2QB3A

Structural studies reveal the inactivation of e. coli l-aspartate aminotransferase by (s)-4,5-dihydro-2-thiophenecarboxylic acid (sadta) via two mechanisms (at ph 7.5)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
381
Chain Sequence
FENITAAPADLFGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inactivation of Escherichia coli L-aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-thiophenecarboxylic acid reveals "a tale of two mechanisms".
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 143
structure length 381
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2qb3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2qb3A01
1SPAA 1MLZA 4MKJA 2F8JA 1XEYA 3PAAA 5DB5A 5G2QA 4ZSWA 2YRRA 5EUDA 2YCPA 4WYFA 1AIBA 2WK8A 1DKAA 3HL2A 5IWQA 5E4ZA 3EZ1A 2ZC0A 3NRAA 2ZY5A 2C0RA 2VMPA 2EH6A 2ZSLA 1RVYA 3UAKA 2JGTA 1TARA 1VJOA 2BI5A 2JJHA 3DU4A 5E5IA 4GE9A 2ZY2A 3AOWA 3NX3A 1LS3A 2W7HA 1BW0A 1J32A 2AATA 3WGCA 4CXRA 3K40A 4IXZA 2GQNA 1CL1A 5G09A 2Z1YA 4ZWMA 2Z20A 2VMXA 3N5MA 4H51A 4AOAA 1CL2A 5I92A 1CZEA 2CH2A 4U1TA 4I8AA 1M0PA 4UHMA 1AHYA 4MSOA 3EIBA 3CQ4A 3UWCA 1AMSA 3QGUA 3WKRA 1LW4A 1BS0A 2GMUA 2VMOA 1QJ3A 2WK7A 3CQ5A 4CBRA 1ARSA 1W23A 3PDXA 1LC7A 2D65A 3I4JA 2X5DA 4O6ZA 1DJEA 5FT4A 4AH3A 1AMQA 3MBBA 1O62A 1KL1A 2TPLA 2VMQA 1BT4A 4JE5A 1UU0A 4LNLA 3H7FA 3CAIA 1C0NA 1LW5A 1MLYA 1WYUA 1IX8A 3PD6A 1LC8A 2ZUKA 4EFFA 1OHYA 3COGA 4IY7A 1FC4A 1FG7A 2D61A 2DKJA 2GMSA 4JEWA 3ELEA 1IJIA 5LHAA 1PG8A 3ZRPA 2C44A 5EUEA 4RAEA 2EZ1A 4EB5A 1SVVA 1PMOA 1AIAA 1UKJA 2RFVA 4GE7A 3DYDA 3BS8A 1AHXA 5D95A 5C6UA 1X28A 3FQAA 3JWBA 1IBJA 3GZCA 3RI6A 3JWAA 3ECDA 1B5PA 1OXOA 4K2MA 1AKBA 3UE8A 2BIEA 3AV7A 2O1BA 2Z67A 1KL2A 1MDXA 2VGSA 2YKXA 1D7SA 3VP6A 2CY8A 1WYVB 2BIAA 3TCMA 4W1WA 4UHOA 3Q8NA 4ZLVA 4A6RA 2D66A 1BKGA 3FZ7A 3GZDC 2W7JA 2W7KA 2W7MA 3GBXA 4U2HA 5F8VA 2VIAA 3WKSA 2NMPA 4IX8A 3MC6C 1BJ4A 1AAWA 4Y0DA 4MY5A 3OKSA 4BA5A 3WLXA 2OATA 1W7LA 3USFA 4OTLA 3QN6A 1B9IA 1S06A 3AEMC 2BKWA 3N75A 4WBTA 4XJPA 4LNMA 1AMAA 2YCNA 1GEXA 1AY5A 1ZOBA 3B1DA 2CANA 3P1TA 3DXWA 2Z9XA 1CZCA 4ISYA 4E1OA 4XJLA 3HDOA 3OP7A 3A9YA 1QJ5A 3LVMA 2HUFA 1AMRA 2ZYJA 1YJZA 1DGEA 2HOYA 1TPLA 1YAAA 1W3UA 3GSBA 4ADEA 3LV2A 1OATA 2O7CA 2W7IA 3EI6A 2ZY3A 1N31A 1FG3A 3WCOA 1LK9A 3K7YA 2VGVA 4XJMA 4F5FA 2VMNA 1EQBA 1BJWA 3LVKA 1Z3ZA 4R5ZA 5JAYA 5M4BA 4JE5D 3AEOA 3BC8A 1LKCA 2OQXA 1N8PA 4R8DA 2BI9A 2DGMA 5F9SA 1X0MA 2D7YA 3ZRRA 1X29A 4GE4A 4ZSYA 5G0AA 3GETA 3NTJA 3VK3A 2EPJA 4ZM4A 2GSAA 3G7QA 1YJSA 3KKIA 2FNIA 3DR7A 2QB3A 3FVUA 3HMUA 3RUYA 1KKPA 2R0TA 4XJOA 3PJ0A 4Q75A 2VMWA 3MAFB 4UQVA 4N0WA 2VLFA 2HOXA 3BCAA 2YRIA 3LVJA 3T32A 3ASBA 3KGWA 4Q6RA 3BWNC 1D7RA 5EFSA 3BWOA 4A0FA 4RITA 4AZJA 5LH9A 1ASEA 2E7UA 3EI7A 2ZP7A 3FVXA 8AATA 2ZY4A 1I29A 3AEMA 2CJGA 2VI9A 3BB8A 1CJ0A 3GJUA 1PFFA 1GD9A 5K8BA 3QHXA 4RJ0A 2R5CA 2AY4A 2JG2A 1OHVA 1AHGA 1IAXA 3RBLA 1YJYA 2CFBA 3AOVA 2BWNA 3WGBA 4MQQA 1IAYA 4OC9A 4MQRA 1GC0A 4EB7A 1ASAA 2DGLA 3MADA 2HUUA 4CXQA 4HF8A 4WXBA 3HBXA 4WYAA 4BA4A 3PGYA 3B1EA 2VMTA 1E5EA 4ZDLA 2HZPA 1AJSA 3FSLA 4PIWA 4WLJA 3RCHB 2YKUA 3VOMA 2BWPA 1S07A 3ASAA 4PFFA 4CBSA 2ZJGA 5BJ4A 1JF9A 1XI9A 2PB2A 4WXFA 3DZZA 4A00A 3F6TA 1IX6A 4ATPA 2CSTA 3IF2A 4RM1A 4W8IA 2VMVA 3HVYA 1AJRA 4MGRA 1J04A 2C81A 4KAMA 3H14A 1GEWA 4IXSA 3DRDA 2W8UA 4DGTA 1YIYA 2Z9VA 1W7MA 4XQ2A 5TF5A 5D5SA 1C9CA 3MKJA 4PVFA 5FT5A 2FYFA 3CBFA 3EIAA 1I48A 4GDYA 3R9AA 3ATHA 3B46A 2HUIA 1D7VA 1KMKA 1AKAA 1ELQA 1C7GA 1CS1A 4F5IA 2CB1A 4WB0A 1OXPA 1AY8A 3EI8A 1V2DA 1GC3A 1GDEA 1WYVA 3FKDA 3AEJC 1S09A 1AHEA 4A0HA 3E2ZB 1ASNA 2BHXA 1ASBA 2AY1A 4NOGA 3DXVA 1GCKA 1DFOA 5EAAA 2AY7A 3HLMA 1DJUA 1LC5A 1AKCA 2QB2A 2ZSMA 3PDBB 3RQ1A 3K28A 1M0OA 2VGUA 4P7YA 1V2EA 4IXOA 2W7LA 2HORA 1WYUB 2OGEA 2ORDA 3QI6A 4JF1A 4JEZA 2BWOA 3EZSA 3E2FA 3MEBA 1AX4A 2OKKA 1ASMA 2YKVA 3FQ8A 2W8VA 2BI3A 3NYTA 4XAUA 4F5LA 4W91A 4BHDA 1YOOA 3N0LA 2QA3A 4EU1A 3NDNA 4JF0A 3GZDA 1RV4A 2PB0A 3FTBA 3FQ7A 3ACZA 4IW7A 1D7UA 4ZM3A 3A8UX 4DQ6A 1BQDA 3VK2A 2BI2A 1ARIA 2AY3A 2BYJA 4J8LA 3QBOA 4JEVA 4ADBA 2W7FA 3AELA 5G4JA 1TASA 4ITXA 1ASLA 1ARHA 4LW2A 1Z7DA 4EMYA 5HXXA 2QBTA 4J5UA 3WCNA 2Z9UA 4ADCA 1GC2A 1RV3A 4W1VA 2XBNA 3F0HA 1N2TA 3KE3A 2JJGA 1BJOA 2V0YA 2X8UA 3NU7A 1WKGA 5FT6A 3TQXA 3BCXA 4R2NA 3II0A 4F5MA 2VMZA 2AEVA 3TFTA 1WYTA 4Q31A 4WXGA 4WYGA 2VIBA 2X3LA 2XH1A 3EI9A 2OGAA 1MAQA 2X5FA 4DBCA 4A6TA 4PFNA 3E77A 4Q76A 1ASCA 3MAFA 3IHJA 1TOGA 1UU1A 4TV7A 4GRXA 3B8XA 2EZ2A 4W1XA 4CVQA 1DTYA 3M5UA 3R4TA 5EAVA 4IYOB 4MKKA 4MQPA 3FRKA 2WKAA 3F9TA 4E3RA 4K2BA 3WY7A 4W5KA 2EGYA 4ATQA 3FFRA 3FFHA 2AY9A 1CQ7A 4QGRA 2R5CB 3GWPA 4WYEA 2W8WA 3W1JA 3PA9A 1AY4A 4Y0IA 1AICA 5G2PA 5M46A 1WSTA 3TFUA 3VK4A 4UHNA 3AATA 4OYTA 1M4NA 3AENA 1DGDA 2R5EA 2FNUA 3JW9A 1TOKA 3E2ZA 2FM1A 3BN1A 1MAPA 1SZUA 4N0BA 1Y4IA 1AJSB 1SZSA 1YNUA 1G4VA 2V1PA 2JISA 3E6GA 1G4XA 3EI5A 4M2MA 2VMUA 1S0AA 5HDMA 4ZASA 4AO9A 1ZODA 1VEFA 2Z9WA 4WD2A 2BYLA 2CINA 1MDZA 1AAMA 3WZFA 3RBFA 1YIZA 1PMMA 1RVUA 3FDBA 2YKYA 2VYCA 3NUIA 4KYOA 3B1CA 4ITGA 3PD6B 4OBVA 3W1IA 2C7TA 2GB3A 1KMJA 2W7DA 4OBUA 1B4XA 4AO4A 1ECXA 2BI1A 2YOBA 4GEBA 2W7GA 1JG8A 2E54A 1IX7A 1H1CA 1KKJA 4ZWVA 2WK9A 2FQ6A 4A0GA 2D64A 1CQ6A 1M6SA 2CTZA 1M32A 1ARTA 2HP1A 1TATA 4K2IA 3ELPA 4F5HA 3ZZKA 4OCAA 5AX8A 4ZAHA 3W1HA 4ZDOA 1MGVA 1GC4A 2D5YA 4XEWA 4E3QA 3NU8A 1TOJA 5E3KA 5EQCA 3FCRA 4F5JA 4FFCA 1VP4A 1UU2A 3G8MA 5HHYA 1E5FA 1TOIA 5EUNA 3RCHA 4ZDPA 3QM2A 5FT8A 4F5KA 4WYDA 3HT4A 1M0QA 3BV0A 4TN4A 1WYTB 3JTXA 1I43A 3NNKA 2CH1A 1BJNA 1G7XA 1SZKA 4AZKA 3FD0A 1I41A 1ASDA 1ASFA 2Z1ZA 5DX5A 1B8GA 1SF2A 2VGWA 1JS3A 3DC1A 1B5OA 2W7EA 3BCBA 3G0TA 1C7NA 1SFFA 1D2FA 5M4DA 1V72A 3TATA 1S08A 4IYOA 1TOEA 1ORDA 1U08A 2YHKA 3A2BA 4F5GA 1ARGA 3LG0A 1C7OA 1BQAA 2O0RA 2AY5A 2Z61A 4RJYA 3NYUA 4B9BA 4WB0B 3FZ6A 3E9KA 2BIGA 2VMSA 1X2AA 3NYSA 4WP0A 2Q7WA 1IUGA 4LNJA 2JJEA 1DJ9A 2FN6A 4P3MA 4A72A 3VAXA 1QISA 1W7NA 3D6KA 4BMKA 2W8JA 1O61A 4LC3A 