2QB0A

Structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymer-driven crystallization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase regulator
molecule keywords E80-TELSAM domain
total genus 19
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2qb0A00
3BS7A 2QB0A 3SEIA 2KSOA 2EAMA 2E8MA 1COKA 2QB1A 4NL9C 2ESEA 3HILA 1KW4A 4RQMA 1SXEA 1RG6A 5F3XB 1F0MA 2E8OA 4NJ8A 1LKYB 1B0XA 1UCVA 1V38A 5JRTA 2DKXA 2Y9UA 2DL0A 2KE7A 1JI7A 2E8NA 2QARA 2QKQA 1X9XA 2DKZA 2GLEA 2EAOA 2K60A 3IDWA 2LPEA 1OXJA 1SV0A 2B6GA 4NL9A 1OW5A 2QARB 2QB0B 5J8YC 5KNIA 2F44A 3SENA 1SV4A 1V85A 2YTUA 2F8KA 1X66A 2L5YA 2KMDA 1SXDA 2LMRA 3BS5B 2EAPA 1PK3A 3H8MA 3KKAA 1PK1B 5J8YA 2KSOB 1Z1VA 1PK1A 3K1RB 2K4PA 2KG5A 3TACB 1WWVA 2E8PA 3BQ7A 2EANA 2KIVA 2D8CA 1SV0C 2Y9TA 1LKYA 1X40A 4PZOA 1DXSA 4IS7A 5JU5A 3KKAC 4RQNA 1WWUA 2F3NA 3TADC 2JV3A 4PZNA 1UQVA 5JTIA 2FE9A 2ES6A 1B4FA 3BS5A 5L1MA 2D3DA 4MHVA 1SGGA 3TADA
chains in the Genus database with same CATH superfamily
1SWVA 4I2FA 3QEBZ 1COKA 5DGBA 3PX4A 3IM1A 2ZIWB 4YXMA 1X42A 1T3QA 5F3XB 3RAXA 4O3OA 4EZ9A 2WAQC 4MFFA 5EOZA 4ED2A 4EYHB 1XS9D 2HHQA 3H40A 2FJ6A 3HKZC 2W8LA 2I5HA 5DB9A 4BWJA 1MC8A 5KFEA 5AM1A 4XUSA 4RT2A 2BQUA 4J9QA 3TKAA 2FPLA 3UQ0A 1CI4A 3EZ5A 4I2HA 2VANA 4UAZA 1OW5A 5DB8A 2EH9A 4YXJA 4DQSA 4I2GA 3G6YA 1N63A 3PMNA 4NXZA 4E0DA 8ICIA 3AQFA 4CF4A 3Q8SB 4Y2UA 3AMZA 3H8MA 3TAQA 4FZNA 2JEJA 5ALQA 7ICHA 1D8YA 4F71A 1HIWA 3OSPA 2KN7A 9ICUA 1L7NA 4ICAA 1X40A 3GZFA 2JH7A 4UAVA 2JGAA 3FDSA 4Q8FA 4PPXA 1ZQPA 2OWOA 3TADC 3JPRA 4GXJA 1UQVA 3GIMA 1ZD5A 3OSNA 5EE1A 4RQ8A 5J2FA 4KLUA 4PGQA 3M9NB 3T5KA 4UARA 1ZXIA 5J0OA 2VA8A 8ICBA 2VKQA 1TV9A 2IOFA 5TZVA 1DGJA 4NWIA 3S6JA 3UXOA 1AROP 3I76A 5KFPA 4GIBA 3MFHA 1D9DA 3MC1A 4X5VA 1FFVA 1S0OA 5KFKA 5KFWA 4KLLA 8ICWA 2HHXA 8ICZA 4DFPA 1NK8A 9ICPA 4RQ1A 2E8NA 1NK5A 5J0PA 2R8KA 3M8RA 1NK0A 1X9XA 4O0IA 4C7ZA 5J0UA 1IXRA 5ALUA 1P7DA 1XNSA 2HHVA 4F5QA 4QW8A 3LVWA 5HR6A 7ICUA 4RQ0A 4DL6A 2UVVA 8ICUA 3K1ZA 3QU2A 2KTQA 3RBEA 2K4IA 4I2DA 2KVCA 3AQEA 3ZDAA 3V6HA 4KLTA 4QZCA 1A0PA 5DBBA 1S8OA 4C4RA 3PX0A 2F1JA 2ODGA 2YMLA 3VCBA 1XSNA 1ZJNA 2A3VA 1ZOLA 2YB4A 2EAPA 2IOHA 2W54A 2WTFA 1TVAA 2NRXA 2PFNA 1S0VA 4UATA 3QU5A 1TAMA 2H3QA 2E8PA 3RH4A 4I29A 4AP9A 4WJ3B 4NM1A 2JXJA 1C20A 4YR2A 3SYZA 4OO1J 5KG6A 4F92B 4DCCA 2ZIUA 3IHQB 2XY6A 4YN4A 1PVPA 3WK5A 5IIOA 4RQNA 3QUTA 4NLKA 2W3SA 4P4MA 4QWDA 3LWLA 4NY8A 4ECZA 5AKEA 4F4KA 4A8EA 5TISU 3MDAA 3ZDEA 4KMOB 4RQ5A 1RZTA 2ZXHA 4HAIA 1J2NA 2IBKA 2D3DA 4Z6CA 2K8CB 4ECSA 2I9GA 2KSOA 5AI4A 3IG5A 2W9AA 3NGDA 3A0HU 4QJFB 3LVVA 3A0BU 5KT4A 3C2KA 2R8GA 7ICMA 1XSPA 3QU7A 2BHNA 1LKYB 1X6JA 2R8IA 1LB2B 3GIIA 1VDVA 3RF9A 5AM2A 4UAYA 1BPDA 2BDPA 4LVSA 4GFJA 2QARA 5IIJA 5KL8B 2BPFA 5DBCA 7ICIA 5DG9A 2NRTA 1OXJA 1SV0A 3TFRA 2C22A 1IG6A 2W7OA 4DSJA 3I1YA 2QARB 4F4XA 4M9LA 2F2AB 1S97A 3WK9A 3JPOA 2F8LA 1BNPA 5L1IA 4PH5A 5DG7A 1OUQA 2DPJA 4MF2A 3PW2A 1KFDA 1CRXA 3KD3A 5J8YA 4KLJA 1ZRNA 3K1RB 4QZDA 1WYGA 1ZQTA 3HRDD 4PGYA 2WF9A 2KIWA 4DFJA 4GC6A 2EZXA 2DQNB 3L4PA 4ECTA 1ZQLA 4PHAA 4US8A 2F77X 4ED8A 5H2FU 2JV3A 4YR3A 4PGXA 3NS1A 1KQQA 1V9PA 8ICKA 4C80A 4XA5A 3BQ0A 4UB5A 2W03A 5DDYA 2EDUA 1L3TA 1N60A 5AI6A 1JXLA 3C28A 5D4BA 3QE9Y 3MR5A 4K4GA 4IRKA 4Z6EA 2UVUA 4IRCA 3D2NA 1D9FA 4RT3A 1O03A 1U9LA 4EBCA 1KLNA 2DGZA 2J6UA 2YQEA 3F2BA 3T5HA 5KTQA 4DF4A 3LK9A 4C8OA 2DKXA 4RU9A 5J2IA 4FFDA 2WF5A 5KFYA 4KTQA 3KHLA 3CW2C 5JUMA 1BVSA 5KFHA 4RUCA 2JEIA 5DDMA 2LHTA 5J2DA 2H3FA 2BCSA 3BDPA 4R64A 3EWAA 4DQRA 3EYZA 1BPZA 3RJEA 1ZQOA 2NV3A 1ZQFA 4DLGA 1TE2A 3RJJA 4PHDA 3WU2U 4FE3A 3ED5A 8ICMA 3V7KA 1FO4A 3QYPA 2HOIA 4DOAA 2P6UA 3TACB 4O5EA 4Y2VA 4QZFA 3ZDBA 1QQ6A 2D8CA 2PFPA 2PI4A 3RH6A 4BJQA 2BPCA 2KHVA 4CNQA 4Y2YA 4NM2A 2ZJAA 1ZQDA 4JUZA 4UB2A 3QEAZ 4C4TA 4EEYA 3ZI4A 3H4DA 4GXKA 3O0FA 5IIIA 4KLGA 3M1YA 1TAUA 1WUDA 5B5EU 1L7OA 5EWGA 4M9JA 1KFTA 9ICHA 4F2RA 1F0MA 1RYRA 1SL1A 3M9OB 2FLLA 2PMZC 2J6SA 3M6KA 4BX9C 2YMQA 3TI0A 8ICRA 4O3MA 4YP3A 5AICA 1NJWA 2KE7A 1JI7A 4G3IA 2HMXA 2RP5A 5AM3A 1T3NA 2AJQA 5D46A 