2QASA

Crystal structure of caulobacter crescentus sspb ortholog
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'PPEDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSVQFALQFSAPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Hydrolase activator
source organism Caulobacter vibrioides
publication title Crystal structure of Caulobacter crescentus SspB ortholog
rcsb
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2qasA00
1OX8A 1TWBA 2QAZA 1ZSZC 1ZSZB 1OU8A 1OULA 2NYSA 1YFNA 1OU9A 1OX9A 2QASA 1ZSZA
chains in the Genus database with same CATH superfamily
2EJ9A 2RJFA 3OW2A 3CCLQ 1X43A 2CP0A 4N4GA 3TSZA 2AKKA 3JCMc 2OTLA 1KJWA 4M77D 2LQWA 1X6BA 3EGXB 2RQVA 1AEYA 2XIDA 3LWIA 3DLLA 2EGAA 1PC0A 2DA9A 3OYEA 2DE0X 3VUBA 1MMDA 4CI0C 3OYFA 3QWYA 5L23A 4J9HA 1PSEA 2GCXA 4XU1A 1FXXA 1M1GA 1YITT 4J9BA 4OVAA 3X24B 3WXMB 3TCJA 3EG2A 3VRZA 1HD3A 3MP1A 3J7AF 1QVPA 1FMWA 1IREB 3EAEA 3I55Q 2R5MA 2K5IA 3MCAB 2KDSA 3WVEB 4A4EA 2DERA 3M4GA 2VASA 1WXBA 2ZPHB 5GANg 3KBGA 4FW1A 3HFNA 2O88A 1YN8A 3BW1A 2SEMA 3OYGA 4BDYA 3TSWA 3X26B 5FROA 4A4GA 2LZ6B 2QQBA 3JCMW 2M0OA 1O75A 3CBPA 5CR2A 3QG1A 1AZGB 3VU3C 4DOVA 1QW1A 2RMOA 2J7IA 3HPWA 1NG2A 4N4HA 2QASA 3CPWP 4R0KA 1YITA 2RO0A 3MKDA 1K8AU 2HZYA 1ZUKA 3QWXX 4ORZA 5GAN5 1D0XA 2RQRA 1TUGB 1X6GA 3C12A 2RI2A 4M75C 4BI3A 4DA4A 2DZCA 3VS1A 3S3OA 1BYMA 3JB9G 2HEQA 3N5BB 1I81A 1JO8A 1NPRA 3QPHA 4XTUA 3GNGA 1QKWA 5GAMe 3ZL7C 1VQMT 3REAB 2GGRA 1VYVA 1VIFA 3PNWC 2QYZA 4J9IA 4DOWA 4XU0A 1AWWA 5DLOA 4FM4B 1MUZA 1SSFA 1OYXA 1TUCA 1AWOA 2KNBB 4F7UF 4XTVA 3M57A 4B9XA 1EFNA 3HRSA 2LQNA 1ZSGA 2EIFA 3G7ZA 5GAMj 5IT9E 2DVJA 2EAYA 4J6WA 2ABLA 1OOTA 2IG0A 4FYYB 3QUIA 2QGGA 5LJ3j 3JCMQ 3JB9F 2QA4A 2L3QA 1RI0A 2CZ6B 2KRSA 3SB2A 1N8RR 1S72Q 3OS0A 1VQMA 2C06A 3CC4T 1NE8A 4LDUA 5FLXE 1H92A 2RH2A 2KEAA 3HSBA 5M9OA 1M90R 3C4SA 2DL4A 1Y57A 1U06A 3EGXA 1MNDA 3UA7A 2M1HA 5LJ5d 1M2VB 1Y07A 4LNPA 2BE7D 4KH0B 3E9GA 3CCQT 2EKHA 1JJ2A 4MZMA 2X4YA 3H41A 1GXIE 1K9MC 2IIMA 2NWMA 1WXUA 3MHXA 2DRMA 3FLGA 3GNFB 4D6WA 1MGQA 2CP3A 4C5EA 1VQ7T 1SEMA 4LDWA 2JTEA 2LX7A 5I22A 2XDBA 4XU2A 2COYA 1GFCA 2DYIA 2XI9A 4M77A 3PE0A 2WSCE 4M75G 2QA4T 2E1HA 4C8QD 3L2UA 5KYWB 2MOXA 3EH1A 3GOXA 2AZSA 3MEWA 4GLMA 1HXDA 2KY9A 2LRQA 4NL2A 5KCHA 3U23A 1ABQA 4JJDA 1YWPA 3CCQQ 4HCBA 3OA6A 4AT1B 1YFNA 3LGLA 3HRUA 3A8OB 2D8JA 4HA8A 2E3HA 1I07A 5GJVB 3EHQA 1WNLA 3CCQA 5A0DA 4M75D 3JSCA 1K9AA 1SRLA 4M7AB 2KSSA 2JUFA 3JCMf 2HSPA 1BU1A 5IAYA 4LD9K 1FYNA 3RESA 1M27C 1VQ7A 4ELZC 3L42A 3WVDB 1U1TA 2OI3A 2E6NA 3O5ZA 2V26A 4ZGDB 2DL5A 2V8IA 2LT1A 2R5AA 3OYLA 2P0KA 1M90C 3OYYA 4JRQA 3LLRA 4M78A 2BTTA 1WHMA 2YXYA 2P84A 2DJZA 3OYJA 3LW5E 1WZOA 2E41A 1AOJA 3L2QA 1OPKA 5FWBA 3CC2A 2RK2A 4MZPA 1IHWA 2HDAA 4C92F 3L2VA 3M58A 1K4US 1E6GA 1M1KC 1UEBA 3PVLA 5FU6C 2LNHB 3VS3A 4JZ4A 1JQQA 4FCYA 2HQHA 3CCEA 4QVDA 2NUZA 2XMFA 1H3HA 1RUWA 5IH2A 4M77F 2QQSA 1EX4A 3JCMV 2YUQA 4ZGJB 4EMGA 2LCSA 1JRIA 2DEUA 2ZGWA 5CQYA 1QCFA 2E70A 4LE9A 3CMEQ 2A08A 5FW9A 4M77C 2F2WA 1Q82C 4YTLA 2RA2A 2L3RA 1VQ6A 3JCMh 4M7DE 1ZA2B 2QK0A 2W10A 1K76A 3CC2T 4E7JA 1YJNA 4QW2A 2X4JA 2O9VA 1NEGA 2RQUA 3I9QA 3C0CA 3E2UA 4LDYA 4M78C 2K7AA 1RAFB 5GANf 2F1LA 1M90U 4M77E 4NOYA 1FMKA 3LYIA 3SWNB 3EFOB 1KHIA 4C0GA 1NLOC 2RPNA 4LDXA 1UG1A 1BIBA 5DM7R 5CK9A 1GRIA 2LC4A 5CCAA 3GIBA 3OMCA 2KVQG 1FMVA 3L2WA 2DIQA 1VQ9A 3VJPA 2GTJA 2ENMA 4HKEA 1MV0B 5GAMf 1Z9ZA 2KMTA 1WHJA 4DQ2A 4M7AC 3O8VA 5LJ5j 2RM4A 1X69A 1T0JA 4AMCA 1TG0A 2RD1A 1X27A 5GAOl 1PG5B 3FJ5A 1X75C 4ELYC 2AK5A 3SD4A 2Y4YA 4V2SA 1VQ4T 1MMGA 3CCLT 1W2BA 2RHZA 3OYMA 3HL8A 3CCSQ 4EMKC 4L5GA 1IGUA 2DK3A 2IPOB 2P0PA 1SSHA 1UECA 4RTXA 2DL8A 4J7FA 1C0MA 3OS2A 2H3JA 2KRMA 3CQTA 3VUZA 1Y96A 2X51A 4RCBA 2D9TA 1QP2A 2COZA 3P8DA 4JS4A 4QKUA 5CAIA 1YJWQ 2YSQA 5A2QE 4HXJA 2PVDB 2B86A 4BI8B 3OS1A 3CC7Q 2FRYA 1G3TA 3CCUT 1YJWT 2NUPA 3QJYA 4Y28E 2OTLQ 4XTZA 1WPYA 1N6AA 1PCXA 3C95A 1JB0E 2CH4W 5IXFA 4AG1C 5CKHA 1K8AR 5HKCA 1D1AA 2A28A 2DVEA 1H8KA 2I2LA 4J9EA 1PWTA 3VRYA 2K3XA 2FZKB 1VIEA 