2QBTA

Structural studies reveal the inactivation of e. coli l-aspartate aminotransferase by (s)-4,5-amino-dihydro-2-thiophenecarboxylic acid (sadta) via two mechanisms (at ph 8.0)
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
395
structure length
393
Chain Sequence
FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Inactivation of Escherichia coli l-Aspartate Aminotransferase by (S)-4-Amino-4,5-dihydro-2-thiophenecarboxylic Acid Reveals "A Tale of Two Mechanisms".
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 147
structure length 393
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2qbtA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2qbtA01
3AEMC 1SZSA 1LW5A 1KKPA 1BJOA 4W1WA 3FVXA 5JAYA 4Q76A 3AOVA 3W1IA 2AY6A 2ZSMA 4EMYA 3FVUA 1C7GA 2VMTA 4RKDA 1S08A 4ZASA 2CJHA 5BJ4A 2FNUA 3LY1A 4ITGA 2W7DA 1M0QA 2PO3A 2W7EA 3II0A 4ATPA 3CBFA 5DJ1A 1SFFA 3F9TA 4ZWMA 5E5IA 1EG5A 2BWOA 3FDBA 4A0RA 2VMRA 2W8VA 1DFOA 3LVMA 4OMAA 3WLXA 2NMPA 4B98A 3A8UX 3QI6A 4K2IA 2WKAA 4ZLVA 4TV7A 3BCXA 3E2ZB 2DR1A 3HVYA 2HOXA 2VIAA 3PD6A 2W7MA 1TOIA 2HOZA 4B9BA 3W1HA 1EQBA 3FD0A 4PFNA 3ZRPA 4XAUA 4JF0A 1AJSB 2CJGA 3FZ7A 2R5EA 4MSOA 1G4VA 1AHGA 2O0RA 4IYOA 4MKKA 5EIGB 4EU1A 1RVYA 2Q7WA 1AJRA 2X5FA 4OYTA 2ZY3A 3NYUA 1M7YA 3IF2A 2CH1A 2YRRA 3BV0A 3JW9A 4CVQA 2BIGA 4AOAA 1TOEA 5M46A 3DU4A 4O6ZA 1I48A 2OKKA 2YKYA 4KXKA 1SPAA 2VI8A 2Z20A 3AATA 1ASFA 2D64A 1IAXA 2Z9UA 3TCMA 8AATA 4ZWVA 1TASA 2Z1ZA 1PMMA 4A0FA 2VGSA 1V2EA 5EAVA 3FZ6A 3DRDA 1ZOBA 1E5EA 3EUCA 4E3QA 3WKSA 2ZYJA 3R9AA 1AY4A 7AATA 1KL2A 1IX8A 2WK8A 1OXOA 2F8JA 1B5PA 2HUUA 1ASBA 1B9IA 4A6TA 2ZJGA 5EQCA 3PAAA 3EI9A 4WXFA 1ARSA 2AEVA 1VEFA 2BI5A 3ASAA 4AO9A 3FQ7A 2OATA 1D7UA 3KKIA 4IXZA 1ORDA 3GJUA 1TPLA 2YRIA 3BCAA 1BQAA 1D7RA 2C0RA 2VGUA 4Y0DA 4JEVA 2AY5A 1CL1A 1CZEA 1WSTA 4CBRA 3ELEA 2X3LA 1BJNA 3PGYA 1AMQA 2ZY4A 3HLMA 1I43A 2R5CA 4ZSYA 1LW4A 1GC3A 1AKCA 4XEWA 3LWSA 1AHYA 3FQAA 3A9YA 1DGDA 1S0AA 4CXQA 5AX8A 3DR7A 1LC8A 2E54A 4ZDOA 2W7HA 3F6TA 2JGTA 1DJ9A 3DODA 2ZY5A 1ASLA 2VYCA 1FG3A 1KL1A 1TOKA 3FDDA 3VAXA 5TF5A 1EJIA 4E1OA 4L0OA 4PVFA 3AEOA 4W91A 2HUFA 1ECXA 4GEBA 4ISYA 4LNMA 4LNLA 1AAMA 1C7OA 2YOBA 1X2AA 5M49A 3WX9A 3GZDA 4FFCA 2OQXA 2JJHA 1DJEA 1O4SA 1ELUA 1AY8A 4MQPA 2EZ2A 3QM2A 4W5KA 1LC7A 5D5SA 2W7IA 1CQ8A 2CY8A 3PDXA 1MDZA 3AV7A 5FT4A 3CQ4A 1T3IA 4LNJA 4XQ2A 1ASDA 3B46A 3E2ZA 4MGRA 1TARA 1YAAA 3K7YA 1BKGA 2QB2A 4Q31A 5G09A 2AY3A 4M2KA 1AIBA 4WB0B 4E77A 4F5LA 2QMAA 2W8TA 4FL0A 1XEYA 4OCAA 4QGRA 3DR4A 2VMXA 2BI1A 4JF1A 1ASMA 3PA9A 2GB3A 1V72A 4U2HA 5G4IA 2YKXA 1YIZA 3NYTA 4Q6RA 4F5GA 4IXSA 1JF9A 2Z61A 1KMKA 2QB3A 2BI9A 2DGMA 1Z3ZA 3OP7A 1LKCA 4K2MA 4WD2A 4F5KA 4Y0HA 3WZFA 4A6RA 3ATHA 3BWNA 2ZY2A 1UU0A 3RBLA 3BB8A 3MAFA 3FTBA 4UHOA 1MGVA 4OT8A 5I92A 1RV3A 1Z7DA 1BJ4A 1YNUA 2DOUA 2W8UA 4WYDA 2W7KA 1CJ0A 2XH1A 3JWAA 3RI6A 4NOGA 3WKRA 1ASCA 3ELPA 1X28A 2FQ6A 3NX3A 4RJ0A 3CQ6A 5FT5A 3ECDA 4ZSWA 3QHXA 3R4TA 3PIUA 4RJYA 1QJ3A 3T32A 1C9CA 4ADEA 4P3MA 4RKCA 4JEZA 1YJSA 3KGXA 4JEXA 1DTYA 1ARGA 2YKVA 4ADBA 4JEYA 3QGUA 3WY7A 1IX6A 3USFA 4H51A 2WK9A 4TMRA 3RUYA 3AEJA 3VOMA 5FT8A 3AEPA 1JS6A 2Z9XA 1DGEA 1GC2A 4RM1A 1BJWA 3GZDC 4UHNA 3MKJA 3NUBA 4A00A 2VGVA 1IX7A 2WK7A 3MC6A 4KAMA 3H7FA 4XJOA 5K8BA 3G7QA 4XJMA 2AY9A 3GZCA 2ZSLA 1GEYA 4WYFA 4J5UA 2YHKA 1OXPA 1JS3A 4MY5A 2BYJA 3EI7A 4PIWA 4ITXA 3GWPA 1B8GA 1PMOA 1QJ5A 2VMUA 2Z9VA 3UAKA 1I41A 4R5ZA 1SVVA 2CANA 2ZUKA 2EPJA 3FCRA 1VP4A 4E3RA 4J8LA 4OTLA 3FFRA 4F4EA 2W8WA 4IW7A 2AY2A 1UKJA 2DGKA 4HVKA 1X0MA 2V1PA 1M0OA 4AZJA 4IY7A 3FSLA 1AAWA 4P7YA 1ZODA 1H0CA 4OC9A 2DKBA 3JU7A 1WYVA 1M4NA 4A0GA 3COGA 3GR9A 3TATA 2AY1A 1I29A 3BWNC 1RV4A 2OGAA 5E3KA 2FYFA 1AHFA 3CQ5A 2DGLA 3BWOA 2VMNA 1GDEA 1OHYA 3AENA 2C7TA 2D65A 2JJEA 4CXRA 4DGTA 3MEBA 3LG0A 2CJDA 1IAYA 1WYTB 3EI6A 3N5MA 1FC4A 2OGEA 1S07A 2GSAA 4WB0A 2BYLA 3H14A 3HQTA 4WYEA 2YCPA 3I16A 1LK9A 1Y4IA 2HUIA 2VMOA 4BMKA 4ZDPA 1CS1A 4K2BA 4ZM3A 2CTZA 2VGZA 4IYOB 3G0TA 1O69A 4ZM4A 1MLZA 2ZC0A 3PJ0A 4GDYA 1G4XA 2E7JA 2ZP7A 3VK3A 5C6UA 4WLJA 1W7NA 2CB1A 1AMAA 3ASBA 4N0WA 3ACZA 5LHAA 3AEJC 1KKJA 3E6GA 3EZSA 1CZCA 1GEWA 3QN6A 1D2FA 4GE9A 3TFUA 1FG7A 2XBNA 4I8AA 4IX8A 1P3WA 2EZ1A 2EH6A 1PG8A 3EIAA 3MC6C 1AHXA 3TFTA 2GQNA 4Y0IA 3JWBA 3ZRRA 1AICA 1WYUB 2PB2A 4RIZA 2VLHA 3A9ZA 3B1CA 4DQ6A 3DYDA 3NYSA 3ZZJA 1UU2A 2ORDA 3NTJA 3UWCA 1M6SA 2CFBA 3TQXA 1ARTA 5M4DA 3RBFA 3B1EA 1QIRA 2X5DA 2YKUA 4RITA 5EFSA 3NNKA 2EO5A 1UU1A 2D63A 3VK4A 3P1TA 2VMSA 3BS8A 4LC3A 5G2PA 2QLRA 2JJFA 3N0LA 4N0BA 4BHDA 4IXOA 1AJSA 3Q8NA 1TOGA 2HP1A 3LV2A 5G2QA 3PPLA 3CAIA 5EIGA 3FRKA 1ELQA 5F9SA 1QZ9A 2O7CA 3DC1A 4R5FA 2VGWA 2D5YA 3B8XA 1J04A 3NUIA 1LS3A 1B5OA 3N75A 4ZDLA 1ASEA 3ZRQA 2D66A 2BWNA 3BC8A 4ADCA 1E5FA 1CL2A 4XK1A 3FFHA 1DKAA 3HDOA 