2G07A 4ELTA 5DQIA 4TUQA 4BGDA 4QZIA 3Q8RB 1BPBA 1U48A 2BCUA 1RPLA 4NL9A 2ASJA 4B9MA 3M8SA 2HHUA 3H8SA 4RPZA 4DOBA 7ICTA 8ICAA 2YTUA 3NRWA 3KZXA 5L1KA 2RDJA 5DLGA 3BS5B 4MFCA 4YVZA 4DWIA 3B0YA 1PK1B 5KG7A 1JMSA 2KSOB 3NASA 4KLMA 2YN4A 4U6PA 1PK1A 4CF5A 1NJYA 4R8UB 4NLCA 3HP6A 3SAFA 1ZQVA 3GQCA 3I28A 9ICJA 4O3PA 4DFDA 5DQHA 8ICGA 4DSFA 5GTHU 3SAHA 1B22A 4FS2A 2GO7A 4KITB 5DGAA 1WWUA 3QX7A 4IC9A 4C7YA 1XWLA 4ELUA 3HKZF 1SZPA 5IILA 1ZQQA 8ICVA 4KMUA 2UVRA 5DBAA 1SL2A 2MUTB 1RXWA 4OJLA 3OJSA 4I28A 2WAQF 1QSLA 2IOFK 3PO4A 4ECRA 1WCNA 2JHDA 1KDHA 4Y2QA 3Q8LA 4F4YA 2ATLA 4QWAA 1SZHA 2WF6A 5AIBA 1B0XA 1SIJA 2VIXA 2KKVA 5JRTA 1EXNA 1ZQHA 2Y0SF 4QZAA 1Z1BA 1L3UA 2XICA 5DQGA 3IV6A 3UMGA 2KNJA 4DL7A 4EZ6A 3PNCA 3UQ2A 5KFMA 4DSIA 2XY5A 1T4GA 5L1LA 3QUBA 3KBBA 4DQIA 4YD1A 3MR6A 4RPYA 7ICNA 2B6GA 3PVXA 2A1JB 3UMBA 3Q8PB 4YG2A 4QZHA 3CRXA 4C8KA 5J8YC 4KLOA 3SV3A 4Y2RA 4OJPA 2YX8A 8ICEA 1SWWA 5HR7A 4PJ0U 3AU6A 2HVIA 4P0QA 1NJZA 9ICKA 1ZD4A 1J97A 8ICTA 4NV0A 5J0SA 3WK7A 4DQQA 3H0RB 2FDRA 4Q45A 7ICOA 4P0QB 5KG3A 4KLFA 4PZOA 3DDHA 9ICBA 3RTVA 3BQ2A 1VJ5A 1DOQA 5KG5A 4KLDA 3D6JA 1LV5A 9ICOA 3WKCA 4P0PB 5IIKA 3B9JA 2W9CA 1PVQA 2C2DA 5EWFA 1Q8KA 4ECXA 3CYMA 4R66A 5AIAA 4ECVA 1KKXA 2YMPA 1XU4A 3JPPA 4YQWA 4IR9A 4F5OA 4DSEA 4P4OA 4J9NA 4KLHA 3RAQA 2C28A 5EE0A 2C2RA 3K4GA 5KFGA 1U4BA 1ZQCA 4J9SA 1YT3A 1ZQYA 4JV0A 1NKEA 3PY8A 2W9BB 1UPHA 5IINA 5KL1B 4DL2A 2XI9A 4QZBA 2WHEA 2ZJ5A 1XC9A 3J81j 2XCPA 1CUKA 2EAOA 1KL9A 4FS1A 1XSLA 3B0XA 5J0QA 1QLNA 3OJUA 3C2MA 4KLQA 1FEZA 5KNIA 2F44A 1Y88A 2G08A 2WFAA 4KN4A 4F72A 4B9TA 4DF8A 3MR3A 4I2IA 2VA2A 1PK3A 3KKAA 4KX5A 1T7PA 4B9LA 3M6ZA 2WB1C 2DF4B 1TKDA 1ZQIA 4J9KA 5CWRA 5ALOA 2E5SA 5KAFU 2Q4TA 4Q8EA 2BCQA 2XO7A 1Z00A 2FMSA 2AQ4A 1N48A 2KFZA 1ZJMA 3RJHA 4DS5A 4JMUA 4UB4A 1DK2A 4RQ7A 2XIDA 1N56A 3PX6A 1U47A 3FAHA 1KN5A 1J2MA 5CRXA 1X9WA 4M2YA 4ECYA 4YR0A 2LYBA 2JEGA 2M9NA 2JH1A 4ED0A 2LKYA 5AKYA 2WB1F 3RFAA 4USAA 5KFQA 4MFAA 5KFFA 1Z00B 3N7SC 5CA7A 4K4IA 1T94A 4RQ6A 1N5XA 4OJ5A 2BPGA 1FIQA 2J6TA 9ICVA 2RLTA 5AK6A 1ZQJA 4NLBA 1BPYA 3OHAA 3D2QA 4YMOA 4Y2XA 9ICFA 5KFDA 2UVWA 3AUOA 2EZYA 3UM9A 4DQPA 2R8HA 2W04A 1RXVA 3MABA 2ALZA 3JPNA 3PO5A 4GC7A 1TK5A 2QB0B 5KT7A 1RQNA 3BQTA 1NK7A 4F93B 1V85A 2G06A 4EYIB 4TURA 1ZETA 5ALJA 3C1YA 5A0LA 2KMDA 5C0YA 5J2CA 5G5HA 1QQ7A 2B0CA 2ZJ8A 1ZRMA 5HNKA 2LBOA 2KHQA 2P35A 5D49A 2ZG6A 2AQ0A 3UMCA 1MSWD 7ICKA 5DG8A 2XVTA 2MUTA 1X9MA 4I2BA 1BPEA 3Q8KA 4RNNA 1HJPA 2K4EA 3PSTA 1ZQMA 4F5PA 4EENA 3WKBA 3V6JA 3V6KA 1GO3F 1NJXA 5EE3A 2OH2A 5ALGA 2ES6A 1O08A 3NTUA 2AU0A 4DS4A 3AEVA 5AM4A 3RB4A 7ICPA 3BS7A 1JN3A 2MU2A 3SZ2A 2F1IA 4DEZA 2JZBA 9ICLA 2MSNA 4M04A 3PSFA 2RRDA 4FO6A 1WCLA 1QH9A 3EUB2 4MEXA 1YZ6A 2JZBB 5ALYA 4R63A 5HHIA 1RG6A 2E8OA 1UCVA 9ICNA 4J9OA 4Y2SA 4EBEA 3DV9A 1WG8A 4CE6A 2Y9UA 5CHGA 4JB3A 2HOFA 2ZTEA 4JV1A 5AK4A 4MEYA 2HOQA 3AL0B 4RQ4A 1LVHA 4UB6U 4O3NA 4GXIA 1RYUA 2FPMA 2XY7A 1V97A 4OCZA 3C1ZA 2HBJA 3RJKA 2P6RA 5ALRA 1SL0A 1SV4A 4TUSA 5BOLA 4O5KA 5J0WA 3MBYA 3D2SA 3PR5B 2AHOB 1ZYQA 5EE9A 4UBCA 1UA1A 3WKAA 4FBTA 2C2EA 2Z7JA 4YD2A 1N62A 2KG5A 3ALRA 3ZDCA 3HT3A 1YZ7A 1C7YA 3T5JA 5KFIA 1ZQWA 5JU5A 4IS7A 5AI0A 3KHHA 3TAPA 4QIWF 3QUCA 5KT3A 2KFNA 3MGIA 5AI8A 5GTIU 4ZH4A 2ZIVB 3CNHA 3NUQA 4C8MA 1DRGA 5JTIA 2LM4A 3T3FA 3OPXA 5KT2A 1L3SA 1NNLA 1Q3VA 3BS5A 4BDPA 3GILA 2W9MA 3TARA 3ZD8A 1Z3EB 2EAMA 5ALNA 2HHWA 2W11A 5KFBA 2AGQA 5J2BA 8ICLA 4G9BA 4NJ8A 1NOMA 4FZLA 4EBDA 3PSIA 2RQ5A 3ZD9A 2WF7A 2ISPA 2ASLA 2BR0A 5ALWA 3PW0A 3GIJA 4US9A 2LM1A 3MGHA 1CEZA 5KG1A 4B9VA 1ZQXA 3R9KA 4CGZA 4JWNA 2MA1A 3HPOA 3F2DA 1JXEA 3ICXA 2VJ4A 3T79A 3EW9A 4DFKA 4QZEA 4F4ZA 2ZIXA 5ALPA 2L5YA 1MQ3A 2LMRA 4MF8A 1JROA 4Y2TA 1NK6A 9ICXA 9ICRA 2K89A 2ZTDA 3AN1A 2KV2A 2EANA 5KFLA 3WK8A 2BCRA 2HHTA 4B6JA 4JV2A 4M9GA 5AKKA 2KJ5A 3IN5A 2Y0SC 1DXSA 7ICGA 1S0MA 3H4BA 4CDGA 5J0TA 3T5LA 3NRZA 3TFSA 5KFJA 7ICLA 2E1FA 4LZGA 4QNLA 4QIWC 2NO5A 1TAQA 3TQ1A 3N7PD 3MGVA 3ISDA 3GIKA 1QSYA 1ECWA 5AKJA 2KOBA 5C5JA 3TADA 1JIHA 2FMPA 3GFKB 2WF8A 3GDXA 2E8MA 8ICFA 4KN7A 4B9UA 