1UFFA 2LMJA 3BE3A 3FEOA 3MP6A 2MK5A 3PIOA 5LJ3e 4J6XA 1JBMA 1WFWA 1GCPA 2ROTA 2DKGA 1Q81C 2YWWA 4OMLA 1VQNQ 1KG1A 3EGDA 2OAUA 2KQWA 1RLPC 3GLXA 2X35A 1B7TA 4JJCA 5D6XA 4PJOC 1PRMC 1N8RC 1R0CB 1YJWA 1WYXA 4BUGA 1UGPB 2WACA 2EW3A 1LOJA 4E7HA 1Y0MA 3EG1A 3G71Q 1UGSB 1WJSA 1BK2A 6AT1B 1PKTA 3KUFA 3FDRA 2CZ1B 4OB3B 3QKJA 1JJ2P 3SFMA 2HBPA 4QQ6A 2LQKA 4LDVA 4N0AC 2O31A 2RHUA 4EMHA 1KD1R 2BZ8A 4II1A 3EHRA 3CXCA 4M75F 2K3BA 1Q95G 5KYXA 3CC4A 2JM9A 4C92A 3M53A 1X6OA 1VQLQ 3M0UA 3JCMe 2HKNA 5CKDA 1SRMA 4J9FA 5LJ5g 1BIAA 1YJ9A 2FPEA 3EGDB 2J05A 2CUDA 1F1BB 1M3CA 3PGGA 3ZEHA 1N9RA 5KYXB 4HCZA 5CKEA 3CCVA 1UHFA 1K1ZA 4CC3A 3JAME 1QVGS 3UDCA 2VUBA 3MEVA 2I0NA 2F5TX 2RJCA 3A98A 2EQJA 4R55A 1UHCA 3VYGA 4R56A 4M7AG 3I56T 3S6WA 4M7AE 1W2BS 2RHYA 3MEUA 4LUDA 2V8KA 2CP5A 4E6RA 4C8QG 3MJXA 1I0CA 2KT8A 1LVKA 1E7OA 2ATCB 2E5QA 1BKBA 4KULA 1B34B 2MMPA 3NMZC 4AFQC 2L8DA 4M77G 2X3WD 2DYBA 5L8RE 1C1AA 1XNIA 4RTTA 4MMLA 2WSFE 3THKA 4C92D 3CXCS 4KGXB 3CCVT 3OBWA 4D8KA 1VUBA 2CP6A 4XTYA 1YITQ 4FSSA 2RQWA 4A54A 2EPDA 1Q81U 3HP9A 1D1CA 1UUEA 4PJLA 1YI2A 2JNGA 4NS5A 3VS2A 3RERA 4IUTA 2EQKA 4Z88A 3I56Q 4M7DA 2QQ9A 2KGTA 2MYSA 3G4SA 5D6WA 1R77A 2LJ1A 3PVQA 3SWNC 4MDWA 2RNAA 4OGCA 2F5KA 5J3BA 2YRCA 2K2MA 1QWFA 3EG0A 1D0ZA 2LP5A 2LCCA 2DJQA 2Y4XA 1WA7A 5KYYA 1C6VX 1KQ2A 2RHIA 1OEBA 1VQ6Q 2ESWA 4KT0E 3QO3A 2HNIA 2DAQA 1IHVA 4NL3A 3FIFA 4ZTFA 4AFSC 1NYFA 3GP8A 2DTOA 2E3IA 4F04B 2EQMA 5GAN4 1ZBXA 1QCOA 2HAXA 1E6HA 4JPBW 2ZPIB 4FU6A 5ECAA 2QEXT 4OB0B 3FRNA 2RI3A 3G4ST 3HKSA 1QVFS 5KH6A 3EG9B 2EYZA 1G3SA 2D0QB 3CMEA 2ZAEA 4TVRA 1BI2A 1U3OA 3VS5A 1TS9A 2J6KA 1WHLA 4RCCA 1KIKA 1GCQC 3OW2P 2KYBA 2GF7A 2GQIA 1VQ6T 1SHGA 2LX9A 5A0GA 4RTYA 4XQ3A 1YJNT 3CCRT 2CP2A 2DLPA 2C0OA 1LJOA 1AHJB 3CXCP 4M75B 4LXCA 3TVTA 1KSWA 1UTIA 2K9GA 3AHUA 2VXEA 4M7DG 4AFZC 2FG0A 1NM7A 3JB9I 2QDLA 2RF0A 1I5LA 3HHTB 1EIFA 2QEXA 3QJ6A 2HL5C 4M78D 2ZPFB 4M4ZA 5I2SA 4C5GA 3FJPA 3EFRA 1RAIB 2E6ZA 5GAN7 1K73C 5J39A 1NZ9A 3CMET 4FIBA 1VQ9T 2ECZA 2L3SA 2PUKB 1NJIR 4OP0A 1R8OB 2LQ8A 4F17A 2YLCA 4E7KA 2X4XA 2EYWA 2JM8A 2DFUA 1GFDA 4FYWB 4RTWA 3QHSA 2DL7A 2EWNA 4F14A 3JV3A 2O4XA 3ASKA 4C0DC 2O9SA 1VQKQ 1IB8A 1TWBA 2LCLA 1Y96B 2XICA 2L5QA 1KQSP 2DRKA 1T0HA 3QZ9B 3LH0A 4E7LA 3BFMA 1Q81R 3G6EA 1VQ4A 4WCIA 3CCLA 3AT1B 1W2BP 2H3EB 2AT1B 2H8HA 1VQKA 4OB1B 3CPWA 1KD1U 1YCYA 1K0SA 2AKLA 1TUDA 3ZFJA 1XQHA 2VVKA 4X9CA 4M7DF 1M1KR 2QG9B 4PJMA 4QQDA 1WI7A 1KQSA 4JLIA 3CBOA 4LD6A 1PD0A 1KQSS 4X34A 2MWPA 4AFUC 4PFOA 4BI4A 3RDVA 2NUTB 2E64A 2DO3A 2CGHA 1KC8U 1WQWA 2GQVA 3OQ5A 1YWOA 3CCUA 1NJIU 3UPUA 1X01A 2NUPB 1IZ6A 3G6ET 5I11A 2EQUA 1UJ0A 3A8MB 5LL6S 1VQKT 2EBPA 3SHWA 1SPKA 5KYNA 3FC3A 2R57A 3G6EQ 1KC8R 1PM3A 3OSVA 1QMCA 4ZN1A 1M9SA 2YRDA 4ZN3A 4KGZB 1NPPA 2KXCA 1TTHB 1W70A 2JOYA 4A4HA 4F7UG 4JRIA 1W4SA 4Y92A 1OI1A 2G6FX 3HFOA 2YHTA 5GAN2 4WF2A 3PIPA 1YIJT 4DBFA 3MP8A 1D3BA 1Q7YR 2DNUA 3CCEQ 3JRZA 1ZQ1A 2FHDA 1H641 2K2VA 5KE3A 4IIMA 5CKFA 4PJNA 5KE2A 3VKIA 5IHNA 3P8HA 1Q7YC 2FO0A 3CMAA 4CC4B 3JCMb 4PJOD 4DBQA 4WTOB 2P4TA 1VYTA 2DD4A 4C5IA 2DM1A 3DLMA 4X1VA 3CCUQ 1AT1B 2OX7A 4D8DA 2AIRB 2JS2A 4C8QA 2PNIA 4KRTA 4PLLA 1WLPB 4FT4A 1WXTA 2GTOA 2D6FA 4A4FA 1VQPA 1K73R 4N4IA 1HJDA 2KBTA 1W1FA 3H0IA 4IUQA 1XOVA 1KHCA 2QAZA 2QI2A 2AZVA 4J83A 2VC8A 1P92A 1QVGP 1YJ9T 1H3ZA 1Y7XA 4N0AA 2C0TA 1YIJA 4E7IA 2JXBA 5C6SA 2VKNA 1WHKA 2YUOA 3GPLA 4RTVA 3H9NA 4A63B 2KI7A 2JW4A 3JCMd 3QDRB 4BACA 1RABB 3RKYA 5FRNA 4RKUE 3OW2S 3I56A 1VQ5A 2LDMA 5FU6B 4ZTJA 1BB9A 2A7YA 4FL6A 5KYWA 3S3NA 2RB6A 3PFSA 1BI0A 1RAEB 1WJQA 3OB9A 1V29B 1ZA1B 4PNOA 2KROA 4C92B 1VQPT 3M0QA 1VQ8Q 4B9WA 2DEQA 1LCKA 4O6JA 2KR3A 5FWCA 1VQNT 1KC8C 1TSFA 3OYIA 1OULA 5LJ3h 1PRLC 2MIOA 4IUUA 2QQRA 2K5LA 4BE0A 4OB2B 2MPXC 5HK0A 2CH4A 2DZ9A 3OSSC 5I2MA 2RN8A 4J8OA 2EKOA 3CCSA 3A8GB 5LJ3f 1HK9A 1YI2T 2L0AA 4F7UE 1VYUA 1VQ5T 3M56A 2FZGB 4Y91A 4Z89A 3EFSA 2O01E 1M8VA 4HCCA 5AYFA 3CD6T 4M7AF 2XG8D 5GANh 5HY6A 1D3BB 1XJWB 3X28B 2DTHA 1D1BA 3HRTA 4HT9A 1VQNA 1YI2Q 1BCMA 1K8AC 4M75A 2EJFA 