2QB0A

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E80-TELSAM domain
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
total genus 19
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0A00
5F3XB 2LMRA 1X40A 1UCVA 4NJ8A 4NL9C 1DXSA 3K1RB 1RG6A 2DL0A 4RQMA 3SEIA 3TACB 2QB0A 2K60A 1JI7A 3KKAC 2KMDA 2DKZA 2D8CA 1UQVA 4RQNA 3IDWA 3BQ7A 1LKYB 4NL9A 1PK3A 2Y9TA 4MHVA 4PZNA 2KSOA 2F44A 5JRTA 1OXJA 2D3DA 1SXDA 1OW5A 3KKAA 1COKA 2E8OA 2EAMA 2EAPA 5KNIA 2JV3A 2Y9UA 1Z1VA 2KE7A 1B0XA 2ES6A 2QB0B 2F8KA 2QARA 5J8YC 1PK1A 2E8MA 1V38A 2L5YA 1WWVA 2KSOB 1SV4A 2F3NA 2KG5A 1KW4A 1V85A 5L1MA 2B6GA 2ESEA 2QB1A 5J8YA 1B4FA 1F0MA 2QKQA 4PZOA 1WWUA 5JTIA 3H8MA 2DKXA 2QARB 3TADC 1SGGA 3BS5A 2K4PA 2E8NA 3SENA 2YTUA 1PK1B 2E8PA 1X9XA 4IS7A 1SXEA 2FE9A 2EANA 2KIVA 1SV0C 5JU5A 3BS7A 3TADA 3HILA 2EAOA 2LPEA 2GLEA 1X66A 3BS5B 1SV0A 1LKYA
chains in the Genus database with same CATH superfamily
4YVZA 5KG1A 4M9NA 4FZMA 1NK6A 3RRGA 5HMLA 1ZETA 5KFTA 1Y88A 3NGDA 5KFUA 4DFPA 3FDSA 7ICPA 4KX5A 3EZ5A 2RP5A 3ONNA 2IBKA 3HX0A 2A1JA 1C7YA 4CF3A 4UB1A 5KFFA 1JX4A 1COOA 4B9TA 4ECSA 1JXLA 5J2HA 1BNPA 2Y9TA 3F5EA 8ICRA 2PMZC 2BDUA 4C4RA 1SXDA 3BZKA 5G5HA 1JN3A 4ELTA 2BCSA 3C1YA 4O3PA 4DSIA 4J9MA 2E8OA 4PL1A 2JV3A 3NVZA 2ES6A 4KX3A 3PSPA 8ICUA 3AL0B 1A0PA 3M1YA 1ZQPA 1IG6A 2ZJ5A 1ZQ1C 4F4YA 5AHXA 3V7JA 1ZD4A 3MDCA 2KP7A 1JXEA 1XWLA 4Y2JA 3MFHA 1T3NA 2R8GA 1BNOA 4KTQA 5ALGA 1B4FA 1WWUA 5DG7A 4UW9A 7ICGA 2ISOA 5CJ7A 3RB0A 2WF7A 2VJ5A 3RB6A 2BCQA 4KLJA 3E0FA 4AYBF 2NO5A 1ZJNA 4NLBA 2AU0A 5KFVA 5F9NA 2EANA 3PSFA 5C0YA 1Q46A 2VA8A 2HOFA 3F2CA 2BCRA 4DO9A 4I2IA 1U47A 2KKVA 3QZ8A 1KFSA 1JALA 1QSLA 1X66A 2BQRA 2HHUA 2NV3A 3CW2C 3RAXA 2JHDA 4JV1A 1A76A 3SQIA 3TAQA 1TE2A 4O3OA 1N56A 4K4HA 3QE9Y 3H4DA 1NJXA 4I2DA 1QQ7A 5C5JA 4B9MA 5EWGA 4DSFA 1UT8A 1L7NA 4O5KA 4FBUA 4O9MA 3UMBA 7ICTA 2PXIA 3RBEA 4EBDA 1QSSA 4MHVA 2AGPA 5DBAA 2D3DA 2H3FA 5J0UA 4YQWA 3M7DA 3ZDEA 4C7YA 1ZQJA 4QZ8A 4ECUA 5ALRA 1EXNA 4MFAA 3Q8RB 5DBBA 4FE3A 3PSTA 3SV4A 4DQPA 4KLIA 7ICOA 5J2GA 3M8RA 1V38A 2ZIVB 1URJA 5ALMA 5HP4A 3WU2U 5L9XA 2XCAA 3NVVA 1NJYA 2ZIWA 2ZUBA 2G09A 4F4WA 4RQ6A 3J81j 2B6GA 1JROA 3PZPA 8ICVA 4OO1J 4JUZA 3L5KA 1Q3VA 4C8LA 1PVQA 1T94A 2UVWA 4Y2UA 1JIHA 2K4PA 3RJFA 3PW7A 3CYMA 3Q8KA 9ICLA 4XRHA 1U4BA 2C2RA 3RF9A 2FE9A 1YT3A 3HKZC 2PI5A 2FMSA 3WK6A 4KLEA 1NK7A 3OSPA 5ALKA 1NK8A 2AXTU 3HILA 1F44A 4ECQA 4BXOB 4KLUA 2FMQA 4F72A 3ZI4A 4UAUA 1ZD3A 1SIJA 3TFRA 4Y2SA 3OSNA 2IHNA 4Y2RA 5AK5A 3MR5A 4DS5A 3EW9A 2P35A 2F8LA 8ICSA 4Y2XA 4R64A 5L1KA 2GWSA 4O3SA 3ED5A 1BPZA 1Z00A 5BOLA 4CGZA 1S0OA 3HKZF 4A8EA 3C5FA 3KHGA 5AK3A 2GO7A 4EZ6A 2W9BA 4F92B 2BCUA 4KLGA 1UQVA 9ICPA 4M6WA 2ALZA 1RQNA 4IC9A 2K89A 4ED3A 3BQ2A 1ED1A 4ICAA 3KHRA 3ISDA 4F8RA 4C8MA 3FC4A 4QWCA 2Y0SC 4QWAA 4I2FA 4O0IA 3LWLA 2F1JA 1DRGA 3SR6A 2VA2A 1XSLA 1CEZA 3OHBA 1L8LA 4TQSA 1KFDA 3GDXA 3JPSA 2KIWA 2IA6A 4F71A 3UPQA 3GILA 3BQTA 9ICCA 2KZZA 1MSWD 3QXGA 2C28A 4O3QA 3TADC 3BS5A 1KFTA 3ZDDA 1SXEA 2QLTA 1V9PA 3IG8A 5AI5A 1MC8A 4RPZA 2R8IA 1U48A 4GXJA 3AM9A 1ZQLA 2KD1A 2DPIA 1NK4A 4RNMA 4YMNA 1KN5A 2W7OA 8ICXA 5IILA 5J0OA 3RBDA 2V4QA 5AKIA 2BQ3A 3AU2A 1LKYA 2KNJA 3ZD8A 3GIMA 1X40A 3JPNA 1MQ2A 2JEGA 4FO6A 2K8BB 1D9FA 2YX8A 1RG6A 3V72A 3RFAA 3HRDD 3AEVA 2DL0A 5J0WA 1O03A 4YXJA 2YMPA 3D2NA 2KVCA 2K60A 3RJIA 3RH6A 2HSZA 4PHEA 2XY6A 4RQNA 1KBUA 2Z7JA 2MA1A 2KSOA 3UMGA 3RB3A 5AKEA 3ISCA 1ZQUA 4J9NA 1XC9A 2NRZA 1D8BA 2W55A 4NLGA 9ICFA 2BKEA 4B9SA 2KN7A 3UQ0A 1Z1VA 4QZ9A 4RQ1A 5AKHA 1KEJA 5ALEA 1PZNA 2ZUDA 2L5YA 2K8AA 8ICAA 4P4PA 5ALLA 2W3RA 2XCPA 4ELUA 5KFJA 1UPHA 1WCLA 5KFOA 4YP3A 1L3SA 4ECVA 5AKJA 3PW5A 3RH4A 4UBBA 1ZRMA 3V7KA 1N2XA 4UAVA 4PHDA 3GIKA 1PK1B 3PR4A 2R8HA 3QYPA 4Y2VA 5KFCA 2KOBA 5J2DA 5CP2A 2FPMA 5JU5A 4KLOA 5KAIU 2RHFA 3TADA 4YXMA 4YN4A 2ZJAA 5D49A 2GLEA 1ZQQA 7ICRA 2W9CA 2AGQA 1U45A 1Q3UA 1S97A 1FO4A 4PGXA 1RDFA 3QUCA 4PPXA 3OHAA 5KT4A 1X9WA 4YMMA 4QZIA 1PUZA 3SAGA 1SL2A 3SYZA 1L5UA 1X2IA 1KKXA 8ICCA 4PL2A 3TAPA 5H2FU 3QEBZ 4K4GA 5KT7A 4P0PB 4DSLA 2MAXA 