2AGOA 1ZD2P 3LWMA 3C5FA 3F5AA 3N7RC 2BGWA 8ICSA 4QWBA 1JUDA 4ZOHC 2V9WA 2VJ5A 4F8RA 2W8KA 3THVA 2K8AA 4Z6FA 3PW5A 2ZTCA 5AKLA 4UAUA 3LYSA 3BZCA 3WKDA 3JPQA 4DOCA 3PW4A 2BKEA 4QW9A 2RDIA 4I2JA 5T14A 2JRZA 4F2SA 2EZZA 1D8LA 5ALZA 2HVHA 1XO0A 5KFCA 4RPXA 5J0RA 3SENA 1S10A 5KT5A 3BQ1A 2FLPA 3LDAA 5K4LA 4TQRA 3TANA 2NRWA 2NRZA 5B66U 1Z19A 3RJIA 1MN8A 3UPQA 4YFKA 5BOMA 2NYVA 4UW9A 1Z1VA 2KZMA 8ICOA 2G0AA 2KK0A 1L8LA 3PSPA 2IA6A 3HWTA 4PL1A 2HSZA 3H8JA 3PZPA 5FP0A 3E0FA 4J9RA 1DK3A 4CF3A 4P2HA 4O9MA 4I2AA 8ICXA 4J9PA 1IIPA 3HJEA 2E1EA 2NRVA 2PI5A 2W43A 3MFIA 5ALKA 4RNMA 1KTQA 1NZPA 1HEKA 2ZUBA 5L9XA 5L1MA 5J2KA 1SGGA 2OCEA 3KFUF 5ALEA 3N28A 4IRDA 2OHFA 2K8BB 1COOA 3MR2A 1KFSA 5HMMA 2LYAA 2YY6A 3F53A 3HX0A 1A76A 1Z4OA 1KW4A 1SXEA 7ICJA 4P4PA 2KD1A 1V38A 2HBMA 2KZ3A 3OTQA 4OD0A 5AK5A 3QZ7A 4PHPA 4Q43A 3C21A 4IQUA 1TK0A 2PFOA 3PV8A 2LPEA 4JWMA 2I1QA 4F5RA 4PL2A 3JPSA 5CJ7A 4KLSA 4TUPA 7ICQA 3C29A 5J2HA 2XCAA 3ONNA 5J2AA 2HHSA 5ALVA 1BGXT 1NK9A 5KFXA 2F8KA 3QZ8A 4XQ8A 7ICEA 1KBUA 3EPGA 1L7MA 5DB6A 2FPKA 5E79U 4YMMA 1QTMA 2DWQA 3C5GA 1S0NA 5ALDA 4RQ3A 2XGQA 4QZGA 3L3FX 3RR8A 2Y1IA 2H3IA 2PMZF 1N2XA 5AK3A 5AKGA 1LKYA 5BPCA 3OHBA 1BPXA 4ELVA 3KKAC 4ED3A 3M7DA 4F4WA 4BWMA 4XRHA 2ZIVA 5KFUA 3V7LA 4J03A 9ICAA 2HCFA 3WK6A 4RZRA 1MQ2A 4IL6U 2H3ZA 4FZMA 4P0PA 5DKWA 4AYBF 7ICRA 1NKCA 5CP2A 2JEFA 2VA3A 3H7IA 1RM6C 9ICIA 2FMQA 5KFOA 5KG4A 3KZIU 4UB8U 2HDOA 5F9LA 3RRGA 4OJOA 3MDCA 2CPRA 5J0XA 4DL5A 2KKPA 4ED7A 2QB1A 1A6SA 2ESEA 5ALSA 4I2EA 1KRPA 5ALHA 3PW7A 9ICGA 1KSPA 4M6WB 3QU9A 4I2CA 4IQWA 4C4SA 5CEHA 2AH5A 9ICWA 2QKQA 1TFRA 5ALFA 5IIMA 4C8NA 4NLGA 9ICEA 2XC9A 1Z4NA 4C0ZA 1SKSA 1T8EA 2BQ3A 4IQTA 1U45A 2AGPA 4O3SA 5ALMA 5F9NA 1ZQRA 1L7PA 3G6VA 1NKBA 2CRXA 3OGUA 4ACOA 4IR1A 4ECWA 1ZQAA 3VC8A 1ZQKA 4UBBA 4QZ9A 1SXDA 3ETRA 4O3RA 1X6IA 3SQIA 1S9FA 5AKXA 5HMLA 3NVVA 5AKHA 9ICTA 4O3QA 3KHGA 3KTQA 2ZIXB 3KOOA 5J0YA 4UB3A 2KP7A 4Y2PA 9ICCA 4R65A 3NVZA 2F3NA 3ZDDA 2CXYA 2W9CB 3HW8A 4Z6DA 1NK4A 1ED1A 2OEHA 1VLBA 4DSLA 4U7CA 4I27A 4JK1A 3C2LA 1MA7A 2FE9A 3GV7B 5KFNA 2V4QA 7ICVA 1SKWA 1IM4A 8ICNA 2DPIA 3JPTA 2DBYA 3WK4A 3SR6A 1XO1A 4NL9C 3M9MB 5L1JA 2M0NA 2GOLA 3DEEA 3RB6A 2D6FC 1A77A 3CP8A 4YCXA 3RRHA 4M9HA 2E3TA 1ZQSA 1JALA 4NLNA 5ALTA 4ECQA 2IMWP 1L6NA 1N5WA 3ISCA 3BZKA 4DFMA 2G5HB 3U26A 8ICQA 4EX7A 2R8JA 3PMLA 1JRPA 3H8WA 3SV4A 4LJXA 4GLXA 2K60A 8ICHA 1L8OA 2KICA 2IHMA 2ZUDA 2F1HA 5J2JA 5HHHA 4KLIA 4DSKA 2ZIWA 3H0MB 1S5LU 2G09A 3GU3A 3QU4A 1K1QA 2DUYA 1UT5A 2AXTU 4M6WA 5KAIU 3KHRA 3IRUA 2PKEA 2HW3A 2DFLA 5AKZA 2HBLA 1ZQ1C 1WWVA 3UXPA 3RH5A 2OM6A 3GV5B 5KFTA 1SV0C 2W55A 2Y9TA 1PVRA 1NI3A 4UB1A 2K4HA 2W3RA 1TK8A 5ALLA 9ICSA 2G5IB 2N1RA 3NVYA 4AYBC 4ED1A 5ALXA 2ZUCA 2A1JA 5J2GA 4DLEA 2A1AA 5G5GA 2GWSA 1QQ5A 4UAWA 4Y2JA 1ZQEA 1ZQUA 3RBDA 3F5EA 2JR5A 4EELA 4M47A 2R18A 3Q8MA 4LZDA 3RB3A 4OJ6A 4MHVA 2QB0A 5KFRA 5DLFA 1RYSA 3G6XA 3N97B 3BJYA 5CB1A 4YMNA 2BQRA 3HILA 4R8UA 4RQMA 2MAXA 2ZXIA 1ZD3A 8ICCA 5HP4A 2BDUA 3ISBA 1UA0A 4QZ8A 2DL0A 1PUZA 4IQVA 1UHUA 5CR0A 4B9NA 3AM9A 4C8LA 4HYKA 3E58A 2MRLA 3V7JA 2ASDA 2XGPA 1ZQBA 2PFQA 2KEYA 1KEJA 2H5XA 3IDWA 2LI6A 4RUAA 2OYYA 1RDFA 4J9MA 4DL4A 2HBKA 4QWEA 1QSSA 5AM5A 1NZBA 2A19A 4J9LA 2CN1A 2GH1A 4EEKA 1X66A 3H0LB 2O6KA 4B9SA 4M0AA 1RQLA 2KZZA 5AI5A 4TQSA 2FI1A 5AI9A 4BUGA 1H38A 3ORYA 8ICYA 9ICQA 1ZQZA 1S77D 2JMGA 3BQ7A 3RB0A 4M9NA 2ISOA 3FM9A 1IV8A 3PR4A 4CCHA 2FLNA 4FBUA 2W7PA 2B21A 1K1SA 3NVWA 9ICMA 2P66A 4PZNA 4QWCA 2Q0ZX 5ALIA 2RHFA 4F3OA 1X9SA 5KT6A 5KG2A 1JX4A 3SEIA 1Q46A 3SI8A 3QNMA 4Q44A 1L5UA 8ICPA 1SB3C 1HUZA 2EQYA 1UT8A 1QCKA 3L5KA 1SKRA 3E2EA 1B43A 3Q8QB 3V72A 1DGSA 3F2CA 3N4MB 4BXOB 3C23A 1F5SA 2KJ9A 2IHNA 5AM0A 4BXOA 2F76X 5KG0A 2H3VA 2DKZA 2BZFA 4F5NA 2W9BA 2GLEA 5EWEA 2KJ8A 2YB1A 1X2IA 4F50A 2OXOA 4ECUA 1Q3UA 4UASA 4RQ2A 2PXIA 4O5CA 4F91B 7ICFA 1BNOA 3SAGA 5AKIA 5KFZA 3FC4A 5J29A 2YMMA 5AHXA 3QUQA 3WKEA 5KFAA 8ICJA 3GV8B 1AQ6A 2Y1JA 2ZIUB 2HI0A 4DL3A 3FYHA 4PHEA 3IG8A 1URJA 4EX6A 3QXGA 1F44A 5KFSA 4K4HA 4KX3A 2V4RA 2K4PA 3SMVA 4CRXA 1FFUA 1D8BA 4DO9A 1L3VA 3RJGA 2KIVA 3RJFA 3RR7A 1ZQGA 3EPIA 5KFVA 4RNOA 2NO4A 3IP4B 1PZNA 7ICSA 3K75D 3ETLA 4KLEA 5DB7A 3SD7A 1HUOA 2QLTA 2BCVA 1K5OA 2LYHA 1ZQNA 1S76D 4UQGA 1U49A 2KVSA 1M6YA 1N61A 3UXNA 5J2EA 1B4FA 2I6XA 3AU2A 4NLZA 4ED6A