4MZTA 1ZSZC 3RNJA 2ZPEB 1FWZA 2AHJB 4QQGA 5D7UA 2V8JA 2EGCA 4AG2C 3BDUA 1UDLA 1U8RA 2DPPB 1VQOQ 3QZ5B 4F16A 1ARKA 5IN1A 3V7RA 1RL2A 3CCST 3CPFA 3JB9H 2M16A 1SKUB 1QQJA 2KT1A 3M0SA 4QT7A 2ED1A 4FYXB 1FX7A 1VQPQ 2HSEB 1RAGB 1PNJA 3URGA 3OYNA 4Q5WA 1I8FA 4PL6A 2D8HA 3CD6A 3SDZA 1DJ7B 4E47A 5HCKA 4RG2A 4XU3A 2JT4A 4BY6C 2ROLA 2DTIA 3KXTA 4EDUA 3PT9A 2A0FB 4HT8A 2E12A 4FT2A 1W6XA 2RI5A 2VWFA 4RG8A 1D0YA 5GMKe 4ME7A 2FPFA 1S72A 4MMKA 1VQMQ 3OBYA 3UF4A 3CCRA 1TU0B 5LJ3g 3CMAQ 3ZBDA 2EYQA 3META 1RADB 2MCNA 1MHNA 3OYBA 3LWHA 2YUPA 1Q82R 4L59A 4J9GA 1VQOA 2P4RA 2MAMA 4PLIA 2L89A 4JJNK 2RHXA 3LH5A 4C92C 2X3XD 2A36A 4CC2A 2DL3A 2MI6A 2DILA 4EMKA 5KYYB 1Z9QA 4RTUA 2EGEA 3Q1JA 1XTDA 2A37A 9ATCB 2BKDN 4KUDK 4OMFB 3J81E 3CPWS 5DLQE 4VUBA 3QBYA 3H0HA 2HCKA 4JUVA 2B8AA 3M9QA 1OU9A 1UGVA 4DBRA 5LJ5f 2NYSA 4Z02A 5J26A 2DXUA 1TXQA 1IGQA 1M30A 5GAMh 1UB4A 1SHFA 4E7SA 5GAN8 4M78G 3EGUA 2E10A 3NTHA 5GMKi 1YHQT 5GAOm 3GF5A 1VQ8T 1N9SA 4QVZA 4IIOA 3I55T 1RACB 4KGVB 4XTWA 5IHKA 2GFAA 2PU9B 5LJ5h 1RAHB 3E9FA 4PJOB 5GJWB 1QCNA 2SRCA 2V1RA 3CCMQ 4OMMA 1QLYA 4JRPA 1HSQA 4JZ3A 1M3AA 1N8RU 2O2OA 2YT6A 5KYUA 1SG5A 4C8QB 4PJOE 5GMKl 1OX8A 2PZ1A 4EPCA 2OAWA 3I5RA 2D0NA 3LGFA 1J3TA 4GY5A 2LT4A 3EH2A 3BDLA 3M0PA 1QVGA 4C8QC 5GANj 5GANe 2FB7A 1Q86U 2EYYA 2KXDA 3CC4Q 2CZ7B 2M51A 2YDLA 1CSKA 3DKMA 1VQLA 3CCJQ 1NLPC 3JCMJ 3SWNA 3H0FA 3VS0A 5FRMA 4O5VA 3OYCA 1ACMB 1YHQA 1ZHIA 3H8ZA 1VQ8A 2QQAA 2BZYA 3I55A 1QVFP 4CC7A 1PSFA 1M2OA 2HQXA 2RQTA 3V7SA 2FPDA 1OV3A 3G71A 2YRVA 2VXFA 1OQKA 3GBQA 2QGFB 5GAMg 3NPFA 2ZCFB 2DBKA 3E19A 5IXBA 3CCMA 1RLQC 1NBEB 2CDTA 3H6ZA 3NTIA 2EJGA 2E65A 4DBHA 3MPUB 3S3MA 1CKAA 1X2KA 4ZNXA 2DF6A 3RKWA 2BUDA 3L1AA 3QXEB 3M4YA 1YIJQ 2COWA 1G8XA 1UGRB 4BB7A 4A4KA 1YNZA 2QA4Q 1M8MA 3UWNA 4E2FB 5I21A 1IRXA 1G3YA 3EG9A 4L6V5 2KAFA 4XAXB 5CKBA 3CCJA 3CMAT 1MMAA 4E7ZA 4J9CA 1QWEA 2JTMA 3LX7A 3VS7A 1JJ2S 4P5NA 3M0TA 1WJRA 3OYHA 5GAN6 4JDSA 1QP3A 2KRNA 2QTVA 2PUOB 2DD5A 2CT3A 3CEYA 2XHCA 5EG2A 4BD3A 1IXDA 4XTXA 4RTZA 4RUGA 2K5FA 2KE9A 4GBQA 2QXFA 3JB9D 3CC2Q 1HYOA 8ATCB 1ZUUA 2FZCB 3NGPA 2A3LA 1PD1A 1ZX6A 1LPLA 4M78F 2ZPBB 4BE2A 1LNXA 3M55A 4Z8AA 4JRKA 2KK4A 3V7CA 5KYUB 4C5HA 5IHIA 4PFZA 1CKBA 3HTRA 3M5AA 4C92E 1M2VA 1RAAB 2F2VA 2RJEA 1ZSZB 1ZSZA 2DX1A 4OGEA 3CCJT 2LTOA 2XD0A 3I5SA 4M7DC 1UGQB 2R58A 3VV0A 4PJOA 2OJ2A 3A1PA 1R0BG 1WDXA 1KQ1A 4M7AD 4M78E 1ZBJA 2RK1A 3A8HB 5GAOp 3R6OA 1TH7A 3CCVQ 1EZZB 1JU5C 1T3SA 2X9HA 1AZEA 8AT1B 1VQ5Q 4PFPA 5D6YA 2EYXA 3REBB 3IQLA 2GBQA 1GL5A 1AWJA 2OTJT 1YHQQ 1AWXA 1WQ7A 2XDPA 2CS7A 2XK0A 3OYKA 4J6YA 5GAOr 1OPLA 2FYKA 4FSXA 1G5VA 4OMNA 2VV5A 1MMNA 2HQEA 5LJ5e 5EC7A 4BE1A 4GLKA 1VOMA 2Z0WA 2XKOC 2RJDA 3RMSA 4C8QF 1YBYA 1M3BA 2HD0A 3FB9A 2FL7A 4LUEA 4OMPA 2ED0A 4JJBA 1TOVA 3V8KA 4UC4A 1B3QA 1GCQA 2G3RA 4IURA 2ZPGB 3F70A 3L2ZA 2V1QA 2X4WA 3TQ7P 1KK7A 1O9SA 2BE9B 2BIVA 5CQXA 3CCRQ 4ANJA 2OTJA 5CVIA 5HK3A 4LN2A 5C0MA 4OMQA 1U5SA 7AT1B 1ABOA 1VQ7Q 2YLBA 4M78B 1X2QA 3QIIA 2HMAA 4PKCC 2LVMA 1AVZC 3INZA 2J06A 2EFIA 3R6NA 4BDZA 1Q7YU 3RKXA 2QEXQ 2D1XA 4XK8E 1K0XA 3OYAA 1NEBA 2K79A 1N5ZA 2MWOA 2JJ9A 3X25B 2QDYB 2DXBA 2YUNA 3T9NA 2KYMA 3NFCA 2BZXA 2J6OA 2HBWA 1S1NA 1M1FA 1D09B 4EIKA 1WGSA 4PJJA 1T3LA 2CSIA 4HVVA 1S72T 1NJIC 3PMTA 3NTKA 3E1SA 4DEYA 4PK4A 5DY9A 3V8JA 2NUTA 3UATA 2K6DA 3VS6A 3OMGA 3TU4K 1Q82U 1PKSA 2GFUA 1VQOT 1WX6A 3M0RA 3L2RA 2K57A 1UE9A 2ZZDA 3EG3A 4CRIA 2CT4A 2DXTA 1I1JA 3ER0A 2DMOA 2CYZB 5GANd 2JS0A 1QKXA 3JCMg 4DEXA 3CC7T 3OY9A 3JB9J 2M02A 2JN0A 3RUXA 1QVFA 1M1KU 4HVWA 3TEEA 2K4YA 3QDFA 3VS4A 2LJ0A 1M4ZA 4FYVB 1G2BA 2LNVA 4F7UB 4PJOG 1RI9A 3OS5A 5FU7B 2EVRA 1BI1A 3TREA 5KCOA 1IO6A 3SEMA 3VYHB 1KD1C 5GAMd 4M7AA 1V1CA 4OMOA 5CIUA 1ZUYA 2E5KA 2JTFA 3BY7A 2HKQB 1WHGA 2CREA 2K3YA 5FU7C 1OX9A 4KH1B 2CZ0B 4OF1A 3A8LB 4M77B 1YCSB 1GBRA 1I5OB 2M0YA 1SF9A 2C0IA 1B07A 2DXCA 2JZ2A 3P8BB 2XDDA 2MF2A 1MNEA 2CUBA 2JVVA 4QVCA 4HCKA 2XU8A 1NYGA 3CC7A 2OTJQ 2LJ3A 3RIRA 2VGNA 2DBMA 2HL3A 4KBMB 1VA7A 2WSEE 2L3PA 4C92G 1B34A 1OU8A 3OYDA 4BY6B 