2QA3A 1OHWA 4UOYA 4EFFA 5G4JA 3E77A 1B4XA 3P6KA 4CBSA 3A2BA 2BIAA 4F5IA 3BCBA 4MQRA 5F8VA 9AATA 4F5JA 1IJIA 1S09A 1SZKA 2JJGA 1MDOA 5E4ZA 1O62A 2FM1A 1JG8A 2BHXA 1C4KA 4W1XA 3RCHB 4WBTA 1W7MA 4MKJA 1N2TA 4WYGA 3VP6A 3W1JA 4LW4A 1ASNA 1SZUA 5FT6A 2VIBA 1YOOA 4AH3A 2HZPA 4DBCA 5HDMA 3OKSA 4WLHA 1SF2A 5BJ3A 4U1TA 1CQ6A 3ZZKA 4TN4A 3G8MA 2QBTA 1M0PA 4GE4A 1V2FA 2O1BA 4OBVA 1X29A 1M0NA 3ISLA 3DXVA 4JE5A 3L44A 1AMRA 2D7ZA 3WGBA 1AMSA 2BI2A 3E9KA 3PDBB 1S06A 4F5HA 1WYTA 4WXBA 2BI3A 1XI9A 2YCTA 1BS0A 1G7WA 4RLGA 3LVKA 4WP0A 4RAEA 2V0YA 3EI5A 4WYAA 2VMZA 1MAQA 2BKWA 1QISA 2VGTA 1AKBA 3K28A 3NDNA 2FN6A 3EZ1A 4WYCA 2VMPA 3D6KA 4W8IA 4R2NA 1KMJA 3L8AA 2GMUA 1IUGA 2VLFA 4M2JA 1WKHA 4F5MA 4ZAHA 1H1CA 1D7SA 5EAAA 5G0AA 2R2NA 1OATA 3I4JA 3UE8A 2VMYA 2TPLA 1BJOB 2VI9A 3B1DA 3DXWA 3K40A 3WCOA 2E7UA 3FVSA 4GE7A 1J32A 2EGYA 1YJZA 2CINA 2W7GA 1WYUA 1BQDA 3MAFB 3KGWA 4UQVA 5J8QA 1GEXA 1RVUA 1GC0A 4WXGA 4BA4A 1AX4A 4JE5D 4A6UA 4A72A 2W7LA 4EB5A 2CH2A 1QGNA 4LW2A 2PB0A 3F0HA 2OKJA 2D61A 1QITA 3HBXA 2HOYA 1GBNA 5DJ9A 1G7XA 5D95A 1O61A 1MAPA 3MAUA 1ARIA 2JISA 3PD6B 4XJLA 4Q75A 2DKJA 5HXXA 5IWQA 1TATA 3JZLA 1AIAA 2C44A 2VMVA 4XJPA 3AEMA 4ATQA 5LH9A 4PFFA 1MLYA 2X8UA 1U08A 1IVRA 4M2MA 3LVLB 1GCKA 3WGCA 4AO4A 1LC5A 3HMUA 2W7JA 4HF8A 4R8DA 1WKGA 3BN1A 1BT4A 3A9XA 3GBXA 5EUNA 2AY7A 4MQQA 1C7NA 1C0NA 1N31A 4EB7A 2VMWA 2CSTA 3WCNA 1W7LA 1AY5A 3VK2A 4JEWA 2C81A 3LVJA 2FNIA 2YCNA 3RCHA 3FZ8A 1DJUA 1OHVA 1VJOA 2Z67A 4A0HA 2VMQA 2BIEA 1ASAA 3QBOA 3AOWA 1IBJA 5M4BA 1CQ7A 1GD9A 2Z1YA 3KE3A 1ASGA 2Z9WA 4BA5A 5DX5A 2HP2A 2W7FA 3QPGA 2RFVA 4ADDA 3NRAA 1BW0A 3HT4A 3HL2A 5HHYA 1W3UA 1TOJA 5DB5A 1GC4A 2AY4A 2E7IA 3JTXA 1N8PA 1WYVB 4KYOA 1PFFA 4W1VA 4GRXA 3GSBA 3PDBA 3NU8A 1ZC9A 3NU7A 3AENB 1V2DA 2HORA 1B9HA 1M32A 4AZKA 2W8JA 2R5CB 2AATA 2AY8A 1YIYA 3MBBA 1MDXA 3MADA 4BQ0A 1AKAA 4GSAA 1ARHA 2JG2A 4F5FA 1YJYA 1D7VA 4UHMA 2BWPA 3E2FA 4OBUA 5EUEA 5EUDA 3FQ8A 3IHJA 2G6WA 3AELA 2R0TA 1AHEA 3I5TA 3M5UA 3DZZA 3EI8A 3FKDA 3E2YA 2GMSA 3EIBA 2AEUA 3RQ1A 2D7YA 1W23A 3GETA
chains in the Genus database with same CATH superfamily
3AEMC 1SZSA 1LW5A 1KKPA 1BJOA 4W1WA 3FVXA 5JAYA 4Q76A 3AOVA 3W1IA 2AY6A 2ZSMA 4EMYA 3FVUA 1C7GA 2VMTA 4RKDA 1S08A 4ZASA 2CJHA 5BJ4A 2FNUA 3LY1A 4ITGA 2W7DA 1M0QA 2PO3A 2W7EA 3II0A 4ATPA 3CBFA 5DJ1A 1SFFA 3F9TA 4ZWMA 5E5IA 1EG5A 2BWOA 3FDBA 4A0RA 2VMRA 2W8VA 1DFOA 3LVMA 4OMAA 3WLXA 2NMPA 4B98A 3A8UX 3QI6A 4K2IA 2WKAA 4ZLVA 4TV7A 3BCXA 3E2ZB 2DR1A 3HVYA 2HOXA 2VIAA 3PD6A 2W7MA 1TOIA 2HOZA 4B9BA 3W1HA 1EQBA 3FD0A 4PFNA 3ZRPA 4XAUA 4JF0A 1AJSB 2CJGA 3FZ7A 2R5EA 4MSOA 1G4VA 1AHGA 2O0RA 4IYOA 4MKKA 5EIGB 4EU1A 1RVYA 2Q7WA 1AJRA 2X5FA 4OYTA 2ZY3A 3NYUA 1M7YA 3IF2A 2CH1A 2YRRA 3BV0A 3JW9A 4CVQA 2BIGA 4AOAA 1TOEA 5M46A 3DU4A 4O6ZA 1I48A 2OKKA 2YKYA 4KXKA 1SPAA 2VI8A 2Z20A 3AATA 1ASFA 2D64A 1IAXA 2Z9UA 3TCMA 8AATA 4ZWVA 1TASA 2Z1ZA 1PMMA 4A0FA 2VGSA 1V2EA 5EAVA 3FZ6A 3DRDA 1ZOBA 1E5EA 3EUCA 4E3QA 3WKSA 2ZYJA 3R9AA 1AY4A 7AATA 1KL2A 5KTBA 1IX8A 2WK8A 1OXOA 2F8JA 1B5PA 2HUUA 1ASBA 1B9IA 4A6TA 2ZJGA 5EQCA 3PAAA 3EI9A 4WXFA 1ARSA 2AEVA 1VEFA 2BI5A 3ASAA 4AO9A 3FQ7A 2OATA 1D7UA 3KKIA 4IXZA 1ORDA 3GJUA 1TPLA 2YRIA 3BCAA 1BQAA 1D7RA 2C0RA 2VGUA 4Y0DA 4JEVA 2AY5A 1CL1A 1CZEA 1WSTA 4CBRA 3ELEA 2X3LA 1BJNA 3PGYA 1AMQA 2ZY4A 3HLMA 1I43A 2R5CA 4ZSYA 1LW4A 1GC3A 1AKCA 4XEWA 3LWSA 1AHYA 3FQAA 3A9YA 1DGDA 1S0AA 4CXQA 5AX8A 3DR7A 1LC8A 2E54A 4ZDOA 2W7HA 3F6TA 2JGTA 1DJ9A 3DODA 2ZY5A 1ASLA 2VYCA 1FG3A 1KL1A 1TOKA 3FDDA 3VAXA 5TF5A 1EJIA 4E1OA 4L0OA 4PVFA 3AEOA 4W91A 2HUFA 1ECXA 4GEBA 4ISYA 4LNMA 4LNLA 1AAMA 1C7OA 2YOBA 1X2AA 5M49A 3WX9A 3GZDA 4FFCA 2OQXA 2JJHA 1DJEA 1O4SA 1ELUA 1AY8A 4MQPA 2EZ2A 3QM2A 4W5KA 1LC7A 5D5SA 2W7IA 1CQ8A 2CY8A 3PDXA 1MDZA 3AV7A 5FT4A 3CQ4A 1T3IA 4LNJA 3N4XA 4XQ2A 1ASDA 3B46A 3E2ZA 4MGRA 1TARA 1YAAA 3K7YA 1BKGA 2QB2A 4Q31A 5G09A 2AY3A 4M2KA 1AIBA 4WB0B 4E77A 4F5LA 2QMAA 2W8TA 4FL0A 1XEYA 4OCAA 4QGRA 3DR4A 2VMXA 2BI1A 4JF1A 1ASMA 3PA9A 2GB3A 1V72A 4U2HA 5G4IA 2YKXA 1YIZA 3NYTA 4Q6RA 4F5GA 4IXSA 1JF9A 2Z61A 1KMKA 2QB3A 2BI9A 2DGMA 1Z3ZA 3OP7A 1LKCA 4K2MA 4WD2A 4F5KA 4Y0HA 3WZFA 4A6RA 3ATHA 3BWNA 2WB6A 2ZY2A 1UU0A 3RBLA 3BB8A 3MAFA 3FTBA 4UHOA 1MGVA 4OT8A 5I92A 1RV3A 1Z7DA 1BJ4A 1YNUA 2DOUA 2W8UA 4WYDA 2W7KA 1CJ0A 2XH1A 3JWAA 3RI6A 4NOGA 3WKRA 1ASCA 3ELPA 1X28A 2FQ6A 3NX3A 4RJ0A 3CQ6A 5FT5A 3ECDA 4ZSWA 3QHXA 3R4TA 3PIUA 4RJYA 1QJ3A 3T32A 1C9CA 4ADEA 4P3MA 4RKCA 4JEZA 1YJSA 3KGXA 4JEXA 1DTYA 1ARGA 2YKVA 4ADBA 4JEYA 3QGUA 3WY7A 1IX6A 3USFA 4H51A 2WK9A 4TMRA 3RUYA 3AEJA 3VOMA 5FT8A 3AEPA 1JS6A 2Z9XA 1DGEA 1GC2A 4RM1A 1BJWA 3GZDC 4UHNA 3MKJA 3NUBA 4A00A 2VGVA 1IX7A 2WK7A 3MC6A 4KAMA 3H7FA 4XJOA 5K8BA 3G7QA 4XJMA 2AY9A 3GZCA 2ZSLA 1GEYA 4WYFA 4J5UA 2YHKA 1OXPA 1JS3A 4MY5A 