1M0NA 2VGZA 5EIGB 2PO3A 2AY2A 2D63A 3AENB 4M2JA 4OMAA 1JS6A 4JEXA 3LWSA 2QLRA 3AEPA 2OKJA 1V2FA 2DOUA 3PDBA 2VGTA 1AHFA 4OT8A 1OHWA 3A9ZA 3I16A 3AEJA 3L44A 4RKCA 1QGNA 1IVRA 1ASGA 1B9HA 1P3WA 3DR4A 3BWNA 3NUBA 4ADDA 4JEYA 3ISLA 4KXKA 2E7JA 3ZZJA 4R5FA 3P6KA 3MAUA 2HOZA 1EJIA 2YCTA 1GEYA 3FDDA 4XK1A 4E77A 4HVKA 2R2NA 9AATA 4L0OA 2AEUA 3WX9A 3FVSA 1M7YA 5J8QA 1GBNA 7AATA 3A9XA 1WKHA 1QITA 4A0RA 3E2YA 1H0CA 2D7ZA 2VMRA 1G7WA 3DODA 2CJHA 4WLHA 4BQ0A 2G6WA 2JJFA 3JU7A 4RIZA 3ZRQA 2AY6A 2HP2A 1MDOA 4LW4A 4TMRA 2CJDA 3HQTA 3I5TA 3LVLB 5BJ3A 3PIUA 4M2KA 2QMAA 3LY1A 4FL0A 3GR9A 2E7IA 4Y0HA 1ELUA 3FZ8A 4RLGA 1QZ9A 4WYCA 3MC6A 1C4KA 4A6UA 5M49A 1EG5A 1BJOB 2VMYA 4UOYA 5DJ9A 1T3IA 1ZC9A 1CQ8A 2DKBA 2EO5A 3PPLA 4GSAA 3L8AA 2DR1A 3KGXA 3QPGA 1QIRA 2AY8A 2DGKA 3EUCA 5EIGA 2W8TA 1O4SA 2VLHA 4B98A 3CQ6A 2VI8A 1O69A 4RKDA 5DJ1A 3JZLA 5G4IA 4F4EA
chains in the Genus database with same CATH superfamily
1SPAA 1MLZA 4MKJA 2F8JA 1XEYA 3PAAA 5DB5A 5G2QA 4ZSWA 2YRRA 5EUDA 2YCPA 4WYFA 1AIBA 2WK8A 1DKAA 3HL2A 5IWQA 5E4ZA 3EZ1A 2ZC0A 3NRAA 2ZY5A 2C0RA 2VMPA 2EH6A 2ZSLA 1RVYA 3UAKA 2EYQA 2JGTA 1TARA 1VJOA 2BI5A 2JJHA 3DU4A 5E5IA 4GE9A 2ZY2A 3AOWA 3NX3A 1LS3A 2W7HA 1BW0A 1J32A 2AATA 3WGCA 4CXRA 3K40A 4IXZA 2GQNA 1CL1A 5G09A 2Z1YA 4ZWMA 2Z20A 2VMXA 3N5MA 4H51A 4AOAA 1CL2A 5I92A 1CZEA 2CH2A 4U1TA 4I8AA 1M0PA 4UHMA 1AHYA 4MSOA 3EIBA 3CQ4A 3UWCA 1AMSA 3QGUA 3WKRA 1LW4A 1BS0A 4K05A 2GMUA 2VMOA 1QJ3A 2WK7A 3CQ5A 4CBRA 1ARSA 1W23A 3PDXA 1LC7A 2D65A 3I4JA 2X5DA 4O6ZA 1DJEA 5FT4A 4AH3A 1AMQA 3MBBA 1O62A 1KL1A 2TPLA 2VMQA 1BT4A 4JE5A 1UU0A 4LNLA 3H7FA 3CAIA 1C0NA 1LW5A 1MLYA 1WYUA 1IX8A 3PD6A 1LC8A 2ZUKA 4EFFA 1OHYA 3COGA 4H63Q 4IY7A 1FC4A 1FG7A 2D61A 2DKJA 2GMSA 4JEWA 3ELEA 1IJIA 5LHAA 1PG8A 3ZRPA 2C44A 1KAFA 5EUEA 4RAEA 2EZ1A 4EB5A 1SVVA 1PMOA 1AIAA 1UKJA 2RFVA 4GE7A 3DYDA 3BS8A 1AHXA 5D95A 5C6UA 1X28A 3FQAA 3JWBA 2KFPA 1IBJA 3GZCA 3RI6A 3JWAA 3ECDA 1B5PA 1OXOA 4K2MA 1AKBA 3UE8A 3H9XA 2BIEA 3AV7A 2O1BA 2Z67A 1KL2A 1MDXA 2VGSA 2YKXA 1D7SA 3VP6A 2CY8A 1WYVB 2BIAA 3TCMA 4W1WA 5KTBA 4UHOA 3Q8NA 4ZLVA 4A6RA 2D66A 1BKGA 3FZ7A 3GZDC 2W7JA 2W7KA 2W7MA 3GBXA 4U2HA 5F8VA 2VIAA 3WKSA 2NMPA 4IX8A 3MC6C 1BJ4A 1AAWA 4Y0DA 4MY5A 3OKSA 4BA5A 3WLXA 2OATA 1W7LA 3USFA 4OTLA 3QN6A 1B9IA 1S06A 3AEMC 2BKWA 3N75A 4WBTA 4XJPA 4LNMA 1AMAA 2YCNA 1GEXA 1AY5A 1ZOBA 3B1DA 2CANA 3P1TA 3DXWA 2Z9XA 2A1VA 1CZCA 4ISYA 4E1OA 4XJLA 3HDOA 3OP7A 3A9YA 1QJ5A 3LVMA 2HUFA 1AMRA 2ZYJA 1YJZA 1DGEA 2HOYA 1TPLA 1YAAA 1W3UA 3GSBA 4ADEA 3LV2A 1OATA 2O7CA 2W7IA 3EI6A 2ZY3A 1N31A 1FG3A 3WCOA 1LK9A 3K7YA 2VGVA 4XJMA 4F5FA 2VMNA 1EQBA 1BJWA 3LVKA 1Z3ZA 4R5ZA 5JAYA 5M4BA 4JE5D 3AEOA 3BC8A 1LKCA 2OQXA 1N8PA 4R8DA 2BI9A 2DGMA 5F9SA 1X0MA 2D7YA 3ZRRA 1X29A 4GE4A 4ZSYA 5G0AA 3GETA 3NTJA 3VK3A 2EPJA 4ZM4A 2GSAA 3G7QA 1YJSA 3KKIA 2FNIA 3DR7A 2QB3A 3FVUA 3HMUA 3RUYA 1KKPA 2R0TA 4XJOA 3PJ0A 4Q75A 2VMWA 3MAFB 4UQVA 4N0WA 2VLFA 2HOXA 3BCAA 2YRIA 3LVJA 3T32A 3ASBA 3KGWA 4Q6RA 3BWNC 1D7RA 5EFSA 3BWOA 4A0FA 4RITA 4AZJA 5LH9A 1ASEA 2E7UA 3EI7A 2ZP7A 3FVXA 8AATA 2ZY4A 1I29A 3AEMA 2CJGA 2VI9A 3BB8A 1CJ0A 3GJUA 1PFFA 1GD9A 5K8BA 3QHXA 4RJ0A 2R5CA 2AY4A 2JG2A 1OHVA 1AHGA 1IAXA 3RBLA 1YJYA 2CFBA 3AOVA 2BWNA 3WGBA 4MQQA 1IAYA 4OC9A 4MQRA 1GC0A 4EB7A 1ASAA 2DGLA 3MADA 2HUUA 4CXQA 4HF8A 4WXBA 3HBXA 4WYAA 4BA4A 3PGYA 3B1EA 2VMTA 1E5EA 4ZDLA 2G7JA 2HZPA 1AJSA 3FSLA 4PIWA 4WLJA 3RCHB 2YKUA 3VOMA 2BWPA 1S07A 3ASAA 4PFFA 4CBSA 2ZJGA 5BJ4A 1JF9A 1XI9A 2PB2A 4WXFA 3DZZA 4A00A 3F6TA 1IX6A 4ATPA 2FKIA 2CSTA 3IF2A 4RM1A 4W8IA 2VMVA 3HVYA 1AJRA 4MGRA 1J04A 2C81A 4KAMA 3H14A 1GEWA 4IXSA 3DRDA 2W8UA 4DGTA 1YIYA 2Z9VA 1W7MA 4XQ2A 5TF5A 5D5SA 1C9CA 3MKJA 4PVFA 5FT5A 2FYFA 3CBFA 3EIAA 1I48A 4GDYA 3R9AA 3ATHA 3B46A 2HUIA 1D7VA 1KMKA 1AKAA 1ELQA 1C7GA 1CS1A 4F5IA 2CB1A 4WB0A 1OXPA 1AY8A 3EI8A 1V2DA 1GC3A 1GDEA 1WYVA 3FKDA 3AEJC 1S09A 1AHEA 4A0HA 3E2ZB 1ASNA 2BHXA 1ASBA 2AY1A 4NOGA 3DXVA 1GCKA 2QSRA 1DFOA 5EAAA 2AY7A 3HLMA 1DJUA 1LC5A 1AKCA 2QB2A 2ZSMA 3PDBB 3RQ1A 3K28A 1M0OA 2VGUA 4P7YA 1V2EA 4IXOA 2W7LA 2HORA 1WYUB 2OGEA 2ORDA 3QI6A 4JF1A 4JEZA 2BWOA 3EZSA 3E2FA 3MEBA 3N4RA 1AX4A 2OKKA 1ASMA 2YKVA 3FQ8A 2W8VA 2BI3A 3NYTA 4XAUA 4F5LA 4W91A 4BHDA 1YOOA 3N0LA 2QA3A 4EU1A 3NDNA 4JF0A 3GZDA 1RV4A 2PB0A 3FTBA 3FQ7A 3ACZA 4IW7A 1D7UA 4ZM3A 3N7NA 3A8UX 4DQ6A 1BQDA 3VK2A 2BI2A 1ARIA 2AY3A 2BYJA 4J8LA 3QBOA 4JEVA 4ADBA 2W7FA 3AELA 5G4JA 1TASA 4ITXA 1ASLA 1ARHA 4LW2A 1Z7DA 4EMYA 5HXXA 2QBTA 4J5UA 3WCNA 2Z9UA 4ADCA 1GC2A 1RV3A 4W1VA 2XBNA 3F0HA 1N2TA 3KE3A 2JJGA 1BJOA 2V0YA 2X8UA 3NU7A 1WKGA 5FT6A 3TQXA 3BCXA 4R2NA 3II0A 4F5MA 2VMZA 2AEVA 3TFTA 1WYTA 4Q31A 4WXGA 4WYGA 2VIBA 2X3LA 2XH1A 3EI9A 2OGAA 1MAQA 2X5FA 4DBCA 4A6TA 4PFNA 3E77A 4Q76A 1ASCA 3MAFA 3IHJA 1TOGA 1UU1A 4TV7A 4GRXA 3B8XA 2EZ2A 4W1XA 4CVQA 1DTYA 3M5UA 3R4TA 5EAVA 4IYOB 4MKKA 4MQPA 3FRKA 2WKAA 3F9TA 4E3RA 4K2BA 3WY7A 4W5KA 3N4SA 2EGYA 4ATQA 3FFRA 3FFHA 2AY9A 1CQ7A 4QGRA 2R5CB 3GWPA 4WYEA 2W8WA 3W1JA 3PA9A 1AY4A 4Y0IA 1AICA 5G2PA 5M46A 1WSTA 3TFUA 3VK4A 4UHNA 3AATA 4OYTA 1M4NA 3AENA 1DGDA 2R5EA 2FNUA 3JW9A 1TOKA 3E2ZA 2FM1A 3BN1A 1MAPA 1SZUA 4N0BA 1Y4IA 1AJSB 1SZSA 1YNUA 1G4VA 2V1PA 2JISA 3E6GA 1G4XA 3EI5A 4M2MA 2VMUA 1S0AA 5HDMA 4ZASA 4AO9A 1ZODA 1VEFA 2Z9WA 4WD2A 2BYLA 2CINA 1MDZA 1AAMA 3WZFA 3RBFA 1YIZA 1PMMA 1RVUA 3FDBA 2YKYA 2VYCA 3NUIA 4KYOA 3B1CA 4ITGA 3PD6B 4OBVA 3W1IA 2C7TA 2GB3A 1KMJA 2W7DA 4OBUA 1B4XA 4AO4A 1ECXA 2BI1A 2YOBA 4GEBA 2W7GA 1JG8A 2E54A 1IX7A 1H1CA 1KKJA 4ZWVA 2WK9A 2FQ6A 4A0GA 2D64A 1CQ6A 1M6SA 2CTZA 1M32A 1ARTA 2HP1A 1TATA 4K2IA 3ELPA 4F5HA 3ZZKA 4OCAA 5AX8A 4ZAHA 3W1HA 4ZDOA 1MGVA 1GC4A 3N4XA 2D5YA 4XEWA 4E3QA 3NU8A 1TOJA 5E3KA 5EQCA 3FCRA 4F5JA 4FFCA 1VP4A 1UU2A 3G8MA 5HHYA 1E5FA 1TOIA 5EUNA 3RCHA 4ZDPA 3QM2A 5FT8A 4F5KA 4WYDA 3HT4A 1M0QA 3BV0A 4TN4A 1WYTB 3JTXA 1I43A 3NNKA 2CH1A 1BJNA 1G7XA 1SZKA 4AZKA 3FD0A 1I41A 1ASDA 1ASFA 2Z1ZA 5DX5A 1B8GA 1SF2A 