2QB6A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, sulfate complex
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Exopolyphosphatase
total genus 143
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb6A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb6A01
2IW4A 2HAWA 4RPAA 1WPNA 4LS9A 1WPMA 2ENXA 1K23A 4PY9A 2EB0A 3DEVA 2QB7A 2QB8A 1I74A 1WPPA 3W5WA 2QB6A 1K20A
chains in the Genus database with same CATH superfamily
1U0KA 2MPBA 4J9WA 5HA4A 4PY9A 4Q60A 4LG3A 3ICJA 5M47A 3WQZA 1WPPA 4J9XA 2LT2A 1WPNA 5GL3A 1YM5A 4JBDA 4DUNA 1K23A 4GL6A 3DEVA 2Q9HA 2ZXOA 2OTNA 2YMAA 1SDJA 4K8LA 4OA3A 4LB0A 3IGHX 2PW0A 4FC5A 5GL4A 1U1VA 1W62A 2Q9JA 1T6KA 2GKJA 2KPTA 1S7JA 2GKEA 2HAWA 3G7KA 2ENXA 4K7XA 2AZPA 4IJZA 4Q2HA 2H9FA 5H2YA 4LS9A 5H2GA 3FVEA 4JUUA 2ZXRA 2EB0A 2IW4A 4JD7A 4RPAA 1U1XA 1BWZA 1TM0A 3PVHA 2QB6A 3PW9A 3EDNA 2ZXPA 1W61A 1GQZA 2QB8A 1I74A 2PVZA 1K20A 1WPMA 1IR6A 5ANPA 3W5WA 2KW7A 1QYAA 1QY9A 4K7GB 5IWEA 2QB7A 1XUAA 3PTJA 5GKXA 4DWZA 1XUBA 3G98A 5GL2A 3EKMA 2ZVFA 3EJXA 4JCIA 1U1WA 4IK0A
chains in the Genus database with same CATH topology
1U0KA 2MPBA 4J9WA 5HA4A 4PY9A 4Q60A 4LG3A 3ICJA 5M47A 3WQZA 1WPPA 4J9XA 2LT2A 1WPNA 5GL3A 1YM5A 4JBDA 4DUNA 1K23A 4GL6A 3DEVA 2Q9HA 2ZXOA 2OTNA 2YMAA 1SDJA 4K8LA 4OA3A 4LB0A 3IGHX 2PW0A 4FC5A 5GL4A 1U1VA 1W62A 2Q9JA 1T6KA 2GKJA 2KPTA 1S7JA 2GKEA 2HAWA 3G7KA 2ENXA 4K7XA 2AZPA 4IJZA 4Q2HA 2H9FA 5H2YA 4LS9A 5H2GA 3FVEA 4JUUA 2ZXRA 2EB0A 2IW4A 4JD7A 4RPAA 1U1XA 1BWZA 1TM0A 3PVHA 2QB6A 3PW9A 3EDNA 2ZXPA 1W61A 1GQZA 2QB8A 1I74A 2PVZA 1K20A 1WPMA 1IR6A 5ANPA 3W5WA 2KW7A 1QYAA 1QY9A 4K7GB 5IWEA 2QB7A 1XUAA 3PTJA 5GKXA 4DWZA 1XUBA 3G98A 5GL2A 3EKMA 2ZVFA 3EJXA 4JCIA 1U1WA 4IK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW4 A;  2HAW A;  4RPA A;  1WPN A;  4LS9 A;  1WPM A;  2ENX A;  1K23 A;  4PY9 A;  2EB0 A;  3DEV A;  2QB7 A;  2QB8 A;  1I74 A;  1WPP A;  3W5W A;  2QB6 A;  1K20 A; 
#chains in the Genus database with same CATH topology
 1U0K A;  2MPB A;  4J9W A;  5HA4 A;  4PY9 A;  4Q60 A;  4LG3 A;  3ICJ A;  5M47 A;  3WQZ A;  1WPP A;  4J9X A;  2LT2 A;  1WPN A;  5GL3 A;  1YM5 A;  4JBD A;  4DUN A;  1K23 A;  4GL6 A;  3DEV A;  2Q9H A;  2ZXO A;  2OTN A;  2YMA A;  1SDJ A;  4K8L A;  4OA3 A;  4LB0 A;  3IGH X;  2PW0 A;  4FC5 A;  5GL4 A;  1U1V A;  1W62 A;  2Q9J A;  1T6K A;  2GKJ A;  2KPT A;  1S7J A;  2GKE A;  2HAW A;  3G7K A;  2ENX A;  4K7X A;  2AZP A;  4IJZ A;  4Q2H A;  2H9F A;  5H2Y A;  4LS9 A;  5H2G A;  3FVE A;  4JUU A;  2ZXR A;  2EB0 A;  2IW4 A;  4JD7 A;  4RPA A;  1U1X A;  1BWZ A;  1TM0 A;  3PVH A;  2QB6 A;  3PW9 A;  3EDN A;  2ZXP A;  1W61 A;  1GQZ A;  2QB8 A;  1I74 A;  2PVZ A;  1K20 A;  1WPM A;  1IR6 A;  5ANP A;  3W5W A;  2KW7 A;  1QYA A;  1QY9 A;  4K7G B;  5IWE A;  2QB7 A;  1XUA A;  3PTJ A;  5GKX A;  4DWZ A;  1XUB A;  3G98 A;  5GL2 A;  3EKM A;  2ZVF A;  3EJX A;  4JCI A;  1U1W A;  4IK0 A; 
#chains in the Genus database with same CATH homology
 1U0K A;  2MPB A;  4J9W A;  5HA4 A;  4PY9 A;  4Q60 A;  4LG3 A;  3ICJ A;  5M47 A;  3WQZ A;  1WPP A;  4J9X A;  2LT2 A;  1WPN A;  5GL3 A;  1YM5 A;  4JBD A;  4DUN A;  1K23 A;  4GL6 A;  3DEV A;  2Q9H A;  2ZXO A;  2OTN A;  2YMA A;  1SDJ A;  4K8L A;  4OA3 A;  4LB0 A;  3IGH X;  2PW0 A;  4FC5 A;  5GL4 A;  1U1V A;  1W62 A;  2Q9J A;  1T6K A;  2GKJ A;  2KPT A;  1S7J A;  2GKE A;  2HAW A;  3G7K A;  2ENX A;  4K7X A;  2AZP A;  4IJZ A;  4Q2H A;  2H9F A;  5H2Y A;  4LS9 A;  5H2G A;  3FVE A;  4JUU A;  2ZXR A;  2EB0 A;  2IW4 A;  4JD7 A;  4RPA A;  1U1X A;  1BWZ A;  1TM0 A;  3PVH A;  2QB6 A;  3PW9 A;  3EDN A;  2ZXP A;  1W61 A;  1GQZ A;  2QB8 A;  1I74 A;  2PVZ A;  1K20 A;  1WPM A;  1IR6 A;  5ANP A;  3W5W A;  2KW7 A;  1QYA A;  1QY9 A;  4K7G B;  5IWE A;  2QB7 A;  1XUA A;  3PTJ A;  5GKX A;  4DWZ A;  1XUB A;  3G98 A;  5GL2 A;  3EKM A;  2ZVF A;  3EJX A;  4JCI A;  1U1W A;  4IK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...