4R8UB 2G06A 3H8JA 4OJLA 1RYRA 1B43A 5AK6A 7ICEA 1OXJA 1BPBA 2IOFK 4DFDA 3K75D 4ED6A 3D6JA 4DWIA 2ODGA 2KE7A 2PFNA 3FM9A 4Z6CA 4F4KA 2RRDA 5J8YC 4EYHB 1BPDA 1UT5A 3NVWA 3DEEA 2JEIA 5KG4A 1NKEA 3IP4B 1XO1A 5ALWA 3BDPA 1FFUA 1CI4A 2EZXA 4ELVA 3LYSA 1DGSA 2O6KA 5KFWA 1F0MA 2QKQA 4PZOA 3I28A 2W03A 3PW4A 4G3IA 2QARB 4QWDA 4ECXA 3SENA 4PGYA 4I2EA 4EEKA 3RAQA 4ECRA 8ICQA 3QUTA 4US9A 1L7MA 1XU4A 5KG3A 2DGZA 3RJHA 5J2JA 4IQTA 1GO3F 4CNQA 2LYAA 1BPEA 4CCHA 1KL9A 1B22A 2D6FC 4I2JA 2W11A 4OCZA 4IRKA 4GXIA 3C21A 3GZFA 3F5AA 1N5WA 5TZVA 7ICLA 1P7DA 4NM2A 4US8A 4M0AA 4DL5A 3LDAA 2PI4A 3K1RB 1XSPA 1FIQA 3PMNA 5DKWA 2WAQF 2RDJA 4C4SA 2F44A 2RQ5A 5KG7A 2AH5A 2OXOA 3BZCA 2YN4A 4BWJA 2W43A 5KNIA 2JH7A 1S5LU 2ZIXB 2GOLA 3QUBA 4U6PA 2QB0B 1ZQNA 2YQEA 2DFLA 2MSNA 1TVAA 5GTHU 1ZD2P 1SB3C 5J0XA 1WWVA 3H7IA 5D4BA 4C7ZA 3ZDCA 9ICIA 9ICMA 1S0VA 4Z6FA 5KFAA 5EOZA 1SWWA 4M9HA 2AGOA 5J8YA 4YCXA 5KFZA 4YD1A 2HOIA 1AROP 2WF5A 4AYBC 9ICVA 1ZQSA 4GXKA 2BPGA 5J2IA 3NRZA 4CE6A 4OJ5A 5KG5A 1ZXIA 3BS7A 2EDUA 2OH2A 5ALPA 5FP0A 1L3UA 2F77X 1ZJMA 1NJWA 4DEZA 1ZQZA 4X5VA 4GC6A 4G9BA 1J2MA 2YMLA 3ETLA 4F5NA 2OM6A 4TUSA 2JZBB 3QZ7A 4UB6U 3RR7A 1BVSA 2ZJ8A 3N4MB 2W54A 3F2BA 4JB3A 2FJ6A 4NLZA 4NL9C 3KFUF 3AN1A 4DCCA 4QZEA 1CRXA 2XVTA 5AKLA 5CHGA 9ICBA 2KHQA 3PX6A 8ICGA 8ICHA 2WTFA 3KKAC 5GTIU 2VIXA 2ZIVA 3MGHA 4BUGA 3M6ZA 2KZMA 2I6XA 3PSIA 5AIBA 2ZTDA 3M9OB 1CUKA 1NJZA 3CNHA 4F4XA 5HMMA 1NK0A 4RZRA 4O5EA 3PV8A 5HR7A 5DDMA 4Q43A 4FZLA 2XC9A 3ZDBA 5CWRA 5ALHA 4DL2A 1L3VA 3FAHA 5AKYA 4F91B 5ALOA 1HUOA 4UQGA 1M6YA 2KG5A 1JRPA 1KW4A 4J9LA 5KFSA 1ZD5A 4K4IA 2HBKA 4M9JA 4J9PA 1ZQAA 3QX7A 4BXOA 5HHHA 4DL6A 3R9KA 4MF8A 4F50A 2OWOA 5KAFU 1SGGA 4F3OA 3GQCA 3RJGA 4DQQA 5ALXA 1TAUA 7ICHA 2NRVA 3T79A 1ZQOA 4PH5A 1JMSA 4TQRA 5J29A 4BWMA 4JWNA 1ZQIA 2IMWP 2FPLA 4EELA 5IIIA 4NLCA 1K1SA 2KFZA 5JUMA 1N63A 1D9DA 3E58A 5ALUA 8ICMA 1QCKA 1J97A 4QZCA 3EUB2 3TI0A 4E0DA 2KICA 1FFVA 5KFEA 1BGXT 2HVHA 1KSPA 9ICEA 4O3RA 4DL7A 2E1EA 5KT5A 5DB6A 2PKEA 3H8WA 2FPKA 2RDIA 4F5QA 2HHSA 3BQ1A 1DGJA 1HIWA 1ZOLA 1QTMA 5KL8B 2A1AA 4DOCA 2A3VA 4NV0A 1ZQVA 3PX0A 2LI6A 3IDWA 4NL9A 2BCVA 9ICTA 5JRTA 2DF4B 5F9LA 4J9QA 3BQ0A 2DUYA 5DG9A 3KKAA 4Y2QA 1COKA 2XIDA 4MFFA 3T5KA 4F5OA 9ICKA 5DG8A 1MA7A 2Y1IA 4XUSA 3LVWA 3WKBA 2J6SA 3WK7A 5B66U 3B0XA 5DQGA 5ALZA 1S0NA 4M2YA 2QB1A 1D8LA 3MGIA 3MC1A 5J0PA 2LBOA 5JTIA 4QZHA 4UARA 4QZFA 2DKXA 4LZDA 3LK9A 2FDRA 4P0QB 4RQ8A 4ED8A 5EE1A 2DBYA 3I76A 3PVXA 4YG2A 4C8OA 3NUQA 3TKAA 1L8OA 2Q0ZX 5AKGA 2WB1C 4JV2A 4Q8FA 5T14A 2XO7A 1RYSA 4ED7A 2XY7A 3F2DA 1Q8KA 3D2QA 2CPRA 2WHEA 3KHHA 2W7PA 3N97B 5DLFA 2BPFA 1UHUA 2JEFA 1S8OA 4YR2A 1YZ6A 3Q8QB 4EZ9A 3GIIA 4OJOA 3AQFA 5DB8A 5A0LA 5J2FA 1DXSA 4RU9A 4P4OA 4I2CA 4DFKA 8ICWA 2R8KA 3H0MB 3HPOA 2ASLA 5B5EU 4YR3A 1J2NA 1PVPA 2B21A 2WB1F 4F2SA 5AI0A 4RQ5A 5DQIA 3N28A 4DSJA 3GV7B 5CB1A 2BGWA 3JPOA 3BQ7A 2CN1A 1L7OA 1IM4A 3UXPA 5J0YA 2G08A 4F2RA 1SKWA 3QNMA 5EE9A 3JPRA 3OGUA 4B9UA 4DSKA 1QH9A 2EQYA 4NWIA 4KLLA 2LYHA 3DV9A 3RTVA 5KG2A 2KVSA 4FS1A 5J2CA 1PK1A 5AI9A 2W04A 4IR9A 3LWMA 2PFOA 7ICJA 3H0LB 4IRDA 3L4PA 3NTUA 4R63A 4ED2A 3H8SA 3V6KA 1ZYQA 3K4GA 3UXOA 1NKBA 9ICRA 1NK5A 7ICUA 2H3IA 2XICA 8ICIA 4MF2A 3GU3A 4QIWF 3IM1A 3GIJA 3QU5A 2E8PA 2V9WA 1X42A 2PFPA 7ICNA 4J9OA 1MQ3A 2KV2A 4DF4A 2IOFA 8ICPA 4UAZA 3IV6A 2PFQA 1TK5A 2C2EA 3WK9A 4ACOA 2JMGA 4HYKA 4P0PA 5AI4A 5EE0A 4R8UA 5KL1B 2ASDA 2LMRA 2N1RA 3T5HA 4DL4A 1UCVA 1ZQDA 1ZQYA 1VDVA 4YMOA 4Y2PA 1WCNA 4IRCA 4GIBA 2ZIUB 3RH5A 5L1JA 3TACB 5J2AA 3EWAA 4DOBA 1JI7A 3Q8LA 4B9LA 3IRUA 2AQ4A 5KFRA 3HJEA 4PZNA 3SZ2A 5D46A 3QUQA 1SL1A 1BPXA 1F5SA 5ALQA 5ALFA 2EAMA 2ZG6A 3LVVA 4OJPA 4DSEA 1A6SA 2KZ3A 2QARA 3RJEA 1SL0A 1MN8A 5KG0A 3L3FX 2JRZA 3WKCA 1SWVA 4I2BA 1ZQEA 3QEAZ 4C8KA 4TURA 3WK8A 2ZTEA 1TK0A 4XQ8A 4NLKA 4ZH4A 1WYGA 2F1HA 1UA1A 4BGDA 4P2HA 3C29A 2F76X 1ZQWA 4C4TA 3UXNA 9ICJA 2H3ZA 1S10A 2RLTA 2R8JA 2EZYA 5ALNA 1JUDA 5AM3A 3T5LA 2C2DA 5ALSA 3H4BA 4KLDA 1DOQA 3N7PD 4BX9C 5CA7A 9ICAA 5DB7A 4KLFA 5ALJA 8ICJA 5KFPA 5G5GA 1ZRNA 5KTQA 