2VGWA 1JS3A 3DC1A 1B5OA 2W7EA 3BCBA 3G0TA 1C7NA 1SFFA 1D2FA 5M4DA 1V72A 3TATA 1S08A 4IYOA 1TOEA 1ORDA 1U08A 2YHKA 3A2BA 4F5GA 1ARGA 3LG0A 1C7OA 1BQAA 2O0RA 2AY5A 2Z61A 4RJYA 3NYUA 4B9BA 4WB0B 3FZ6A 3E9KA 2BIGA 2VMSA 1X2AA 3NYSA 4WP0A 2Q7WA 1IUGA 4LNJA 2JJEA 1DJ9A 2FN6A 4P3MA 4A72A 3VAXA 1QISA 1W7NA 3D6KA 4BMKA 2W8JA 1O61A 4LC3A 1M0NA 2VGZA 5EIGB 2PO3A 2AY2A 2D63A 3AENB 4M2JA 4OMAA 1JS6A 4JEXA 3LWSA 2QLRA 3AEPA 2OKJA 1V2FA 2DOUA 3PDBA 2VGTA 1AHFA 4OT8A 1OHWA 3A9ZA 3I16A 3AEJA 3L44A 4RKCA 1QGNA 1IVRA 1ASGA 1B9HA 1P3WA 3DR4A 3BWNA 3NUBA 4ADDA 4JEYA 3ISLA 4KXKA 2E7JA 3ZZJA 4R5FA 3P6KA 3MAUA 2HOZA 1EJIA 2YCTA 2WB6A 1GEYA 3FDDA 4XK1A 4E77A 4HVKA 2R2NA 9AATA 4L0OA 2AEUA 3WX9A 3FVSA 1M7YA 5J8QA 1GBNA 7AATA 3A9XA 1WKHA 1QITA 4A0RA 3E2YA 1H0CA 2D7ZA 2VMRA 1G7WA 3DODA 2CJHA 4WLHA 4BQ0A 2G6WA 2JJFA 3JU7A 4RIZA 3ZRQA 2AY6A 2HP2A 1MDOA 4LW4A 4TMRA 2CJDA 3HQTA 3I5TA 3LVLB 5BJ3A 3PIUA 4M2KA 2QMAA 3LY1A 4FL0A 3GR9A 2E7IA 4Y0HA 1ELUA 3FZ8A 4RLGA 1QZ9A 4WYCA 3MC6A 1C4KA 4A6UA 5M49A 1EG5A 1BJOB 2VMYA 4UOYA 5DJ9A 1T3IA 1ZC9A 1CQ8A 2DKBA 2EO5A 3PPLA 4GSAA 3L8AA 2DR1A 3KGXA 3QPGA 1QIRA 2AY8A 2DGKA 3EUCA 5EIGA 2W8TA 1O4SA 2VLHA 4B98A 3CQ6A 2VI8A 1O69A 4RKDA 5DJ1A 3JZLA 5G4IA 4F4EA
chains in the Genus database with same CATH topology
1SPAA 1MLZA 4MKJA 2F8JA 1XEYA 3PAAA 5DB5A 5G2QA 4ZSWA 2YRRA 5EUDA 2YCPA 4WYFA 1AIBA 2WK8A 1DKAA 3HL2A 5IWQA 5E4ZA 3EZ1A 2ZC0A 3NRAA 2ZY5A 2C0RA 2VMPA 2EH6A 2ZSLA 1RVYA 3UAKA 2EYQA 2JGTA 1TARA 1VJOA 2BI5A 2JJHA 3DU4A 5E5IA 4GE9A 2ZY2A 3AOWA 3NX3A 1LS3A 2W7HA 1BW0A 1J32A 2AATA 3WGCA 4CXRA 3K40A 4IXZA 2GQNA 1CL1A 5G09A 2Z1YA 4ZWMA 2Z20A 2VMXA 3N5MA 4H51A 4AOAA 1CL2A 5I92A 1CZEA 2CH2A 4U1TA 4I8AA 1M0PA 4UHMA 1AHYA 4MSOA 3EIBA 3CQ4A 3UWCA 1AMSA 3QGUA 3WKRA 1LW4A 1BS0A 4K05A 2GMUA 2VMOA 1QJ3A 2WK7A 3CQ5A 4CBRA 1ARSA 1W23A 3PDXA 1LC7A 2D65A 3I4JA 2X5DA 4O6ZA 1DJEA 5FT4A 4AH3A 1AMQA 3MBBA 1O62A 1KL1A 2TPLA 2VMQA 1BT4A 4JE5A 1UU0A 4LNLA 3H7FA 3CAIA 1C0NA 1LW5A 1MLYA 1WYUA 1IX8A 3PD6A 1LC8A 2ZUKA 4EFFA 1OHYA 3COGA 4H63Q 4IY7A 1FC4A 1FG7A 2D61A 2DKJA 2GMSA 4JEWA 3ELEA 1IJIA 5LHAA 1PG8A 3ZRPA 2C44A 5EUEA 4RAEA 2EZ1A 4EB5A 1SVVA 1PMOA 1AIAA 1UKJA 2RFVA 4GE7A 3DYDA 3BS8A 1AHXA 5D95A 5C6UA 1X28A 3FQAA 3JWBA 2KFPA 1IBJA 3GZCA 3RI6A 3JWAA 3ECDA 1B5PA 1OXOA 4K2MA 1AKBA 3UE8A 3H9XA 2BIEA 3AV7A 2O1BA 2Z67A 1KL2A 1MDXA 2VGSA 2YKXA 1D7SA 3VP6A 2CY8A 1WYVB 2BIAA 3TCMA 4W1WA 5KTBA 4UHOA 3Q8NA 4ZLVA 4A6RA 2D66A 1BKGA 3FZ7A 3GZDC 2W7JA 2W7KA 2W7MA 3GBXA 4U2HA 5F8VA 2VIAA 3WKSA 2NMPA 4IX8A 3MC6C 1BJ4A 1AAWA 4Y0DA 4MY5A 3OKSA 4BA5A 3WLXA 2OATA 1W7LA 3USFA 4OTLA 3QN6A 1B9IA 1S06A 3AEMC 2BKWA 3N75A 4WBTA 4XJPA 4LNMA 1AMAA 2YCNA 1GEXA 1AY5A 1ZOBA 3B1DA 2CANA 3P1TA 3DXWA 2Z9XA 2A1VA 1CZCA 4ISYA 4E1OA 4XJLA 3HDOA 3OP7A 3A9YA 1QJ5A 3LVMA 2HUFA 1AMRA 2ZYJA 1YJZA 1DGEA 2HOYA 1TPLA 1YAAA 1W3UA 3GSBA 4ADEA 3LV2A 1OATA 2O7CA 2W7IA 3EI6A 2ZY3A 1N31A 1FG3A 3WCOA 1LK9A 3K7YA 2VGVA 4XJMA 4F5FA 2VMNA 1EQBA 1BJWA 3LVKA 1Z3ZA 4R5ZA 5JAYA 5M4BA 4JE5D 3AEOA 3BC8A 1LKCA 2OQXA 1N8PA 4R8DA 2BI9A 2DGMA 5F9SA 1X0MA 2D7YA 3ZRRA 1X29A 4GE4A 4ZSYA 5G0AA 3GETA 3NTJA 3VK3A 2EPJA 4ZM4A 2GSAA 3G7QA 1YJSA 3KKIA 2FNIA 3DR7A 2QB3A 3FVUA 3HMUA 3RUYA 1KKPA 2R0TA 4XJOA 3PJ0A 4Q75A 2VMWA 3MAFB 4UQVA 4N0WA 2VLFA 2HOXA 3BCAA 2YRIA 3LVJA 3T32A 3ASBA 3KGWA 4Q6RA 3BWNC 1D7RA 5EFSA 3BWOA 4A0FA 4RITA 4AZJA 5LH9A 1ASEA 2E7UA 3EI7A 2ZP7A 3FVXA 8AATA 2ZY4A 1I29A 3AEMA 2CJGA 2VI9A 3BB8A 1CJ0A 3GJUA 1PFFA 1GD9A 5K8BA 3QHXA 4RJ0A 2R5CA 2AY4A 2JG2A 1OHVA 1AHGA 1IAXA 3RBLA 1YJYA 2CFBA 3AOVA 2BWNA 3WGBA 4MQQA 1IAYA 4OC9A 4MQRA 1GC0A 4EB7A 1ASAA 2DGLA 3MADA 2HUUA 4CXQA 4HF8A 4WXBA 3HBXA 4WYAA 4BA4A 3PGYA 3B1EA 2VMTA 1E5EA 4ZDLA 2G7JA 2HZPA 1AJSA 3FSLA 4PIWA 4WLJA 3RCHB 2YKUA 3VOMA 2BWPA 1S07A 3ASAA 4PFFA 4CBSA 2ZJGA 5BJ4A 1JF9A 1XI9A 2PB2A 4WXFA 3DZZA 4A00A 3F6TA 1IX6A 4ATPA 2FKIA 2CSTA 3IF2A 4RM1A 4W8IA 2VMVA 3HVYA 1AJRA 4MGRA 1J04A 2C81A 4KAMA 3H14A 1GEWA 4IXSA 3DRDA 2W8UA 4DGTA 1YIYA 2Z9VA 1W7MA 4XQ2A 5TF5A 5D5SA 1C9CA 3MKJA 4PVFA 5FT5A 2FYFA 3CBFA 3EIAA 1I48A 4GDYA 3R9AA 3ATHA 3B46A 2HUIA 1D7VA 1KMKA 1AKAA 1ELQA 1C7GA 1CS1A 4F5IA 2CB1A 4WB0A 1OXPA 1AY8A 3EI8A 1V2DA 1GC3A 1GDEA 1WYVA 3FKDA 3AEJC 1S09A 1AHEA 4A0HA 3E2ZB 1ASNA 2BHXA 1ASBA 2AY1A 4NOGA 3DXVA 1GCKA 2QSRA 1DFOA 5EAAA 2AY7A 3HLMA 1DJUA 1LC5A 1AKCA 2QB2A 2ZSMA 3PDBB 3RQ1A 3K28A 1M0OA 2VGUA 4P7YA 1V2EA 4IXOA 2W7LA 2HORA 1WYUB 2OGEA 2ORDA 3QI6A 4JF1A 4JEZA 2BWOA 3EZSA 3E2FA 3MEBA 3N4RA 1AX4A 2OKKA 1ASMA 2YKVA 3FQ8A 2W8VA 2BI3A 3NYTA 4XAUA 4F5LA 4W91A 4BHDA 1YOOA 3N0LA 2QA3A 4EU1A 3NDNA 4JF0A 3GZDA 1RV4A 2PB0A 3FTBA 3FQ7A 3ACZA 4IW7A 1D7UA 4ZM3A 3N7NA 3A8UX 4DQ6A 1BQDA 3VK2A 2BI2A 1ARIA 2AY3A 2BYJA 4J8LA 3QBOA 4JEVA 4ADBA 2W7FA 3AELA 5G4JA 1TASA 4ITXA 1ASLA 1ARHA 4LW2A 1Z7DA 4EMYA 5HXXA 2QBTA 4J5UA 3WCNA 2Z9UA 4ADCA 1GC2A 1RV3A 4W1VA 2XBNA 3F0HA 1N2TA 3KE3A 2JJGA 1BJOA 2V0YA 2X8UA 3NU7A 1WKGA 5FT6A 3TQXA 3BCXA 4R2NA 3II0A 4F5MA 2VMZA 2AEVA 3TFTA 1WYTA 4Q31A 4WXGA 4WYGA 2VIBA 2X3LA 2XH1A 3EI9A 2OGAA 1MAQA 2X5FA 4DBCA 4A6TA 4PFNA 3E77A 4Q76A 1ASCA 3MAFA 3IHJA 1TOGA 1UU1A 4TV7A 4GRXA 3B8XA 2EZ2A 4W1XA 4CVQA 1DTYA 3M5UA 3R4TA 5EAVA 4IYOB 4MKKA 4MQPA 3FRKA 2WKAA 3F9TA 4E3RA 4K2BA 3WY7A 4W5KA 3N4SA 2EGYA 4ATQA 3FFRA 3FFHA 2AY9A 1CQ7A 4QGRA 2R5CB 3GWPA 4WYEA 2W8WA 3W1JA 3PA9A 1AY4A 4Y0IA 1AICA 5G2PA 5M46A 1WSTA 3TFUA 3VK4A 4UHNA 3AATA 4OYTA 1M4NA 3AENA 1DGDA 2R5EA 2FNUA 3JW9A 1TOKA 3E2ZA 2FM1A 3BN1A 1MAPA 1SZUA 4N0BA 1Y4IA 1AJSB 1SZSA 1YNUA 1G4VA 2V1PA 2JISA 3E6GA 1G4XA 3EI5A 4M2MA 2VMUA 1S0AA 5HDMA 4ZASA 4AO9A 1ZODA 1VEFA 2Z9WA 4WD2A 2BYLA 2CINA 1MDZA 1AAMA 3WZFA 3RBFA 1YIZA 1PMMA 1RVUA 3FDBA 2YKYA 2VYCA 3NUIA 4KYOA 3B1CA 4ITGA 3PD6B 4OBVA 3W1IA 2C7TA 2GB3A 1KMJA 2W7DA 4OBUA 1B4XA 4AO4A 1ECXA 2BI1A 2YOBA 4GEBA 2W7GA 1JG8A 2E54A 1IX7A 1H1CA 1KKJA 4ZWVA 2WK9A 2FQ6A 4A0GA 2D64A 1CQ6A 1M6SA 2CTZA 1M32A 1ARTA 2HP1A 1TATA 4K2IA 3ELPA 