chains in the Genus database with same CATH topology
3BS7A 2QB0A 3SEIA 2KSOA 2EAMA 2E8MA 1COKA 2QB1A 4NL9C 2ESEA 3HILA 1KW4A 4RQMA 1SXEA 1RG6A 5F3XB 1F0MA 2E8OA 4NJ8A 1LKYB 1B0XA 1UCVA 1V38A 5JRTA 2DKXA 2Y9UA 2DL0A 2KE7A 1JI7A 2E8NA 2QARA 2QKQA 1X9XA 2DKZA 2GLEA 2EAOA 2K60A 3IDWA 2LPEA 1OXJA 1SV0A 2B6GA 4NL9A 1OW5A 2QARB 2QB0B 5J8YC 5KNIA 2F44A 3SENA 1SV4A 1V85A 2YTUA 2F8KA 1X66A 2L5YA 2KMDA 1SXDA 2LMRA 3BS5B 2EAPA 1PK3A 3H8MA 3KKAA 1PK1B 5J8YA 2KSOB 1Z1VA 1PK1A 3K1RB 2K4PA 2KG5A 3TACB 1WWVA 2E8PA 3BQ7A 2EANA 2KIVA 2D8CA 1SV0C 2Y9TA 1LKYA 1X40A 4PZOA 1DXSA 4IS7A 5JU5A 3KKAC 4RQNA 1WWUA 2F3NA 3TADC 2JV3A 4PZNA 1UQVA 5JTIA 2FE9A 2ES6A 1B4FA 3BS5A 5L1MA 2D3DA 4MHVA 1SGGA 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS7 A;  2QB0 A;  3SEI A;  2KSO A;  2EAM A;  2E8M A;  1COK A;  2QB1 A;  4NL9 C;  2ESE A;  3HIL A;  1KW4 A;  4RQM A;  1SXE A;  1RG6 A;  5F3X B;  1F0M A;  2E8O A;  4NJ8 A;  1LKY B;  1B0X A;  1UCV A;  1V38 A;  5JRT A;  2DKX A;  2Y9U A;  2DL0 A;  2KE7 A;  1JI7 A;  2E8N A;  2QAR A;  2QKQ A;  1X9X A;  2DKZ A;  2GLE A;  2EAO A;  2K60 A;  3IDW A;  2LPE A;  1OXJ A;  1SV0 A;  2B6G A;  4NL9 A;  1OW5 A;  2QAR B;  2QB0 B;  5J8Y C;  5KNI A;  2F44 A;  3SEN A;  1SV4 A;  1V85 A;  2YTU A;  2F8K A;  1X66 A;  2L5Y A;  2KMD A;  1SXD A;  2LMR A;  3BS5 B;  2EAP A;  1PK3 A;  3H8M A;  3KKA A;  1PK1 B;  5J8Y A;  2KSO B;  1Z1V A;  1PK1 A;  3K1R B;  2K4P A;  2KG5 A;  3TAC B;  1WWV A;  2E8P A;  3BQ7 A;  2EAN A;  2KIV A;  2D8C A;  1SV0 C;  2Y9T A;  1LKY A;  1X40 A;  4PZO A;  1DXS A;  4IS7 A;  5JU5 A;  3KKA C;  4RQN A;  1WWU A;  2F3N A;  3TAD C;  2JV3 A;  4PZN A;  1UQV A;  5JTI A;  2FE9 A;  2ES6 A;  1B4F A;  3BS5 A;  5L1M A;  2D3D A;  4MHV A;  1SGG A;  3TAD A; 
#chains in the Genus database with same CATH topology
 1SWV A;  4I2F A;  3QEB Z;  1COK A;  5DGB A;  3PX4 A;  3IM1 A;  2ZIW B;  4YXM A;  1X42 A;  1T3Q A;  5F3X B;  3RAX A;  4O3O A;  4EZ9 A;  2WAQ C;  4MFF A;  5EOZ A;  4ED2 A;  4EYH B;  1XS9 D;  2HHQ A;  3H40 A;  2FJ6 A;  3HKZ C;  2W8L A;  2I5H A;  5DB9 A;  4BWJ A;  1MC8 A;  5KFE A;  5AM1 A;  4XUS A;  4RT2 A;  2BQU A;  4J9Q A;  3TKA A;  2FPL A;  3UQ0 A;  1CI4 A;  3EZ5 A;  4I2H A;  2VAN A;  4UAZ A;  1OW5 A;  5DB8 A;  2EH9 A;  4YXJ A;  4DQS A;  4I2G A;  3G6Y A;  1N63 A;  3PMN A;  4NXZ A;  4E0D A;  8ICI A;  3AQF A;  4CF4 A;  3Q8S B;  4Y2U A;  3AMZ A;  3H8M A;  3TAQ A;  4FZN A;  2JEJ A;  5ALQ A;  7ICH A;  1D8Y A;  4F71 A;  1HIW A;  3OSP A;  2KN7 A;  9ICU A;  1L7N A;  4ICA A;  1X40 A;  3GZF A;  2JH7 A;  4UAV A;  2JGA A;  3FDS A;  4Q8F A;  4PPX A;  1ZQP A;  2OWO A;  3TAD C;  3JPR A;  4GXJ A;  1UQV A;  3GIM A;  1ZD5 A;  3OSN A;  5EE1 A;  4RQ8 A;  5J2F A;  4KLU A;  4PGQ A;  3M9N B;  3T5K A;  4UAR A;  1ZXI A;  5J0O A;  2VA8 A;  8ICB A;  2VKQ A;  1TV9 A;  2IOF A;  5TZV A;  1DGJ A;  4NWI A;  3S6J A;  3UXO A;  1ARO P;  3I76 A;  5KFP A;  4GIB A;  3MFH A;  1D9D A;  3MC1 A;  4X5V A;  1FFV A;  1S0O A;  5KFK A;  5KFW A;  4KLL A;  8ICW A;  2HHX A;  8ICZ A;  4DFP A;  1NK8 A;  9ICP A;  4RQ1 A;  2E8N A;  1NK5 A;  5J0P A;  2R8K A;  3M8R A;  1NK0 A;  1X9X A;  4O0I A;  4C7Z A;  5J0U A;  1IXR A;  5ALU A;  1P7D A;  1XNS A;  2HHV A;  4F5Q A;  4QW8 A;  3LVW A;  5HR6 A;  7ICU A;  4RQ0 A;  4DL6 A;  2UVV A;  8ICU A;  3K1Z A;  3QU2 A;  2KTQ A;  3RBE A;  2K4I A;  4I2D A;  2KVC A;  3AQE A;  3ZDA A;  3V6H A;  4KLT A;  4QZC A;  1A0P A;  5DBB A;  1S8O A;  4C4R A;  3PX0 A;  2F1J A;  2ODG A;  2YML A;  3VCB A;  1XSN A;  1ZJN A;  2A3V A;  1ZOL A;  2YB4 A;  2EAP A;  2IOH A;  2W54 A;  2WTF A;  1TVA A;  2NRX A;  2PFN A;  1S0V A;  4UAT A;  3QU5 A;  1TAM A;  2H3Q A;  2E8P A;  3RH4 A;  4I29 A;  4AP9 A;  4WJ3 B;  4NM1 A;  2JXJ A;  1C20 A;  4YR2 A;  3SYZ A;  4OO1 J;  5KG6 A;  4F92 B;  4DCC A;  