2QB6A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, sulfate complex
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
393
structure length
393
Chain Sequence
b'RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exopolyphosphatase
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
total genus 143
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb6A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb6A01
1K23A 2QB7A 4RPAA 2EB0A 1WPNA 2IW4A 2QB8A 1WPMA 1WPPA 1K20A 3DEVA 3W5WA 2QB6A 2ENXA 1I74A 4PY9A 4LS9A 2HAWA
chains in the Genus database with same CATH superfamily
2QB7A 3FVEA 4FC5A 3PVHA 1U1VA 5IWEA 5GL3A 2GKJA 2KW7A 1U1XA 3G7KA 2EB0A 4OA3A 5HA4A 1BWZA 4JBDA 4JCIA 1U1WA 1T6KA 4LS9A 4JUUA 2IW4A 5ANPA 1GQZA 5GL4A 1XUAA 5H2GA 1WPPA 3EKMA 3G98A 3PW9A 1YM5A 2QB6A 4DWZA 3DEVA 2ZXPA 2PW0A 2QB8A 4GL6A 1S7JA 1IR6A 2AZPA 1K23A 4RPAA 1TM0A 1K20A 3ICJA 4Q2HA 4LB0A 1WPMA 2Q9JA 2MPBA 4JD7A 1W61A 2PVZA 2ZXRA 5GKXA 5GL2A 2KPTA 1WPNA 4LG3A 4J9WA 2ZXOA 3PTJA 1I74A 2HAWA 5M47A 3EDNA 3EJXA 2ZVFA 4K7XA 2YMAA 3IGHX 2ENXA 4J9XA 3W5WA 3WQZA 1QY9A 2Q9HA 1QYAA 1W62A 4PY9A 2LT2A 2H9FA 4Q60A 4IJZA 4IK0A 1U0KA 5H2YA 1SDJA 4K7GB 4K8LA 2GKEA 2OTNA 4DUNA 1XUBA
chains in the Genus database with same CATH topology
2QB7A 3FVEA 4FC5A 3PVHA 1U1VA 5IWEA 5GL3A 2GKJA 2KW7A 1U1XA 3G7KA 2EB0A 4OA3A 5HA4A 1BWZA 4JBDA 4JCIA 1U1WA 1T6KA 4LS9A 4JUUA 2IW4A 5ANPA 1GQZA 5GL4A 1XUAA 5H2GA 1WPPA 3EKMA 3G98A 3PW9A 1YM5A 2QB6A 4DWZA 3DEVA 2ZXPA 2PW0A 2QB8A 4GL6A 1S7JA 1IR6A 2AZPA 1K23A 4RPAA 1TM0A 1K20A 3ICJA 4Q2HA 4LB0A 1WPMA 2Q9JA 2MPBA 4JD7A 1W61A 2PVZA 2ZXRA 5GKXA 5GL2A 2KPTA 1WPNA 4LG3A 4J9WA 2ZXOA 3PTJA 1I74A 2HAWA 5M47A 3EDNA 3EJXA 2ZVFA 4K7XA 2YMAA 3IGHX 2ENXA 4J9XA 3W5WA 3WQZA 1QY9A 2Q9HA 1QYAA 1W62A 4PY9A 2LT2A 2H9FA 4Q60A 4IJZA 4IK0A 1U0KA 5H2YA 1SDJA 4K7GB 4K8LA 2GKEA 2OTNA 4DUNA 1XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K23 A;  2QB7 A;  4RPA A;  2EB0 A;  1WPN A;  2IW4 A;  2QB8 A;  1WPM A;  1WPP A;  1K20 A;  3DEV A;  3W5W A;  2QB6 A;  2ENX A;  1I74 A;  4PY9 A;  4LS9 A;  2HAW A; 
#chains in the Genus database with same CATH topology
 2QB7 A;  3FVE A;  4FC5 A;  3PVH A;  1U1V A;  5IWE A;  5GL3 A;  2GKJ A;  2KW7 A;  1U1X A;  3G7K A;  2EB0 A;  4OA3 A;  5HA4 A;  1BWZ A;  4JBD A;  4JCI A;  1U1W A;  1T6K A;  4LS9 A;  4JUU A;  2IW4 A;  5ANP A;  1GQZ A;  5GL4 A;  1XUA A;  5H2G A;  1WPP A;  3EKM A;  3G98 A;  3PW9 A;  1YM5 A;  2QB6 A;  4DWZ A;  3DEV A;  2ZXP A;  2PW0 A;  2QB8 A;  4GL6 A;  1S7J A;  1IR6 A;  2AZP A;  1K23 A;  4RPA A;  1TM0 A;  1K20 A;  3ICJ A;  4Q2H A;  4LB0 A;  1WPM A;  2Q9J A;  2MPB A;  4JD7 A;  1W61 A;  2PVZ A;  2ZXR A;  5GKX A;  5GL2 A;  2KPT A;  1WPN A;  4LG3 A;  4J9W A;  2ZXO A;  3PTJ A;  1I74 A;  2HAW A;  5M47 A;  3EDN A;  3EJX A;  2ZVF A;  4K7X A;  2YMA A;  3IGH X;  2ENX A;  4J9X A;  3W5W A;  3WQZ A;  1QY9 A;  2Q9H A;  1QYA A;  1W62 A;  4PY9 A;  2LT2 A;  2H9F A;  4Q60 A;  4IJZ A;  4IK0 A;  1U0K A;  5H2Y A;  1SDJ A;  4K7G B;  4K8L A;  2GKE A;  2OTN A;  4DUN A;  1XUB A; 
#chains in the Genus database with same CATH homology
 2QB7 A;  3FVE A;  4FC5 A;  3PVH A;  1U1V A;  5IWE A;  5GL3 A;  2GKJ A;  2KW7 A;  1U1X A;  3G7K A;  2EB0 A;  4OA3 A;  5HA4 A;  1BWZ A;  4JBD A;  4JCI A;  1U1W A;  1T6K A;  4LS9 A;  4JUU A;  2IW4 A;  5ANP A;  1GQZ A;  5GL4 A;  1XUA A;  5H2G A;  1WPP A;  3EKM A;  3G98 A;  3PW9 A;  1YM5 A;  2QB6 A;  4DWZ A;  3DEV A;  2ZXP A;  2PW0 A;  2QB8 A;  4GL6 A;  1S7J A;  1IR6 A;  2AZP A;  1K23 A;  4RPA A;  1TM0 A;  1K20 A;  3ICJ A;  4Q2H A;  4LB0 A;  1WPM A;  2Q9J A;  2MPB A;  4JD7 A;  1W61 A;  2PVZ A;  2ZXR A;  5GKX A;  5GL2 A;  2KPT A;  1WPN A;  4LG3 A;  4J9W A;  2ZXO A;  3PTJ A;  1I74 A;  2HAW A;  5M47 A;  3EDN A;  3EJX A;  2ZVF A;  4K7X A;  2YMA A;  3IGH X;  2ENX A;  4J9X A;  3W5W A;  3WQZ A;  1QY9 A;  2Q9H A;  1QYA A;  1W62 A;  4PY9 A;  2LT2 A;  2H9F A;  4Q60 A;  4IJZ A;  4IK0 A;  1U0K A;  5H2Y A;  1SDJ A;  4K7G B;  4K8L A;  2GKE A;  2OTN A;  4DUN A;  1XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...