2A19A 3H0RB 5F3XB 5AM5A 5ALTA 2WF9A 3KD3A 1ZQFA 2XGPA 4I2AA 4MFCA 2KJ8A 4F5RA 4RUCA 2CXYA 2WAQC 4KLHA 2ZIXA 3MGVA 1LV5A 2QB0A 2HHTA 3A0BU 2P6RA 2K4HA 2BDPA 2UVUA 5DLGA 2KJ5A 4FFDA 1DK3A 7ICQA 3GV8B 4IQVA 4QZDA 1D8YA 2MUTB 2C22A 1HEKA 1T7PA 8ICEA 1FEZA 2HVIA 5J0RA 4RQ4A 5DBCA 2H3QA 2OEHA 5KFNA 1Z4OA 2I9GA 1IIPA 8ICBA 4RQ3A 5IIJA 4YFKA 3HP6A 4C8NA 4J9KA 5HHIA 1LVHA 4EYIB 3N7RC 4ECTA 5L1MA 2LM1A 2ESEA 1Z19A 5AK4A 2E3TA 5HR6A 8ICNA 1KRPA 1S0MA 1TV9A 2BHNA 4QWEA 3C2LA 1ZQCA 8ICKA 4EX7A 4KITB 2JZBA 2W3SA 3RJJA 2P66A 5BOMA 1XO0A 5K4LA 1OUQA 3V7LA 3MR6A 3THVA 2EZZA 1IV8A 2FLPA 2V4RA 5J2EA 2YB4A 2ZUCA 2F1IA 3MR2A 2LPEA 1IXRA 5KFHA 4LVSA 1VJ5A 1ZQRA 4MEYA 4RT3A 3HT3A 1WG8A 3EPGA 2WFAA 4PHAA 4KN4A 4BJQA 2VJ4A 3OPXA 4M04A 3KOOA 4Z6EA 3PX4A 2HDOA 5AM2A 3EPIA 2HMXA 4FBTA 3NASA 1NK9A 3TARA 4GFJA 4LJXA 4UAYA 3SEIA 3QU4A 1UA0A 2UVVA 4USAA 1XNSA 4IR1A 1X6JA 2KMDA 3AMZA 2DKZA 1TK8A 2D8CA 2HI0A 1RQLA 4J03A 2H5XA 1N60A 4ED1A 2KJ9A 3KHLA 4B9NA 4LZGA 2PMZF 4Q8EA 4QZGA 3WKAA 1B0XA 2A1JB 1N48A 4KLQA 3B0YA 2ISPA 2H3VA 3VCBA 2K8CB 2AHOB 2G0AA 2KTQA 3PMLA 1ZQMA 5DDYA 4YD2A 3ISBA 2NRXA 3BJYA 3SV3A 2K4EA 1T3QA 3ETRA 9ICNA 1S76D 9ICHA 3A0HU 5KT6A 2HHQA 4JWMA 3H8MA 2KFNA 9ICUA 1ZQTA 1SKSA 2YTUA 1V97A 3HWTA 1X9XA 4TUQA 4KLSA 1RYUA 3C2MA 3OTQA 4RPXA 4I28A 2KKPA 4GLXA 1TFRA 2KIVA 3C28A 5KFXA 3NRWA 8ICFA 2NRWA 4JK1A 2JXJA 2VANA 9ICOA 4YR0A 3EYZA 5ALIA 4RNNA 5AICA 1ZQHA 4O3NA 5IIKA 3M9MB 4KLMA 4CDGA 2CRXA 3M8SA 3G6YA 2M0NA 3SAFA 2FLLA 5DGAA 2JR5A 3SAHA 1ZQBA 3WK4A 1TKDA 5KFLA 5KT2A 1K1QA 4UASA 2KK0A 2WF8A 2E5SA 2DWQA 4XA5A 5EE3A 3JPTA 9ICGA 3ALRA 3MABA 3CRXA 2W9AA 3OJSA 3T3FA 2JEJA 7ICKA 4RPYA 2HHVA 3C2KA 2HCFA 2VA3A 4RNOA 4F4ZA 1OW5A 2Y1JA 4KLTA 5IIMA 2P6UA 2EAPA 3ZDAA 2W8KA 4P0QA 4J9SA 2HBJA 4UB8U 2G07A 3TFSA 3WKEA 3C23A 3WKDA 2HHXA 4DF8A 4JMUA 3MDAA 8ICYA 7ICMA 1SV4A 3RB4A 3GV5B 3M6KA 5CEHA 2NYVA 3IG5A 2EH9A 4FZNA 5TISU 1N5XA 5KFBA 3AUOA 5KFDA 5AKKA 1N61A 5L1LA 2E8NA 2YY6A 1K5OA 1HJPA 4PJ0U 4IS7A 4QZAA 3H40A 3VC8A 3N7SC 3KTQA 3C1ZA 2YMMA 4QNLA 2ZIWB 3V6HA 3UM9A 1SV0C 2K4IA 4IQWA 1KTQA 4ZOHC 5CR0A 1T8EA 4QW9A 2F2AB 2MRLA 4UAWA 3U26A 4B6JA 5CRXA 2ATLA 5EWFA 4WJ3B 1X6IA 3HW8A 4CF5A 4I2HA 2MU2A 5AM4A 3Q8MA 3ICXA 1RM6C 3SD7A 4O5CA 1NZBA 1BPYA 5AKXA 2VKQA 4Q45A 5J0QA 4NY8A 5AM1A 2BZFA 4RQMA 1RPLA 1WUDA 4DLEA 2FI1A 3SI8A 3S6JA 2BPCA 2DQNB 5DQHA 1QLNA 2BQUA 4DQSA 1PK3A 5J2KA 4AP9A 4Q44A 4IQUA 1SZPA 3G6VA 3PO4A 4F5PA 1NZPA 5HNKA 4UATA 3NS1A 2XGQA 4Y2YA 1X9MA 4QJFB 4Y2TA 1Z00B 4U7CA 3ORYA 1L6NA 2Y9UA 1RXWA 2F8KA 5KFKA 2HBMA 2Y0SF 3DDHA 4M47A 1Z1BA 3RR8A 2W9BB 1RXVA 4M6WB 2ASJA 3FYHA 8ICZA 7ICSA 2Q4TA 2W9MA 4JV0A 4B9VA 3RRHA 2R18A 5IIOA 5AM0A 8ICTA 1H38A 9ICQA 1ECWA 4UB4A 4QIWC 2LM4A 1S9FA 2I5HA 3QU2A 3D2SA 4HAIA 1ZQKA 1NOMA 4RQ0A 2FMPA 1SZHA 1KQQA 4EENA 2G5IB 5DGBA 5KFGA 2M9NA 5AI6A 1HUZA 2ZIUA 4FS2A 4C80A 4DFJA 2YB1A 1KDHA 1L3TA 1QSYA 3BS5B 4M9GA 1SV0A 4QZBA 4RT2A 5BPCA 1NI3A 4OJ6A 1U9LA 5EWEA 2OCEA 3G6XA 2WF6A 7ICFA 2HHWA 2OYYA 3AQEA 4UB3A 2W8LA 2I1QA 1AQ6A 1TAMA 3IHQB 4ECWA 3NVYA 3F53A 3KZXA 5ALDA 4R66A 3WK5A 3QU7A 4DS4A 2HOQA 3K1ZA 3SMVA 5ALVA 1ZQGA 1LKYB 7ICIA 4NXZA 9ICWA 4DOAA 4OD0A 1VLBA 2NRTA 4KMUA 1U49A 4EBEA 5KT3A 2FLNA 3KZIU 2NO4A 1SKRA 4J9RA 2JH1A 2JGAA 1PVRA 1QQ5A 3Q8SB 7ICVA 4I29A 1XSNA 5KFIA 1Z4NA 4MEXA 4O3MA 5E79U 3PR5B 3M9NB 2KSOB 5DB9A 4NM1A 3Q8PB 1V85A 4R65A 4I27A 3PW2A 2ZXIA 2IHMA 4DL3A 1X9SA 1TAQA 2ZXHA 5KFYA 3JPQA 2LYBA 5KG6A 2DPJA 2J6UA 4PGQA 5J0SA 4UB2A 1KLNA 5AI8A 5L1IA 1NNLA 4DFMA 4M9LA 3T5JA 1LB2B 2AQ0A 4DLGA 4KN7A 3TQ1A 2HW3A 3PO5A 4EX6A 4RQ7A 4C0ZA 4DQIA 5IINA 2BR0A 4EBCA 2UVRA 4NJ8A 2AJQA 3V6JA 5J0TA 2MUTA 2LHTA 4CF4A 4GC7A 3UQ2A 1QQ6A 2KEYA 3ZD9A 3AU6A 4QW8A 1S77D 3PNCA 3I1YA 9ICXA 5KFQA 1ZQXA 4KMOB 3GFKB 1DK2A 2G5HB 4PHPA 4F93B 2W9CB 1NKCA 1XS9D 1YZ7A 3CP8A 4Z6DA 2ZTCA 4ED0A 3TANA 3MBYA 2OHFA 3QU9A 2YMQA 1O08A 3UMCA 4BDPA 4UB5A 3PY8A 4ECYA 3PW0A 5ALYA 4DQRA 4IL6U 3IN5A 2E8MA 2IOHA 1L7PA 3B9JA 3O0FA 5J2BA 2F3NA 2LKYA 1C20A 2E1FA 4NLNA 1RZTA 2XI9A 4RUAA 2GH1A 1A77A 8ICLA 1Z3EB 5KFMA 1N62A 2J6TA 4EEYA 4UBCA 4CRXA 3E2EA 1T4GA 5AKZA 3C5GA 4RQ2A 3MFIA 9ICSA 3RJKA 2EAOA 8ICOA 2XY5A 4ECZA 3JPPA 4P4MA 4TUPA 3OJUA 2B0CA 5AIAA 3MR3A 2HBLA 4QWBA 4I2GA 2KHVA 3KBBA