2ZIU A;  3IHQ B;  2XY6 A;  4YN4 A;  1PVP A;  3WK5 A;  5IIO A;  4RQN A;  3QUT A;  4NLK A;  2W3S A;  4P4M A;  4QWD A;  3LWL A;  4NY8 A;  4ECZ A;  5AKE A;  4F4K A;  4A8E A;  5TIS U;  3MDA A;  3ZDE A;  4KMO B;  4RQ5 A;  1RZT A;  2ZXH A;  4HAI A;  1J2N A;  2IBK A;  2D3D A;  4Z6C A;  2K8C B;  4ECS A;  2I9G A;  2KSO A;  5AI4 A;  3IG5 A;  2W9A A;  3NGD A;  3A0H U;  4QJF B;  3LVV A;  3A0B U;  5KT4 A;  3C2K A;  2R8G A;  7ICM A;  1XSP A;  3QU7 A;  2BHN A;  1LKY B;  1X6J A;  2R8I A;  1LB2 B;  3GII A;  1VDV A;  3RF9 A;  5AM2 A;  4UAY A;  1BPD A;  2BDP A;  4LVS A;  4GFJ A;  2QAR A;  5IIJ A;  5KL8 B;  2BPF A;  5DBC A;  7ICI A;  5DG9 A;  2NRT A;  1OXJ A;  1SV0 A;  3TFR A;  2C22 A;  1IG6 A;  2W7O A;  4DSJ A;  3I1Y A;  2QAR B;  4F4X A;  4M9L A;  2F2A B;  1S97 A;  3WK9 A;  3JPO A;  2F8L A;  1BNP A;  5L1I A;  4PH5 A;  5DG7 A;  1OUQ A;  2DPJ A;  4MF2 A;  3PW2 A;  1KFD A;  1CRX A;  3KD3 A;  5J8Y A;  4KLJ A;  1ZRN A;  3K1R B;  4QZD A;  1WYG A;  1ZQT A;  3HRD D;  4PGY A;  2WF9 A;  2KIW A;  4DFJ A;  4GC6 A;  2EZX A;  2DQN B;  3L4P A;  4ECT A;  1ZQL A;  4PHA A;  4US8 A;  2F77 X;  4ED8 A;  5H2F U;  2JV3 A;  4YR3 A;  4PGX A;  3NS1 A;  1KQQ A;  1V9P A;  8ICK A;  4C80 A;  4XA5 A;  3BQ0 A;  4UB5 A;  2W03 A;  5DDY A;  2EDU A;  1L3T A;  1N60 A;  5AI6 A;  1JXL A;  3C28 A;  5D4B A;  3QE9 Y;  3MR5 A;  4K4G A;  4IRK A;  4Z6E A;  2UVU A;  4IRC A;  3D2N A;  1D9F A;  4RT3 A;  1O03 A;  1U9L A;  4EBC A;  1KLN A;  2DGZ A;  2J6U A;  2YQE A;  3F2B A;  3T5H A;  5KTQ A;  4DF4 A;  3LK9 A;  4C8O A;  2DKX A;  4RU9 A;  5J2I A;  4FFD A;  2WF5 A;  5KFY A;  4KTQ A;  3KHL A;  3CW2 C;  5JUM A;  1BVS A;  5KFH A;  4RUC A;  2JEI A;  5DDM A;  2LHT A;  5J2D A;  2H3F A;  2BCS A;  3BDP A;  4R64 A;  3EWA A;  4DQR A;  3EYZ A;  1BPZ A;  3RJE A;  1ZQO A;  2NV3 A;  1ZQF A;  4DLG A;  1TE2 A;  3RJJ A;  4PHD A;  3WU2 U;  4FE3 A;  3ED5 A;  8ICM A;  3V7K A;  1FO4 A;  3QYP A;  2HOI A;  4DOA A;  2P6U A;  3TAC B;  4O5E A;  4Y2V A;  4QZF A;  3ZDB A;  1QQ6 A;  2D8C A;  2PFP A;  2PI4 A;  3RH6 A;  4BJQ A;  2BPC A;  2KHV A;  4CNQ A;  4Y2Y A;  4NM2 A;  2ZJA A;  1ZQD A;  4JUZ A;  4UB2 A;  3QEA Z;  4C4T A;  4EEY A;  3ZI4 A;  3H4D A;  4GXK A;  3O0F A;  5III A;  4KLG A;  3M1Y A;  1TAU A;  1WUD A;  5B5E U;  1L7O A;  5EWG A;  4M9J A;  1KFT A;  9ICH A;  4F2R A;  1F0M A;  1RYR A;  1SL1 A;  3M9O B;  2FLL A;  2PMZ C;  2J6S A;  3M6K A;  4BX9 C;  2YMQ A;  3TI0 A;  8ICR A;  4O3M A;  4YP3 A;  5AIC A;  1NJW A;  2KE7 A;  1JI7 A;  4G3I A;  2HMX A;  2RP5 A;  5AM3 A;  1T3N A;  2AJQ A;  5D46 A;  2G07 A;  4ELT A;  5DQI A;  4TUQ A;  4BGD A;  4QZI A;  3Q8R B;  1BPB A;  1U48 A;  2BCU A;  1RPL A;  4NL9 A;  2ASJ A;  4B9M A;  3M8S A;  2HHU A;  3H8S A;  4RPZ A;  4DOB A;  7ICT A;  8ICA A;  2YTU A;  3NRW A;  3KZX A;  5L1K A;  2RDJ A;  5DLG A;  3BS5 B;  4MFC A;  4YVZ A;  4DWI A;  3B0Y A;  1PK1 B;  5KG7 A;  1JMS A;  2KSO B;  3NAS A;  4KLM A;  2YN4 A;  4U6P A;  1PK1 A;  4CF5 A;  1NJY A;  4R8U B;  4NLC A;  3HP6 A;  3SAF A;  1ZQV A;  3GQC A;  3I28 A;  9ICJ A;  4O3P A;  4DFD A;  5DQH A;  8ICG A;  4DSF A;  5GTH U;  3SAH A;  1B22 A;  4FS2 A;  2GO7 A;  4KIT B;  5DGA A;  1WWU A;  3QX7 A;  4IC9 A;  4C7Y A;  1XWL A;  4ELU A;  3HKZ F;  1SZP A;  5IIL A;  1ZQQ A;  8ICV A;  4KMU A;  2UVR A;  5DBA A;  1SL2 A;  2MUT B;  1RXW A;  4OJL A;  3OJS A;  4I28 A;  2WAQ F;  1QSL A;  2IOF K;  3PO4 A;  4ECR A;  1WCN A;  2JHD A;  1KDH A;  4Y2Q A;  3Q8L A;  4F4Y A;  2ATL A;  4QWA A;  1SZH A;  2WF6 A;  5AIB A;  1B0X A;  1SIJ A;  2VIX A;  2KKV A;  5JRT A;  1EXN A;  1ZQH A;  2Y0S F;  4QZA A;  1Z1B A;  1L3U A;  2XIC A;  5DQG A;  3IV6 A;  3UMG A;  2KNJ A;  4DL7 A;  4EZ6 A;  3PNC A;  3UQ2 A;  5KFM A;  4DSI A;  2XY5 A;  1T4G A;  5L1L A;  3QUB A;  3KBB A;  4DQI A;  4YD1 A;  3MR6 A;  4RPY A;  7ICN A;  2B6G A;  3PVX A;  2A1J B;  3UMB A;  3Q8P B;  4YG2 A;  4QZH A;  3CRX A;  4C8K A;  5J8Y C;  4KLO A;  3SV3 A;  4Y2R A;  4OJP A;  2YX8 A;  8ICE A;  1SWW A;  5HR7 A;  4PJ0 U;  3AU6 A;  2HVI A;  4P0Q A;  1NJZ A;  9ICK