3MO8A 1YJNQ 1M5Q1 2FRWA 1JXMA 1VQLT 2FVUA 4M7DD 3A5ZB 2VB6A 3KFVA 1BI3A 2E4HA 3MEAA 3X20B 1V76A 3C94A 1BCOA 4IKFA 2F2XA 1K73U 2CSQA 2M9UA 3DB3A 2EQIA 2CKKA 1JXOA 1YJ9Q 4J9DA 4FW2A 5GAOq 3ME9A 3JCMP 4JLGA 2VYTA 3G71T 1OZ3A 1GBQA 3CD6Q 3QYHB 2JMCA 3ULRB 1YP5A 3G1JA 4M7DB 1VQ9Q 2PTKA 1UJYA 5GAOn 3CCMT 3D7SB 3M54A 3UT1A 2J6FA 1K9MU 5GMKm 4IUPA 4J7IA 1A0NB 3PMIA 4HVUA 4PJOF 2IVWA 3RBBB 3RMQA 4F7UA 5CO7A 4X9DA 2PVOB 5AT1B 2L2PA 2VGMA 1KFZA 1Y71A 4RMOA 4MDXA 4J5YA 4KUIA 3RR6A 2JMAA 2PVGB 2DETA 1K9MR 2GNCA 3CCET 3NHNA 4C0ZA 2QTXA 5A0LA 3PTAA 3JCMX 1U1SA 2F69A 1PHTA 3V8LA 3J80E 5GMKj 1JEGA 3QYGB 4K11A 4A53A 1ZLMA 1BBZA 1N27A 1G83A 3I35A 1WIEA 4ESRA 2OTLT 5LJ3d 4M75E 4ATOA 4JS5A 2FEIA 3G4SQ 3QSUA 2Y90A 1AD5A 3EFOA 1WHHA 2W0ZA 1Q86C 3CBMA 2NLUA 5GMKh 4B6MA 2PQWA 4EMKB 1Q86R 1I4K1 1G3WA 3M59A 2CP7A 2P0QA 4C0DB 2O4XB 4ZGEB 4C8QE 3DB4A 2DIGA 5GAN3 1MV3A 4IUVA 1OZ2A 1VQ4Q 4C0FA 3UA6A
chains in the Genus database with same CATH topology
1OX8A 1TWBA 2QAZA 1ZSZC 1ZSZB 1OU8A 1OULA 2NYSA 1YFNA 1OU9A 1OX9A 2QASA 1ZSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  1TWB A;  2QAZ A;  1ZSZ C;  1ZSZ B;  1OU8 A;  1OUL A;  2NYS A;  1YFN A;  1OU9 A;  1OX9 A;  2QAS A;  1ZSZ A; 
#chains in the Genus database with same CATH topology
 2EJ9 A;  2RJF A;  3OW2 A;  3CCL Q;  1X43 A;  2CP0 A;  4N4G A;  3TSZ A;  2AKK A;  3JCM c;  2OTL A;  1KJW A;  4M77 D;  2LQW A;  1X6B A;  3EGX B;  2RQV A;  1AEY A;  2XID A;  3LWI A;  3DLL A;  2EGA A;  1PC0 A;  2DA9 A;  3OYE A;  2DE0 X;  3VUB A;  1MMD A;  4CI0 C;  3OYF A;  3QWY A;  5L23 A;  4J9H A;  1PSE A;  2GCX A;  4XU1 A;  1FXX A;  1M1G A;  1YIT T;  4J9B A;  4OVA A;  3X24 B;  3WXM B;  3TCJ A;  3EG2 A;  3VRZ A;  1HD3 A;  3MP1 A;  3J7A F;  1QVP A;  1FMW A;  1IRE B;  3EAE A;  3I55 Q;  2R5M A;  2K5I A;  3MCA B;  2KDS A;  3WVE B;  4A4E A;  2DER A;  3M4G A;  2VAS A;  1WXB A;  2ZPH B;  5GAN g;  3KBG A;  4FW1 A;  3HFN A;  2O88 A;  1YN8 A;  3BW1 A;  2SEM A;  3OYG A;  4BDY A;  3TSW A;  3X26 B;  5FRO A;  4A4G A;  2LZ6 B;  2QQB A;  3JCM W;  2M0O A;  1O75 A;  3CBP A;  5CR2 A;  3QG1 A;  1AZG B;  3VU3 C;  4DOV A;  1QW1 A;  2RMO A;  2J7I A;  3HPW A;  1NG2 A;  4N4H A;  2QAS A;  3CPW P;  4R0K A;  1YIT A;  2RO0 A;  3MKD A;  1K8A U;  2HZY A;  1ZUK A;  3QWX X;  4ORZ A;  5GAN 5;  1D0X A;  2RQR A;  1TUG B;  1X6G A;  3C12 A;  2RI2 A;  4M75 C;  4BI3 A;  4DA4 A;  2DZC A;  3VS1 A;  3S3O A;  1BYM A;  3JB9 G;  2HEQ A;  3N5B B;  1I81 A;  1JO8 A;  1NPR A;  3QPH A;  4XTU A;  3GNG A;  1QKW A;  5GAM e;  3ZL7 C;  1VQM T;  3REA B;  2GGR A;  1VYV A;  1VIF A;  3PNW C;  2QYZ A;  4J9I A;  4DOW A;  4XU0 A;  1AWW A;  5DLO A;  4FM4 B;  1MUZ A;  1SSF A;  1OYX A;  1TUC A;  1AWO A;  2KNB B;  4F7U F;  4XTV A;  3M57 A;  4B9X A;  1EFN A;  3HRS A;  2LQN A;  1ZSG A;  2EIF A;  3G7Z A;  5GAM j;  5IT9 E;  2DVJ A;  2EAY A;  4J6W A;  2ABL A;  1OOT A;  2IG0 A;  4FYY B;  3QUI A;  2QGG A;  5LJ3 j;  3JCM Q;  3JB9 F;  2QA4 A;  2L3Q A;  1RI0 A;  2CZ6 B;  2KRS A;  3SB2 A;  1N8R R;  1S72 Q;  3OS0 A;  1VQM A;  2C06 A;  3CC4 T;  1NE8 A;  4LDU A;  5FLX E;  1H92 A;  2RH2 A;  2KEA A;  3HSB A;  5M9O A;  1M90 R;  3C4S A;  2DL4 A;  1Y57 A;  1U06 A;  3EGX A;  1MND A;  3UA7 A;  2M1H A;  5LJ5 d;  1M2V B;  1Y07 A;  4LNP A;  2BE7 D;  4KH0 B;  3E9G A;  3CCQ T;  2EKH A;  1JJ2 A;  4MZM A;  2X4Y A;  3H41 A;  1GXI E;  1K9M C;  2IIM A;  2NWM A;  1WXU A;  3MHX A;  2DRM A;  3FLG A;  3GNF B;  4D6W A;  1MGQ A;  2CP3 A;  4C5E A;  1VQ7 T;  1SEM A;  4LDW A;  2JTE A;  2LX7 A;  5I22 A;  2XDB A;  4XU2 A;  2COY A;  1GFC A;  2DYI A;  2XI9 A;  4M77 A;  3PE0 A;  2WSC E;  4M75 G;  2QA4 T;  2E1H A;  4C8Q D;  3L2U A;  5KYW B;  2MOX A;  3EH1 A;  3GOX A;  2AZS A;  3MEW A;  4GLM A;  1HXD A;  2KY9 A;  2LRQ A;  4NL2 A;  5KCH A;  3U23 A;  1ABQ A;  4JJD A;  1YWP A;  3CCQ Q;  4HCB A;  3OA6 A;  4AT1 B;  1YFN A;  3LGL A;  3HRU A;  3A8O B;  2D8J A;  4HA8 A;  2E3H A;  1I07 A;  5GJV B;  3EHQ A;  1WNL A;  3CCQ A;  5A0D A;  4M75 D;  3JSC A;  