chains in the Genus database with same CATH topology
5F3XB 2LMRA 1X40A 1UCVA 4NJ8A 4NL9C 1DXSA 3K1RB 1RG6A 2DL0A 4RQMA 3SEIA 3TACB 2QB0A 2K60A 1JI7A 3KKAC 2KMDA 2DKZA 2D8CA 1UQVA 4RQNA 3IDWA 3BQ7A 1LKYB 4NL9A 1PK3A 2Y9TA 4MHVA 4PZNA 2KSOA 2F44A 5JRTA 1OXJA 2D3DA 1SXDA 1OW5A 3KKAA 1COKA 2E8OA 2EAMA 2EAPA 5KNIA 2JV3A 2Y9UA 1Z1VA 2KE7A 1B0XA 2ES6A 2QB0B 2F8KA 2QARA 5J8YC 1PK1A 2E8MA 1V38A 2L5YA 1WWVA 2KSOB 1SV4A 2F3NA 2KG5A 1KW4A 1V85A 5L1MA 2B6GA 2ESEA 2QB1A 5J8YA 1B4FA 1F0MA 2QKQA 4PZOA 1WWUA 5JTIA 3H8MA 2DKXA 2QARB 3TADC 1SGGA 3BS5A 2K4PA 2E8NA 3SENA 2YTUA 1PK1B 2E8PA 1X9XA 4IS7A 1SXEA 2FE9A 2EANA 2KIVA 1SV0C 5JU5A 3BS7A 3TADA 3HILA 2EAOA 2LPEA 2GLEA 1X66A 3BS5B 1SV0A 1LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3X B;  2LMR A;  1X40 A;  1UCV A;  4NJ8 A;  4NL9 C;  1DXS A;  3K1R B;  1RG6 A;  2DL0 A;  4RQM A;  3SEI A;  3TAC B;  2QB0 A;  2K60 A;  1JI7 A;  3KKA C;  2KMD A;  2DKZ A;  2D8C A;  1UQV A;  4RQN A;  3IDW A;  3BQ7 A;  1LKY B;  4NL9 A;  1PK3 A;  2Y9T A;  4MHV A;  4PZN A;  2KSO A;  2F44 A;  5JRT A;  1OXJ A;  2D3D A;  1SXD A;  1OW5 A;  3KKA A;  1COK A;  2E8O A;  2EAM A;  2EAP A;  5KNI A;  2JV3 A;  2Y9U A;  1Z1V A;  2KE7 A;  1B0X A;  2ES6 A;  2QB0 B;  2F8K A;  2QAR A;  5J8Y C;  1PK1 A;  2E8M A;  1V38 A;  2L5Y A;  1WWV A;  2KSO B;  1SV4 A;  2F3N A;  2KG5 A;  1KW4 A;  1V85 A;  5L1M A;  2B6G A;  2ESE A;  2QB1 A;  5J8Y A;  1B4F A;  1F0M A;  2QKQ A;  4PZO A;  1WWU A;  5JTI A;  3H8M A;  2DKX A;  2QAR B;  3TAD C;  1SGG A;  3BS5 A;  2K4P A;  2E8N A;  3SEN A;  2YTU A;  1PK1 B;  2E8P A;  1X9X A;  4IS7 A;  1SXE A;  2FE9 A;  2EAN A;  2KIV A;  1SV0 C;  5JU5 A;  3BS7 A;  3TAD A;  3HIL A;  2EAO A;  2LPE A;  2GLE A;  1X66 A;  3BS5 B;  1SV0 A;  1LKY A; 
#chains in the Genus database with same CATH topology
 4YVZ A;  5KG1 A;  4M9N A;  4FZM A;  1NK6 A;  3RRG A;  5HML A;  1ZET A;  5KFT A;  1Y88 A;  3NGD A;  5KFU A;  4DFP A;  3FDS A;  7ICP A;  4KX5 A;  3EZ5 A;  2RP5 A;  3ONN A;  2IBK A;  3HX0 A;  2A1J A;  1C7Y A;  4CF3 A;  4UB1 A;  5KFF A;  1JX4 A;  1COO A;  4B9T A;  4ECS A;  1JXL A;  5J2H A;  1BNP A;  2Y9T A;  3F5E A;  8ICR A;  2PMZ C;  2BDU A;  4C4R A;  1SXD A;  3BZK A;  5G5H A;  1JN3 A;  4ELT A;  2BCS A;  3C1Y A;  4O3P A;  4DSI A;  4J9M A;  2E8O A;  4PL1 A;  2JV3 A;  3NVZ A;  2ES6 A;  4KX3 A;  3PSP A;  8ICU A;  3AL0 B;  1A0P A;  3M1Y A;  1ZQP A;  1IG6 A;  2ZJ5 A;  1ZQ1 C;  4F4Y A;  5AHX A;  3V7J A;  1ZD4 A;  3MDC A;  2KP7 A;  1JXE A;  1XWL A;  4Y2J A;  3MFH A;  1T3N A;  2R8G A;  1BNO A;  4KTQ A;  5ALG A;  1B4F A;  1WWU A;  5DG7 A;  4UW9 A;  7ICG A;  2ISO A;  5CJ7 A;  3RB0 A;  2WF7 A;  2VJ5 A;  3RB6 A;  2BCQ A;  4KLJ A;  3E0F A;  4AYB F;  2NO5 A;  1ZJN A;  4NLB A;  2AU0 A;  5KFV A;  5F9N A;  2EAN A;  3PSF A;  5C0Y A;  1Q46 A;  2VA8 A;  2HOF A;  3F2C A;  2BCR A;  4DO9 A;  4I2I A;  1U47 A;  2KKV A;  3QZ8 A;  1KFS A;  1JAL A;  1QSL A;  1X66 A;  2BQR A;  2HHU A;  2NV3 A;  3CW2 C;  3RAX A;  2JHD A;  4JV1 A;  1A76 A;  3SQI A;  3TAQ A;  1TE2 A;  4O3O A;  1N56 A;  4K4H A;  3QE9 Y;  3H4D A;  1NJX A;  4I2D A;  1QQ7 A;  5C5J A;  4B9M A;  5EWG A;  4DSF A;  1UT8 A;  1L7N A;  4O5K A;  4FBU A;  4O9M A;  3UMB A;  7ICT A;  2PXI A;  3RBE A;  4EBD A;  1QSS A;  4MHV A;  2AGP A;  5DBA A;  2D3D A;  2H3F A;  5J0U A;  4YQW A;  3M7D A;  3ZDE A;  4C7Y A;  1ZQJ A;  4QZ8 A;  4ECU A;  5ALR A;  1EXN A;  4MFA A;  3Q8R B;  5DBB A;  4FE3 A;  3PST A;  3SV4 A;  4DQP A;  4KLI A;  7ICO A;  5J2G A;  3M8R A;  1V38 A;  2ZIV B;  1URJ A;  5ALM A;  5HP4 A;  3WU2 U;  5L9X A;  2XCA A;  3NVV A;  1NJY A;  2ZIW A;  2ZUB A;  2G09 A;  4F4W A;  4RQ6 A;  3J81 j;  2B6G A;  1JRO A;  3PZP A;  8ICV A;  4OO1 J;  4JUZ A;  3L5K A;  1Q3V A;  4C8L A;  1PVQ A;  1T94 A;  2UVW A;  4Y2U A;  1JIH A;  2K4P A;  3RJF A;  3PW7 A;  3CYM A;  3Q8K A;  