2BYJA 3EI7A 2QSRA 4PIWA 4ITXA 3GWPA 1B8GA 1PMOA 1QJ5A 2VMUA 2Z9VA 3UAKA 1I41A 4R5ZA 2KFPA 1SVVA 2CANA 2ZUKA 2EPJA 3FCRA 1VP4A 4E3RA 4J8LA 4OTLA 3FFRA 4F4EA 2W8WA 4IW7A 2AY2A 1UKJA 2DGKA 4HVKA 1X0MA 2V1PA 1M0OA 4AZJA 4IY7A 3FSLA 1AAWA 4P7YA 1ZODA 1H0CA 4OC9A 2DKBA 3JU7A 1WYVA 1M4NA 4A0GA 3COGA 3GR9A 3TATA 2AY1A 1I29A 3BWNC 1RV4A 2OGAA 5E3KA 2FYFA 1AHFA 3CQ5A 2DGLA 3BWOA 2VMNA 1GDEA 1OHYA 3AENA 2C7TA 2D65A 2JJEA 4CXRA 4DGTA 3MEBA 3LG0A 2CJDA 2G7JA 3N4SA 1IAYA 1WYTB 3EI6A 3N5MA 1FC4A 2OGEA 1S07A 2GSAA 4WB0A 2BYLA 3H14A 3HQTA 4WYEA 2YCPA 3I16A 1LK9A 1Y4IA 2HUIA 2VMOA 4BMKA 4ZDPA 1CS1A 4K2BA 4ZM3A 2CTZA 2VGZA 4IYOB 3G0TA 1O69A 4ZM4A 1MLZA 2ZC0A 3PJ0A 4GDYA 1G4XA 2E7JA 2ZP7A 3VK3A 5C6UA 4WLJA 4K05A 1W7NA 2CB1A 1AMAA 3ASBA 4N0WA 3ACZA 5LHAA 3AEJC 1KKJA 3E6GA 3EZSA 1CZCA 1GEWA 3QN6A 1D2FA 4GE9A 3TFUA 1FG7A 2XBNA 4I8AA 4IX8A 1P3WA 2EZ1A 2EH6A 1PG8A 3EIAA 3MC6C 1AHXA 3TFTA 2GQNA 4Y0IA 3JWBA 3ZRRA 1AICA 1WYUB 2PB2A 4RIZA 2VLHA 3A9ZA 3B1CA 2FKIA 4DQ6A 3DYDA 3NYSA 3ZZJA 1UU2A 2ORDA 3NTJA 3UWCA 1M6SA 2CFBA 3TQXA 1ARTA 5M4DA 3RBFA 3B1EA 1QIRA 2X5DA 2YKUA 4RITA 5EFSA 3NNKA 2EO5A 1UU1A 2D63A 3VK4A 3P1TA 2VMSA 3BS8A 4LC3A 5G2PA 2QLRA 2JJFA 3N0LA 4N0BA 4BHDA 4IXOA 1AJSA 3Q8NA 1TOGA 2HP1A 3LV2A 5G2QA 3PPLA 3CAIA 5EIGA 3FRKA 1ELQA 5F9SA 1QZ9A 2O7CA 3DC1A 4R5FA 2VGWA 2D5YA 3B8XA 1J04A 3NUIA 1LS3A 1B5OA 3N75A 4ZDLA 1ASEA 3ZRQA 2D66A 2BWNA 3BC8A 4ADCA 1E5FA 1CL2A 4XK1A 3FFHA 1DKAA 3HDOA 2QA3A 1OHWA 4UOYA 4EFFA 5G4JA 3E77A 1B4XA 3P6KA 4CBSA 3A2BA 2BIAA 4F5IA 3BCBA 4MQRA 5F8VA 9AATA 4F5JA 1IJIA 1S09A 1SZKA 2JJGA 1MDOA 5E4ZA 1O62A 2FM1A 1JG8A 2BHXA 1C4KA 4W1XA 3RCHB 4WBTA 1W7MA 4MKJA 1N2TA 4WYGA 3VP6A 3W1JA 4LW4A 1ASNA 1SZUA 5FT6A 2VIBA 1YOOA 4AH3A 2HZPA 4DBCA 5HDMA 3OKSA 4WLHA 1SF2A 5BJ3A 4U1TA 1CQ6A 3ZZKA 4TN4A 3G8MA 2QBTA 1M0PA 4GE4A 1V2FA 2O1BA 4OBVA 1X29A 1M0NA 3ISLA 3DXVA 4JE5A 3L44A 1AMRA 2D7ZA 3WGBA 2A1VA 1AMSA 2BI2A 3E9KA 3PDBB 1S06A 4F5HA 1WYTA 4WXBA 2BI3A 1XI9A 2YCTA 1BS0A 1G7WA 4RLGA 3LVKA 4WP0A 4RAEA 2V0YA 3EI5A 4WYAA 3N7NA 2VMZA 1MAQA 2BKWA 1QISA 2VGTA 1AKBA 3K28A 3NDNA 2FN6A 3EZ1A 4WYCA 2VMPA 3D6KA 4W8IA 4R2NA 1KMJA 3L8AA 2GMUA 1IUGA 2VLFA 4M2JA 1WKHA 4F5MA 4ZAHA 1H1CA 1D7SA 5EAAA 5G0AA 2R2NA 1OATA 3I4JA 3UE8A 2VMYA 2TPLA 1BJOB 2VI9A 3B1DA 3DXWA 3K40A 3WCOA 2E7UA 3FVSA 4GE7A 1J32A 2EGYA 1YJZA 2CINA 2W7GA 1WYUA 1BQDA 3MAFB 3KGWA 4UQVA 5J8QA 1GEXA 1RVUA 1GC0A 4WXGA 4BA4A 1AX4A 4JE5D 4A6UA 4A72A 2W7LA 4EB5A 2CH2A 1QGNA 4LW2A 2PB0A 3F0HA 2OKJA 2D61A 1QITA 2EYQA 3HBXA 2HOYA 1GBNA 5DJ9A 1G7XA 5D95A 1O61A 1MAPA 3MAUA 1ARIA 2JISA 3PD6B 4XJLA 4Q75A 2DKJA 5HXXA 5IWQA 1TATA 3JZLA 1AIAA 2C44A 2VMVA 4XJPA 3AEMA 4ATQA 5LH9A 4PFFA 1MLYA 3H9XA 2X8UA 1U08A 1IVRA 4M2MA 3LVLB 1GCKA 3WGCA 4AO4A 1LC5A 3HMUA 2W7JA 4HF8A 4R8DA 1WKGA 3BN1A 1BT4A 3A9XA 3GBXA 5EUNA 2AY7A 4MQQA 1C7NA 1C0NA 1N31A 4EB7A 2VMWA 2CSTA 3WCNA 1W7LA 1AY5A 3VK2A 4JEWA 2C81A 3LVJA 2FNIA 2YCNA 3RCHA 3FZ8A 1DJUA 1OHVA 1VJOA 2Z67A 4A0HA 2VMQA 2BIEA 1ASAA 3QBOA 3AOWA 1IBJA 5M4BA 1CQ7A 1GD9A 2Z1YA 3KE3A 1ASGA 2Z9WA 4BA5A 5DX5A 2HP2A 2W7FA 3QPGA 2RFVA 4ADDA 3NRAA 1BW0A 3HT4A 3HL2A 5HHYA 1W3UA 1TOJA 5DB5A 1GC4A 2AY4A 2E7IA 3JTXA 1N8PA 1WYVB 4KYOA 1PFFA 4W1VA 4GRXA 3GSBA 3PDBA 3NU8A 1ZC9A 3NU7A 3AENB 1V2DA 2HORA 1B9HA 1M32A 4AZKA 2W8JA 2R5CB 4H63Q 2AATA 2AY8A 3N4RA 1YIYA 3MBBA 1KAFA 1MDXA 3MADA 4BQ0A 1AKAA 4GSAA 1ARHA 2JG2A 4F5FA 1YJYA 1D7VA 4UHMA 2BWPA 3E2FA 4OBUA 5EUEA 5EUDA 3FQ8A 3IHJA 2G6WA 3AELA 2R0TA 1AHEA 3I5TA 3M5UA 3DZZA 3EI8A 3FKDA 3E2YA 2GMSA 3EIBA 2AEUA 3RQ1A 2D7YA 1W23A 3GETA
chains in the Genus database with same CATH topology
3AEMC 1SZSA 1LW5A 1KKPA 1BJOA 4W1WA 3FVXA 5JAYA 4Q76A 3AOVA 3W1IA 2AY6A 2ZSMA 4EMYA 3FVUA 1C7GA 2VMTA 4RKDA 1S08A 4ZASA 2CJHA 5BJ4A 2FNUA 3LY1A 4ITGA 2W7DA 1M0QA 2PO3A 2W7EA 3II0A 4ATPA 3CBFA 5DJ1A 1SFFA 3F9TA 4ZWMA 5E5IA 1EG5A 2BWOA 3FDBA 4A0RA 2VMRA 2W8VA 1DFOA 3LVMA 4OMAA 3WLXA 2NMPA 4B98A 3A8UX 3QI6A 4K2IA 2WKAA 4ZLVA 4TV7A 3BCXA 3E2ZB 2DR1A 3HVYA 2HOXA 2VIAA 3PD6A 2W7MA 1TOIA 2HOZA 4B9BA 3W1HA 1EQBA 3FD0A 4PFNA 3ZRPA 4XAUA 4JF0A 1AJSB 2CJGA 3FZ7A 2R5EA 4MSOA 1G4VA 1AHGA 2O0RA 4IYOA 4MKKA 5EIGB 4EU1A 1RVYA 2Q7WA 1AJRA 2X5FA 4OYTA 2ZY3A 3NYUA 1M7YA 3IF2A 2CH1A 2YRRA 3BV0A 3JW9A 4CVQA 2BIGA 4AOAA 1TOEA 5M46A 3DU4A 4O6ZA 1I48A 2OKKA 2YKYA 4KXKA 1SPAA 2VI8A 2Z20A 3AATA 1ASFA 2D64A 1IAXA 2Z9UA 3TCMA 8AATA 4ZWVA 1TASA 2Z1ZA 1PMMA 4A0FA 2VGSA 1V2EA 5EAVA 3FZ6A 3DRDA 1ZOBA 1E5EA 3EUCA 4E3QA 3WKSA 2ZYJA 3R9AA 1AY4A 7AATA 1KL2A 5KTBA 1IX8A 2WK8A 1OXOA 2F8JA 1B5PA 2HUUA 1ASBA 1B9IA 4A6TA 2ZJGA 5EQCA 3PAAA 3EI9A 4WXFA 1ARSA 2AEVA 1VEFA 2BI5A 3ASAA 4AO9A 3FQ7A 2OATA 1D7UA 3KKIA 4IXZA 1ORDA 3GJUA 1TPLA 2YRIA 3BCAA 1BQAA 1D7RA 2C0RA 2VGUA 4Y0DA 4JEVA 2AY5A 1CL1A 1CZEA 1WSTA 4CBRA 