4F5HA 3ZZKA 4OCAA 5AX8A 4ZAHA 3W1HA 4ZDOA 1MGVA 1GC4A 3N4XA 2D5YA 4XEWA 4E3QA 3NU8A 1TOJA 5E3KA 5EQCA 3FCRA 4F5JA 4FFCA 1VP4A 1UU2A 3G8MA 5HHYA 1E5FA 1TOIA 5EUNA 3RCHA 4ZDPA 3QM2A 5FT8A 4F5KA 4WYDA 3HT4A 1M0QA 3BV0A 4TN4A 1WYTB 3JTXA 1I43A 3NNKA 2CH1A 1BJNA 1G7XA 1SZKA 4AZKA 3FD0A 1I41A 1ASDA 1ASFA 2Z1ZA 5DX5A 1B8GA 1SF2A 2VGWA 1JS3A 3DC1A 1B5OA 2W7EA 3BCBA 3G0TA 1C7NA 1SFFA 1D2FA 5M4DA 1V72A 3TATA 1S08A 4IYOA 1TOEA 1ORDA 1U08A 2YHKA 3A2BA 4F5GA 1ARGA 3LG0A 1C7OA 1BQAA 2O0RA 2AY5A 2Z61A 4RJYA 3NYUA 4B9BA 4WB0B 3FZ6A 3E9KA 2BIGA 2VMSA 1X2AA 3NYSA 4WP0A 2Q7WA 1IUGA 4LNJA 2JJEA 1DJ9A 2FN6A 4P3MA 4A72A 3VAXA 1QISA 1W7NA 3D6KA 4BMKA 2W8JA 1O61A 4LC3A 1M0NA 2VGZA 5EIGB 2PO3A 2AY2A 2D63A 3AENB 4M2JA 4OMAA 1JS6A 4JEXA 3LWSA 2QLRA 3AEPA 2OKJA 1V2FA 2DOUA 3PDBA 2VGTA 1AHFA 4OT8A 1OHWA 3A9ZA 3I16A 3AEJA 3L44A 4RKCA 1QGNA 1IVRA 1ASGA 1B9HA 1P3WA 3DR4A 3BWNA 3NUBA 4ADDA 4JEYA 3ISLA 4KXKA 2E7JA 3ZZJA 4R5FA 3P6KA 3MAUA 2HOZA 1EJIA 2YCTA 2WB6A 1GEYA 3FDDA 4XK1A 4E77A 4HVKA 2R2NA 9AATA 4L0OA 2AEUA 3WX9A 3FVSA 1M7YA 5J8QA 1GBNA 7AATA 3A9XA 1WKHA 1QITA 4A0RA 3E2YA 1H0CA 2D7ZA 2VMRA 1G7WA 3DODA 2CJHA 4WLHA 4BQ0A 2G6WA 2JJFA 3JU7A 4RIZA 3ZRQA 2AY6A 2HP2A 1MDOA 4LW4A 4TMRA 2CJDA 3HQTA 3I5TA 3LVLB 5BJ3A 3PIUA 4M2KA 2QMAA 3LY1A 4FL0A 3GR9A 2E7IA 4Y0HA 1ELUA 3FZ8A 4RLGA 1QZ9A 4WYCA 3MC6A 1C4KA 4A6UA 5M49A 1EG5A 1BJOB 2VMYA 4UOYA 5DJ9A 1T3IA 1ZC9A 1CQ8A 2DKBA 2EO5A 3PPLA 4GSAA 3L8AA 2DR1A 3KGXA 3QPGA 1QIRA 2AY8A 2DGKA 3EUCA 5EIGA 2W8TA 1O4SA 2VLHA 4B98A 3CQ6A 2VI8A 1O69A 4RKDA 5DJ1A 3JZLA 5G4IA 4F4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPA A;  1MLZ A;  4MKJ A;  2F8J A;  1XEY A;  3PAA A;  5DB5 A;  5G2Q A;  4ZSW A;  2YRR A;  5EUD A;  2YCP A;  4WYF A;  1AIB A;  2WK8 A;  1DKA A;  3HL2 A;  5IWQ A;  5E4Z A;  3EZ1 A;  2ZC0 A;  3NRA A;  2ZY5 A;  2C0R A;  2VMP A;  2EH6 A;  2ZSL A;  1RVY A;  3UAK A;  2JGT A;  1TAR A;  1VJO A;  2BI5 A;  2JJH A;  3DU4 A;  5E5I A;  4GE9 A;  2ZY2 A;  3AOW A;  3NX3 A;  1LS3 A;  2W7H A;  1BW0 A;  1J32 A;  2AAT A;  3WGC A;  4CXR A;  3K40 A;  4IXZ A;  2GQN A;  1CL1 A;  5G09 A;  2Z1Y A;  4ZWM A;  2Z20 A;  2VMX A;  3N5M A;  4H51 A;  4AOA A;  1CL2 A;  5I92 A;  1CZE A;  2CH2 A;  4U1T A;  4I8A A;  1M0P A;  4UHM A;  1AHY A;  4MSO A;  3EIB A;  3CQ4 A;  3UWC A;  1AMS A;  3QGU A;  3WKR A;  1LW4 A;  1BS0 A;  2GMU A;  2VMO A;  1QJ3 A;  2WK7 A;  3CQ5 A;  4CBR A;  1ARS A;  1W23 A;  3PDX A;  1LC7 A;  2D65 A;  3I4J A;  2X5D A;  4O6Z A;  1DJE A;  5FT4 A;  4AH3 A;  1AMQ A;  3MBB A;  1O62 A;  1KL1 A;  2TPL A;  2VMQ A;  1BT4 A;  4JE5 A;  1UU0 A;  4LNL A;  3H7F A;  3CAI A;  1C0N A;  1LW5 A;  1MLY A;  1WYU A;  1IX8 A;  3PD6 A;  1LC8 A;  2ZUK A;  4EFF A;  1OHY A;  3COG A;  4IY7 A;  1FC4 A;  1FG7 A;  2D61 A;  2DKJ A;  2GMS A;  4JEW A;  3ELE A;  1IJI A;  5LHA A;  1PG8 A;  3ZRP A;  2C44 A;  5EUE A;  4RAE A;  2EZ1 A;  4EB5 A;  1SVV A;  1PMO A;  1AIA A;  1UKJ A;  2RFV A;  4GE7 A;  3DYD A;  3BS8 A;  1AHX A;  5D95 A;  5C6U A;  1X28 A;  3FQA A;  3JWB A;  1IBJ A;  3GZC A;  3RI6 A;  3JWA A;  3ECD A;  1B5P A;  1OXO A;  4K2M A;  1AKB A;  3UE8 A;  2BIE A;  3AV7 A;  2O1B A;  2Z67 A;  1KL2 A;  1MDX A;  2VGS A;  2YKX A;  1D7S A;  3VP6 A;  2CY8 A;  1WYV B;  2BIA A;  3TCM A;  4W1W A;  4UHO A;  3Q8N A;  4ZLV A;  4A6R A;  2D66 A;  1BKG A;  3FZ7 A;  3GZD C;  2W7J A;  2W7K A;  2W7M A;  3GBX A;  4U2H A;  5F8V A;  2VIA A;  3WKS A;  2NMP A;  4IX8 A;  3MC6 C;  1BJ4 A;  1AAW A;  4Y0D A;  4MY5 A;  3OKS A;  4BA5 A;  3WLX A;  2OAT A;  1W7L A;  3USF A;  4OTL A;  3QN6 A;  1B9I A;  1S06 A;  3AEM C;  2BKW A;  3N75 A;  4WBT A;  4XJP A;  4LNM A;  1AMA A;  2YCN A;  1GEX A;  1AY5 A;  1ZOB A;  3B1D A;  2CAN A;  3P1T A;  3DXW A;  2Z9X A;  1CZC A;  4ISY A;  4E1O A;  4XJL A;  3HDO A;  3OP7 A;  3A9Y A;  1QJ5 A;  3LVM A;  2HUF A;  1AMR A;  2ZYJ A;  1YJZ A;  1DGE A;  2HOY A;  1TPL A;  1YAA A;  1W3U A;  3GSB A;  4ADE A;  3LV2 A;  1OAT A;  2O7C A;  2W7I A;  3EI6 A;  2ZY3 A;  1N31 A;  1FG3 A;  3WCO A;  1LK9 A;  3K7Y A;  2VGV A;  4XJM A;  4F5F A;  2VMN A;  1EQB A;  1BJW A;  3LVK A;  1Z3Z A;  4R5Z A;  5JAY A;  5M4B A;  4JE5 D;  3AEO A;  3BC8 A;  1LKC A;  2OQX A;  1N8P A;  4R8D A;  2BI9 A;  2DGM A;  5F9S A;  1X0M A;  2D7Y A;  3ZRR A;  1X29 A;  4GE4 A;  4ZSY A;  5G0A A;  3GET A;  3NTJ A;  3VK3 A;  2EPJ A;  4ZM4 A;  2GSA A;  3G7Q A;  1YJS A;  3KKI A;  2FNI A;  3DR7 A;  2QB3 A;  3FVU A;  3HMU A;  3RUY A;  1KKP A;  2R0T A;  4XJO A;  3PJ0 A;  4Q75 A;  2VMW A;  3MAF B;  4UQV A;  4N0W A;  2VLF A;  2HOX A;  3BCA A;  2YRI A;  3LVJ A;  3T32 A;  3ASB A;  3KGW A;  4Q6R A;  3BWN C;  1D7R A;  5EFS A;  3BWO A;  4A0F A;  4RIT A;  4AZJ A;  5LH9 A;  1ASE A;  2E7U A;  3EI7 A;  2ZP7 A;  3FVX A;  8AAT A;  2ZY4 A;  1I29 A;  3AEM A;  2CJG A;  2VI9 A;  3BB8 A;  1CJ0 A;  3GJU A;  1PFF A;  1GD9 A;  5K8B A;  3QHX A;  4RJ0 A;  2R5C A;  2AY4 A;  2JG2 A;  1OHV A;  1AHG A;  1IAX A;  3RBL A;  1YJY A;  2CFB A;  3AOV A;  2BWN A;  3WGB A;  4MQQ A;  1IAY A;  4OC9 A;  4MQR A;  1GC0 A;  4EB7 A;  1ASA A;  2DGL A;  3MAD A;  2HUU A;  4CXQ A;  4HF8 A;  4WXB A;  3HBX A;  4WYA A;  4BA4 A;  3PGY A;  3B1E A;  2VMT A;  1E5E A;  4ZDL A;  2HZP A;  1AJS A;  3FSL A;  4PIW A;  4WLJ A;  3RCH B;  2YKU A;  3VOM A;  2BWP A;  1S07 A;  3ASA A;  4PFF A;  4CBS A;  2ZJG A;  5BJ4 A;  1JF9 A;  1XI9 A;  2PB2 A;  4WXF A;  3DZZ A;  4A00 A;  3F6T A;  1IX6 A;  4ATP A;  2CST A;  3IF2 A;  4RM1 A;  4W8I A;  2VMV A;  3HVY A;  1AJR A;  4MGR A;  1J04 A;  2C81 A;  4KAM A;  3H14 A;  1GEW A;  4IXS A;  3DRD A;  2W8U A;  4DGT A;  1YIY A;  2Z9V A;  1W7M A;  4XQ2 A;  5TF5 A;  5D5S A;  1C9C A;  3MKJ A;  4PVF A;  5FT5 A;  2FYF A;  3CBF A;  3EIA A;  1I48 A;  4GDY A;  3R9A A;  3ATH A;  3B46 A;  2HUI A;  1D7V A;  1KMK A;  1AKA A;  1ELQ A;  1C7G A;  1CS1 A;  4F5I A;  2CB1 A;  4WB0 A;  1OXP A;  1AY8 A;  3EI8 A;  1V2D A;  1GC3 A;  1GDE A;  1WYV A;  3FKD A;  