OS5 A;  4M7A B;  1OPL A;  5GAN 5;  3EFO A;  5D6W A;  2FB7 A;  3M59 A;  3MEV A;  1JBM A;  4QVD A;  1VQN Q;  3TU4 K;  6AT1 B;  3VS6 A;  3OYJ A;  3RUX A;  3L2V A;  5CVI A;  2DJQ A;  2L3P A;  2ZZD A;  1RAF B;  2EBP A;  3SHW A;  2O4X B;  3NTH A;  3OBW A;  1YJN T;  5I2S A;  2MI6 A;  4XU3 A;  1NM7 A;  2DVE A;  1Q81 C;  1PSE A;  2RQU A;  4AT1 B;  1VYV A;  1Q82 U;  2HEQ A;  3CCS T;  1KSW A;  4KUI A;  3QWX X;  2RQT A;  3LH5 A;  2E10 A;  2YUN A;  4ZN1 A;  2NUP A;  2JNG A;  2JMC A;  4ZGE B;  1NE8 A;  1KD1 R;  1QW1 A;  1I0C A;  2MPX C;  2NUT A;  1YIJ Q;  3OW2 S;  4PK4 A;  1KC8 C;  4EDU A;  1IRE B;  1VQ7 A;  4BUG A;  4DBQ A;  1BKB A;  4E2F B;  1M1K R;  1QP2 A;  4RUG A;  4PJL A;  4A63 B;  5GAM f;  5J3B A;  1UGR B;  1U06 A;  2VV5 A;  4FSS A;  4AFZ C;  2DYI A;  2DBK A;  1WZO A;  3R6O A;  1N8R R;  2RI5 A;  1FWZ A;  2BE7 D;  3EG9 B;  2LCS A;  4EMK C;  2CSQ A;  2XID A;  1YFN A;  1UUE A;  1PC0 A;  5FU7 C;  2EYQ A;  4RKU E;  3JCM V;  1D3B B;  2MIO A;  3CCQ Q;  1R0B G;  1H3Z A;  1PRL C;  3OMC A;  1W70 A;  1GRI A;  1TUG B;  1EZZ B;  3HP9 A;  1QWF A;  2PUO B;  1Q81 U;  2DLP A;  4M75 A;  1KIK A;  1G3S A;  2RQV A;  4F16 A;  3OYE A;  3JB9 D;  4BD3 A;  1WLP B;  2EKO A;  4OGC A;  5IHN A;  3RES A;  4J7I A;  3S3O A;  1U1S A;  3MP6 A;  2JTF A;  2O31 A;  3VS3 A;  3SWN C;  3X20 B;  2FG0 A;  3VJP A;  5GAN d;  1ABQ A;  4FU6 A;  2L5Q A;  4LUD A;  2MAM A;  1N5Z A;  1WQW A;  3M4Y A;  2IG0 A;  1VQ9 Q;  3UPU A;  2GTJ A;  1XTD A;  3EFS A;  1SKU B;  2C0O A;  1W2B A;  3EGD A;  1WI7 A;  4M77 E;  4J9E A;  5IHK A;  4V2S A;  1N9R A;  3C4S A;  2RF0 A;  3M0T A;  3JCM J;  4Y92 A;  2DM1 A;  1VUB A;  2LQW A;  3NGP A;  5GAN e;  3A8L B;  2CZ0 B;  2A0F B;  1MMN A;  1VQ7 T;  1TTH B;  2K57 A;  3QII A;  9ATC B;  2OX7 A;  3QKJ A;  3TQ7 P;  1S1N A;  4BI3 A;  4ZN3 A;  3ZEH A;  2DZC A;  2D8H A;  4IUV A;  1VQ6 T;  1BU1 A;  2AIR B;  1QCF A;  2FPF A;  4KBM B;  3QPH A;  1MGQ A;  5HK0 A;  1VQO Q;  4IIM A;  2GQV A;  2G6F X;  4QQ6 A;  2D0Q B;  4LNP A;  3CCV A;  1H92 A;  2V8K A;  2DA9 A;  3TSW A;  3QXE B;  4ORZ A;  2EAY A;  3GP8 A;  2CT4 A;  1Q86 R;  1BI1 A;  1B34 A;  1WYX A;  4OVA A;  3PMI A;  4M7D B;  1RAA B;  2ATC B;  2J7I A;  4M7D C;  5KYY A;  1GFD A;  1K9M C;  2GNC A;  3QJ6 A;  3RMQ A;  3VV0 A;  4EMK A;  3EG3 A;  3CCJ Q;  5IXF A;  2O01 E;  1M3B A; 
#chains in the Genus database with same CATH homology
 1YFN A;  1ZSZ C;  1OU9 A;  2QAS A;  1OUL A;  1OU8 A;  1OX8 A;  1ZSZ A;  1OX9 A;  1ZSZ B;  2NYS A;  2QAZ A;  1TWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...