3ELEA 2X3LA 1BJNA 3PGYA 1AMQA 2ZY4A 3HLMA 1I43A 2R5CA 4ZSYA 1LW4A 1GC3A 1AKCA 4XEWA 3LWSA 1AHYA 3FQAA 3A9YA 1DGDA 1S0AA 4CXQA 5AX8A 3DR7A 1LC8A 2E54A 4ZDOA 2W7HA 3F6TA 2JGTA 1DJ9A 3DODA 2ZY5A 1ASLA 2VYCA 1FG3A 1KL1A 1TOKA 3FDDA 3VAXA 5TF5A 1EJIA 4E1OA 4L0OA 4PVFA 3AEOA 4W91A 2HUFA 1ECXA 4GEBA 4ISYA 4LNMA 4LNLA 1AAMA 1C7OA 2YOBA 1X2AA 5M49A 3WX9A 3GZDA 4FFCA 2OQXA 2JJHA 1DJEA 1O4SA 1ELUA 1AY8A 4MQPA 2EZ2A 3QM2A 4W5KA 1LC7A 5D5SA 2W7IA 1CQ8A 2CY8A 3PDXA 1MDZA 3AV7A 5FT4A 3CQ4A 1T3IA 4LNJA 3N4XA 4XQ2A 1ASDA 3B46A 3E2ZA 4MGRA 1TARA 1YAAA 3K7YA 1BKGA 2QB2A 4Q31A 5G09A 2AY3A 4M2KA 1AIBA 4WB0B 4E77A 4F5LA 2QMAA 2W8TA 4FL0A 1XEYA 4OCAA 4QGRA 3DR4A 2VMXA 2BI1A 4JF1A 1ASMA 3PA9A 2GB3A 1V72A 4U2HA 5G4IA 2YKXA 1YIZA 3NYTA 4Q6RA 4F5GA 4IXSA 1JF9A 2Z61A 1KMKA 2QB3A 2BI9A 2DGMA 1Z3ZA 3OP7A 1LKCA 4K2MA 4WD2A 4F5KA 4Y0HA 3WZFA 4A6RA 3ATHA 3BWNA 2WB6A 2ZY2A 1UU0A 3RBLA 3BB8A 3MAFA 3FTBA 4UHOA 1MGVA 4OT8A 5I92A 1RV3A 1Z7DA 1BJ4A 1YNUA 2DOUA 2W8UA 4WYDA 2W7KA 1CJ0A 2XH1A 3JWAA 3RI6A 4NOGA 3WKRA 1ASCA 3ELPA 1X28A 2FQ6A 3NX3A 4RJ0A 3CQ6A 5FT5A 3ECDA 4ZSWA 3QHXA 3R4TA 3PIUA 4RJYA 1QJ3A 3T32A 1C9CA 4ADEA 4P3MA 4RKCA 4JEZA 1YJSA 3KGXA 4JEXA 1DTYA 1ARGA 2YKVA 4ADBA 4JEYA 3QGUA 3WY7A 1IX6A 3USFA 4H51A 2WK9A 4TMRA 3RUYA 3AEJA 3VOMA 5FT8A 3AEPA 1JS6A 2Z9XA 1DGEA 1GC2A 4RM1A 1BJWA 3GZDC 4UHNA 3MKJA 3NUBA 4A00A 2VGVA 1IX7A 2WK7A 3MC6A 4KAMA 3H7FA 4XJOA 5K8BA 3G7QA 4XJMA 2AY9A 3GZCA 2ZSLA 1GEYA 4WYFA 4J5UA 2YHKA 1OXPA 1JS3A 4MY5A 2BYJA 3EI7A 2QSRA 4PIWA 4ITXA 3GWPA 1B8GA 1PMOA 1QJ5A 2VMUA 2Z9VA 3UAKA 1I41A 4R5ZA 2KFPA 1SVVA 2CANA 2ZUKA 2EPJA 3FCRA 1VP4A 4E3RA 4J8LA 4OTLA 3FFRA 4F4EA 2W8WA 4IW7A 2AY2A 1UKJA 2DGKA 4HVKA 1X0MA 2V1PA 1M0OA 4AZJA 4IY7A 3FSLA 1AAWA 4P7YA 1ZODA 1H0CA 4OC9A 2DKBA 3JU7A 1WYVA 1M4NA 4A0GA 3COGA 3GR9A 3TATA 2AY1A 1I29A 3BWNC 1RV4A 2OGAA 5E3KA 2FYFA 1AHFA 3CQ5A 2DGLA 3BWOA 2VMNA 1GDEA 1OHYA 3AENA 2C7TA 2D65A 2JJEA 4CXRA 4DGTA 3MEBA 3LG0A 2CJDA 2G7JA 3N4SA 1IAYA 1WYTB 3EI6A 3N5MA 1FC4A 2OGEA 1S07A 2GSAA 4WB0A 2BYLA 3H14A 3HQTA 4WYEA 2YCPA 3I16A 1LK9A 1Y4IA 2HUIA 2VMOA 4BMKA 4ZDPA 1CS1A 4K2BA 4ZM3A 2CTZA 2VGZA 4IYOB 3G0TA 1O69A 4ZM4A 1MLZA 2ZC0A 3PJ0A 4GDYA 1G4XA 2E7JA 2ZP7A 3VK3A 5C6UA 4WLJA 4K05A 1W7NA 2CB1A 1AMAA 3ASBA 4N0WA 3ACZA 5LHAA 3AEJC 1KKJA 3E6GA 3EZSA 1CZCA 1GEWA 3QN6A 1D2FA 4GE9A 3TFUA 1FG7A 2XBNA 4I8AA 4IX8A 1P3WA 2EZ1A 2EH6A 1PG8A 3EIAA 3MC6C 1AHXA 3TFTA 2GQNA 4Y0IA 3JWBA 3ZRRA 1AICA 1WYUB 2PB2A 4RIZA 2VLHA 3A9ZA 3B1CA 2FKIA 4DQ6A 3DYDA 3NYSA 3ZZJA 1UU2A 2ORDA 3NTJA 3UWCA 1M6SA 2CFBA 3TQXA 1ARTA 5M4DA 3RBFA 3B1EA 1QIRA 2X5DA 2YKUA 4RITA 5EFSA 3NNKA 2EO5A 1UU1A 2D63A 3VK4A 3P1TA 2VMSA 3BS8A 4LC3A 5G2PA 2QLRA 2JJFA 3N0LA 4N0BA 4BHDA 4IXOA 1AJSA 3Q8NA 1TOGA 2HP1A 3LV2A 5G2QA 3PPLA 3CAIA 5EIGA 3FRKA 1ELQA 5F9SA 1QZ9A 2O7CA 3DC1A 4R5FA 2VGWA 2D5YA 3B8XA 1J04A 3NUIA 1LS3A 1B5OA 3N75A 4ZDLA 1ASEA 3ZRQA 2D66A 2BWNA 3BC8A 4ADCA 1E5FA 1CL2A 4XK1A 3FFHA 1DKAA 3HDOA 2QA3A 1OHWA 4UOYA 4EFFA 5G4JA 3E77A 1B4XA 3P6KA 4CBSA 3A2BA 2BIAA 4F5IA 3BCBA 4MQRA 5F8VA 9AATA 4F5JA 1IJIA 1S09A 1SZKA 2JJGA 1MDOA 5E4ZA 1O62A 2FM1A 1JG8A 2BHXA 1C4KA 4W1XA 3RCHB 4WBTA 1W7MA 4MKJA 1N2TA 4WYGA 3VP6A 3W1JA 4LW4A 1ASNA 1SZUA 5FT6A 2VIBA 1YOOA 4AH3A 2HZPA 4DBCA 5HDMA 3OKSA 4WLHA 1SF2A 5BJ3A 4U1TA 1CQ6A 3ZZKA 4TN4A 3G8MA 2QBTA 1M0PA 4GE4A 1V2FA 2O1BA 4OBVA 1X29A 1M0NA 3ISLA 3DXVA 4JE5A 3L44A 1AMRA 2D7ZA 3WGBA 2A1VA 1AMSA 2BI2A 3E9KA 3PDBB 1S06A 4F5HA 1WYTA 4WXBA 2BI3A 1XI9A 2YCTA 1BS0A 1G7WA 4RLGA 3LVKA 4WP0A 4RAEA 2V0YA 3EI5A 4WYAA 3N7NA 2VMZA 1MAQA 2BKWA 1QISA 2VGTA 1AKBA 3K28A 3NDNA 2FN6A 3EZ1A 4WYCA 2VMPA 3D6KA 4W8IA 4R2NA 1KMJA 3L8AA 2GMUA 1IUGA 2VLFA 4M2JA 1WKHA 4F5MA 4ZAHA 1H1CA 1D7SA 5EAAA 5G0AA 2R2NA 1OATA 3I4JA 3UE8A 2VMYA 2TPLA 1BJOB 2VI9A 3B1DA 3DXWA 3K40A 3WCOA 2E7UA 3FVSA 4GE7A 1J32A 2EGYA 1YJZA 2CINA 2W7GA 1WYUA 1BQDA 3MAFB 3KGWA 4UQVA 5J8QA 1GEXA 1RVUA 1GC0A 4WXGA 4BA4A 1AX4A 4JE5D 4A6UA 4A72A 2W7LA 4EB5A 2CH2A 1QGNA 4LW2A 2PB0A 3F0HA 2OKJA 2D61A 1QITA 2EYQA 3HBXA 2HOYA 1GBNA 5DJ9A 1G7XA 5D95A 1O61A 1MAPA 3MAUA 1ARIA 2JISA 3PD6B 4XJLA 4Q75A 2DKJA 5HXXA 5IWQA 1TATA 3JZLA 1AIAA 2C44A 2VMVA 4XJPA 3AEMA 4ATQA 5LH9A 4PFFA 1MLYA 3H9XA 2X8UA 1U08A 1IVRA 4M2MA 3LVLB 1GCKA 3WGCA 4AO4A 1LC5A 3HMUA 2W7JA 4HF8A 4R8DA 1WKGA 3BN1A 1BT4A 3A9XA 3GBXA 5EUNA 2AY7A 4MQQA 1C7NA 1C0NA 1N31A 4EB7A 2VMWA 2CSTA 3WCNA 1W7LA 1AY5A 3VK2A 4JEWA 2C81A 3LVJA 2FNIA 2YCNA 3RCHA 3FZ8A 1DJUA 1OHVA 1VJOA 2Z67A 4A0HA 2VMQA 2BIEA 1ASAA 3QBOA 3AOWA 1IBJA 5M4BA 1CQ7A 1GD9A 2Z1YA 3KE3A 1ASGA 2Z9WA 4BA5A 5DX5A 2HP2A 2W7FA 3QPGA 2RFVA 4ADDA 3NRAA 1BW0A 3HT4A 3HL2A 5HHYA 1W3UA 1TOJA 5DB5A 1GC4A 2AY4A 2E7IA 3JTXA 1N8PA 1WYVB 4KYOA 1PFFA 4W1VA 4GRXA 3GSBA 3PDBA 3NU8A 1ZC9A 3NU7A 3AENB 1V2DA 2HORA 