9ICL A;  4XRH A;  1U4B A;  2C2R A;  3RF9 A;  2FE9 A;  1YT3 A;  3HKZ C;  2PI5 A;  2FMS A;  3WK6 A;  4KLE A;  1NK7 A;  3OSP A;  5ALK A;  1NK8 A;  2AXT U;  3HIL A;  1F44 A;  4ECQ A;  4BXO B;  4KLU A;  2FMQ A;  4F72 A;  3ZI4 A;  4UAU A;  1ZD3 A;  1SIJ A;  3TFR A;  4Y2S A;  3OSN A;  2IHN A;  4Y2R A;  5AK5 A;  3MR5 A;  4DS5 A;  3EW9 A;  2P35 A;  2F8L A;  8ICS A;  4Y2X A;  4R64 A;  5L1K A;  2GWS A;  4O3S A;  3ED5 A;  1BPZ A;  1Z00 A;  5BOL A;  4CGZ A;  1S0O A;  3HKZ F;  4A8E A;  3C5F A;  3KHG A;  5AK3 A;  2GO7 A;  4EZ6 A;  2W9B A;  4F92 B;  2BCU A;  4KLG A;  1UQV A;  9ICP A;  4M6W A;  2ALZ A;  1RQN A;  4IC9 A;  2K89 A;  4ED3 A;  3BQ2 A;  1ED1 A;  4ICA A;  3KHR A;  3ISD A;  4F8R A;  4C8M A;  3FC4 A;  4QWC A;  2Y0S C;  4QWA A;  4I2F A;  4O0I A;  3LWL A;  2F1J A;  1DRG A;  3SR6 A;  2VA2 A;  1XSL A;  1CEZ A;  3OHB A;  1L8L A;  4TQS A;  1KFD A;  3GDX A;  3JPS A;  2KIW A;  2IA6 A;  4F71 A;  3UPQ A;  3GIL A;  3BQT A;  9ICC A;  2KZZ A;  1MSW D;  3QXG A;  2C28 A;  4O3Q A;  3TAD C;  3BS5 A;  1KFT A;  3ZDD A;  1SXE A;  2QLT A;  1V9P A;  3IG8 A;  5AI5 A;  1MC8 A;  4RPZ A;  2R8I A;  1U48 A;  4GXJ A;  3AM9 A;  1ZQL A;  2KD1 A;  2DPI A;  1NK4 A;  4RNM A;  4YMN A;  1KN5 A;  2W7O A;  8ICX A;  5IIL A;  5J0O A;  3RBD A;  2V4Q A;  5AKI A;  2BQ3 A;  3AU2 A;  1LKY A;  2KNJ A;  3ZD8 A;  3GIM A;  1X40 A;  3JPN A;  1MQ2 A;  2JEG A;  4FO6 A;  2K8B B;  1D9F A;  2YX8 A;  1RG6 A;  3V72 A;  3RFA A;  3HRD D;  3AEV A;  2DL0 A;  5J0W A;  1O03 A;  4YXJ A;  2YMP A;  3D2N A;  2KVC A;  2K60 A;  3RJI A;  3RH6 A;  2HSZ A;  4PHE A;  2XY6 A;  4RQN A;  1KBU A;  2Z7J A;  2MA1 A;  2KSO A;  3UMG A;  3RB3 A;  5AKE A;  3ISC A;  1ZQU A;  4J9N A;  1XC9 A;  2NRZ A;  1D8B A;  2W55 A;  4NLG A;  9ICF A;  2BKE A;  4B9S A;  2KN7 A;  3UQ0 A;  1Z1V A;  4QZ9 A;  4RQ1 A;  5AKH A;  1KEJ A;  5ALE A;  1PZN A;  2ZUD A;  2L5Y A;  2K8A A;  8ICA A;  4P4P A;  5ALL A;  2W3R A;  2XCP A;  4ELU A;  5KFJ A;  1UPH A;  1WCL A;  5KFO A;  4YP3 A;  1L3S A;  4ECV A;  5AKJ A;  3PW5 A;  3RH4 A;  4UBB A;  1ZRM A;  3V7K A;  1N2X A;  4UAV A;  4PHD A;  3GIK A;  1PK1 B;  3PR4 A;  2R8H A;  3QYP A;  4Y2V A;  5KFC A;  2KOB A;  5J2D A;  5CP2 A;  2FPM A;  5JU5 A;  4KLO A;  5KAI U;  2RHF A;  3TAD A;  4YXM A;  4YN4 A;  2ZJA A;  5D49 A;  2GLE A;  1ZQQ A;  7ICR A;  2W9C A;  2AGQ A;  1U45 A;  1Q3U A;  1S97 A;  1FO4 A;  4PGX A;  1RDF A;  3QUC A;  4PPX A;  3OHA A;  5KT4 A;  1X9W A;  4YMM A;  4QZI A;  1PUZ A;  3SAG A;  1SL2 A;  3SYZ A;  1L5U A;  1X2I A;  1KKX A;  8ICC A;  4PL2 A;  3TAP A;  5H2F U;  3QEB Z;  4K4G A;  5KT7 A;  4P0P B;  4DSL A;  2MAX A;  4R8U B;  2G06 A;  3H8J A;  4OJL A;  1RYR A;  1B43 A;  5AK6 A;  7ICE A;  1OXJ A;  1BPB A;  2IOF K;  4DFD A;  3K75 D;  4ED6 A;  3D6J A;  4DWI A;  2ODG A;  2KE7 A;  2PFN A;  3FM9 A;  4Z6C A;  4F4K A;  2RRD A;  5J8Y C;  4EYH B;  1BPD A;  1UT5 A;  3NVW A;  3DEE A;  2JEI A;  5KG4 A;  1NKE A;  3IP4 B;  1XO1 A;  5ALW A;  3BDP A;  1FFU A;  1CI4 A;  2EZX A;  4ELV A;  3LYS A;  1DGS A;  2O6K A;  5KFW A;  1F0M A;  2QKQ A;  4PZO A;  3I28 A;  2W03 A;  3PW4 A;  4G3I A;  2QAR B;  4QWD A;  4ECX A;  3SEN A;  4PGY A;  4I2E A;  4EEK A;  3RAQ A;  4ECR A;  8ICQ A;  3QUT A;  4US9 A;  1L7M A;  1XU4 A;  5KG3 A;  2DGZ A;  3RJH A;  5J2J A;  4IQT A;  1GO3 F;  4CNQ A;  2LYA A;  1BPE A;  4CCH A;  1KL9 A;  1B22 A;  2D6F C;  4I2J A;  2W11 A;  4OCZ A;  4IRK A;  4GXI A;  3C21 A;  3GZF A;  3F5A A;  1N5W A;  5TZV A;  7ICL A;  1P7D A;  4NM2 A;  4US8 A;  4M0A A;  4DL5 A;  3LDA A;  2PI4 A;  3K1R B;  1XSP A;  1FIQ A;  3PMN A;  5DKW A;  2WAQ F;  2RDJ A;  4C4S A;  2F44 A;  2RQ5 A;  5KG7 A;  2AH5 A;  2OXO A;  3BZC A;  2YN4 A;  4BWJ A;  2W43 A;  5KNI A;  2JH7 A;  1S5L U;  2ZIX B;  2GOL A;  3QUB A;  4U6P A;  2QB0 B;  1ZQN A;  2YQE A;  2DFL A;  2MSN A;  1TVA A;  5GTH U;  1ZD2 P;  1SB3 C;  5J0X A;  1WWV A;  3H7I A;  5D4B A;  4C7Z A;  3ZDC A;  9ICI A;  9ICM A;  1S0V A;  4Z6F A;  5KFA A;  5EOZ A;  1SWW A;  4M9H A;  2AGO A;  5J8Y A;  4YCX A;  5KFZ A;  4YD1 