1K9A A;  1SRL A;  4M7A B;  2KSS A;  2JUF A;  3JCM f;  2HSP A;  1BU1 A;  5IAY A;  4LD9 K;  1FYN A;  3RES A;  1M27 C;  1VQ7 A;  4ELZ C;  3L42 A;  3WVD B;  1U1T A;  2OI3 A;  2E6N A;  3O5Z A;  2V26 A;  4ZGD B;  2DL5 A;  2V8I A;  2LT1 A;  2R5A A;  3OYL A;  2P0K A;  1M90 C;  3OYY A;  4JRQ A;  3LLR A;  4M78 A;  2BTT A;  1WHM A;  2YXY A;  2P84 A;  2DJZ A;  3OYJ A;  3LW5 E;  1WZO A;  2E41 A;  1AOJ A;  3L2Q A;  1OPK A;  5FWB A;  3CC2 A;  2RK2 A;  4MZP A;  1IHW A;  2HDA A;  4C92 F;  3L2V A;  3M58 A;  1K4U S;  1E6G A;  1M1K C;  1UEB A;  3PVL A;  5FU6 C;  2LNH B;  3VS3 A;  4JZ4 A;  1JQQ A;  4FCY A;  2HQH A;  3CCE A;  4QVD A;  2NUZ A;  2XMF A;  1H3H A;  1RUW A;  5IH2 A;  4M77 F;  2QQS A;  1EX4 A;  3JCM V;  2YUQ A;  4ZGJ B;  4EMG A;  2LCS A;  1JRI A;  2DEU A;  2ZGW A;  5CQY A;  1QCF A;  2E70 A;  4LE9 A;  3CME Q;  2A08 A;  5FW9 A;  4M77 C;  2F2W A;  1Q82 C;  4YTL A;  2RA2 A;  2L3R A;  1VQ6 A;  3JCM h;  4M7D E;  1ZA2 B;  2QK0 A;  2W10 A;  1K76 A;  3CC2 T;  4E7J A;  1YJN A;  4QW2 A;  2X4J A;  2O9V A;  1NEG A;  2RQU A;  3I9Q A;  3C0C A;  3E2U A;  4LDY A;  4M78 C;  2K7A A;  1RAF B;  5GAN f;  2F1L A;  1M90 U;  4M77 E;  4NOY A;  1FMK A;  3LYI A;  3SWN B;  3EFO B;  1KHI A;  4C0G A;  1NLO C;  2RPN A;  4LDX A;  1UG1 A;  1BIB A;  5DM7 R;  5CK9 A;  1GRI A;  2LC4 A;  5CCA A;  3GIB A;  3OMC A;  2KVQ G;  1FMV A;  3L2W A;  2DIQ A;  1VQ9 A;  3VJP A;  2GTJ A;  2ENM A;  4HKE A;  1MV0 B;  5GAM f;  1Z9Z A;  2KMT A;  1WHJ A;  4DQ2 A;  4M7A C;  3O8V A;  5LJ5 j;  2RM4 A;  1X69 A;  1T0J A;  4AMC A;  1TG0 A;  2RD1 A;  1X27 A;  5GAO l;  1PG5 B;  3FJ5 A;  1X75 C;  4ELY C;  2AK5 A;  3SD4 A;  2Y4Y A;  4V2S A;  1VQ4 T;  1MMG A;  3CCL T;  1W2B A;  2RHZ A;  3OYM A;  3HL8 A;  3CCS Q;  4EMK C;  4L5G A;  1IGU A;  2DK3 A;  2IPO B;  2P0P A;  1SSH A;  1UEC A;  4RTX A;  2DL8 A;  4J7F A;  1C0M A;  3OS2 A;  2H3J A;  2KRM A;  3CQT A;  3VUZ A;  1Y96 A;  2X51 A;  4RCB A;  2D9T A;  1QP2 A;  2COZ A;  3P8D A;  4JS4 A;  4QKU A;  5CAI A;  1YJW Q;  2YSQ A;  5A2Q E;  4HXJ A;  2PVD B;  2B86 A;  4BI8 B;  3OS1 A;  3CC7 Q;  2FRY A;  1G3T A;  3CCU T;  1YJW T;  2NUP A;  3QJY A;  4Y28 E;  2OTL Q;  4XTZ A;  1WPY A;  1N6A A;  1PCX A;  3C95 A;  1JB0 E;  2CH4 W;  5IXF A;  4AG1 C;  5CKH A;  1K8A R;  5HKC A;  1D1A A;  2A28 A;  2DVE A;  1H8K A;  2I2L A;  4J9E A;  1PWT A;  3VRY A;  2K3X A;  2FZK B;  1VIE A;  1UFF A;  2LMJ A;  3BE3 A;  3FEO A;  3MP6 A;  2MK5 A;  3PIO A;  5LJ3 e;  4J6X A;  1JBM A;  1WFW A;  1GCP A;  2ROT A;  2DKG A;  1Q81 C;  2YWW A;  4OML A;  1VQN Q;  1KG1 A;  3EGD A;  2OAU A;  2KQW A;  1RLP C;  3GLX A;  2X35 A;  1B7T A;  4JJC A;  5D6X A;  4PJO C;  1PRM C;  1N8R C;  1R0C B;  1YJW A;  1WYX A;  4BUG A;  1UGP B;  2WAC A;  2EW3 A;  1LOJ A;  4E7H A;  1Y0M A;  3EG1 A;  3G71 Q;  1UGS B;  1WJS A;  1BK2 A;  6AT1 B;  1PKT A;  3KUF A;  3FDR A;  2CZ1 B;  4OB3 B;  3QKJ A;  1JJ2 P;  3SFM A;  2HBP A;  4QQ6 A;  2LQK A;  4LDV A;  4N0A C;  2O31 A;  2RHU A;  4EMH A;  1KD1 R;  2BZ8 A;  4II1 A;  3EHR A;  3CXC A;  4M75 F;  2K3B A;  1Q95 G;  5KYX A;  3CC4 A;  2JM9 A;  4C92 A;  3M53 A;  1X6O A;  1VQL Q;  3M0U A;  3JCM e;  2HKN A;  5CKD A;  1SRM A;  4J9F A;  5LJ5 g;  1BIA A;  1YJ9 A;  2FPE A;  3EGD B;  2J05 A;  2CUD A;  1F1B B;  1M3C A;  3PGG A;  3ZEH A;  1N9R A;  5KYX B;  4HCZ A;  5CKE A;  3CCV A;  1UHF A;  1K1Z A;  4CC3 A;  3JAM E;  1QVG S;  3UDC A;  2VUB A;  3MEV A;  2I0N A;  2F5T X;  2RJC A;  3A98 A;  2EQJ A;  4R55 A;  1UHC A;  3VYG A;  4R56 A;  4M7A G;  3I56 T;  3S6W A;  4M7A E;  1W2B S;  2RHY A;  3MEU A;  4LUD A;  2V8K A;  2CP5 A;  4E6R A;  4C8Q G;  3MJX A;  1I0C A;  2KT8 A;  1LVK A;  1E7O A;  2ATC B;  2E5Q A;  1BKB A;  4KUL A;  1B34 B;  2MMP A;  3NMZ C;  4AFQ C;  2L8D A;  4M77 G;  2X3W D;  2DYB A;  5L8R E;  1C1A A;  1XNI A;  4RTT A;  4MML A;  2WSF E;  3THK A;  4C92 D;  3CXC S;  4KGX B;  3CCV T;  3OBW A;  4D8K A;  1VUB A;  2CP6 A;  4XTY A;  1YIT Q;  4FSS A;  2RQW A;  4A54 A;  2EPD A;  1Q81 U;  3HP9 A;  1D1C A;  