3AEJ C;  1S09 A;  1AHE A;  4A0H A;  3E2Z B;  1ASN A;  2BHX A;  1ASB A;  2AY1 A;  4NOG A;  3DXV A;  1GCK A;  1DFO A;  5EAA A;  2AY7 A;  3HLM A;  1DJU A;  1LC5 A;  1AKC A;  2QB2 A;  2ZSM A;  3PDB B;  3RQ1 A;  3K28 A;  1M0O A;  2VGU A;  4P7Y A;  1V2E A;  4IXO A;  2W7L A;  2HOR A;  1WYU B;  2OGE A;  2ORD A;  3QI6 A;  4JF1 A;  4JEZ A;  2BWO A;  3EZS A;  3E2F A;  3MEB A;  1AX4 A;  2OKK A;  1ASM A;  2YKV A;  3FQ8 A;  2W8V A;  2BI3 A;  3NYT A;  4XAU A;  4F5L A;  4W91 A;  4BHD A;  1YOO A;  3N0L A;  2QA3 A;  4EU1 A;  3NDN A;  4JF0 A;  3GZD A;  1RV4 A;  2PB0 A;  3FTB A;  3FQ7 A;  3ACZ A;  4IW7 A;  1D7U A;  4ZM3 A;  3A8U X;  4DQ6 A;  1BQD A;  3VK2 A;  2BI2 A;  1ARI A;  2AY3 A;  2BYJ A;  4J8L A;  3QBO A;  4JEV A;  4ADB A;  2W7F A;  3AEL A;  5G4J A;  1TAS A;  4ITX A;  1ASL A;  1ARH A;  4LW2 A;  1Z7D A;  4EMY A;  5HXX A;  2QBT A;  4J5U A;  3WCN A;  2Z9U A;  4ADC A;  1GC2 A;  1RV3 A;  4W1V A;  2XBN A;  3F0H A;  1N2T A;  3KE3 A;  2JJG A;  1BJO A;  2V0Y A;  2X8U A;  3NU7 A;  1WKG A;  5FT6 A;  3TQX A;  3BCX A;  4R2N A;  3II0 A;  4F5M A;  2VMZ A;  2AEV A;  3TFT A;  1WYT A;  4Q31 A;  4WXG A;  4WYG A;  2VIB A;  2X3L A;  2XH1 A;  3EI9 A;  2OGA A;  1MAQ A;  2X5F A;  4DBC A;  4A6T A;  4PFN A;  3E77 A;  4Q76 A;  1ASC A;  3MAF A;  3IHJ A;  1TOG A;  1UU1 A;  4TV7 A;  4GRX A;  3B8X A;  2EZ2 A;  4W1X A;  4CVQ A;  1DTY A;  3M5U A;  3R4T A;  5EAV A;  4IYO B;  4MKK A;  4MQP A;  3FRK A;  2WKA A;  3F9T A;  4E3R A;  4K2B A;  3WY7 A;  4W5K A;  2EGY A;  4ATQ A;  3FFR A;  3FFH A;  2AY9 A;  1CQ7 A;  4QGR A;  2R5C B;  3GWP A;  4WYE A;  2W8W A;  3W1J A;  3PA9 A;  1AY4 A;  4Y0I A;  1AIC A;  5G2P A;  5M46 A;  1WST A;  3TFU A;  3VK4 A;  4UHN A;  3AAT A;  4OYT A;  1M4N A;  3AEN A;  1DGD A;  2R5E A;  2FNU A;  3JW9 A;  1TOK A;  3E2Z A;  2FM1 A;  3BN1 A;  1MAP A;  1SZU A;  4N0B A;  1Y4I A;  1AJS B;  1SZS A;  1YNU A;  1G4V A;  2V1P A;  2JIS A;  3E6G A;  1G4X A;  3EI5 A;  4M2M A;  2VMU A;  1S0A A;  5HDM A;  4ZAS A;  4AO9 A;  1ZOD A;  1VEF A;  2Z9W A;  4WD2 A;  2BYL A;  2CIN A;  1MDZ A;  1AAM A;  3WZF A;  3RBF A;  1YIZ A;  1PMM A;  1RVU A;  3FDB A;  2YKY A;  2VYC A;  3NUI A;  4KYO A;  3B1C A;  4ITG A;  3PD6 B;  4OBV A;  3W1I A;  2C7T A;  2GB3 A;  1KMJ A;  2W7D A;  4OBU A;  1B4X A;  4AO4 A;  1ECX A;  2BI1 A;  2YOB A;  4GEB A;  2W7G A;  1JG8 A;  2E54 A;  1IX7 A;  1H1C A;  1KKJ A;  4ZWV A;  2WK9 A;  2FQ6 A;  4A0G A;  2D64 A;  1CQ6 A;  1M6S A;  2CTZ A;  1M32 A;  1ART A;  2HP1 A;  1TAT A;  4K2I A;  3ELP A;  4F5H A;  3ZZK A;  4OCA A;  5AX8 A;  4ZAH A;  3W1H A;  4ZDO A;  1MGV A;  1GC4 A;  2D5Y A;  4XEW A;  4E3Q A;  3NU8 A;  1TOJ A;  5E3K A;  5EQC A;  3FCR A;  4F5J A;  4FFC A;  1VP4 A;  1UU2 A;  3G8M A;  5HHY A;  1E5F A;  1TOI A;  5EUN A;  3RCH A;  4ZDP A;  3QM2 A;  5FT8 A;  4F5K A;  4WYD A;  3HT4 A;  1M0Q A;  3BV0 A;  4TN4 A;  1WYT B;  3JTX A;  1I43 A;  3NNK A;  2CH1 A;  1BJN A;  1G7X A;  1SZK A;  4AZK A;  3FD0 A;  1I41 A;  1ASD A;  1ASF A;  2Z1Z A;  5DX5 A;  1B8G A;  1SF2 A;  2VGW A;  1JS3 A;  3DC1 A;  1B5O A;  2W7E A;  3BCB A;  3G0T A;  1C7N A;  1SFF A;  1D2F A;  5M4D A;  1V72 A;  3TAT A;  1S08 A;  4IYO A;  1TOE A;  1ORD A;  1U08 A;  2YHK A;  3A2B A;  4F5G A;  1ARG A;  3LG0 A;  1C7O A;  1BQA A;  2O0R A;  2AY5 A;  2Z61 A;  4RJY A;  3NYU A;  4B9B A;  4WB0 B;  3FZ6 A;  3E9K A;  2BIG A;  2VMS A;  1X2A A;  3NYS A;  4WP0 A;  2Q7W A;  1IUG A;  4LNJ A;  2JJE A;  1DJ9 A;  2FN6 A;  4P3M A;  4A72 A;  3VAX A;  1QIS A;  1W7N A;  3D6K A;  4BMK A;  2W8J A;  1O61 A;  4LC3 A;  1M0N A;  2VGZ A;  5EIG B;  2PO3 A;  2AY2 A;  2D63 A;  3AEN B;  4M2J A;  4OMA A;  1JS6 A;  4JEX A;  3LWS A;  2QLR A;  3AEP A;  2OKJ A;  1V2F A;  2DOU A;  3PDB A;  2VGT A;  1AHF A;  4OT8 A;  1OHW A;  3A9Z A;  3I16 A;  3AEJ A;  3L44 A;  4RKC A;  1QGN A;  1IVR A;  1ASG A;  1B9H A;  1P3W A;  3DR4 A;  3BWN A;  3NUB A;  4ADD A;  4JEY A;  3ISL A;  4KXK A;  2E7J A;  3ZZJ A;  4R5F A;  3P6K A;  3MAU A;  2HOZ A;  1EJI A;  2YCT A;  1GEY A;  3FDD A;  4XK1 A;  4E77 A;  4HVK A;  2R2N A;  9AAT A;  4L0O A;  2AEU A;  3WX9 A;  3FVS A;  1M7Y A;  5J8Q A;  1GBN A;  7AAT A;  3A9X A;  1WKH A;  1QIT A;  4A0R A;  3E2Y A;  1H0C A;  2D7Z A;  2VMR A;  1G7W A;  3DOD A;  2CJH A;  4WLH A;  4BQ0 A;  2G6W A;  2JJF A;  3JU7 A;  4RIZ A;  3ZRQ A;  2AY6 A;  2HP2 A;  1MDO A;  4LW4 A;  4TMR A;  2CJD A;  3HQT A;  3I5T A;  3LVL B;  5BJ3 A;  3PIU A;  4M2K A;  2QMA A;  3LY1 A;  4FL0 A;  3GR9 A;  2E7I A;  4Y0H A;  1ELU A;  3FZ8 A;  4RLG A;  1QZ9 A;  4WYC A;  3MC6 A;  1C4K A;  4A6U A;  5M49 A;  1EG5 A;  1BJO B;  2VMY A;  4UOY A;  5DJ9 A;  1T3I A;  1ZC9 A;  1CQ8 A;  2DKB A;  2EO5 A;  3PPL A;  4GSA A;  3L8A A;  2DR1 A;  3KGX A;  3QPG A;  1QIR A;  2AY8 A;  2DGK A;  3EUC A;  5EIG A;  2W8T A;  1O4S A;  2VLH A;  4B98 A;  3CQ6 A;  2VI8 A;  1O69 A;  4RKD A;  5DJ1 A;  3JZL A;  5G4I A;  4F4E A; 
#chains in the Genus database with same CATH topology
 1SPA A;  1MLZ A;  4MKJ A;  2F8J A;  1XEY A;  3PAA A;  5DB5 A;  5G2Q A;  4ZSW A;  2YRR A;  5EUD A;  2YCP A;  4WYF A;  1AIB A;  2WK8 A;  1DKA A;  3HL2 A;  5IWQ A;  5E4Z A;  3EZ1 A;  2ZC0 A;  3NRA A;  2ZY5 A;  2C0R A;  2VMP A;  2EH6 A;  2ZSL A;  1RVY A;  3UAK A;  2EYQ A;  2JGT A;  1TAR A;  1VJO A;  2BI5 A;  2JJH A;  3DU4 A;  5E5I A;  4GE9 A;  2ZY2 A;  3AOW A;  3NX3 A;  1LS3 A;  2W7H A;  1BW0 A;  1J32 A;  2AAT A;  3WGC A;  4CXR A;  3K40 A;  4IXZ A;  2GQN A;  1CL1 A;  5G09 A;  2Z1Y A;  4ZWM A;  2Z20 A;  2VMX A;  3N5M A;  4H51 A;  4AOA A;  1CL2 A;  5I92 A;  1CZE A;  2CH2 A;  4U1T A;  4I8A A;  1M0P A;  4UHM A;  1AHY A;  4MSO A;  3EIB A;  3CQ4 A;  3UWC A;  1AMS A;  3QGU A;  3WKR A;  1LW4 A;  1BS0 A;  4K05 A;  2GMU A;  2VMO A;  1QJ3 A;  2WK7 A;  3CQ5 A;  4CBR A;  1ARS A;  1W23 A;  3PDX A;  1LC7 A;  2D65 A;  3I4J A;  2X5D A;  4O6Z A;  1DJE A;  5FT4 A;  4AH3 A;  1AMQ A;  3MBB A;  1O62 A;  1KL1 A;  2TPL A;  2VMQ A;  1BT4 A;  