A;  2HOI A;  1ARO P;  2WF5 A;  4AYB C;  9ICV A;  1ZQS A;  4GXK A;  2BPG A;  5J2I A;  3NRZ A;  4CE6 A;  4OJ5 A;  5KG5 A;  1ZXI A;  3BS7 A;  2EDU A;  2OH2 A;  5ALP A;  5FP0 A;  1L3U A;  2F77 X;  1ZJM A;  1NJW A;  4DEZ A;  1ZQZ A;  4X5V A;  4GC6 A;  4G9B A;  1J2M A;  2YML A;  3ETL A;  4F5N A;  2OM6 A;  4TUS A;  2JZB B;  3QZ7 A;  4UB6 U;  3RR7 A;  1BVS A;  2ZJ8 A;  3N4M B;  2W54 A;  3F2B A;  4JB3 A;  2FJ6 A;  4NLZ A;  4NL9 C;  3KFU F;  3AN1 A;  4DCC A;  4QZE A;  1CRX A;  2XVT A;  5AKL A;  5CHG A;  9ICB A;  2KHQ A;  3PX6 A;  8ICG A;  8ICH A;  2WTF A;  3KKA C;  5GTI U;  2VIX A;  2ZIV A;  3MGH A;  4BUG A;  3M6Z A;  2KZM A;  2I6X A;  3PSI A;  5AIB A;  2ZTD A;  3M9O B;  1CUK A;  1NJZ A;  3CNH A;  4F4X A;  5HMM A;  1NK0 A;  4RZR A;  4O5E A;  3PV8 A;  5HR7 A;  5DDM A;  4Q43 A;  4FZL A;  2XC9 A;  3ZDB A;  5CWR A;  5ALH A;  4DL2 A;  1L3V A;  3FAH A;  5AKY A;  4F91 B;  5ALO A;  1HUO A;  4UQG A;  1M6Y A;  2KG5 A;  1JRP A;  1KW4 A;  4J9L A;  5KFS A;  1ZD5 A;  4K4I A;  2HBK A;  4M9J A;  4J9P A;  1ZQA A;  3QX7 A;  4BXO A;  5HHH A;  4DL6 A;  3R9K A;  4MF8 A;  4F50 A;  2OWO A;  5KAF U;  1SGG A;  4F3O A;  3GQC A;  3RJG A;  4DQQ A;  5ALX A;  1TAU A;  7ICH A;  2NRV A;  3T79 A;  1ZQO A;  4PH5 A;  1JMS A;  4TQR A;  5J29 A;  4BWM A;  4JWN A;  1ZQI A;  2IMW P;  2FPL A;  4EEL A;  5III A;  4NLC A;  1K1S A;  2KFZ A;  5JUM A;  1N63 A;  1D9D A;  3E58 A;  5ALU A;  8ICM A;  1QCK A;  1J97 A;  4QZC A;  3EUB 2;  3TI0 A;  4E0D A;  2KIC A;  1FFV A;  5KFE A;  1BGX T;  2HVH A;  1KSP A;  9ICE A;  4O3R A;  4DL7 A;  2E1E A;  5KT5 A;  5DB6 A;  2PKE A;  3H8W A;  2FPK A;  2RDI A;  4F5Q A;  2HHS A;  3BQ1 A;  1DGJ A;  1HIW A;  1ZOL A;  1QTM A;  5KL8 B;  2A1A A;  4DOC A;  2A3V A;  4NV0 A;  1ZQV A;  3PX0 A;  2LI6 A;  3IDW A;  4NL9 A;  2BCV A;  9ICT A;  5JRT A;  2DF4 B;  5F9L A;  4J9Q A;  3BQ0 A;  2DUY A;  5DG9 A;  3KKA A;  4Y2Q A;  1COK A;  2XID A;  4MFF A;  3T5K A;  4F5O A;  9ICK A;  5DG8 A;  1MA7 A;  2Y1I A;  4XUS A;  3LVW A;  3WKB A;  2J6S A;  3WK7 A;  5B66 U;  3B0X A;  5DQG A;  5ALZ A;  1S0N A;  4M2Y A;  2QB1 A;  1D8L A;  3MGI A;  3MC1 A;  5J0P A;  2LBO A;  5JTI A;  4QZH A;  4UAR A;  4QZF A;  2DKX A;  4LZD A;  3LK9 A;  2FDR A;  4P0Q B;  4RQ8 A;  4ED8 A;  5EE1 A;  2DBY A;  3I76 A;  3PVX A;  4YG2 A;  4C8O A;  3NUQ A;  3TKA A;  1L8O A;  2Q0Z X;  5AKG A;  2WB1 C;  4JV2 A;  4Q8F A;  5T14 A;  2XO7 A;  1RYS A;  4ED7 A;  2XY7 A;  3F2D A;  1Q8K A;  3D2Q A;  2CPR A;  2WHE A;  3KHH A;  2W7P A;  3N97 B;  5DLF A;  2BPF A;  1UHU A;  2JEF A;  1S8O A;  4YR2 A;  1YZ6 A;  3Q8Q B;  4EZ9 A;  3GII A;  4OJO A;  3AQF A;  5DB8 A;  5A0L A;  5J2F A;  1DXS A;  4RU9 A;  4P4O A;  4I2C A;  4DFK A;  8ICW A;  2R8K A;  3H0M B;  3HPO A;  2ASL A;  5B5E U;  4YR3 A;  1J2N A;  1PVP A;  2B21 A;  2WB1 F;  4F2S A;  5AI0 A;  4RQ5 A;  5DQI A;  3N28 A;  4DSJ A;  3GV7 B;  5CB1 A;  2BGW A;  3JPO A;  3BQ7 A;  2CN1 A;  1L7O A;  1IM4 A;  3UXP A;  5J0Y A;  2G08 A;  4F2R A;  1SKW A;  3QNM A;  5EE9 A;  3JPR A;  3OGU A;  4B9U A;  4DSK A;  1QH9 A;  2EQY A;  4NWI A;  4KLL A;  2LYH A;  3DV9 A;  3RTV A;  5KG2 A;  2KVS A;  4FS1 A;  5J2C A;  1PK1 A;  5AI9 A;  2W04 A;  4IR9 A;  3LWM A;  2PFO A;  7ICJ A;  3H0L B;  4IRD A;  3L4P A;  3NTU A;  4R63 A;  4ED2 A;  3H8S A;  3V6K A;  1ZYQ A;  3K4G A;  3UXO A;  1NKB A;  9ICR A;  1NK5 A;  7ICU A;  2H3I A;  2XIC A;  8ICI A;  4MF2 A;  3GU3 A;  4QIW F;  3IM1 A;  3GIJ A;  3QU5 A;  2E8P A;  2V9W A;  1X42 A;  2PFP A;  7ICN A;  4J9O A;  1MQ3 A;  2KV2 A;  4DF4 A;  2IOF A;  8ICP A;  4UAZ A;  3IV6 A;  2PFQ A;  1TK5 A;  2C2E A;  3WK9 A;  4ACO A;  2JMG A;  4HYK A;  4P0P A;  5AI4 A;  5EE0 A;  4R8U A;  5KL1 B;  2ASD A;  2LMR A;  2N1R A;  3T5H A;  4DL4 A;  1UCV A;  1ZQD A;  1ZQY A;  1VDV A;  4YMO A;  4Y2P A;  1WCN A;  4IRC A;  4GIB A;  2ZIU B;  3RH5 A;  5L1J A;  3TAC B;  5J2A A;  3EWA A;  4DOB A;  1JI7 A;  3Q8L A;  4B9L A;  3IRU A;  2AQ4 A;  5KFR A;  3HJE A;  4PZN A;  3SZ2 A;  5D46 A;  3QUQ A;  1SL1 A;  1BPX A;  1F5S A;  5ALQ A;  5ALF