1UUE A;  4PJL A;  1YI2 A;  2JNG A;  4NS5 A;  3VS2 A;  3RER A;  4IUT A;  2EQK A;  4Z88 A;  3I56 Q;  4M7D A;  2QQ9 A;  2KGT A;  2MYS A;  3G4S A;  5D6W A;  1R77 A;  2LJ1 A;  3PVQ A;  3SWN C;  4MDW A;  2RNA A;  4OGC A;  2F5K A;  5J3B A;  2YRC A;  2K2M A;  1QWF A;  3EG0 A;  1D0Z A;  2LP5 A;  2LCC A;  2DJQ A;  2Y4X A;  1WA7 A;  5KYY A;  1C6V X;  1KQ2 A;  2RHI A;  1OEB A;  1VQ6 Q;  2ESW A;  4KT0 E;  3QO3 A;  2HNI A;  2DAQ A;  1IHV A;  4NL3 A;  3FIF A;  4ZTF A;  4AFS C;  1NYF A;  3GP8 A;  2DTO A;  2E3I A;  4F04 B;  2EQM A;  5GAN 4;  1ZBX A;  1QCO A;  2HAX A;  1E6H A;  4JPB W;  2ZPI B;  4FU6 A;  5ECA A;  2QEX T;  4OB0 B;  3FRN A;  2RI3 A;  3G4S T;  3HKS A;  1QVF S;  5KH6 A;  3EG9 B;  2EYZ A;  1G3S A;  2D0Q B;  3CME A;  2ZAE A;  4TVR A;  1BI2 A;  1U3O A;  3VS5 A;  1TS9 A;  2J6K A;  1WHL A;  4RCC A;  1KIK A;  1GCQ C;  3OW2 P;  2KYB A;  2GF7 A;  2GQI A;  1VQ6 T;  1SHG A;  2LX9 A;  5A0G A;  4RTY A;  4XQ3 A;  1YJN T;  3CCR T;  2CP2 A;  2DLP A;  2C0O A;  1LJO A;  1AHJ B;  3CXC P;  4M75 B;  4LXC A;  3TVT A;  1KSW A;  1UTI A;  2K9G A;  3AHU A;  2VXE A;  4M7D G;  4AFZ C;  2FG0 A;  1NM7 A;  3JB9 I;  2QDL A;  2RF0 A;  1I5L A;  3HHT B;  1EIF A;  2QEX A;  3QJ6 A;  2HL5 C;  4M78 D;  2ZPF B;  4M4Z A;  5I2S A;  4C5G A;  3FJP A;  3EFR A;  1RAI B;  2E6Z A;  5GAN 7;  1K73 C;  5J39 A;  1NZ9 A;  3CME T;  4FIB A;  1VQ9 T;  2ECZ A;  2L3S A;  2PUK B;  1NJI R;  4OP0 A;  1R8O B;  2LQ8 A;  4F17 A;  2YLC A;  4E7K A;  2X4X A;  2EYW A;  2JM8 A;  2DFU A;  1GFD A;  4FYW B;  4RTW A;  3QHS A;  2DL7 A;  2EWN A;  4F14 A;  3JV3 A;  2O4X A;  3ASK A;  4C0D C;  2O9S A;  1VQK Q;  1IB8 A;  1TWB A;  2LCL A;  1Y96 B;  2XIC A;  2L5Q A;  1KQS P;  2DRK A;  1T0H A;  3QZ9 B;  3LH0 A;  4E7L A;  3BFM A;  1Q81 R;  3G6E A;  1VQ4 A;  4WCI A;  3CCL A;  3AT1 B;  1W2B P;  2H3E B;  2AT1 B;  2H8H A;  1VQK A;  4OB1 B;  3CPW A;  1KD1 U;  1YCY A;  1K0S A;  2AKL A;  1TUD A;  3ZFJ A;  1XQH A;  2VVK A;  4X9C A;  4M7D F;  1M1K R;  2QG9 B;  4PJM A;  4QQD A;  1WI7 A;  1KQS A;  4JLI A;  3CBO A;  4LD6 A;  1PD0 A;  1KQS S;  4X34 A;  2MWP A;  4AFU C;  4PFO A;  4BI4 A;  3RDV A;  2NUT B;  2E64 A;  2DO3 A;  2CGH A;  1KC8 U;  1WQW A;  2GQV A;  3OQ5 A;  1YWO A;  3CCU A;  1NJI U;  3UPU A;  1X01 A;  2NUP B;  1IZ6 A;  3G6E T;  5I11 A;  2EQU A;  1UJ0 A;  3A8M B;  5LL6 S;  1VQK T;  2EBP A;  3SHW A;  1SPK A;  5KYN A;  3FC3 A;  2R57 A;  3G6E Q;  1KC8 R;  1PM3 A;  3OSV A;  1QMC A;  4ZN1 A;  1M9S A;  2YRD A;  4ZN3 A;  4KGZ B;  1NPP A;  2KXC A;  1TTH B;  1W70 A;  2JOY A;  4A4H A;  4F7U G;  4JRI A;  1W4S A;  4Y92 A;  1OI1 A;  2G6F X;  3HFO A;  2YHT A;  5GAN 2;  4WF2 A;  3PIP A;  1YIJ T;  4DBF A;  3MP8 A;  1D3B A;  1Q7Y R;  2DNU A;  3CCE Q;  3JRZ A;  1ZQ1 A;  2FHD A;  1H64 1;  2K2V A;  5KE3 A;  4IIM A;  5CKF A;  4PJN A;  5KE2 A;  3VKI A;  5IHN A;  3P8H A;  1Q7Y C;  2FO0 A;  3CMA A;  4CC4 B;  3JCM b;  4PJO D;  4DBQ A;  4WTO B;  2P4T A;  1VYT A;  2DD4 A;  4C5I A;  2DM1 A;  3DLM A;  4X1V A;  3CCU Q;  1AT1 B;  2OX7 A;  4D8D A;  2AIR B;  2JS2 A;  4C8Q A;  2PNI A;  4KRT A;  4PLL A;  1WLP B;  4FT4 A;  1WXT A;  2GTO A;  2D6F A;  4A4F A;  1VQP A;  1K73 R;  4N4I A;  1HJD A;  2KBT A;  1W1F A;  3H0I A;  4IUQ A;  1XOV A;  1KHC A;  2QAZ A;  2QI2 A;  2AZV A;  4J83 A;  2VC8 A;  1P92 A;  1QVG P;  1YJ9 T;  1H3Z A;  1Y7X A;  4N0A A;  2C0T A;  1YIJ A;  4E7I A;  2JXB A;  5C6S A;  2VKN A;  1WHK A;  2YUO A;  3GPL A;  4RTV A;  3H9N A;  4A63 B;  2KI7 A;  2JW4 A;  3JCM d;  3QDR B;  4BAC A;  1RAB B;  3RKY A;  5FRN A;  4RKU E;  3OW2 S;  3I56 A;  1VQ5 A;  2LDM A;  5FU6 B;  4ZTJ A;  1BB9 A;  2A7Y A;  4FL6 A;  5KYW A;  3S3N A;  2RB6 A;  3PFS A;  1BI0 A;  1RAE B;  1WJQ A;  3OB9 A;  1V29 B;  1ZA1 B;  4PNO A;  2KRO A;  4C92 B;  1VQP T;  3M0Q A;  1VQ8 Q;  4B9W A;  2DEQ A;  1LCK A;  4O6J A;  2KR3 A;  5FWC A;  1VQN T;  1KC8 C;  1TSF A;  3OYI A;  1OUL A;  5LJ3 h;  1PRL C;  2MIO A;  4IUU A;  2QQR A;  2K5L A;  4BE0 A;  4OB2 B;  2MPX C;  5HK0 A;  2CH4 A;  2DZ9 A;  3OSS