A;  1ZD4 A;  1J97 A;  8ICT A;  4NV0 A;  5J0S A;  3WK7 A;  4DQQ A;  3H0R B;  2FDR A;  4Q45 A;  7ICO A;  4P0Q B;  5KG3 A;  4KLF A;  4PZO A;  3DDH A;  9ICB A;  3RTV A;  3BQ2 A;  1VJ5 A;  1DOQ A;  5KG5 A;  4KLD A;  3D6J A;  1LV5 A;  9ICO A;  3WKC A;  4P0P B;  5IIK A;  3B9J A;  2W9C A;  1PVQ A;  2C2D A;  5EWF A;  1Q8K A;  4ECX A;  3CYM A;  4R66 A;  5AIA A;  4ECV A;  1KKX A;  2YMP A;  1XU4 A;  3JPP A;  4YQW A;  4IR9 A;  4F5O A;  4DSE A;  4P4O A;  4J9N A;  4KLH A;  3RAQ A;  2C28 A;  5EE0 A;  2C2R A;  3K4G A;  5KFG A;  1U4B A;  1ZQC A;  4J9S A;  1YT3 A;  1ZQY A;  4JV0 A;  1NKE A;  3PY8 A;  2W9B B;  1UPH A;  5IIN A;  5KL1 B;  4DL2 A;  2XI9 A;  4QZB A;  2WHE A;  2ZJ5 A;  1XC9 A;  3J81 j;  2XCP A;  1CUK A;  2EAO A;  1KL9 A;  4FS1 A;  1XSL A;  3B0X A;  5J0Q A;  1QLN A;  3OJU A;  3C2M A;  4KLQ A;  1FEZ A;  5KNI A;  2F44 A;  1Y88 A;  2G08 A;  2WFA A;  4KN4 A;  4F72 A;  4B9T A;  4DF8 A;  3MR3 A;  4I2I A;  2VA2 A;  1PK3 A;  3KKA A;  4KX5 A;  1T7P A;  4B9L A;  3M6Z A;  2WB1 C;  2DF4 B;  1TKD A;  1ZQI A;  4J9K A;  5CWR A;  5ALO A;  2E5S A;  5KAF U;  2Q4T A;  4Q8E A;  2BCQ A;  2XO7 A;  1Z00 A;  2FMS A;  2AQ4 A;  1N48 A;  2KFZ A;  1ZJM A;  3RJH A;  4DS5 A;  4JMU A;  4UB4 A;  1DK2 A;  4RQ7 A;  2XID A;  1N56 A;  3PX6 A;  1U47 A;  3FAH A;  1KN5 A;  1J2M A;  5CRX A;  1X9W A;  4M2Y A;  4ECY A;  4YR0 A;  2LYB A;  2JEG A;  2M9N A;  2JH1 A;  4ED0 A;  2LKY A;  5AKY A;  2WB1 F;  3RFA A;  4USA A;  5KFQ A;  4MFA A;  5KFF A;  1Z00 B;  3N7S C;  5CA7 A;  4K4I A;  1T94 A;  4RQ6 A;  1N5X A;  4OJ5 A;  2BPG A;  1FIQ A;  2J6T A;  9ICV A;  2RLT A;  5AK6 A;  1ZQJ A;  4NLB A;  1BPY A;  3OHA A;  3D2Q A;  4YMO A;  4Y2X A;  9ICF A;  5KFD A;  2UVW A;  3AUO A;  2EZY A;  3UM9 A;  4DQP A;  2R8H A;  2W04 A;  1RXV A;  3MAB A;  2ALZ A;  3JPN A;  3PO5 A;  4GC7 A;  1TK5 A;  2QB0 B;  5KT7 A;  1RQN A;  3BQT A;  1NK7 A;  4F93 B;  1V85 A;  2G06 A;  4EYI B;  4TUR A;  1ZET A;  5ALJ A;  3C1Y A;  5A0L A;  2KMD A;  5C0Y A;  5J2C A;  5G5H A;  1QQ7 A;  2B0C A;  2ZJ8 A;  1ZRM A;  5HNK A;  2LBO A;  2KHQ A;  2P35 A;  5D49 A;  2ZG6 A;  2AQ0 A;  3UMC A;  1MSW D;  7ICK A;  5DG8 A;  2XVT A;  2MUT A;  1X9M A;  4I2B A;  1BPE A;  3Q8K A;  4RNN A;  1HJP A;  2K4E A;  3PST A;  1ZQM A;  4F5P A;  4EEN A;  3WKB A;  3V6J A;  3V6K A;  1GO3 F;  1NJX A;  5EE3 A;  2OH2 A;  5ALG A;  2ES6 A;  1O08 A;  3NTU A;  2AU0 A;  4DS4 A;  3AEV A;  5AM4 A;  3RB4 A;  7ICP A;  3BS7 A;  1JN3 A;  2MU2 A;  3SZ2 A;  2F1I A;  4DEZ A;  2JZB A;  9ICL A;  2MSN A;  4M04 A;  3PSF A;  2RRD A;  4FO6 A;  1WCL A;  1QH9 A;  3EUB 2;  4MEX A;  1YZ6 A;  2JZB B;  5ALY A;  4R63 A;  5HHI A;  1RG6 A;  2E8O A;  1UCV A;  9ICN A;  4J9O A;  4Y2S A;  4EBE A;  3DV9 A;  1WG8 A;  4CE6 A;  2Y9U A;  5CHG A;  4JB3 A;  2HOF A;  2ZTE A;  4JV1 A;  5AK4 A;  4MEY A;  2HOQ A;  3AL0 B;  4RQ4 A;  1LVH A;  4UB6 U;  4O3N A;  4GXI A;  1RYU A;  2FPM A;  2XY7 A;  1V97 A;  4OCZ A;  3C1Z A;  2HBJ A;  3RJK A;  2P6R A;  5ALR A;  1SL0 A;  1SV4 A;  4TUS A;  5BOL A;  4O5K A;  5J0W A;  3MBY A;  3D2S A;  3PR5 B;  2AHO B;  1ZYQ A;  5EE9 A;  4UBC A;  1UA1 A;  3WKA A;  4FBT A;  2C2E A;  2Z7J A;  4YD2 A;  1N62 A;  2KG5 A;  3ALR A;  3ZDC A;  3HT3 A;  1YZ7 A;  1C7Y A;  3T5J A;  5KFI A;  1ZQW A;  5JU5 A;  4IS7 A;  5AI0 A;  3KHH A;  3TAP A;  4QIW F;  3QUC A;  5KT3 A;  2KFN A;  3MGI A;  5AI8 A;  5GTI U;  4ZH4 A;  2ZIV B;  3CNH A;  3NUQ A;  4C8M A;  1DRG A;  5JTI A;  2LM4 A;  3T3F A;  3OPX A;  5KT2 A;  1L3S A;  1NNL A;  1Q3V A;  3BS5 A;  4BDP A;  3GIL A;  2W9M A;  3TAR A;  3ZD8 A;  1Z3E B;  2EAM A;  5ALN A;  2HHW A;  2W11 A;  5KFB A;  2AGQ A;  5J2B A;  8ICL A;  4G9B A;  4NJ8 A;  1NOM A;  4FZL A;  4EBD A;  3PSI A;  2RQ5 A;  3ZD9 A;  2WF7 A;  2ISP A;  2ASL A;  2BR0 A;  5ALW A;  3PW0 A;  3GIJ A;  4US9 A;  2LM1 A;  3MGH A;  1CEZ A;  5KG1 A;  4B9V A;  1ZQX A;  3R9K A;  4CGZ A;  4JWN A;  2MA1 A;  3HPO A;  3F2D A;  1JXE A;  3ICX A;  2VJ4 A;  3T79 A;  3EW9 A;  4DFK A;  4QZE A;  4F4Z A;  2ZIX A;  5ALP A;  2L5Y A;  1MQ3 A;  2LMR A;  4MF8 