4JE5 A;  1UU0 A;  4LNL A;  3H7F A;  3CAI A;  1C0N A;  1LW5 A;  1MLY A;  1WYU A;  1IX8 A;  3PD6 A;  1LC8 A;  2ZUK A;  4EFF A;  1OHY A;  3COG A;  4H63 Q;  4IY7 A;  1FC4 A;  1FG7 A;  2D61 A;  2DKJ A;  2GMS A;  4JEW A;  3ELE A;  1IJI A;  5LHA A;  1PG8 A;  3ZRP A;  2C44 A;  1KAF A;  5EUE A;  4RAE A;  2EZ1 A;  4EB5 A;  1SVV A;  1PMO A;  1AIA A;  1UKJ A;  2RFV A;  4GE7 A;  3DYD A;  3BS8 A;  1AHX A;  5D95 A;  5C6U A;  1X28 A;  3FQA A;  3JWB A;  2KFP A;  1IBJ A;  3GZC A;  3RI6 A;  3JWA A;  3ECD A;  1B5P A;  1OXO A;  4K2M A;  1AKB A;  3UE8 A;  3H9X A;  2BIE A;  3AV7 A;  2O1B A;  2Z67 A;  1KL2 A;  1MDX A;  2VGS A;  2YKX A;  1D7S A;  3VP6 A;  2CY8 A;  1WYV B;  2BIA A;  3TCM A;  4W1W A;  5KTB A;  4UHO A;  3Q8N A;  4ZLV A;  4A6R A;  2D66 A;  1BKG A;  3FZ7 A;  3GZD C;  2W7J A;  2W7K A;  2W7M A;  3GBX A;  4U2H A;  5F8V A;  2VIA A;  3WKS A;  2NMP A;  4IX8 A;  3MC6 C;  1BJ4 A;  1AAW A;  4Y0D A;  4MY5 A;  3OKS A;  4BA5 A;  3WLX A;  2OAT A;  1W7L A;  3USF A;  4OTL A;  3QN6 A;  1B9I A;  1S06 A;  3AEM C;  2BKW A;  3N75 A;  4WBT A;  4XJP A;  4LNM A;  1AMA A;  2YCN A;  1GEX A;  1AY5 A;  1ZOB A;  3B1D A;  2CAN A;  3P1T A;  3DXW A;  2Z9X A;  2A1V A;  1CZC A;  4ISY A;  4E1O A;  4XJL A;  3HDO A;  3OP7 A;  3A9Y A;  1QJ5 A;  3LVM A;  2HUF A;  1AMR A;  2ZYJ A;  1YJZ A;  1DGE A;  2HOY A;  1TPL A;  1YAA A;  1W3U A;  3GSB A;  4ADE A;  3LV2 A;  1OAT A;  2O7C A;  2W7I A;  3EI6 A;  2ZY3 A;  1N31 A;  1FG3 A;  3WCO A;  1LK9 A;  3K7Y A;  2VGV A;  4XJM A;  4F5F A;  2VMN A;  1EQB A;  1BJW A;  3LVK A;  1Z3Z A;  4R5Z A;  5JAY A;  5M4B A;  4JE5 D;  3AEO A;  3BC8 A;  1LKC A;  2OQX A;  1N8P A;  4R8D A;  2BI9 A;  2DGM A;  5F9S A;  1X0M A;  2D7Y A;  3ZRR A;  1X29 A;  4GE4 A;  4ZSY A;  5G0A A;  3GET A;  3NTJ A;  3VK3 A;  2EPJ A;  4ZM4 A;  2GSA A;  3G7Q A;  1YJS A;  3KKI A;  2FNI A;  3DR7 A;  2QB3 A;  3FVU A;  3HMU A;  3RUY A;  1KKP A;  2R0T A;  4XJO A;  3PJ0 A;  4Q75 A;  2VMW A;  3MAF B;  4UQV A;  4N0W A;  2VLF A;  2HOX A;  3BCA A;  2YRI A;  3LVJ A;  3T32 A;  3ASB A;  3KGW A;  4Q6R A;  3BWN C;  1D7R A;  5EFS A;  3BWO A;  4A0F A;  4RIT A;  4AZJ A;  5LH9 A;  1ASE A;  2E7U A;  3EI7 A;  2ZP7 A;  3FVX A;  8AAT A;  2ZY4 A;  1I29 A;  3AEM A;  2CJG A;  2VI9 A;  3BB8 A;  1CJ0 A;  3GJU A;  1PFF A;  1GD9 A;  5K8B A;  3QHX A;  4RJ0 A;  2R5C A;  2AY4 A;  2JG2 A;  1OHV A;  1AHG A;  1IAX A;  3RBL A;  1YJY A;  2CFB A;  3AOV A;  2BWN A;  3WGB A;  4MQQ A;  1IAY A;  4OC9 A;  4MQR A;  1GC0 A;  4EB7 A;  1ASA A;  2DGL A;  3MAD A;  2HUU A;  4CXQ A;  4HF8 A;  4WXB A;  3HBX A;  4WYA A;  4BA4 A;  3PGY A;  3B1E A;  2VMT A;  1E5E A;  4ZDL A;  2G7J A;  2HZP A;  1AJS A;  3FSL A;  4PIW A;  4WLJ A;  3RCH B;  2YKU A;  3VOM A;  2BWP A;  1S07 A;  3ASA A;  4PFF A;  4CBS A;  2ZJG A;  5BJ4 A;  1JF9 A;  1XI9 A;  2PB2 A;  4WXF A;  3DZZ A;  4A00 A;  3F6T A;  1IX6 A;  4ATP A;  2FKI A;  2CST A;  3IF2 A;  4RM1 A;  4W8I A;  2VMV A;  3HVY A;  1AJR A;  4MGR A;  1J04 A;  2C81 A;  4KAM A;  3H14 A;  1GEW A;  4IXS A;  3DRD A;  2W8U A;  4DGT A;  1YIY A;  2Z9V A;  1W7M A;  4XQ2 A;  5TF5 A;  5D5S A;  1C9C A;  3MKJ A;  4PVF A;  5FT5 A;  2FYF A;  3CBF A;  3EIA A;  1I48 A;  4GDY A;  3R9A A;  3ATH A;  3B46 A;  2HUI A;  1D7V A;  1KMK A;  1AKA A;  1ELQ A;  1C7G A;  1CS1 A;  4F5I A;  2CB1 A;  4WB0 A;  1OXP A;  1AY8 A;  3EI8 A;  1V2D A;  1GC3 A;  1GDE A;  1WYV A;  3FKD A;  3AEJ C;  1S09 A;  1AHE A;  4A0H A;  3E2Z B;  1ASN A;  2BHX A;  1ASB A;  2AY1 A;  4NOG A;  3DXV A;  1GCK A;  2QSR A;  1DFO A;  5EAA A;  2AY7 A;  3HLM A;  1DJU A;  1LC5 A;  1AKC A;  2QB2 A;  2ZSM A;  3PDB B;  3RQ1 A;  3K28 A;  1M0O A;  2VGU A;  4P7Y A;  1V2E A;  4IXO A;  2W7L A;  2HOR A;  1WYU B;  2OGE A;  2ORD A;  3QI6 A;  4JF1 A;  4JEZ A;  2BWO A;  3EZS A;  3E2F A;  3MEB A;  3N4R A;  1AX4 A;  2OKK A;  1ASM A;  2YKV A;  3FQ8 A;  2W8V A;  2BI3 A;  3NYT A;  4XAU A;  4F5L A;  4W91 A;  4BHD A;  1YOO A;  3N0L A;  2QA3 A;  4EU1 A;  3NDN A;  4JF0 A;  3GZD A;  1RV4 A;  2PB0 A;  3FTB A;  3FQ7 A;  3ACZ A;  4IW7 A;  1D7U A;  4ZM3 A;  3N7N A;  3A8U X;  4DQ6 A;  1BQD A;  3VK2 A;  2BI2 A;  1ARI A;  2AY3 A;  2BYJ A;  4J8L A;  3QBO A;  4JEV A;  4ADB A;  2W7F A;  3AEL A;  5G4J A;  1TAS A;  4ITX A;  1ASL A;  1ARH A;  4LW2 A;  1Z7D A;  4EMY A;  5HXX A;  2QBT A;  4J5U A;  3WCN A;  2Z9U A;  4ADC A;  1GC2 A;  1RV3 A;  4W1V A;  2XBN A;  3F0H A;  1N2T A;  3KE3 A;  2JJG A;  1BJO A;  2V0Y A;  2X8U A;  3NU7 A;  1WKG A;  5FT6 A;  3TQX A;  3BCX A;  4R2N A;  3II0 A;  4F5M A;  2VMZ A;  2AEV A;  3TFT A;  1WYT A;  4Q31 A;  4WXG A;  4WYG A;  2VIB A;  2X3L A;  2XH1 A;  3EI9 A;  2OGA A;  1MAQ A;  2X5F A;  4DBC A;  4A6T A;  4PFN A;  3E77 A;  4Q76 A;  1ASC A;  3MAF A;  3IHJ A;  1TOG A;  1UU1 A;  4TV7 A;  4GRX A;  3B8X A;  2EZ2 A;  4W1X A;  4CVQ A;  1DTY A;  3M5U A;  3R4T A;  5EAV A;  4IYO B;  4MKK A;  4MQP A;  3FRK A;  2WKA A;  3F9T A;  4E3R A;  4K2B A;  3WY7 A;  4W5K A;  3N4S A;  2EGY A;  4ATQ A;  3FFR A;  3FFH A;  2AY9 A;  1CQ7 A;  4QGR A;  2R5C B;  3GWP A;  4WYE A;  2W8W A;  3W1J A;  3PA9 A;  1AY4 A;  4Y0I A;  1AIC A;  5G2P A;  5M46 A;  1WST A;  3TFU A;  3VK4 A;  4UHN A;  3AAT A;  4OYT A;  1M4N A;  3AEN A;  1DGD A;  2R5E A;  2FNU A;  3JW9 A;  1TOK A;  3E2Z A;  2FM1 A;  3BN1 A;  1MAP A;  1SZU A;  4N0B A;  1Y4I A;  1AJS B;  1SZS A;  1YNU A;  1G4V A;  2V1P A;  2JIS A;  3E6G A;  1G4X A;  3EI5 A;  4M2M A;  2VMU A;  1S0A A;  5HDM A;  4ZAS A;  4AO9 A;  1ZOD A;  1VEF A;  2Z9W A;  4WD2 A;  2BYL A;  2CIN A;  1MDZ A;  1AAM A;  3WZF A;  3RBF A;  1YIZ A;  1PMM A;  1RVU A;  3FDB A;  2YKY A;  2VYC A;  3NUI A;  4KYO A;  3B1C A;  4ITG A;  3PD6 B;  4OBV A;  3W1I A;  2C7T A;  2GB3 A;  1KMJ A;  2W7D A;  4OBU A;  1B4X A;  4AO4 A;  1ECX A;  2BI1 A;  2YOB A;  4GEB A;  2W7G A;  1JG8 A;  2E54 A;  1IX7 A;  1H1C A;  1KKJ A;  4ZWV A;  2WK9 A;  2FQ6 A;  4A0G A;  2D64 A;  1CQ6 A;  1M6S A;  2CTZ A;  1M32 A;  1ART