1B9HA 1M32A 4AZKA 2W8JA 2R5CB 4H63Q 2AATA 2AY8A 3N4RA 1YIYA 3MBBA 1MDXA 3MADA 4BQ0A 1AKAA 4GSAA 1ARHA 2JG2A 4F5FA 1YJYA 1D7VA 4UHMA 2BWPA 3E2FA 4OBUA 5EUEA 5EUDA 3FQ8A 3IHJA 2G6WA 3AELA 2R0TA 1AHEA 3I5TA 3M5UA 3DZZA 3EI8A 3FKDA 3E2YA 2GMSA 3EIBA 2AEUA 3RQ1A 2D7YA 1W23A 3GETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEM C;  1SZS A;  1LW5 A;  1KKP A;  1BJO A;  4W1W A;  3FVX A;  5JAY A;  4Q76 A;  3AOV A;  3W1I A;  2AY6 A;  2ZSM A;  4EMY A;  3FVU A;  1C7G A;  2VMT A;  4RKD A;  1S08 A;  4ZAS A;  2CJH A;  5BJ4 A;  2FNU A;  3LY1 A;  4ITG A;  2W7D A;  1M0Q A;  2PO3 A;  2W7E A;  3II0 A;  4ATP A;  3CBF A;  5DJ1 A;  1SFF A;  3F9T A;  4ZWM A;  5E5I A;  1EG5 A;  2BWO A;  3FDB A;  4A0R A;  2VMR A;  2W8V A;  1DFO A;  3LVM A;  4OMA A;  3WLX A;  2NMP A;  4B98 A;  3A8U X;  3QI6 A;  4K2I A;  2WKA A;  4ZLV A;  4TV7 A;  3BCX A;  3E2Z B;  2DR1 A;  3HVY A;  2HOX A;  2VIA A;  3PD6 A;  2W7M A;  1TOI A;  2HOZ A;  4B9B A;  3W1H A;  1EQB A;  3FD0 A;  4PFN A;  3ZRP A;  4XAU A;  4JF0 A;  1AJS B;  2CJG A;  3FZ7 A;  2R5E A;  4MSO A;  1G4V A;  1AHG A;  2O0R A;  4IYO A;  4MKK A;  5EIG B;  4EU1 A;  1RVY A;  2Q7W A;  1AJR A;  2X5F A;  4OYT A;  2ZY3 A;  3NYU A;  1M7Y A;  3IF2 A;  2CH1 A;  2YRR A;  3BV0 A;  3JW9 A;  4CVQ A;  2BIG A;  4AOA A;  1TOE A;  5M46 A;  3DU4 A;  4O6Z A;  1I48 A;  2OKK A;  2YKY A;  4KXK A;  1SPA A;  2VI8 A;  2Z20 A;  3AAT A;  1ASF A;  2D64 A;  1IAX A;  2Z9U A;  3TCM A;  8AAT A;  4ZWV A;  1TAS A;  2Z1Z A;  1PMM A;  4A0F A;  2VGS A;  1V2E A;  5EAV A;  3FZ6 A;  3DRD A;  1ZOB A;  1E5E A;  3EUC A;  4E3Q A;  3WKS A;  2ZYJ A;  3R9A A;  1AY4 A;  7AAT A;  1KL2 A;  1IX8 A;  2WK8 A;  1OXO A;  2F8J A;  1B5P A;  2HUU A;  1ASB A;  1B9I A;  4A6T A;  2ZJG A;  5EQC A;  3PAA A;  3EI9 A;  4WXF A;  1ARS A;  2AEV A;  1VEF A;  2BI5 A;  3ASA A;  4AO9 A;  3FQ7 A;  2OAT A;  1D7U A;  3KKI A;  4IXZ A;  1ORD A;  3GJU A;  1TPL A;  2YRI A;  3BCA A;  1BQA A;  1D7R A;  2C0R A;  2VGU A;  4Y0D A;  4JEV A;  2AY5 A;  1CL1 A;  1CZE A;  1WST A;  4CBR A;  3ELE A;  2X3L A;  1BJN A;  3PGY A;  1AMQ A;  2ZY4 A;  3HLM A;  1I43 A;  2R5C A;  4ZSY A;  1LW4 A;  1GC3 A;  1AKC A;  4XEW A;  3LWS A;  1AHY A;  3FQA A;  3A9Y A;  1DGD A;  1S0A A;  4CXQ A;  5AX8 A;  3DR7 A;  1LC8 A;  2E54 A;  4ZDO A;  2W7H A;  3F6T A;  2JGT A;  1DJ9 A;  3DOD A;  2ZY5 A;  1ASL A;  2VYC A;  1FG3 A;  1KL1 A;  1TOK A;  3FDD A;  3VAX A;  5TF5 A;  1EJI A;  4E1O A;  4L0O A;  4PVF A;  3AEO A;  4W91 A;  2HUF A;  1ECX A;  4GEB A;  4ISY A;  4LNM A;  4LNL A;  1AAM A;  1C7O A;  2YOB A;  1X2A A;  5M49 A;  3WX9 A;  3GZD A;  4FFC A;  2OQX A;  2JJH A;  1DJE A;  1O4S A;  1ELU A;  1AY8 A;  4MQP A;  2EZ2 A;  3QM2 A;  4W5K A;  1LC7 A;  5D5S A;  2W7I A;  1CQ8 A;  2CY8 A;  3PDX A;  1MDZ A;  3AV7 A;  5FT4 A;  3CQ4 A;  1T3I A;  4LNJ A;  4XQ2 A;  1ASD A;  3B46 A;  3E2Z A;  4MGR A;  1TAR A;  1YAA A;  3K7Y A;  1BKG A;  2QB2 A;  4Q31 A;  5G09 A;  2AY3 A;  4M2K A;  1AIB A;  4WB0 B;  4E77 A;  4F5L A;  2QMA A;  2W8T A;  4FL0 A;  1XEY A;  4OCA A;  4QGR A;  3DR4 A;  2VMX A;  2BI1 A;  4JF1 A;  1ASM A;  3PA9 A;  2GB3 A;  1V72 A;  4U2H A;  5G4I A;  2YKX A;  1YIZ A;  3NYT A;  4Q6R A;  4F5G A;  4IXS A;  1JF9 A;  2Z61 A;  1KMK A;  2QB3 A;  2BI9 A;  2DGM A;  1Z3Z A;  3OP7 A;  1LKC A;  4K2M A;  4WD2 A;  4F5K A;  4Y0H A;  3WZF A;  4A6R A;  3ATH A;  3BWN A;  2ZY2 A;  1UU0 A;  3RBL A;  3BB8 A;  3MAF A;  3FTB A;  4UHO A;  1MGV A;  4OT8 A;  5I92 A;  1RV3 A;  1Z7D A;  1BJ4 A;  1YNU A;  2DOU A;  2W8U A;  4WYD A;  2W7K A;  1CJ0 A;  2XH1 A;  3JWA A;  3RI6 A;  4NOG A;  3WKR A;  1ASC A;  3ELP A;  1X28 A;  2FQ6 A;  3NX3 A;  4RJ0 A;  3CQ6 A;  5FT5 A;  3ECD A;  4ZSW A;  3QHX A;  3R4T A;  3PIU A;  4RJY A;  1QJ3 A;  3T32 A;  1C9C A;  4ADE A;  4P3M A;  4RKC A;  4JEZ A;  1YJS A;  3KGX A;  4JEX A;  1DTY A;  1ARG A;  2YKV A;  4ADB A;  4JEY A;  3QGU A;  3WY7 A;  1IX6 A;  3USF A;  4H51 A;  2WK9 A;  4TMR A;  3RUY A;  3AEJ A;  3VOM A;  5FT8 A;  3AEP A;  1JS6 A;  2Z9X A;  1DGE A;  1GC2 A;  4RM1 A;  1BJW A;  3GZD C;  4UHN A;  3MKJ A;  3NUB A;  4A00 A;  2VGV A;  1IX7 A;  2WK7 A;  3MC6 A;  4KAM A;  3H7F A;  4XJO A;  5K8B A;  3G7Q A;  4XJM A;  2AY9 A;  3GZC A;  2ZSL A;  1GEY A;  4WYF A;  4J5U A;  2YHK A;  1OXP A;  1JS3 A;  4MY5 A;  2BYJ A;  3EI7 A;  4PIW A;  4ITX A;  3GWP A;  1B8G A;  1PMO A;  1QJ5 A;  2VMU A;  2Z9V A;  3UAK A;  1I41 A;  4R5Z A;  1SVV A;  2CAN A;  2ZUK A;  2EPJ A;  3FCR A;  1VP4 A;  4E3R A;  4J8L A;  4OTL A;  3FFR A;  4F4E A;  2W8W A;  4IW7 A;  2AY2 A;  1UKJ A;  2DGK A;  4HVK A;  1X0M A;  2V1P A;  1M0O A;  4AZJ A;  4IY7 A;  3FSL A;  1AAW A;  4P7Y A;  1ZOD A;  1H0C A;  4OC9 A;  2DKB A;  3JU7 A;  1WYV A;  1M4N A;  4A0G A;  3COG A;  3GR9 A;  3TAT A;  2AY1 A;  1I29 