2QB6A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, sulfate complex
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exopolyphosphatase
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 143
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb6A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb6A01
1I74A 1K23A 2QB6A 2HAWA 4LS9A 2QB8A 1K20A 1WPNA 3W5WA 2IW4A 3DEVA 2EB0A 1WPPA 1WPMA 2QB7A 4RPAA 2ENXA 4PY9A
chains in the Genus database with same CATH superfamily
1I74A 4IJZA 1WPNA 5IWEA 4IK0A 4FC5A 3PVHA 5HA4A 3FVEA 1XUBA 4Q60A 5GKXA 2Q9JA 3PW9A 2ZXOA 1GQZA 2OTNA 5GL3A 5ANPA 2Q9HA 1WPPA 1U1WA 1QY9A 4DUNA 4RPAA 2YMAA 1S7JA 3EJXA 5GL4A 1TM0A 2ZXRA 3EKMA 4JUUA 1BWZA 4K7GB 4GL6A 2ZVFA 5H2YA 1YM5A 2H9FA 2GKJA 1IR6A 3EDNA 4K8LA 3G7KA 2HAWA 3WQZA 1U0KA 4PY9A 3W5WA 4J9XA 2GKEA 3PTJA 2MPBA 1W61A 2QB8A 1K23A 4OA3A 2PW0A 2ZXPA 1QYAA 1K20A 4DWZA 2IW4A 3DEVA 2LT2A 1T6KA 2EB0A 4J9WA 3G98A 4JCIA 2PVZA 2KW7A 2QB7A 2ENXA 3ICJA 4LG3A 5GL2A 5M47A 5H2GA 1XUAA 4LB0A 4Q2HA 3IGHX 1SDJA 4LS9A 1U1VA 2QB6A 4K7XA 4JD7A 1W62A 1U1XA 1WPMA 4JBDA 2AZPA 2KPTA
chains in the Genus database with same CATH topology
1I74A 4IJZA 1WPNA 5IWEA 4IK0A 4FC5A 3PVHA 5HA4A 3FVEA 1XUBA 4Q60A 5GKXA 2Q9JA 3PW9A 2ZXOA 1GQZA 2OTNA 5GL3A 5ANPA 2Q9HA 1WPPA 1U1WA 1QY9A 4DUNA 4RPAA 2YMAA 1S7JA 3EJXA 5GL4A 1TM0A 2ZXRA 3EKMA 4JUUA 1BWZA 4K7GB 4GL6A 2ZVFA 5H2YA 1YM5A 2H9FA 2GKJA 1IR6A 3EDNA 4K8LA 3G7KA 2HAWA 3WQZA 1U0KA 4PY9A 3W5WA 4J9XA 2GKEA 3PTJA 2MPBA 1W61A 2QB8A 1K23A 4OA3A 2PW0A 2ZXPA 1QYAA 1K20A 4DWZA 2IW4A 3DEVA 2LT2A 1T6KA 2EB0A 4J9WA 3G98A 4JCIA 2PVZA 2KW7A 2QB7A 2ENXA 3ICJA 4LG3A 5GL2A 5M47A 5H2GA 1XUAA 4LB0A 4Q2HA 3IGHX 1SDJA 4LS9A 1U1VA 2QB6A 4K7XA 4JD7A 1W62A 1U1XA 1WPMA 4JBDA 2AZPA 2KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I74 A;  1K23 A;  2QB6 A;  2HAW A;  4LS9 A;  2QB8 A;  1K20 A;  1WPN A;  3W5W A;  2IW4 A;  3DEV A;  2EB0 A;  1WPP A;  1WPM A;  2QB7 A;  4RPA A;  2ENX A;  4PY9 A; 
#chains in the Genus database with same CATH topology
 1I74 A;  4IJZ A;  1WPN A;  5IWE A;  4IK0 A;  4FC5 A;  3PVH A;  5HA4 A;  3FVE A;  1XUB A;  4Q60 A;  5GKX A;  2Q9J A;  3PW9 A;  2ZXO A;  1GQZ A;  2OTN A;  5GL3 A;  5ANP A;  2Q9H A;  1WPP A;  1U1W A;  1QY9 A;  4DUN A;  4RPA A;  2YMA A;  1S7J A;  3EJX A;  5GL4 A;  1TM0 A;  2ZXR A;  3EKM A;  4JUU A;  1BWZ A;  4K7G B;  4GL6 A;  2ZVF A;  5H2Y A;  1YM5 A;  2H9F A;  2GKJ A;  1IR6 A;  3EDN A;  4K8L A;  3G7K A;  2HAW A;  3WQZ A;  1U0K A;  4PY9 A;  3W5W A;  4J9X A;  2GKE A;  3PTJ A;  2MPB A;  1W61 A;  2QB8 A;  1K23 A;  4OA3 A;  2PW0 A;  2ZXP A;  1QYA A;  1K20 A;  4DWZ A;  2IW4 A;  3DEV A;  2LT2 A;  1T6K A;  2EB0 A;  4J9W A;  3G98 A;  4JCI A;  2PVZ A;  2KW7 A;  2QB7 A;  2ENX A;  3ICJ A;  4LG3 A;  5GL2 A;  5M47 A;  5H2G A;  1XUA A;  4LB0 A;  4Q2H A;  3IGH X;  1SDJ A;  4LS9 A;  1U1V A;  2QB6 A;  4K7X A;  4JD7 A;  1W62 A;  1U1X A;  1WPM A;  4JBD A;  2AZP A;  2KPT A; 
#chains in the Genus database with same CATH homology
 1I74 A;  4IJZ A;  1WPN A;  5IWE A;  4IK0 A;  4FC5 A;  3PVH A;  5HA4 A;  3FVE A;  1XUB A;  4Q60 A;  5GKX A;  2Q9J A;  3PW9 A;  2ZXO A;  1GQZ A;  2OTN A;  5GL3 A;  5ANP A;  2Q9H A;  1WPP A;  1U1W A;  1QY9 A;  4DUN A;  4RPA A;  2YMA A;  1S7J A;  3EJX A;  5GL4 A;  1TM0 A;  2ZXR A;  3EKM A;  4JUU A;  1BWZ A;  4K7G B;  4GL6 A;  2ZVF A;  5H2Y A;  1YM5 A;  2H9F A;  2GKJ A;  1IR6 A;  3EDN A;  4K8L A;  3G7K A;  2HAW A;  3WQZ A;  1U0K A;  4PY9 A;  3W5W A;  4J9X A;  2GKE A;  3PTJ A;  2MPB A;  1W61 A;  2QB8 A;  1K23 A;  4OA3 A;  2PW0 A;  2ZXP A;  1QYA A;  1K20 A;  4DWZ A;  2IW4 A;  3DEV A;  2LT2 A;  1T6K A;  2EB0 A;  4J9W A;  3G98 A;  4JCI A;  2PVZ A;  2KW7 A;  2QB7 A;  2ENX A;  3ICJ A;  4LG3 A;  5GL2 A;  5M47 A;  5H2G A;  1XUA A;  4LB0 A;  4Q2H A;  3IGH X;  1SDJ A;  4LS9 A;  1U1V A;  2QB6 A;  4K7X A;  4JD7 A;  1W62 A;  1U1X A;  1WPM A;  4JBD A;  2AZP A;  2KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...