A;  2EAM A;  2ZG6 A;  3LVV A;  4OJP A;  4DSE A;  1A6S A;  2KZ3 A;  2QAR A;  3RJE A;  1SL0 A;  1MN8 A;  5KG0 A;  3L3F X;  2JRZ A;  3WKC A;  1SWV A;  4I2B A;  1ZQE A;  3QEA Z;  4C8K A;  4TUR A;  3WK8 A;  2ZTE A;  1TK0 A;  4XQ8 A;  4NLK A;  4ZH4 A;  1WYG A;  2F1H A;  1UA1 A;  4BGD A;  4P2H A;  3C29 A;  2F76 X;  1ZQW A;  4C4T A;  3UXN A;  9ICJ A;  2H3Z A;  1S10 A;  2RLT A;  2R8J A;  2EZY A;  5ALN A;  1JUD A;  5AM3 A;  3T5L A;  2C2D A;  5ALS A;  3H4B A;  4KLD A;  1DOQ A;  3N7P D;  4BX9 C;  5CA7 A;  9ICA A;  5DB7 A;  4KLF A;  5ALJ A;  8ICJ A;  5KFP A;  5G5G A;  1ZRN A;  5KTQ A;  2A19 A;  3H0R B;  5F3X B;  5AM5 A;  5ALT A;  2WF9 A;  3KD3 A;  1ZQF A;  2XGP A;  4I2A A;  4MFC A;  2KJ8 A;  4F5R A;  4RUC A;  2CXY A;  2WAQ C;  4KLH A;  2ZIX A;  3MGV A;  1LV5 A;  2QB0 A;  2HHT A;  3A0B U;  2P6R A;  2K4H A;  2BDP A;  2UVU A;  5DLG A;  2KJ5 A;  4FFD A;  1DK3 A;  7ICQ A;  3GV8 B;  4IQV A;  4QZD A;  1D8Y A;  2MUT B;  2C22 A;  1HEK A;  1T7P A;  8ICE A;  1FEZ A;  2HVI A;  5J0R A;  4RQ4 A;  5DBC A;  2H3Q A;  2OEH A;  5KFN A;  1Z4O A;  2I9G A;  1IIP A;  8ICB A;  4RQ3 A;  5IIJ A;  4YFK A;  3HP6 A;  4C8N A;  4J9K A;  5HHI A;  1LVH A;  4EYI B;  3N7R C;  4ECT A;  5L1M A;  2LM1 A;  2ESE A;  1Z19 A;  5AK4 A;  2E3T A;  5HR6 A;  8ICN A;  1KRP A;  1S0M A;  1TV9 A;  2BHN A;  4QWE A;  3C2L A;  1ZQC A;  8ICK A;  4EX7 A;  4KIT B;  2JZB A;  2W3S A;  3RJJ A;  2P66 A;  5BOM A;  1XO0 A;  5K4L A;  1OUQ A;  3V7L A;  3MR6 A;  3THV A;  2EZZ A;  1IV8 A;  2FLP A;  2V4R A;  5J2E A;  2YB4 A;  2ZUC A;  2F1I A;  3MR2 A;  2LPE A;  1IXR A;  5KFH A;  4LVS A;  1VJ5 A;  1ZQR A;  4MEY A;  4RT3 A;  3HT3 A;  1WG8 A;  3EPG A;  2WFA A;  4PHA A;  4KN4 A;  4BJQ A;  2VJ4 A;  3OPX A;  4M04 A;  3KOO A;  4Z6E A;  3PX4 A;  2HDO A;  5AM2 A;  3EPI A;  2HMX A;  4FBT A;  3NAS A;  1NK9 A;  3TAR A;  4GFJ A;  4LJX A;  4UAY A;  3SEI A;  3QU4 A;  1UA0 A;  2UVV A;  4USA A;  1XNS A;  4IR1 A;  1X6J A;  2KMD A;  3AMZ A;  2DKZ A;  1TK8 A;  2D8C A;  2HI0 A;  1RQL A;  4J03 A;  2H5X A;  1N60 A;  4ED1 A;  2KJ9 A;  3KHL A;  4B9N A;  4LZG A;  2PMZ F;  4Q8E A;  4QZG A;  3WKA A;  1B0X A;  2A1J B;  1N48 A;  4KLQ A;  3B0Y A;  2ISP A;  2H3V A;  3VCB A;  2K8C B;  2AHO B;  2G0A A;  2KTQ A;  3PML A;  1ZQM A;  5DDY A;  4YD2 A;  3ISB A;  2NRX A;  3BJY A;  3SV3 A;  2K4E A;  1T3Q A;  3ETR A;  9ICN A;  1S76 D;  9ICH A;  3A0H U;  5KT6 A;  2HHQ A;  4JWM A;  3H8M A;  2KFN A;  9ICU A;  1ZQT A;  1SKS A;  2YTU A;  1V97 A;  3HWT A;  1X9X A;  4TUQ A;  4KLS A;  1RYU A;  3C2M A;  3OTQ A;  4RPX A;  4I28 A;  2KKP A;  4GLX A;  1TFR A;  2KIV A;  3C28 A;  5KFX A;  3NRW A;  8ICF A;  2NRW A;  4JK1 A;  2JXJ A;  2VAN A;  9ICO A;  4YR0 A;  3EYZ A;  5ALI A;  4RNN A;  5AIC A;  1ZQH A;  4O3N A;  5IIK A;  3M9M B;  4KLM A;  4CDG A;  2CRX A;  3M8S A;  3G6Y A;  2M0N A;  3SAF A;  2FLL A;  5DGA A;  2JR5 A;  3SAH A;  1ZQB A;  3WK4 A;  1TKD A;  5KFL A;  5KT2 A;  1K1Q A;  4UAS A;  2KK0 A;  2WF8 A;  2E5S A;  2DWQ A;  4XA5 A;  5EE3 A;  3JPT A;  9ICG A;  3ALR A;  3MAB A;  3CRX A;  2W9A A;  3OJS A;  3T3F A;  2JEJ A;  7ICK A;  4RPY A;  2HHV A;  3C2K A;  2HCF A;  2VA3 A;  4RNO A;  4F4Z A;  1OW5 A;  2Y1J A;  4KLT A;  5IIM A;  2P6U A;  2EAP A;  3ZDA A;  2W8K A;  4P0Q A;  4J9S A;  2HBJ A;  4UB8 U;  2G07 A;  3TFS A;  3WKE A;  3C23 A;  3WKD A;  2HHX A;  4DF8 A;  4JMU A;  3MDA A;  8ICY A;  7ICM A;  1SV4 A;  3RB4 A;  3GV5 B;  3M6K A;  5CEH A;  2NYV A;  3IG5 A;  2EH9 A;  4FZN A;  5TIS U;  1N5X A;  5KFB A;  3AUO A;  5KFD A;  5AKK A;  1N61 A;  5L1L A;  2E8N A;  2YY6 A;  1K5O A;  1HJP A;  4PJ0 U;  4IS7 A;  4QZA A;  3H40 A;  3VC8 A;  3N7S C;  3KTQ A;  3C1Z A;  2YMM A;  4QNL A;  2ZIW B;  3V6H A;  3UM9 A;  1SV0 C;  2K4I A;  4IQW A;  1KTQ A;  4ZOH C;  5CR0 A;  1T8E A;  4QW9 A;  2F2A B;  2MRL A;  4UAW A;  3U26 A;  4B6J A;  5CRX A;  2ATL A;  5EWF A;  4WJ3 B;  1X6I A;  3HW8 A;  4CF5 A;  4I2H A;  2MU2 A;  5AM4 A;  3Q8M A;  3ICX A;  1RM6 C;  3SD7 A;  4O5C A;  1NZB A;  1BPY A;  5AKX A;  2VKQ A;  4Q45 A;  5J0Q