A;  3BWN C;  1RV4 A;  2OGA A;  5E3K A;  2FYF A;  1AHF A;  3CQ5 A;  2DGL A;  3BWO A;  2VMN A;  1GDE A;  1OHY A;  3AEN A;  2C7T A;  2D65 A;  2JJE A;  4CXR A;  4DGT A;  3MEB A;  3LG0 A;  2CJD A;  1IAY A;  1WYT B;  3EI6 A;  3N5M A;  1FC4 A;  2OGE A;  1S07 A;  2GSA A;  4WB0 A;  2BYL A;  3H14 A;  3HQT A;  4WYE A;  2YCP A;  3I16 A;  1LK9 A;  1Y4I A;  2HUI A;  2VMO A;  4BMK A;  4ZDP A;  1CS1 A;  4K2B A;  4ZM3 A;  2CTZ A;  2VGZ A;  4IYO B;  3G0T A;  1O69 A;  4ZM4 A;  1MLZ A;  2ZC0 A;  3PJ0 A;  4GDY A;  1G4X A;  2E7J A;  2ZP7 A;  3VK3 A;  5C6U A;  4WLJ A;  1W7N A;  2CB1 A;  1AMA A;  3ASB A;  4N0W A;  3ACZ A;  5LHA A;  3AEJ C;  1KKJ A;  3E6G A;  3EZS A;  1CZC A;  1GEW A;  3QN6 A;  1D2F A;  4GE9 A;  3TFU A;  1FG7 A;  2XBN A;  4I8A A;  4IX8 A;  1P3W A;  2EZ1 A;  2EH6 A;  1PG8 A;  3EIA A;  3MC6 C;  1AHX A;  3TFT A;  2GQN A;  4Y0I A;  3JWB A;  3ZRR A;  1AIC A;  1WYU B;  2PB2 A;  4RIZ A;  2VLH A;  3A9Z A;  3B1C A;  4DQ6 A;  3DYD A;  3NYS A;  3ZZJ A;  1UU2 A;  2ORD A;  3NTJ A;  3UWC A;  1M6S A;  2CFB A;  3TQX A;  1ART A;  5M4D A;  3RBF A;  3B1E A;  1QIR A;  2X5D A;  2YKU A;  4RIT A;  5EFS A;  3NNK A;  2EO5 A;  1UU1 A;  2D63 A;  3VK4 A;  3P1T A;  2VMS A;  3BS8 A;  4LC3 A;  5G2P A;  2QLR A;  2JJF A;  3N0L A;  4N0B A;  4BHD A;  4IXO A;  1AJS A;  3Q8N A;  1TOG A;  2HP1 A;  3LV2 A;  5G2Q A;  3PPL A;  3CAI A;  5EIG A;  3FRK A;  1ELQ A;  5F9S A;  1QZ9 A;  2O7C A;  3DC1 A;  4R5F A;  2VGW A;  2D5Y A;  3B8X A;  1J04 A;  3NUI A;  1LS3 A;  1B5O A;  3N75 A;  4ZDL A;  1ASE A;  3ZRQ A;  2D66 A;  2BWN A;  3BC8 A;  4ADC A;  1E5F A;  1CL2 A;  4XK1 A;  3FFH A;  1DKA A;  3HDO A;  2QA3 A;  1OHW A;  4UOY A;  4EFF A;  5G4J A;  3E77 A;  1B4X A;  3P6K A;  4CBS A;  3A2B A;  2BIA A;  4F5I A;  3BCB A;  4MQR A;  5F8V A;  9AAT A;  4F5J A;  1IJI A;  1S09 A;  1SZK A;  2JJG A;  1MDO A;  5E4Z A;  1O62 A;  2FM1 A;  1JG8 A;  2BHX A;  1C4K A;  4W1X A;  3RCH B;  4WBT A;  1W7M A;  4MKJ A;  1N2T A;  4WYG A;  3VP6 A;  3W1J A;  4LW4 A;  1ASN A;  1SZU A;  5FT6 A;  2VIB A;  1YOO A;  4AH3 A;  2HZP A;  4DBC A;  5HDM A;  3OKS A;  4WLH A;  1SF2 A;  5BJ3 A;  4U1T A;  1CQ6 A;  3ZZK A;  4TN4 A;  3G8M A;  2QBT A;  1M0P A;  4GE4 A;  1V2F A;  2O1B A;  4OBV A;  1X29 A;  1M0N A;  3ISL A;  3DXV A;  4JE5 A;  3L44 A;  1AMR A;  2D7Z A;  3WGB A;  1AMS A;  2BI2 A;  3E9K A;  3PDB B;  1S06 A;  4F5H A;  1WYT A;  4WXB A;  2BI3 A;  1XI9 A;  2YCT A;  1BS0 A;  1G7W A;  4RLG A;  3LVK A;  4WP0 A;  4RAE A;  2V0Y A;  3EI5 A;  4WYA A;  2VMZ A;  1MAQ A;  2BKW A;  1QIS A;  2VGT A;  1AKB A;  3K28 A;  3NDN A;  2FN6 A;  3EZ1 A;  4WYC A;  2VMP A;  3D6K A;  4W8I A;  4R2N A;  1KMJ A;  3L8A A;  2GMU A;  1IUG A;  2VLF A;  4M2J A;  1WKH A;  4F5M A;  4ZAH A;  1H1C A;  1D7S A;  5EAA A;  5G0A A;  2R2N A;  1OAT A;  3I4J A;  3UE8 A;  2VMY A;  2TPL A;  1BJO B;  2VI9 A;  3B1D A;  3DXW A;  3K40 A;  3WCO A;  2E7U A;  3FVS A;  4GE7 A;  1J32 A;  2EGY A;  1YJZ A;  2CIN A;  2W7G A;  1WYU A;  1BQD A;  3MAF B;  3KGW A;  4UQV A;  5J8Q A;  1GEX A;  1RVU A;  1GC0 A;  4WXG A;  4BA4 A;  1AX4 A;  4JE5 D;  4A6U A;  4A72 A;  2W7L A;  4EB5 A;  2CH2 A;  1QGN A;  4LW2 A;  2PB0 A;  3F0H A;  2OKJ A;  2D61 A;  1QIT A;  3HBX A;  2HOY A;  1GBN A;  5DJ9 A;  1G7X A;  5D95 A;  1O61 A;  1MAP A;  3MAU A;  1ARI A;  2JIS A;  3PD6 B;  4XJL A;  4Q75 A;  2DKJ A;  5HXX A;  5IWQ A;  1TAT A;  3JZL A;  1AIA A;  2C44 A;  2VMV A;  4XJP A;  3AEM A;  4ATQ A;  5LH9 A;  4PFF A;  1MLY A;  2X8U A;  1U08 A;  1IVR A;  4M2M A;  3LVL B;  1GCK A;  3WGC A;  4AO4 A;  1LC5 A;  3HMU A;  2W7J A;  4HF8 A;  4R8D A;  1WKG A;  3BN1 A;  1BT4 A;  3A9X A;  3GBX A;  5EUN A;  2AY7 A;  4MQQ A;  1C7N A;  1C0N A;  1N31 A;  4EB7 A;  2VMW A;  2CST A;  3WCN A;  1W7L A;  1AY5 A;  3VK2 A;  4JEW A;  2C81 A;  3LVJ A;  2FNI A;  2YCN A;  3RCH A;  3FZ8 A;  1DJU A;  1OHV A;  1VJO A;  2Z67 A;  4A0H A;  2VMQ A;  2BIE A;  1ASA A;  3QBO A;  3AOW A;  1IBJ A;  5M4B A;  1CQ7 A;  1GD9 A;  2Z1Y A;  3KE3 A;  1ASG A;  2Z9W A;  4BA5 A;  5DX5 A;  2HP2 A;  2W7F A;  3QPG A;  2RFV A;  4ADD A;  3NRA A;  1BW0 A;  3HT4 A;  3HL2 A;  5HHY A;  1W3U A;  1TOJ A;  5DB5 A;  1GC4 A;  2AY4 A;  2E7I A;  3JTX A;  1N8P A;  1WYV B;  4KYO A;  1PFF A;  4W1V A;  4GRX A;  3GSB A;  3PDB A;  3NU8 A;  1ZC9 A;  3NU7 A;  3AEN B;  1V2D A;  2HOR A;  1B9H A;  1M32 A;  4AZK A;  2W8J A;  2R5C B;  2AAT A;  2AY8 A;  1YIY A;  3MBB A;  1MDX A;  3MAD A;  4BQ0 A;  1AKA A;  4GSA A;  1ARH A;  2JG2 A;  4F5F A;  1YJY A;  1D7V A;  4UHM A;  2BWP A;  3E2F A;  4OBU A;  5EUE A;  5EUD A;  3FQ8 A;  3IHJ A;  2G6W A;  3AEL A;  2R0T A;  1AHE A;  3I5T A;  3M5U A;  3DZZ A;  3EI8 A;  3FKD A;  3E2Y A;  2GMS A;  3EIB A;  2AEU A;  3RQ1 A;  2D7Y A;  1W23 A;  3GET A; 