A;  1JRO A;  4Y2T A;  1NK6 A;  9ICX A;  9ICR A;  2K89 A;  2ZTD A;  3AN1 A;  2KV2 A;  2EAN A;  5KFL A;  3WK8 A;  2BCR A;  2HHT A;  4B6J A;  4JV2 A;  4M9G A;  5AKK A;  2KJ5 A;  3IN5 A;  2Y0S C;  1DXS A;  7ICG A;  1S0M A;  3H4B A;  4CDG A;  5J0T A;  3T5L A;  3NRZ A;  3TFS A;  5KFJ A;  7ICL A;  2E1F A;  4LZG A;  4QNL A;  4QIW C;  2NO5 A;  1TAQ A;  3TQ1 A;  3N7P D;  3MGV A;  3ISD A;  3GIK A;  1QSY A;  1ECW A;  5AKJ A;  2KOB A;  5C5J A;  3TAD A;  1JIH A;  2FMP A;  3GFK B;  2WF8 A;  3GDX A;  2E8M A;  8ICF A;  4KN7 A;  4B9U A;  2AGO A;  1ZD2 P;  3LWM A;  3C5F A;  3F5A A;  3N7R C;  2BGW A;  8ICS A;  4QWB A;  1JUD A;  4ZOH C;  2V9W A;  2VJ5 A;  4F8R A;  2W8K A;  3THV A;  2K8A A;  4Z6F A;  3PW5 A;  2ZTC A;  5AKL A;  4UAU A;  3LYS A;  3BZC A;  3WKD A;  3JPQ A;  4DOC A;  3PW4 A;  2BKE A;  4QW9 A;  2RDI A;  4I2J A;  5T14 A;  2JRZ A;  4F2S A;  2EZZ A;  1D8L A;  5ALZ A;  2HVH A;  1XO0 A;  5KFC A;  4RPX A;  5J0R A;  3SEN A;  1S10 A;  5KT5 A;  3BQ1 A;  2FLP A;  3LDA A;  5K4L A;  4TQR A;  3TAN A;  2NRW A;  2NRZ A;  5B66 U;  1Z19 A;  3RJI A;  1MN8 A;  3UPQ A;  4YFK A;  5BOM A;  2NYV A;  4UW9 A;  1Z1V A;  2KZM A;  8ICO A;  2G0A A;  2KK0 A;  1L8L A;  3PSP A;  2IA6 A;  3HWT A;  4PL1 A;  2HSZ A;  3H8J A;  3PZP A;  5FP0 A;  3E0F A;  4J9R A;  1DK3 A;  4CF3 A;  4P2H A;  4O9M A;  4I2A A;  8ICX A;  4J9P A;  1IIP A;  3HJE A;  2E1E A;  2NRV A;  2PI5 A;  2W43 A;  3MFI A;  5ALK A;  4RNM A;  1KTQ A;  1NZP A;  1HEK A;  2ZUB A;  5L9X A;  5L1M A;  5J2K A;  1SGG A;  2OCE A;  3KFU F;  5ALE A;  3N28 A;  4IRD A;  2OHF A;  2K8B B;  1COO A;  3MR2 A;  1KFS A;  5HMM A;  2LYA A;  2YY6 A;  3F53 A;  3HX0 A;  1A76 A;  1Z4O A;  1KW4 A;  1SXE A;  7ICJ A;  4P4P A;  2KD1 A;  1V38 A;  2HBM A;  2KZ3 A;  3OTQ A;  4OD0 A;  5AK5 A;  3QZ7 A;  4PHP A;  4Q43 A;  3C21 A;  4IQU A;  1TK0 A;  2PFO A;  3PV8 A;  2LPE A;  4JWM A;  2I1Q A;  4F5R A;  4PL2 A;  3JPS A;  5CJ7 A;  4KLS A;  4TUP A;  7ICQ A;  3C29 A;  5J2H A;  2XCA A;  3ONN A;  5J2A A;  2HHS A;  5ALV A;  1BGX T;  1NK9 A;  5KFX A;  2F8K A;  3QZ8 A;  4XQ8 A;  7ICE A;  1KBU A;  3EPG A;  1L7M A;  5DB6 A;  2FPK A;  5E79 U;  4YMM A;  1QTM A;  2DWQ A;  3C5G A;  1S0N A;  5ALD A;  4RQ3 A;  2XGQ A;  4QZG A;  3L3F X;  3RR8 A;  2Y1I A;  2H3I A;  2PMZ F;  1N2X A;  5AK3 A;  5AKG A;  1LKY A;  5BPC A;  3OHB A;  1BPX A;  4ELV A;  3KKA C;  4ED3 A;  3M7D A;  4F4W A;  4BWM A;  4XRH A;  2ZIV A;  5KFU A;  3V7L A;  4J03 A;  9ICA A;  2HCF A;  3WK6 A;  4RZR A;  1MQ2 A;  4IL6 U;  2H3Z A;  4FZM A;  4P0P A;  5DKW A;  4AYB F;  7ICR A;  1NKC A;  5CP2 A;  2JEF A;  2VA3 A;  3H7I A;  1RM6 C;  9ICI A;  2FMQ A;  5KFO A;  5KG4 A;  3KZI U;  4UB8 U;  2HDO A;  5F9L A;  3RRG A;  4OJO A;  3MDC A;  2CPR A;  5J0X A;  4DL5 A;  2KKP A;  4ED7 A;  2QB1 A;  1A6S A;  2ESE A;  5ALS A;  4I2E A;  1KRP A;  5ALH A;  3PW7 A;  9ICG A;  1KSP A;  4M6W B;  3QU9 A;  4I2C A;  4IQW A;  4C4S A;  5CEH A;  2AH5 A;  9ICW A;  2QKQ A;  1TFR A;  5ALF A;  5IIM A;  4C8N A;  4NLG A;  9ICE A;  2XC9 A;  1Z4N A;  4C0Z A;  1SKS A;  1T8E A;  2BQ3 A;  4IQT A;  1U45 A;  2AGP A;  4O3S A;  5ALM A;  5F9N A;  1ZQR A;  1L7P A;  3G6V A;  1NKB A;  2CRX A;  3OGU A;  4ACO A;  4IR1 A;  4ECW A;  1ZQA A;  3VC8 A;  1ZQK A;  4UBB A;  4QZ9 A;  1SXD A;  3ETR A;  4O3R A;  1X6I A;  3SQI A;  1S9F A;  5AKX A;  5HML A;  3NVV A;  5AKH A;  9ICT A;  4O3Q A;  3KHG A;  3KTQ A;  2ZIX B;  3KOO A;  5J0Y A;  4UB3 A;  2KP7 A;  4Y2P A;  9ICC A;  4R65 A;  3NVZ A;  2F3N A;  3ZDD A;  2CXY A;  2W9C B;  3HW8 A;  4Z6D A;  1NK4 A;  1ED1 A;  2OEH A;  1VLB A;  4DSL A;  4U7C A;  4I27 A;  4JK1 A;  3C2L A;  1MA7 A;  2FE9 A;  3GV7 B;  5KFN A;  2V4Q A;  7ICV A;  1SKW A;  1IM4 A;  8ICN A;  2DPI A;  3JPT A;  2DBY A;  3WK4 A;  3SR6 A;  1XO1 A;  4NL9 C;  3M9M B;  5L1J A;  2M0N A;  2GOL A;  3DEE A;  3RB6 A;  2D6F C;  1A77 A;  3CP8 A;  4YCX A;  3RRH A;  4M9H A;  2E3T A;  1ZQS A;  1JAL A;  4NLN A;  5ALT A;  4ECQ A;  2IMW P;  1L6N A;  1N5W A;  3ISC A;  3BZK A;  4DFM A;  2G5H B;  3U26 A;  8ICQ A;  4EX7 