2QB6A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, sulfate complex
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Exopolyphosphatase
total genus 143
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb6A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb6A01
1K20A 2QB7A 2ENXA 3DEVA 1WPMA 1WPNA 3W5WA 1I74A 2EB0A 4RPAA 4PY9A 1K23A 1WPPA 2HAWA 2IW4A 2QB6A 2QB8A 4LS9A
chains in the Genus database with same CATH superfamily
2Q9JA 2PW0A 4GL6A 1K23A 4JD7A 2KPTA 2ZXRA 1QY9A 1BWZA 3IGHX 5M47A 4DUNA 4FC5A 5IWEA 1XUAA 4LB0A 4K7XA 1U1WA 1SDJA 4Q2HA 4Q60A 3EJXA 5GL4A 3PW9A 3EDNA 1WPPA 1XUBA 5GKXA 5ANPA 1WPNA 3W5WA 1S7JA 2KW7A 2YMAA 2ZVFA 2PVZA 4J9XA 2QB6A 3EKMA 2OTNA 2HAWA 4JBDA 4LG3A 2Q9HA 3PVHA 1U1VA 1IR6A 3G98A 1U0KA 1U1XA 4K7GB 2QB8A 3PTJA 1QYAA 4J9WA 5HA4A 2ENXA 2EB0A 2GKJA 4IK0A 5GL2A 1WPMA 1I74A 2ZXOA 1W61A 4JUUA 5H2YA 2AZPA 5GL3A 1W62A 4OA3A 3ICJA 2H9FA 1GQZA 2QB7A 3DEVA 4JCIA 3FVEA 1TM0A 1K20A 3WQZA 4K8LA 4PY9A 3G7KA 1T6KA 2IW4A 2LT2A 2MPBA 4DWZA 1YM5A 2ZXPA 4RPAA 2GKEA 5H2GA 4IJZA 4LS9A
chains in the Genus database with same CATH topology
2Q9JA 2PW0A 4GL6A 1K23A 4JD7A 2KPTA 2ZXRA 1QY9A 1BWZA 3IGHX 5M47A 4DUNA 4FC5A 5IWEA 1XUAA 4LB0A 4K7XA 1U1WA 1SDJA 4Q2HA 4Q60A 3EJXA 5GL4A 3PW9A 3EDNA 1WPPA 1XUBA 5GKXA 5ANPA 1WPNA 3W5WA 1S7JA 2KW7A 2YMAA 2ZVFA 2PVZA 4J9XA 2QB6A 3EKMA 2OTNA 2HAWA 4JBDA 4LG3A 2Q9HA 3PVHA 1U1VA 1IR6A 3G98A 1U0KA 1U1XA 4K7GB 2QB8A 3PTJA 1QYAA 4J9WA 5HA4A 2ENXA 2EB0A 2GKJA 4IK0A 5GL2A 1WPMA 1I74A 2ZXOA 1W61A 4JUUA 5H2YA 2AZPA 5GL3A 1W62A 4OA3A 3ICJA 2H9FA 1GQZA 2QB7A 3DEVA 4JCIA 3FVEA 1TM0A 1K20A 3WQZA 4K8LA 4PY9A 3G7KA 1T6KA 2IW4A 2LT2A 2MPBA 4DWZA 1YM5A 2ZXPA 4RPAA 2GKEA 5H2GA 4IJZA 4LS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K20 A;  2QB7 A;  2ENX A;  3DEV A;  1WPM A;  1WPN A;  3W5W A;  1I74 A;  2EB0 A;  4RPA A;  4PY9 A;  1K23 A;  1WPP A;  2HAW A;  2IW4 A;  2QB6 A;  2QB8 A;  4LS9 A; 
#chains in the Genus database with same CATH topology
 2Q9J A;  2PW0 A;  4GL6 A;  1K23 A;  4JD7 A;  2KPT A;  2ZXR A;  1QY9 A;  1BWZ A;  3IGH X;  5M47 A;  4DUN A;  4FC5 A;  5IWE A;  1XUA A;  4LB0 A;  4K7X A;  1U1W A;  1SDJ A;  4Q2H A;  4Q60 A;  3EJX A;  5GL4 A;  3PW9 A;  3EDN A;  1WPP A;  1XUB A;  5GKX A;  5ANP A;  1WPN A;  3W5W A;  1S7J A;  2KW7 A;  2YMA A;  2ZVF A;  2PVZ A;  4J9X A;  2QB6 A;  3EKM A;  2OTN A;  2HAW A;  4JBD A;  4LG3 A;  2Q9H A;  3PVH A;  1U1V A;  1IR6 A;  3G98 A;  1U0K A;  1U1X A;  4K7G B;  2QB8 A;  3PTJ A;  1QYA A;  4J9W A;  5HA4 A;  2ENX A;  2EB0 A;  2GKJ A;  4IK0 A;  5GL2 A;  1WPM A;  1I74 A;  2ZXO A;  1W61 A;  4JUU A;  5H2Y A;  2AZP A;  5GL3 A;  1W62 A;  4OA3 A;  3ICJ A;  2H9F A;  1GQZ A;  2QB7 A;  3DEV A;  4JCI A;  3FVE A;  1TM0 A;  1K20 A;  3WQZ A;  4K8L A;  4PY9 A;  3G7K A;  1T6K A;  2IW4 A;  2LT2 A;  2MPB A;  4DWZ A;  1YM5 A;  2ZXP A;  4RPA A;  2GKE A;  5H2G A;  4IJZ A;  4LS9 A; 
#chains in the Genus database with same CATH homology
 2Q9J A;  2PW0 A;  4GL6 A;  1K23 A;  4JD7 A;  2KPT A;  2ZXR A;  1QY9 A;  1BWZ A;  3IGH X;  5M47 A;  4DUN A;  4FC5 A;  5IWE A;  1XUA A;  4LB0 A;  4K7X A;  1U1W A;  1SDJ A;  4Q2H A;  4Q60 A;  3EJX A;  5GL4 A;  3PW9 A;  3EDN A;  1WPP A;  1XUB A;  5GKX A;  5ANP A;  1WPN A;  3W5W A;  1S7J A;  2KW7 A;  2YMA A;  2ZVF A;  2PVZ A;  4J9X A;  2QB6 A;  3EKM A;  2OTN A;  2HAW A;  4JBD A;  4LG3 A;  2Q9H A;  3PVH A;  1U1V A;  1IR6 A;  3G98 A;  1U0K A;  1U1X A;  4K7G B;  2QB8 A;  3PTJ A;  1QYA A;  4J9W A;  5HA4 A;  2ENX A;  2EB0 A;  2GKJ A;  4IK0 A;  5GL2 A;  1WPM A;  1I74 A;  2ZXO A;  1W61 A;  4JUU A;  5H2Y A;  2AZP A;  5GL3 A;  1W62 A;  4OA3 A;  3ICJ A;  2H9F A;  1GQZ A;  2QB7 A;  3DEV A;  4JCI A;  3FVE A;  1TM0 A;  1K20 A;  3WQZ A;  4K8L A;  4PY9 A;  3G7K A;  1T6K A;  2IW4 A;  2LT2 A;  2MPB A;  4DWZ A;  1YM5 A;  2ZXP A;  4RPA A;  2GKE A;  5H2G A;  4IJZ A;  4LS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...