#chains in the Genus database with same CATH topology
 3AEM C;  1SZS A;  1LW5 A;  1KKP A;  1BJO A;  4W1W A;  3FVX A;  5JAY A;  4Q76 A;  3AOV A;  3W1I A;  2AY6 A;  2ZSM A;  4EMY A;  3FVU A;  1C7G A;  2VMT A;  4RKD A;  1S08 A;  4ZAS A;  2CJH A;  5BJ4 A;  2FNU A;  3LY1 A;  4ITG A;  2W7D A;  1M0Q A;  2PO3 A;  2W7E A;  3II0 A;  4ATP A;  3CBF A;  5DJ1 A;  1SFF A;  3F9T A;  4ZWM A;  5E5I A;  1EG5 A;  2BWO A;  3FDB A;  4A0R A;  2VMR A;  2W8V A;  1DFO A;  3LVM A;  4OMA A;  3WLX A;  2NMP A;  4B98 A;  3A8U X;  3QI6 A;  4K2I A;  2WKA A;  4ZLV A;  4TV7 A;  3BCX A;  3E2Z B;  2DR1 A;  3HVY A;  2HOX A;  2VIA A;  3PD6 A;  2W7M A;  1TOI A;  2HOZ A;  4B9B A;  3W1H A;  1EQB A;  3FD0 A;  4PFN A;  3ZRP A;  4XAU A;  4JF0 A;  1AJS B;  2CJG A;  3FZ7 A;  2R5E A;  4MSO A;  1G4V A;  1AHG A;  2O0R A;  4IYO A;  4MKK A;  5EIG B;  4EU1 A;  1RVY A;  2Q7W A;  1AJR A;  2X5F A;  4OYT A;  2ZY3 A;  3NYU A;  1M7Y A;  3IF2 A;  2CH1 A;  2YRR A;  3BV0 A;  3JW9 A;  4CVQ A;  2BIG A;  4AOA A;  1TOE A;  5M46 A;  3DU4 A;  4O6Z A;  1I48 A;  2OKK A;  2YKY A;  4KXK A;  1SPA A;  2VI8 A;  2Z20 A;  3AAT A;  1ASF A;  2D64 A;  1IAX A;  2Z9U A;  3TCM A;  8AAT A;  4ZWV A;  1TAS A;  2Z1Z A;  1PMM A;  4A0F A;  2VGS A;  1V2E A;  5EAV A;  3FZ6 A;  3DRD A;  1ZOB A;  1E5E A;  3EUC A;  4E3Q A;  3WKS A;  2ZYJ A;  3R9A A;  1AY4 A;  7AAT A;  1KL2 A;  5KTB A;  1IX8 A;  2WK8 A;  1OXO A;  2F8J A;  1B5P A;  2HUU A;  1ASB A;  1B9I A;  4A6T A;  2ZJG A;  5EQC A;  3PAA A;  3EI9 A;  4WXF A;  1ARS A;  2AEV A;  1VEF A;  2BI5 A;  3ASA A;  4AO9 A;  3FQ7 A;  2OAT A;  1D7U A;  3KKI A;  4IXZ A;  1ORD A;  3GJU A;  1TPL A;  2YRI A;  3BCA A;  1BQA A;  1D7R A;  2C0R A;  2VGU A;  4Y0D A;  4JEV A;  2AY5 A;  1CL1 A;  1CZE A;  1WST A;  4CBR A;  3ELE A;  2X3L A;  1BJN A;  3PGY A;  1AMQ A;  2ZY4 A;  3HLM A;  1I43 A;  2R5C A;  4ZSY A;  1LW4 A;  1GC3 A;  1AKC A;  4XEW A;  3LWS A;  1AHY A;  3FQA A;  3A9Y A;  1DGD A;  1S0A A;  4CXQ A;  5AX8 A;  3DR7 A;  1LC8 A;  2E54 A;  4ZDO A;  2W7H A;  3F6T A;  2JGT A;  1DJ9 A;  3DOD A;  2ZY5 A;  1ASL A;  2VYC A;  1FG3 A;  1KL1 A;  1TOK A;  3FDD A;  3VAX A;  5TF5 A;  1EJI A;  4E1O A;  4L0O A;  4PVF A;  3AEO A;  4W91 A;  2HUF A;  1ECX A;  4GEB A;  4ISY A;  4LNM A;  4LNL A;  1AAM A;  1C7O A;  2YOB A;  1X2A A;  5M49 A;  3WX9 A;  3GZD A;  4FFC A;  2OQX A;  2JJH A;  1DJE A;  1O4S A;  1ELU A;  1AY8 A;  4MQP A;  2EZ2 A;  3QM2 A;  4W5K A;  1LC7 A;  5D5S A;  2W7I A;  1CQ8 A;  2CY8 A;  3PDX A;  1MDZ A;  3AV7 A;  5FT4 A;  3CQ4 A;  1T3I A;  4LNJ A;  3N4X A;  4XQ2 A;  1ASD A;  3B46 A;  3E2Z A;  4MGR A;  1TAR A;  1YAA A;  3K7Y A;  1BKG A;  2QB2 A;  4Q31 A;  5G09 A;  2AY3 A;  4M2K A;  1AIB A;  4WB0 B;  4E77 A;  4F5L A;  2QMA A;  2W8T A;  4FL0 A;  1XEY A;  4OCA A;  4QGR A;  3DR4 A;  2VMX A;  2BI1 A;  4JF1 A;  1ASM A;  3PA9 A;  2GB3 A;  1V72 A;  4U2H A;  5G4I A;  2YKX A;  1YIZ A;  3NYT A;  4Q6R A;  4F5G A;  4IXS A;  1JF9 A;  2Z61 A;  1KMK A;  2QB3 A;  2BI9 A;  2DGM A;  1Z3Z A;  3OP7 A;  1LKC A;  4K2M A;  4WD2 A;  4F5K A;  4Y0H A;  3WZF A;  4A6R A;  3ATH A;  3BWN A;  2WB6 A;  2ZY2 A;  1UU0 A;  3RBL A;  3BB8 A;  3MAF A;  3FTB A;  4UHO A;  1MGV A;  4OT8 A;  5I92 A;  1RV3 A;  1Z7D A;  1BJ4 A;  1YNU A;  2DOU A;  2W8U A;  4WYD A;  2W7K A;  1CJ0 A;  2XH1 A;  3JWA A;  3RI6 A;  4NOG A;  3WKR A;  1ASC A;  3ELP A;  1X28 A;  2FQ6 A;  3NX3 A;  4RJ0 A;  3CQ6 A;  5FT5 A;  3ECD A;  4ZSW A;  3QHX A;  3R4T A;  3PIU A;  4RJY A;  1QJ3 A;  3T32 A;  1C9C A;  4ADE A;  4P3M A;  4RKC A;  4JEZ A;  1YJS A;  3KGX A;  4JEX A;  1DTY A;  1ARG A;  2YKV A;  4ADB A;  4JEY A;  3QGU A;  3WY7 A;  1IX6 A;  3USF A;  4H51 A;  2WK9 A;  4TMR A;  3RUY A;  3AEJ A;  3VOM A;  5FT8 A;  3AEP A;  1JS6 A;  2Z9X A;  1DGE A;  1GC2 A;  4RM1 A;  1BJW A;  3GZD C;  4UHN A;  3MKJ A;  3NUB A;  4A00 A;  2VGV A;  1IX7 A;  2WK7 A;  3MC6 A;  4KAM A;  3H7F A;  4XJO A;  5K8B A;  3G7Q A;  4XJM A;  2AY9 A;  3GZC A;  2ZSL A;  1GEY A;  4WYF A;  4J5U A;  2YHK A;  1OXP A;  1JS3 A;  4MY5 A;  2BYJ A;  3EI7 A;  2QSR A;  4PIW A;  4ITX A;  3GWP A;  1B8G A;  1PMO A;  1QJ5 A;  2VMU A;  2Z9V A;  3UAK A;  1I41 A;  4R5Z A;  2KFP A;  1SVV A;  2CAN A;  2ZUK A;  2EPJ A;  3FCR A;  1VP4 A;  4E3R A;  4J8L A;  4OTL A;  3FFR A;  4F4E A;  2W8W A;  4IW7 A;  2AY2 A;  1UKJ A;  2DGK A;  4HVK A;  1X0M A;  2V1P A;  1M0O A;  4AZJ A;  4IY7 A;  3FSL A;  1AAW A;  4P7Y A;  1ZOD A;  1H0C A;  4OC9 A;  2DKB A;  3JU7 A;  1WYV A;  1M4N A;  4A0G A;  3COG A;  3GR9 A;  3TAT A;  2AY1 A;  1I29 A;  3BWN C;  1RV4 A;  2OGA A;  5E3K A;  2FYF A;  1AHF A;  3CQ5 A;  2DGL A;  3BWO A;  2VMN A;  1GDE A;  1OHY A;  3AEN A;  2C7T A;  2D65 A;  2JJE A;  4CXR A;  4DGT A;  3MEB A;  3LG0 A;  2CJD A;  2G7J A;  3N4S A;  1IAY A;  1WYT B;  3EI6 A;  3N5M A;  