A;  2R8J A;  3PML A;  1JRP A;  3H8W A;  3SV4 A;  4LJX A;  4GLX A;  2K60 A;  8ICH A;  1L8O A;  2KIC A;  2IHM A;  2ZUD A;  2F1H A;  5J2J A;  5HHH A;  4KLI A;  4DSK A;  2ZIW A;  3H0M B;  1S5L U;  2G09 A;  3GU3 A;  3QU4 A;  1K1Q A;  2DUY A;  1UT5 A;  2AXT U;  4M6W A;  5KAI U;  3KHR A;  3IRU A;  2PKE A;  2HW3 A;  2DFL A;  5AKZ A;  2HBL A;  1ZQ1 C;  1WWV A;  3UXP A;  3RH5 A;  2OM6 A;  3GV5 B;  5KFT A;  1SV0 C;  2W55 A;  2Y9T A;  1PVR A;  1NI3 A;  4UB1 A;  2K4H A;  2W3R A;  1TK8 A;  5ALL A;  9ICS A;  2G5I B;  2N1R A;  3NVY A;  4AYB C;  4ED1 A;  5ALX A;  2ZUC A;  2A1J A;  5J2G A;  4DLE A;  2A1A A;  5G5G A;  2GWS A;  1QQ5 A;  4UAW A;  4Y2J A;  1ZQE A;  1ZQU A;  3RBD A;  3F5E A;  2JR5 A;  4EEL A;  4M47 A;  2R18 A;  3Q8M A;  4LZD A;  3RB3 A;  4OJ6 A;  4MHV A;  2QB0 A;  5KFR A;  5DLF A;  1RYS A;  3G6X A;  3N97 B;  3BJY A;  5CB1 A;  4YMN A;  2BQR A;  3HIL A;  4R8U A;  4RQM A;  2MAX A;  2ZXI A;  1ZD3 A;  8ICC A;  5HP4 A;  2BDU A;  3ISB A;  1UA0 A;  4QZ8 A;  2DL0 A;  1PUZ A;  4IQV A;  1UHU A;  5CR0 A;  4B9N A;  3AM9 A;  4C8L A;  4HYK A;  3E58 A;  2MRL A;  3V7J A;  2ASD A;  2XGP A;  1ZQB A;  2PFQ A;  2KEY A;  1KEJ A;  2H5X A;  3IDW A;  2LI6 A;  4RUA A;  2OYY A;  1RDF A;  4J9M A;  4DL4 A;  2HBK A;  4QWE A;  1QSS A;  5AM5 A;  1NZB A;  2A19 A;  4J9L A;  2CN1 A;  2GH1 A;  4EEK A;  1X66 A;  3H0L B;  2O6K A;  4B9S A;  4M0A A;  1RQL A;  2KZZ A;  5AI5 A;  4TQS A;  2FI1 A;  5AI9 A;  4BUG A;  1H38 A;  3ORY A;  8ICY A;  9ICQ A;  1ZQZ A;  1S77 D;  2JMG A;  3BQ7 A;  3RB0 A;  4M9N A;  2ISO A;  3FM9 A;  1IV8 A;  3PR4 A;  4CCH A;  2FLN A;  4FBU A;  2W7P A;  2B21 A;  1K1S A;  3NVW A;  9ICM A;  2P66 A;  4PZN A;  4QWC A;  2Q0Z X;  5ALI A;  2RHF A;  4F3O A;  1X9S A;  5KT6 A;  5KG2 A;  1JX4 A;  3SEI A;  1Q46 A;  3SI8 A;  3QNM A;  4Q44 A;  1L5U A;  8ICP A;  1SB3 C;  1HUZ A;  2EQY A;  1UT8 A;  1QCK A;  3L5K A;  1SKR A;  3E2E A;  1B43 A;  3Q8Q B;  3V72 A;  1DGS A;  3F2C A;  3N4M B;  4BXO B;  3C23 A;  1F5S A;  2KJ9 A;  2IHN A;  5AM0 A;  4BXO A;  2F76 X;  5KG0 A;  2H3V A;  2DKZ A;  2BZF A;  4F5N A;  2W9B A;  2GLE A;  5EWE A;  2KJ8 A;  2YB1 A;  1X2I A;  4F50 A;  2OXO A;  4ECU A;  1Q3U A;  4UAS A;  4RQ2 A;  2PXI A;  4O5C A;  4F91 B;  7ICF A;  1BNO A;  3SAG A;  5AKI A;  5KFZ A;  3FC4 A;  5J29 A;  2YMM A;  5AHX A;  3QUQ A;  3WKE A;  5KFA A;  8ICJ A;  3GV8 B;  1AQ6 A;  2Y1J A;  2ZIU B;  2HI0 A;  4DL3 A;  3FYH A;  4PHE A;  3IG8 A;  1URJ A;  4EX6 A;  3QXG A;  1F44 A;  5KFS A;  4K4H A;  4KX3 A;  2V4R A;  2K4P A;  3SMV A;  4CRX A;  1FFU A;  1D8B A;  4DO9 A;  1L3V A;  3RJG A;  2KIV A;  3RJF A;  3RR7 A;  1ZQG A;  3EPI A;  5KFV A;  4RNO A;  2NO4 A;  3IP4 B;  1PZN A;  7ICS A;  3K75 D;  3ETL A;  4KLE A;  5DB7 A;  3SD7 A;  1HUO A;  2QLT A;  2BCV A;  1K5O A;  2LYH A;  1ZQN A;  1S76 D;  4UQG A;  1U49 A;  2KVS A;  1M6Y A;  1N61 A;  3UXN A;  5J2E A;  1B4F A;  2I6X A;  3AU2 A;  4NLZ A;  4ED6 A; 
#chains in the Genus database with same CATH homology
 3BS7 A;  2QB0 A;  3SEI A;  2KSO A;  2EAM A;  2E8M A;  1COK A;  2QB1 A;  4NL9 C;  2ESE A;  3HIL A;  1KW4 A;  4RQM A;  1SXE A;  1RG6 A;  5F3X B;  1F0M A;  2E8O A;  4NJ8 A;  1LKY B;  1B0X A;  1UCV A;  1V38 A;  5JRT A;  2DKX A;  2Y9U A;  2DL0 A;  2KE7 A;  1JI7 A;  2E8N A;  2QAR A;  2QKQ A;  1X9X A;  2DKZ A;  2GLE A;  2EAO A;  2K60 A;  3IDW A;  2LPE A;  1OXJ A;  1SV0 A;  2B6G A;  4NL9 A;  1OW5 A;  2QAR B;  2QB0 B;  5J8Y C;  5KNI A;  2F44 A;  3SEN A;  1SV4 A;  1V85 A;  2YTU A;  2F8K A;  1X66 A;  2L5Y A;  2KMD A;  1SXD A;  2LMR A;  3BS5 B;  2EAP A;  1PK3 A;  3H8M A;  3KKA A;  1PK1 B;  5J8Y A;  2KSO B;  1Z1V A;  1PK1 A;  3K1R B;  2K4P A;  2KG5 A;  3TAC B;  1WWV A;  2E8P A;  3BQ7 A;  2EAN A;  2KIV A;  2D8C A;  1SV0 C;  2Y9T A;  1LKY A;  1X40 A;  4PZO A;  1DXS A;  4IS7 A;  5JU5 A;  3KKA C;  4RQN A;  1WWU A;  2F3N A;  3TAD C;  2JV3 A;  4PZN A;  1UQV A;  5JTI A;  2FE9 A;  2ES6 A;  1B4F A;  3BS5 A;  5L1M A;  2D3D A;  4MHV A;  1SGG A;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...