C;  5I2M A;  2RN8 A;  4J8O A;  2EKO A;  3CCS A;  3A8G B;  5LJ3 f;  1HK9 A;  1YI2 T;  2L0A A;  4F7U E;  1VYU A;  1VQ5 T;  3M56 A;  2FZG B;  4Y91 A;  4Z89 A;  3EFS A;  2O01 E;  1M8V A;  4HCC A;  5AYF A;  3CD6 T;  4M7A F;  2XG8 D;  5GAN h;  5HY6 A;  1D3B B;  1XJW B;  3X28 B;  2DTH A;  1D1B A;  3HRT A;  4HT9 A;  1VQN A;  1YI2 Q;  1BCM A;  1K8A C;  4M75 A;  2EJF A;  4MZT A;  1ZSZ C;  3RNJ A;  2ZPE B;  1FWZ A;  2AHJ B;  4QQG A;  5D7U A;  2V8J A;  2EGC A;  4AG2 C;  3BDU A;  1UDL A;  1U8R A;  2DPP B;  1VQO Q;  3QZ5 B;  4F16 A;  1ARK A;  5IN1 A;  3V7R A;  1RL2 A;  3CCS T;  3CPF A;  3JB9 H;  2M16 A;  1SKU B;  1QQJ A;  2KT1 A;  3M0S A;  4QT7 A;  2ED1 A;  4FYX B;  1FX7 A;  1VQP Q;  2HSE B;  1RAG B;  1PNJ A;  3URG A;  3OYN A;  4Q5W A;  1I8F A;  4PL6 A;  2D8H A;  3CD6 A;  3SDZ A;  1DJ7 B;  4E47 A;  5HCK A;  4RG2 A;  4XU3 A;  2JT4 A;  4BY6 C;  2ROL A;  2DTI A;  3KXT A;  4EDU A;  3PT9 A;  2A0F B;  4HT8 A;  2E12 A;  4FT2 A;  1W6X A;  2RI5 A;  2VWF A;  4RG8 A;  1D0Y A;  5GMK e;  4ME7 A;  2FPF A;  1S72 A;  4MMK A;  1VQM Q;  3OBY A;  3UF4 A;  3CCR A;  1TU0 B;  5LJ3 g;  3CMA Q;  3ZBD A;  2EYQ A;  3MET A;  1RAD B;  2MCN A;  1MHN A;  3OYB A;  3LWH A;  2YUP A;  1Q82 R;  4L59 A;  4J9G A;  1VQO A;  2P4R A;  2MAM A;  4PLI A;  2L89 A;  4JJN K;  2RHX A;  3LH5 A;  4C92 C;  2X3X D;  2A36 A;  4CC2 A;  2DL3 A;  2MI6 A;  2DIL A;  4EMK A;  5KYY B;  1Z9Q A;  4RTU A;  2EGE A;  3Q1J A;  1XTD A;  2A37 A;  9ATC B;  2BKD N;  4KUD K;  4OMF B;  3J81 E;  3CPW S;  5DLQ E;  4VUB A;  3QBY A;  3H0H A;  2HCK A;  4JUV A;  2B8A A;  3M9Q A;  1OU9 A;  1UGV A;  4DBR A;  5LJ5 f;  2NYS A;  4Z02 A;  5J26 A;  2DXU A;  1TXQ A;  1IGQ A;  1M30 A;  5GAM h;  1UB4 A;  1SHF A;  4E7S A;  5GAN 8;  4M78 G;  3EGU A;  2E10 A;  3NTH A;  5GMK i;  1YHQ T;  5GAO m;  3GF5 A;  1VQ8 T;  1N9S A;  4QVZ A;  4IIO A;  3I55 T;  1RAC B;  4KGV B;  4XTW A;  5IHK A;  2GFA A;  2PU9 B;  5LJ5 h;  1RAH B;  3E9F A;  4PJO B;  5GJW B;  1QCN A;  2SRC A;  2V1R A;  3CCM Q;  4OMM A;  1QLY A;  4JRP A;  1HSQ A;  4JZ3 A;  1M3A A;  1N8R U;  2O2O A;  2YT6 A;  5KYU A;  1SG5 A;  4C8Q B;  4PJO E;  5GMK l;  1OX8 A;  2PZ1 A;  4EPC A;  2OAW A;  3I5R A;  2D0N A;  3LGF A;  1J3T A;  4GY5 A;  2LT4 A;  3EH2 A;  3BDL A;  3M0P A;  1QVG A;  4C8Q C;  5GAN j;  5GAN e;  2FB7 A;  1Q86 U;  2EYY A;  2KXD A;  3CC4 Q;  2CZ7 B;  2M51 A;  2YDL A;  1CSK A;  3DKM A;  1VQL A;  3CCJ Q;  1NLP C;  3JCM J;  3SWN A;  3H0F A;  3VS0 A;  5FRM A;  4O5V A;  3OYC A;  1ACM B;  1YHQ A;  1ZHI A;  3H8Z A;  1VQ8 A;  2QQA A;  2BZY A;  3I55 A;  1QVF P;  4CC7 A;  1PSF A;  1M2O A;  2HQX A;  2RQT A;  3V7S A;  2FPD A;  1OV3 A;  3G71 A;  2YRV A;  2VXF A;  1OQK A;  3GBQ A;  2QGF B;  5GAM g;  3NPF A;  2ZCF B;  2DBK A;  3E19 A;  5IXB A;  3CCM A;  1RLQ C;  1NBE B;  2CDT A;  3H6Z A;  3NTI A;  2EJG A;  2E65 A;  4DBH A;  3MPU B;  3S3M A;  1CKA A;  1X2K A;  4ZNX A;  2DF6 A;  3RKW A;  2BUD A;  3L1A A;  3QXE B;  3M4Y A;  1YIJ Q;  2COW A;  1G8X A;  1UGR B;  4BB7 A;  4A4K A;  1YNZ A;  2QA4 Q;  1M8M A;  3UWN A;  4E2F B;  5I21 A;  1IRX A;  1G3Y A;  3EG9 A;  4L6V 5;  2KAF A;  4XAX B;  5CKB A;  3CCJ A;  3CMA T;  1MMA A;  4E7Z A;  4J9C A;  1QWE A;  2JTM A;  3LX7 A;  3VS7 A;  1JJ2 S;  4P5N A;  3M0T A;  1WJR A;  3OYH A;  5GAN 6;  4JDS A;  1QP3 A;  2KRN A;  2QTV A;  2PUO B;  2DD5 A;  2CT3 A;  3CEY A;  2XHC A;  5EG2 A;  4BD3 A;  1IXD A;  4XTX A;  4RTZ A;  4RUG A;  2K5F A;  2KE9 A;  4GBQ A;  2QXF A;  3JB9 D;  3CC2 Q;  1HYO A;  8ATC B;  1ZUU A;  2FZC B;  3NGP A;  2A3L A;  1PD1 A;  1ZX6 A;  1LPL A;  4M78 F;  2ZPB B;  4BE2 A;  1LNX A;  3M55 A;  4Z8A A;  4JRK A;  2KK4 A;  3V7C A;  5KYU B;  4C5H A;  5IHI A;  4PFZ A;  1CKB A;  3HTR A;  3M5A A;  4C92 E;  1M2V A;  1RAA B;  2F2V A;  2RJE A;  1ZSZ B;  1ZSZ A;  2DX1 A;  4OGE A;  3CCJ T;  2LTO A;  2XD0 A;  3I5S A;  4M7D C;  1UGQ B;  2R58 A;  3VV0 A;  4PJO A;  2OJ2 A;  3A1P A;  1R0B G;  1WDX A;  1KQ1 A;  4M7A D;  4M78 E;  1ZBJ A;  2RK1 A;  3A8H B;  5GAO p;  3R6O A;  