A;  2HP1 A;  1TAT A;  4K2I A;  3ELP A;  4F5H A;  3ZZK A;  4OCA A;  5AX8 A;  4ZAH A;  3W1H A;  4ZDO A;  1MGV A;  1GC4 A;  3N4X A;  2D5Y A;  4XEW A;  4E3Q A;  3NU8 A;  1TOJ A;  5E3K A;  5EQC A;  3FCR A;  4F5J A;  4FFC A;  1VP4 A;  1UU2 A;  3G8M A;  5HHY A;  1E5F A;  1TOI A;  5EUN A;  3RCH A;  4ZDP A;  3QM2 A;  5FT8 A;  4F5K A;  4WYD A;  3HT4 A;  1M0Q A;  3BV0 A;  4TN4 A;  1WYT B;  3JTX A;  1I43 A;  3NNK A;  2CH1 A;  1BJN A;  1G7X A;  1SZK A;  4AZK A;  3FD0 A;  1I41 A;  1ASD A;  1ASF A;  2Z1Z A;  5DX5 A;  1B8G A;  1SF2 A;  2VGW A;  1JS3 A;  3DC1 A;  1B5O A;  2W7E A;  3BCB A;  3G0T A;  1C7N A;  1SFF A;  1D2F A;  5M4D A;  1V72 A;  3TAT A;  1S08 A;  4IYO A;  1TOE A;  1ORD A;  1U08 A;  2YHK A;  3A2B A;  4F5G A;  1ARG A;  3LG0 A;  1C7O A;  1BQA A;  2O0R A;  2AY5 A;  2Z61 A;  4RJY A;  3NYU A;  4B9B A;  4WB0 B;  3FZ6 A;  3E9K A;  2BIG A;  2VMS A;  1X2A A;  3NYS A;  4WP0 A;  2Q7W A;  1IUG A;  4LNJ A;  2JJE A;  1DJ9 A;  2FN6 A;  4P3M A;  4A72 A;  3VAX A;  1QIS A;  1W7N A;  3D6K A;  4BMK A;  2W8J A;  1O61 A;  4LC3 A;  1M0N A;  2VGZ A;  5EIG B;  2PO3 A;  2AY2 A;  2D63 A;  3AEN B;  4M2J A;  4OMA A;  1JS6 A;  4JEX A;  3LWS A;  2QLR A;  3AEP A;  2OKJ A;  1V2F A;  2DOU A;  3PDB A;  2VGT A;  1AHF A;  4OT8 A;  1OHW A;  3A9Z A;  3I16 A;  3AEJ A;  3L44 A;  4RKC A;  1QGN A;  1IVR A;  1ASG A;  1B9H A;  1P3W A;  3DR4 A;  3BWN A;  3NUB A;  4ADD A;  4JEY A;  3ISL A;  4KXK A;  2E7J A;  3ZZJ A;  4R5F A;  3P6K A;  3MAU A;  2HOZ A;  1EJI A;  2YCT A;  2WB6 A;  1GEY A;  3FDD A;  4XK1 A;  4E77 A;  4HVK A;  2R2N A;  9AAT A;  4L0O A;  2AEU A;  3WX9 A;  3FVS A;  1M7Y A;  5J8Q A;  1GBN A;  7AAT A;  3A9X A;  1WKH A;  1QIT A;  4A0R A;  3E2Y A;  1H0C A;  2D7Z A;  2VMR A;  1G7W A;  3DOD A;  2CJH A;  4WLH A;  4BQ0 A;  2G6W A;  2JJF A;  3JU7 A;  4RIZ A;  3ZRQ A;  2AY6 A;  2HP2 A;  1MDO A;  4LW4 A;  4TMR A;  2CJD A;  3HQT A;  3I5T A;  3LVL B;  5BJ3 A;  3PIU A;  4M2K A;  2QMA A;  3LY1 A;  4FL0 A;  3GR9 A;  2E7I A;  4Y0H A;  1ELU A;  3FZ8 A;  4RLG A;  1QZ9 A;  4WYC A;  3MC6 A;  1C4K A;  4A6U A;  5M49 A;  1EG5 A;  1BJO B;  2VMY A;  4UOY A;  5DJ9 A;  1T3I A;  1ZC9 A;  1CQ8 A;  2DKB A;  2EO5 A;  3PPL A;  4GSA A;  3L8A A;  2DR1 A;  3KGX A;  3QPG A;  1QIR A;  2AY8 A;  2DGK A;  3EUC A;  5EIG A;  2W8T A;  1O4S A;  2VLH A;  4B98 A;  3CQ6 A;  2VI8 A;  1O69 A;  4RKD A;  5DJ1 A;  3JZL A;  5G4I A;  4F4E A; 
#chains in the Genus database with same CATH homology
 1SPA A;  1MLZ A;  4MKJ A;  2F8J A;  1XEY A;  3PAA A;  5DB5 A;  5G2Q A;  4ZSW A;  2YRR A;  5EUD A;  2YCP A;  4WYF A;  1AIB A;  2WK8 A;  1DKA A;  3HL2 A;  5IWQ A;  5E4Z A;  3EZ1 A;  2ZC0 A;  3NRA A;  2ZY5 A;  2C0R A;  2VMP A;  2EH6 A;  2ZSL A;  1RVY A;  3UAK A;  2EYQ A;  2JGT A;  1TAR A;  1VJO A;  2BI5 A;  2JJH A;  3DU4 A;  5E5I A;  4GE9 A;  2ZY2 A;  3AOW A;  3NX3 A;  1LS3 A;  2W7H A;  1BW0 A;  1J32 A;  2AAT A;  3WGC A;  4CXR A;  3K40 A;  4IXZ A;  2GQN A;  1CL1 A;  5G09 A;  2Z1Y A;  4ZWM A;  2Z20 A;  2VMX A;  3N5M A;  4H51 A;  4AOA A;  1CL2 A;  5I92 A;  1CZE A;  2CH2 A;  4U1T A;  4I8A A;  1M0P A;  4UHM A;  1AHY A;  4MSO A;  3EIB A;  3CQ4 A;  3UWC A;  1AMS A;  3QGU A;  3WKR A;  1LW4 A;  1BS0 A;  4K05 A;  2GMU A;  2VMO A;  1QJ3 A;  2WK7 A;  3CQ5 A;  4CBR A;  1ARS A;  1W23 A;  3PDX A;  1LC7 A;  2D65 A;  3I4J A;  2X5D A;  4O6Z A;  1DJE A;  5FT4 A;  4AH3 A;  1AMQ A;  3MBB A;  1O62 A;  1KL1 A;  2TPL A;  2VMQ A;  1BT4 A;  4JE5 A;  1UU0 A;  4LNL A;  3H7F A;  3CAI A;  1C0N A;  1LW5 A;  1MLY A;  1WYU A;  1IX8 A;  3PD6 A;  1LC8 A;  2ZUK A;  4EFF A;  1OHY A;  3COG A;  4H63 Q;  4IY7 A;  1FC4 A;  1FG7 A;  2D61 A;  2DKJ A;  2GMS A;  4JEW A;  3ELE A;  1IJI A;  5LHA A;  1PG8 A;  3ZRP A;  2C44 A;  5EUE A;  4RAE A;  2EZ1 A;  4EB5 A;  1SVV A;  1PMO A;  1AIA A;  1UKJ A;  2RFV A;  4GE7 A;  3DYD A;  3BS8 A;  1AHX A;  5D95 A;  5C6U A;  1X28 A;  3FQA A;  3JWB A;  2KFP A;  1IBJ A;  3GZC A;  3RI6 A;  3JWA A;  3ECD A;  1B5P A;  1OXO A;  4K2M A;  1AKB A;  3UE8 A;  3H9X A;  2BIE A;  3AV7 A;  2O1B A;  2Z67 A;  1KL2 A;  1MDX A;  2VGS A;  2YKX A;  1D7S A;  3VP6 A;  2CY8 A;  1WYV B;  2BIA A;  3TCM A;  4W1W A;  5KTB A;  4UHO A;  3Q8N A;  4ZLV A;  4A6R A;  2D66 A;  1BKG A;  3FZ7 A;  3GZD C;  2W7J A;  2W7K A;  2W7M A;  3GBX A;  4U2H A;  5F8V A;  2VIA A;  3WKS A;  2NMP A;  4IX8 A;  3MC6 C;  1BJ4 A;  1AAW A;  4Y0D A;  4MY5 A;  3OKS A;  4BA5 A;  3WLX A;  2OAT A;  1W7L A;  3USF A;  4OTL A;  3QN6 A;  1B9I A;  1S06 A;  3AEM C;  2BKW A;  3N75 A;  4WBT A;  4XJP A;  4LNM A;  1AMA A;  2YCN A;  1GEX A;  1AY5 A;  1ZOB A;  3B1D A;  2CAN A;  3P1T A;  3DXW A;  2Z9X A;  2A1V A;  1CZC A;  4ISY A;  4E1O A;  4XJL A;  3HDO A;  3OP7 A;  3A9Y A;  1QJ5 A;  3LVM A;  2HUF A;  1AMR A;  2ZYJ A;  1YJZ A;  1DGE A;  2HOY A;  1TPL A;  1YAA A;  1W3U A;  3GSB A;  4ADE A;  3LV2 A;  1OAT A;  2O7C A;  2W7I A;  3EI6 A;  2ZY3 A;  1N31 A;  1FG3 A;  3WCO A;  1LK9 A;  3K7Y A;  2VGV A;  4XJM A;  4F5F A;  2VMN A;  1EQB A;  1BJW A;  3LVK A;  1Z3Z A;  4R5Z A;  5JAY A;  5M4B A;  4JE5 D;  3AEO A;  3BC8 A;  1LKC A;  2OQX A;  1N8P A;  4R8D A;  2BI9 A;  2DGM A;  5F9S A;  1X0M A;  2D7Y A;  3ZRR A;  1X29 A;  4GE4 A;  4ZSY A;  5G0A A;  3GET A;  3NTJ A;  3VK3 A;  2EPJ A;  4ZM4 A;  2GSA A;  3G7Q A;  1YJS A;  3KKI A;  2FNI A;  3DR7 A;  2QB3 A;  3FVU A;  3HMU A;  3RUY A;  1KKP A;  2R0T A;  4XJO A;  3PJ0 A;  4Q75 A;  2VMW A;  3MAF B;  4UQV A;  4N0W A;  2VLF A;  2HOX A;  3BCA A;  2YRI A;  3LVJ A;  3T32 A;  3ASB A;  3KGW A;  4Q6R A;  3BWN C;  1D7R A;  5EFS A;  3BWO A;  4A0F A;  4RIT A;  4AZJ A;  5LH9 A;  1ASE A;  2E7U A;  3EI7 A;  2ZP7 A;  3FVX A;  8AAT A;  2ZY4 A;  1I29 A;  3AEM A;  2CJG A;  2VI9 A;  3BB8 A;  1CJ0 A;  3GJU A;  1PFF A;  1GD9 A;  5K8B A;  3QHX A;  4RJ0 A;  2R5C A;  2AY4 A;  2JG2 A;  1OHV A;  1AHG A;  1IAX A;  3RBL A;  1YJY A;  2CFB A;  3AOV A;  2BWN A;  3WGB A;  4MQQ A;  1IAY A;  4OC9 