A;  4NY8 A;  5AM1 A;  2BZF A;  4RQM A;  1RPL A;  1WUD A;  4DLE A;  2FI1 A;  3SI8 A;  3S6J A;  2BPC A;  2DQN B;  5DQH A;  1QLN A;  2BQU A;  4DQS A;  1PK3 A;  5J2K A;  4AP9 A;  4Q44 A;  4IQU A;  1SZP A;  3G6V A;  3PO4 A;  4F5P A;  1NZP A;  5HNK A;  4UAT A;  3NS1 A;  2XGQ A;  4Y2Y A;  1X9M A;  4QJF B;  4Y2T A;  1Z00 B;  4U7C A;  3ORY A;  1L6N A;  2Y9U A;  1RXW A;  2F8K A;  5KFK A;  2HBM A;  2Y0S F;  3DDH A;  4M47 A;  1Z1B A;  3RR8 A;  2W9B B;  1RXV A;  4M6W B;  2ASJ A;  3FYH A;  8ICZ A;  7ICS A;  2Q4T A;  2W9M A;  4JV0 A;  4B9V A;  3RRH A;  2R18 A;  5IIO A;  5AM0 A;  8ICT A;  1H38 A;  9ICQ A;  1ECW A;  4UB4 A;  4QIW C;  2LM4 A;  1S9F A;  2I5H A;  3QU2 A;  3D2S A;  4HAI A;  1ZQK A;  1NOM A;  4RQ0 A;  2FMP A;  1SZH A;  1KQQ A;  4EEN A;  2G5I B;  5DGB A;  5KFG A;  2M9N A;  5AI6 A;  1HUZ A;  2ZIU A;  4FS2 A;  4C80 A;  4DFJ A;  2YB1 A;  1KDH A;  1L3T A;  1QSY A;  3BS5 B;  4M9G A;  1SV0 A;  4QZB A;  4RT2 A;  5BPC A;  1NI3 A;  4OJ6 A;  1U9L A;  5EWE A;  2OCE A;  3G6X A;  2WF6 A;  7ICF A;  2HHW A;  2OYY A;  3AQE A;  4UB3 A;  2W8L A;  2I1Q A;  1AQ6 A;  1TAM A;  3IHQ B;  4ECW A;  3NVY A;  3F53 A;  3KZX A;  5ALD A;  4R66 A;  3WK5 A;  3QU7 A;  4DS4 A;  2HOQ A;  3K1Z A;  3SMV A;  5ALV A;  1ZQG A;  1LKY B;  7ICI A;  4NXZ A;  9ICW A;  4DOA A;  4OD0 A;  1VLB A;  2NRT A;  4KMU A;  1U49 A;  4EBE A;  5KT3 A;  2FLN A;  3KZI U;  2NO4 A;  1SKR A;  4J9R A;  2JH1 A;  2JGA A;  1PVR A;  1QQ5 A;  3Q8S B;  7ICV A;  4I29 A;  1XSN A;  5KFI A;  1Z4N A;  4MEX A;  4O3M A;  5E79 U;  3PR5 B;  3M9N B;  2KSO B;  5DB9 A;  4NM1 A;  3Q8P B;  1V85 A;  4R65 A;  4I27 A;  3PW2 A;  2ZXI A;  2IHM A;  4DL3 A;  1X9S A;  1TAQ A;  2ZXH A;  5KFY A;  3JPQ A;  2LYB A;  5KG6 A;  2DPJ A;  2J6U A;  4PGQ A;  5J0S A;  4UB2 A;  1KLN A;  5AI8 A;  5L1I A;  1NNL A;  4DFM A;  4M9L A;  3T5J A;  1LB2 B;  2AQ0 A;  4DLG A;  4KN7 A;  3TQ1 A;  2HW3 A;  3PO5 A;  4EX6 A;  4RQ7 A;  4C0Z A;  4DQI A;  5IIN A;  2BR0 A;  4EBC A;  2UVR A;  4NJ8 A;  2AJQ A;  3V6J A;  5J0T A;  2MUT A;  2LHT A;  4CF4 A;  4GC7 A;  3UQ2 A;  1QQ6 A;  2KEY A;  3ZD9 A;  3AU6 A;  4QW8 A;  1S77 D;  3PNC A;  3I1Y A;  9ICX A;  5KFQ A;  1ZQX A;  4KMO B;  3GFK B;  1DK2 A;  2G5H B;  4PHP A;  4F93 B;  2W9C B;  1NKC A;  1XS9 D;  1YZ7 A;  3CP8 A;  4Z6D A;  2ZTC A;  4ED0 A;  3TAN A;  3MBY A;  2OHF A;  3QU9 A;  2YMQ A;  1O08 A;  3UMC A;  4BDP A;  4UB5 A;  3PY8 A;  4ECY A;  3PW0 A;  5ALY A;  4DQR A;  4IL6 U;  3IN5 A;  2E8M A;  2IOH A;  1L7P A;  3B9J A;  3O0F A;  5J2B A;  2F3N A;  2LKY A;  1C20 A;  2E1F A;  4NLN A;  1RZT A;  2XI9 A;  4RUA A;  2GH1 A;  1A77 A;  8ICL A;  1Z3E B;  5KFM A;  1N62 A;  2J6T A;  4EEY A;  4UBC A;  4CRX A;  3E2E A;  1T4G A;  5AKZ A;  3C5G A;  4RQ2 A;  3MFI A;  9ICS A;  3RJK A;  2EAO A;  8ICO A;  2XY5 A;  4ECZ A;  3JPP A;  4P4M A;  4TUP A;  3OJU A;  2B0C A;  5AIA A;  3MR3 A;  2HBL A;  4QWB A;  4I2G A;  2KHV A;  3KBB A; 
#chains in the Genus database with same CATH homology
 5F3X B;  2LMR A;  1X40 A;  1UCV A;  4NJ8 A;  4NL9 C;  1DXS A;  3K1R B;  1RG6 A;  2DL0 A;  4RQM A;  3SEI A;  3TAC B;  2QB0 A;  2K60 A;  1JI7 A;  3KKA C;  2KMD A;  2DKZ A;  2D8C A;  1UQV A;  4RQN A;  3IDW A;  3BQ7 A;  1LKY B;  4NL9 A;  1PK3 A;  2Y9T A;  4MHV A;  4PZN A;  2KSO A;  2F44 A;  5JRT A;  1OXJ A;  2D3D A;  1SXD A;  1OW5 A;  3KKA A;  1COK A;  2E8O A;  2EAM A;  2EAP A;  5KNI A;  2JV3 A;  2Y9U A;  1Z1V A;  2KE7 A;  1B0X A;  2ES6 A;  2QB0 B;  2F8K A;  2QAR A;  5J8Y C;  1PK1 A;  2E8M A;  1V38 A;  2L5Y A;  1WWV A;  2KSO B;  1SV4 A;  2F3N A;  2KG5 A;  1KW4 A;  1V85 A;  5L1M A;  2B6G A;  2ESE A;  2QB1 A;  5J8Y A;  1B4F A;  1F0M A;  2QKQ A;  4PZO A;  1WWU A;  5JTI A;  3H8M A;  2DKX A;  2QAR B;  3TAD C;  1SGG A;  3BS5 A;  2K4P A;  2E8N A;  3SEN A;  2YTU A;  1PK1 B;  2E8P A;  1X9X A;  4IS7 A;  1SXE A;  2FE9 A;  2EAN A;  2KIV A;  1SV0 C;  5JU5 A;  3BS7 A;  3TAD A;  3HIL A;  2EAO A;  2LPE A;  2GLE A;  1X66 A;  3BS5 B;  1SV0 A;  1LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...