1TH7 A;  3CCV Q;  1EZZ B;  1JU5 C;  1T3S A;  2X9H A;  1AZE A;  8AT1 B;  1VQ5 Q;  4PFP A;  5D6Y A;  2EYX A;  3REB B;  3IQL A;  2GBQ A;  1GL5 A;  1AWJ A;  2OTJ T;  1YHQ Q;  1AWX A;  1WQ7 A;  2XDP A;  2CS7 A;  2XK0 A;  3OYK A;  4J6Y A;  5GAO r;  1OPL A;  2FYK A;  4FSX A;  1G5V A;  4OMN A;  2VV5 A;  1MMN A;  2HQE A;  5LJ5 e;  5EC7 A;  4BE1 A;  4GLK A;  1VOM A;  2Z0W A;  2XKO C;  2RJD A;  3RMS A;  4C8Q F;  1YBY A;  1M3B A;  2HD0 A;  3FB9 A;  2FL7 A;  4LUE A;  4OMP A;  2ED0 A;  4JJB A;  1TOV A;  3V8K A;  4UC4 A;  1B3Q A;  1GCQ A;  2G3R A;  4IUR A;  2ZPG B;  3F70 A;  3L2Z A;  2V1Q A;  2X4W A;  3TQ7 P;  1KK7 A;  1O9S A;  2BE9 B;  2BIV A;  5CQX A;  3CCR Q;  4ANJ A;  2OTJ A;  5CVI A;  5HK3 A;  4LN2 A;  5C0M A;  4OMQ A;  1U5S A;  7AT1 B;  1ABO A;  1VQ7 Q;  2YLB A;  4M78 B;  1X2Q A;  3QII A;  2HMA A;  4PKC C;  2LVM A;  1AVZ C;  3INZ A;  2J06 A;  2EFI A;  3R6N A;  4BDZ A;  1Q7Y U;  3RKX A;  2QEX Q;  2D1X A;  4XK8 E;  1K0X A;  3OYA A;  1NEB A;  2K79 A;  1N5Z A;  2MWO A;  2JJ9 A;  3X25 B;  2QDY B;  2DXB A;  2YUN A;  3T9N A;  2KYM A;  3NFC A;  2BZX A;  2J6O A;  2HBW A;  1S1N A;  1M1F A;  1D09 B;  4EIK A;  1WGS A;  4PJJ A;  1T3L A;  2CSI A;  4HVV A;  1S72 T;  1NJI C;  3PMT A;  3NTK A;  3E1S A;  4DEY A;  4PK4 A;  5DY9 A;  3V8J A;  2NUT A;  3UAT A;  2K6D A;  3VS6 A;  3OMG A;  3TU4 K;  1Q82 U;  1PKS A;  2GFU A;  1VQO T;  1WX6 A;  3M0R A;  3L2R A;  2K57 A;  1UE9 A;  2ZZD A;  3EG3 A;  4CRI A;  2CT4 A;  2DXT A;  1I1J A;  3ER0 A;  2DMO A;  2CYZ B;  5GAN d;  2JS0 A;  1QKX A;  3JCM g;  4DEX A;  3CC7 T;  3OY9 A;  3JB9 J;  2M02 A;  2JN0 A;  3RUX A;  1QVF A;  1M1K U;  4HVW A;  3TEE A;  2K4Y A;  3QDF A;  3VS4 A;  2LJ0 A;  1M4Z A;  4FYV B;  1G2B A;  2LNV A;  4F7U B;  4PJO G;  1RI9 A;  3OS5 A;  5FU7 B;  2EVR A;  1BI1 A;  3TRE A;  5KCO A;  1IO6 A;  3SEM A;  3VYH B;  1KD1 C;  5GAM d;  4M7A A;  1V1C A;  4OMO A;  5CIU A;  1ZUY A;  2E5K A;  2JTF A;  3BY7 A;  2HKQ B;  1WHG A;  2CRE A;  2K3Y A;  5FU7 C;  1OX9 A;  4KH1 B;  2CZ0 B;  4OF1 A;  3A8L B;  4M77 B;  1YCS B;  1GBR A;  1I5O B;  2M0Y A;  1SF9 A;  2C0I A;  1B07 A;  2DXC A;  2JZ2 A;  3P8B B;  2XDD A;  2MF2 A;  1MNE A;  2CUB A;  2JVV A;  4QVC A;  4HCK A;  2XU8 A;  1NYG A;  3CC7 A;  2OTJ Q;  2LJ3 A;  3RIR A;  2VGN A;  2DBM A;  2HL3 A;  4KBM B;  1VA7 A;  2WSE E;  2L3P A;  4C92 G;  1B34 A;  1OU8 A;  3OYD A;  4BY6 B;  3MO8 A;  1YJN Q;  1M5Q 1;  2FRW A;  1JXM A;  1VQL T;  2FVU A;  4M7D D;  3A5Z B;  2VB6 A;  3KFV A;  1BI3 A;  2E4H A;  3MEA A;  3X20 B;  1V76 A;  3C94 A;  1BCO A;  4IKF A;  2F2X A;  1K73 U;  2CSQ A;  2M9U A;  3DB3 A;  2EQI A;  2CKK A;  1JXO A;  1YJ9 Q;  4J9D A;  4FW2 A;  5GAO q;  3ME9 A;  3JCM P;  4JLG A;  2VYT A;  3G71 T;  1OZ3 A;  1GBQ A;  3CD6 Q;  3QYH B;  2JMC A;  3ULR B;  1YP5 A;  3G1J A;  4M7D B;  1VQ9 Q;  2PTK A;  1UJY A;  5GAO n;  3CCM T;  3D7S B;  3M54 A;  3UT1 A;  2J6F A;  1K9M U;  5GMK m;  4IUP A;  4J7I A;  1A0N B;  3PMI A;  4HVU A;  4PJO F;  2IVW A;  3RBB B;  3RMQ A;  4F7U A;  5CO7 A;  4X9D A;  2PVO B;  5AT1 B;  2L2P A;  2VGM A;  1KFZ A;  1Y71 A;  4RMO A;  4MDX A;  4J5Y A;  4KUI A;  3RR6 A;  2JMA A;  2PVG B;  2DET A;  1K9M R;  2GNC A;  3CCE T;  3NHN A;  4C0Z A;  2QTX A;  5A0L A;  3PTA A;  3JCM X;  1U1S A;  2F69 A;  1PHT A;  3V8L A;  3J80 E;  5GMK j;  1JEG A;  3QYG B;  4K11 A;  4A53 A;  1ZLM A;  1BBZ A;  1N27 A;  1G83 A;  3I35 A;  1WIE A;  4ESR A;  2OTL T;  5LJ3 d;  4M75 E;  4ATO A;  4JS5 A;  2FEI A;  3G4S Q;  3QSU A;  2Y90 A;  1AD5 A;  3EFO A;  1WHH A;  2W0Z A;  1Q86 C;  3CBM A;  2NLU A;  5GMK h;  4B6M A;  2PQW A;  4EMK B;  1Q86 R;  1I4K 1;  1G3W A;  3M59 A;  2CP7 A;  2P0Q A;  4C0D B;  2O4X B;  4ZGE B;  4C8Q E;  3DB4 A;  2DIG A;  5GAN 3;  1MV3 A;  4IUV A;  1OZ2 A;  1VQ4 Q;  4C0F A;  3UA6 A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  1TWB A;  2QAZ A;  1ZSZ C;  1ZSZ B;  1OU8 A;  1OUL A;  2NYS A;  1YFN A;  1OU9 A;  1OX9 A;  2QAS A;  1ZSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...