A;  4MQR A;  1GC0 A;  4EB7 A;  1ASA A;  2DGL A;  3MAD A;  2HUU A;  4CXQ A;  4HF8 A;  4WXB A;  3HBX A;  4WYA A;  4BA4 A;  3PGY A;  3B1E A;  2VMT A;  1E5E A;  4ZDL A;  2G7J A;  2HZP A;  1AJS A;  3FSL A;  4PIW A;  4WLJ A;  3RCH B;  2YKU A;  3VOM A;  2BWP A;  1S07 A;  3ASA A;  4PFF A;  4CBS A;  2ZJG A;  5BJ4 A;  1JF9 A;  1XI9 A;  2PB2 A;  4WXF A;  3DZZ A;  4A00 A;  3F6T A;  1IX6 A;  4ATP A;  2FKI A;  2CST A;  3IF2 A;  4RM1 A;  4W8I A;  2VMV A;  3HVY A;  1AJR A;  4MGR A;  1J04 A;  2C81 A;  4KAM A;  3H14 A;  1GEW A;  4IXS A;  3DRD A;  2W8U A;  4DGT A;  1YIY A;  2Z9V A;  1W7M A;  4XQ2 A;  5TF5 A;  5D5S A;  1C9C A;  3MKJ A;  4PVF A;  5FT5 A;  2FYF A;  3CBF A;  3EIA A;  1I48 A;  4GDY A;  3R9A A;  3ATH A;  3B46 A;  2HUI A;  1D7V A;  1KMK A;  1AKA A;  1ELQ A;  1C7G A;  1CS1 A;  4F5I A;  2CB1 A;  4WB0 A;  1OXP A;  1AY8 A;  3EI8 A;  1V2D A;  1GC3 A;  1GDE A;  1WYV A;  3FKD A;  3AEJ C;  1S09 A;  1AHE A;  4A0H A;  3E2Z B;  1ASN A;  2BHX A;  1ASB A;  2AY1 A;  4NOG A;  3DXV A;  1GCK A;  2QSR A;  1DFO A;  5EAA A;  2AY7 A;  3HLM A;  1DJU A;  1LC5 A;  1AKC A;  2QB2 A;  2ZSM A;  3PDB B;  3RQ1 A;  3K28 A;  1M0O A;  2VGU A;  4P7Y A;  1V2E A;  4IXO A;  2W7L A;  2HOR A;  1WYU B;  2OGE A;  2ORD A;  3QI6 A;  4JF1 A;  4JEZ A;  2BWO A;  3EZS A;  3E2F A;  3MEB A;  3N4R A;  1AX4 A;  2OKK A;  1ASM A;  2YKV A;  3FQ8 A;  2W8V A;  2BI3 A;  3NYT A;  4XAU A;  4F5L A;  4W91 A;  4BHD A;  1YOO A;  3N0L A;  2QA3 A;  4EU1 A;  3NDN A;  4JF0 A;  3GZD A;  1RV4 A;  2PB0 A;  3FTB A;  3FQ7 A;  3ACZ A;  4IW7 A;  1D7U A;  4ZM3 A;  3N7N A;  3A8U X;  4DQ6 A;  1BQD A;  3VK2 A;  2BI2 A;  1ARI A;  2AY3 A;  2BYJ A;  4J8L A;  3QBO A;  4JEV A;  4ADB A;  2W7F A;  3AEL A;  5G4J A;  1TAS A;  4ITX A;  1ASL A;  1ARH A;  4LW2 A;  1Z7D A;  4EMY A;  5HXX A;  2QBT A;  4J5U A;  3WCN A;  2Z9U A;  4ADC A;  1GC2 A;  1RV3 A;  4W1V A;  2XBN A;  3F0H A;  1N2T A;  3KE3 A;  2JJG A;  1BJO A;  2V0Y A;  2X8U A;  3NU7 A;  1WKG A;  5FT6 A;  3TQX A;  3BCX A;  4R2N A;  3II0 A;  4F5M A;  2VMZ A;  2AEV A;  3TFT A;  1WYT A;  4Q31 A;  4WXG A;  4WYG A;  2VIB A;  2X3L A;  2XH1 A;  3EI9 A;  2OGA A;  1MAQ A;  2X5F A;  4DBC A;  4A6T A;  4PFN A;  3E77 A;  4Q76 A;  1ASC A;  3MAF A;  3IHJ A;  1TOG A;  1UU1 A;  4TV7 A;  4GRX A;  3B8X A;  2EZ2 A;  4W1X A;  4CVQ A;  1DTY A;  3M5U A;  3R4T A;  5EAV A;  4IYO B;  4MKK A;  4MQP A;  3FRK A;  2WKA A;  3F9T A;  4E3R A;  4K2B A;  3WY7 A;  4W5K A;  3N4S A;  2EGY A;  4ATQ A;  3FFR A;  3FFH A;  2AY9 A;  1CQ7 A;  4QGR A;  2R5C B;  3GWP A;  4WYE A;  2W8W A;  3W1J A;  3PA9 A;  1AY4 A;  4Y0I A;  1AIC A;  5G2P A;  5M46 A;  1WST A;  3TFU A;  3VK4 A;  4UHN A;  3AAT A;  4OYT A;  1M4N A;  3AEN A;  1DGD A;  2R5E A;  2FNU A;  3JW9 A;  1TOK A;  3E2Z A;  2FM1 A;  3BN1 A;  1MAP A;  1SZU A;  4N0B A;  1Y4I A;  1AJS B;  1SZS A;  1YNU A;  1G4V A;  2V1P A;  2JIS A;  3E6G A;  1G4X A;  3EI5 A;  4M2M A;  2VMU A;  1S0A A;  5HDM A;  4ZAS A;  4AO9 A;  1ZOD A;  1VEF A;  2Z9W A;  4WD2 A;  2BYL A;  2CIN A;  1MDZ A;  1AAM A;  3WZF A;  3RBF A;  1YIZ A;  1PMM A;  1RVU A;  3FDB A;  2YKY A;  2VYC A;  3NUI A;  4KYO A;  3B1C A;  4ITG A;  3PD6 B;  4OBV A;  3W1I A;  2C7T A;  2GB3 A;  1KMJ A;  2W7D A;  4OBU A;  1B4X A;  4AO4 A;  1ECX A;  2BI1 A;  2YOB A;  4GEB A;  2W7G A;  1JG8 A;  2E54 A;  1IX7 A;  1H1C A;  1KKJ A;  4ZWV A;  2WK9 A;  2FQ6 A;  4A0G A;  2D64 A;  1CQ6 A;  1M6S A;  2CTZ A;  1M32 A;  1ART A;  2HP1 A;  1TAT A;  4K2I A;  3ELP A;  4F5H A;  3ZZK A;  4OCA A;  5AX8 A;  4ZAH A;  3W1H A;  4ZDO A;  1MGV A;  1GC4 A;  3N4X A;  2D5Y A;  4XEW A;  4E3Q A;  3NU8 A;  1TOJ A;  5E3K A;  5EQC A;  3FCR A;  4F5J A;  4FFC A;  1VP4 A;  1UU2 A;  3G8M A;  5HHY A;  1E5F A;  1TOI A;  5EUN A;  3RCH A;  4ZDP A;  3QM2 A;  5FT8 A;  4F5K A;  4WYD A;  3HT4 A;  1M0Q A;  3BV0 A;  4TN4 A;  1WYT B;  3JTX A;  1I43 A;  3NNK A;  2CH1 A;  1BJN A;  1G7X A;  1SZK A;  4AZK A;  3FD0 A;  1I41 A;  1ASD A;  1ASF A;  2Z1Z A;  5DX5 A;  1B8G A;  1SF2 A;  2VGW A;  1JS3 A;  3DC1 A;  1B5O A;  2W7E A;  3BCB A;  3G0T A;  1C7N A;  1SFF A;  1D2F A;  5M4D A;  1V72 A;  3TAT A;  1S08 A;  4IYO A;  1TOE A;  1ORD A;  1U08 A;  2YHK A;  3A2B A;  4F5G A;  1ARG A;  3LG0 A;  1C7O A;  1BQA A;  2O0R A;  2AY5 A;  2Z61 A;  4RJY A;  3NYU A;  4B9B A;  4WB0 B;  3FZ6 A;  3E9K A;  2BIG A;  2VMS A;  1X2A A;  3NYS A;  4WP0 A;  2Q7W A;  1IUG A;  4LNJ A;  2JJE A;  1DJ9 A;  2FN6 A;  4P3M A;  4A72 A;  3VAX A;  1QIS A;  1W7N A;  3D6K A;  4BMK A;  2W8J A;  1O61 A;  4LC3 A;  1M0N A;  2VGZ A;  5EIG B;  2PO3 A;  2AY2 A;  2D63 A;  3AEN B;  4M2J A;  4OMA A;  1JS6 A;  4JEX A;  3LWS A;  2QLR A;  3AEP A;  2OKJ A;  1V2F A;  2DOU A;  3PDB A;  2VGT A;  1AHF A;  4OT8 A;  1OHW A;  3A9Z A;  3I16 A;  3AEJ A;  3L44 A;  4RKC A;  1QGN A;  1IVR A;  1ASG A;  1B9H A;  1P3W A;  3DR4 A;  3BWN A;  3NUB A;  4ADD A;  4JEY A;  3ISL A;  4KXK A;  2E7J A;  3ZZJ A;  4R5F A;  3P6K A;  3MAU A;  2HOZ A;  1EJI A;  2YCT A;  2WB6 A;  1GEY A;  3FDD A;  4XK1 A;  4E77 A;  4HVK A;  2R2N A;  9AAT A;  4L0O A;  2AEU A;  3WX9 A;  3FVS A;  1M7Y A;  5J8Q A;  1GBN A;  7AAT A;  3A9X A;  1WKH A;  1QIT A;  4A0R A;  3E2Y A;  1H0C A;  2D7Z A;  2VMR A;  1G7W A;  3DOD A;  2CJH A;  4WLH A;  4BQ0 A;  2G6W A;  2JJF A;  3JU7 A;  4RIZ A;  3ZRQ A;  2AY6 A;  2HP2 A;  1MDO A;  4LW4 A;  4TMR A;  2CJD A;  3HQT A;  3I5T A;  3LVL B;  5BJ3 A;  3PIU A;  4M2K A;  2QMA A;  3LY1 A;  4FL0 A;  3GR9 A;  2E7I A;  4Y0H A;  1ELU A;  3FZ8 A;  4RLG A;  1QZ9 A;  4WYC A;  3MC6 A;  1C4K A;  4A6U A;  5M49 A;  1EG5 A;  1BJO B;  2VMY A;  4UOY A;  5DJ9 A;  1T3I A;  1ZC9 A;  1CQ8 A;  2DKB A;  2EO5 A;  3PPL A;  4GSA A;  3L8A A;  2DR1 A;  3KGX A;  3QPG A;  1QIR A;  2AY8 A;  2DGK A;  3EUC A;  5EIG A;  2W8T A;  1O4S A;  2VLH A;  4B98 A;  3CQ6 A;  2VI8 A;  1O69 A;  4RKD A;  5DJ1 A;  3JZL A;  5G4I A;  4F4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...