1FC4 A;  2OGE A;  1S07 A;  2GSA A;  4WB0 A;  2BYL A;  3H14 A;  3HQT A;  4WYE A;  2YCP A;  3I16 A;  1LK9 A;  1Y4I A;  2HUI A;  2VMO A;  4BMK A;  4ZDP A;  1CS1 A;  4K2B A;  4ZM3 A;  2CTZ A;  2VGZ A;  4IYO B;  3G0T A;  1O69 A;  4ZM4 A;  1MLZ A;  2ZC0 A;  3PJ0 A;  4GDY A;  1G4X A;  2E7J A;  2ZP7 A;  3VK3 A;  5C6U A;  4WLJ A;  4K05 A;  1W7N A;  2CB1 A;  1AMA A;  3ASB A;  4N0W A;  3ACZ A;  5LHA A;  3AEJ C;  1KKJ A;  3E6G A;  3EZS A;  1CZC A;  1GEW A;  3QN6 A;  1D2F A;  4GE9 A;  3TFU A;  1FG7 A;  2XBN A;  4I8A A;  4IX8 A;  1P3W A;  2EZ1 A;  2EH6 A;  1PG8 A;  3EIA A;  3MC6 C;  1AHX A;  3TFT A;  2GQN A;  4Y0I A;  3JWB A;  3ZRR A;  1AIC A;  1WYU B;  2PB2 A;  4RIZ A;  2VLH A;  3A9Z A;  3B1C A;  2FKI A;  4DQ6 A;  3DYD A;  3NYS A;  3ZZJ A;  1UU2 A;  2ORD A;  3NTJ A;  3UWC A;  1M6S A;  2CFB A;  3TQX A;  1ART A;  5M4D A;  3RBF A;  3B1E A;  1QIR A;  2X5D A;  2YKU A;  4RIT A;  5EFS A;  3NNK A;  2EO5 A;  1UU1 A;  2D63 A;  3VK4 A;  3P1T A;  2VMS A;  3BS8 A;  4LC3 A;  5G2P A;  2QLR A;  2JJF A;  3N0L A;  4N0B A;  4BHD A;  4IXO A;  1AJS A;  3Q8N A;  1TOG A;  2HP1 A;  3LV2 A;  5G2Q A;  3PPL A;  3CAI A;  5EIG A;  3FRK A;  1ELQ A;  5F9S A;  1QZ9 A;  2O7C A;  3DC1 A;  4R5F A;  2VGW A;  2D5Y A;  3B8X A;  1J04 A;  3NUI A;  1LS3 A;  1B5O A;  3N75 A;  4ZDL A;  1ASE A;  3ZRQ A;  2D66 A;  2BWN A;  3BC8 A;  4ADC A;  1E5F A;  1CL2 A;  4XK1 A;  3FFH A;  1DKA A;  3HDO A;  2QA3 A;  1OHW A;  4UOY A;  4EFF A;  5G4J A;  3E77 A;  1B4X A;  3P6K A;  4CBS A;  3A2B A;  2BIA A;  4F5I A;  3BCB A;  4MQR A;  5F8V A;  9AAT A;  4F5J A;  1IJI A;  1S09 A;  1SZK A;  2JJG A;  1MDO A;  5E4Z A;  1O62 A;  2FM1 A;  1JG8 A;  2BHX A;  1C4K A;  4W1X A;  3RCH B;  4WBT A;  1W7M A;  4MKJ A;  1N2T A;  4WYG A;  3VP6 A;  3W1J A;  4LW4 A;  1ASN A;  1SZU A;  5FT6 A;  2VIB A;  1YOO A;  4AH3 A;  2HZP A;  4DBC A;  5HDM A;  3OKS A;  4WLH A;  1SF2 A;  5BJ3 A;  4U1T A;  1CQ6 A;  3ZZK A;  4TN4 A;  3G8M A;  2QBT A;  1M0P A;  4GE4 A;  1V2F A;  2O1B A;  4OBV A;  1X29 A;  1M0N A;  3ISL A;  3DXV A;  4JE5 A;  3L44 A;  1AMR A;  2D7Z A;  3WGB A;  2A1V A;  1AMS A;  2BI2 A;  3E9K A;  3PDB B;  1S06 A;  4F5H A;  1WYT A;  4WXB A;  2BI3 A;  1XI9 A;  2YCT A;  1BS0 A;  1G7W A;  4RLG A;  3LVK A;  4WP0 A;  4RAE A;  2V0Y A;  3EI5 A;  4WYA A;  3N7N A;  2VMZ A;  1MAQ A;  2BKW A;  1QIS A;  2VGT A;  1AKB A;  3K28 A;  3NDN A;  2FN6 A;  3EZ1 A;  4WYC A;  2VMP A;  3D6K A;  4W8I A;  4R2N A;  1KMJ A;  3L8A A;  2GMU A;  1IUG A;  2VLF A;  4M2J A;  1WKH A;  4F5M A;  4ZAH A;  1H1C A;  1D7S A;  5EAA A;  5G0A A;  2R2N A;  1OAT A;  3I4J A;  3UE8 A;  2VMY A;  2TPL A;  1BJO B;  2VI9 A;  3B1D A;  3DXW A;  3K40 A;  3WCO A;  2E7U A;  3FVS A;  4GE7 A;  1J32 A;  2EGY A;  1YJZ A;  2CIN A;  2W7G A;  1WYU A;  1BQD A;  3MAF B;  3KGW A;  4UQV A;  5J8Q A;  1GEX A;  1RVU A;  1GC0 A;  4WXG A;  4BA4 A;  1AX4 A;  4JE5 D;  4A6U A;  4A72 A;  2W7L A;  4EB5 A;  2CH2 A;  1QGN A;  4LW2 A;  2PB0 A;  3F0H A;  2OKJ A;  2D61 A;  1QIT A;  2EYQ A;  3HBX A;  2HOY A;  1GBN A;  5DJ9 A;  1G7X A;  5D95 A;  1O61 A;  1MAP A;  3MAU A;  1ARI A;  2JIS A;  3PD6 B;  4XJL A;  4Q75 A;  2DKJ A;  5HXX A;  5IWQ A;  1TAT A;  3JZL A;  1AIA A;  2C44 A;  2VMV A;  4XJP A;  3AEM A;  4ATQ A;  5LH9 A;  4PFF A;  1MLY A;  3H9X A;  2X8U A;  1U08 A;  1IVR A;  4M2M A;  3LVL B;  1GCK A;  3WGC A;  4AO4 A;  1LC5 A;  3HMU A;  2W7J A;  4HF8 A;  4R8D A;  1WKG A;  3BN1 A;  1BT4 A;  3A9X A;  3GBX A;  5EUN A;  2AY7 A;  4MQQ A;  1C7N A;  1C0N A;  1N31 A;  4EB7 A;  2VMW A;  2CST A;  3WCN A;  1W7L A;  1AY5 A;  3VK2 A;  4JEW A;  2C81 A;  3LVJ A;  2FNI A;  2YCN A;  3RCH A;  3FZ8 A;  1DJU A;  1OHV A;  1VJO A;  2Z67 A;  4A0H A;  2VMQ A;  2BIE A;  1ASA A;  3QBO A;  3AOW A;  1IBJ A;  5M4B A;  1CQ7 A;  1GD9 A;  2Z1Y A;  3KE3 A;  1ASG A;  2Z9W A;  4BA5 A;  5DX5 A;  2HP2 A;  2W7F A;  3QPG A;  2RFV A;  4ADD A;  3NRA A;  1BW0 A;  3HT4 A;  3HL2 A;  5HHY A;  1W3U A;  1TOJ A;  5DB5 A;  1GC4 A;  2AY4 A;  2E7I A;  3JTX A;  1N8P A;  1WYV B;  4KYO A;  1PFF A;  4W1V A;  4GRX A;  3GSB A;  3PDB A;  3NU8 A;  1ZC9 A;  3NU7 A;  3AEN B;  1V2D A;  2HOR A;  1B9H A;  1M32 A;  4AZK A;  2W8J A;  2R5C B;  4H63 Q;  2AAT A;  2AY8 A;  3N4R A;  1YIY A;  3MBB A;  1KAF A;  1MDX A;  3MAD A;  4BQ0 A;  1AKA A;  4GSA A;  1ARH A;  2JG2 A;  4F5F A;  1YJY A;  1D7V A;  4UHM A;  2BWP A;  3E2F A;  4OBU A;  5EUE A;  5EUD A;  3FQ8 A;  3IHJ A;  2G6W A;  3AEL A;  2R0T A;  1AHE A;  3I5T A;  3M5U A;  3DZZ A;  3EI8 A;  3FKD A;  3E2Y A;  2GMS A;  3EIB A;  2AEU A;  3RQ1 A;  2D7Y A;  1W23 A;  3GET A; 
#chains in the Genus database with same CATH homology
 3AEM C;  1SZS A;  1LW5 A;  1KKP A;  1BJO A;  4W1W A;  3FVX A;  5JAY A;  4Q76 A;  3AOV A;  3W1I A;  2AY6 A;  2ZSM A;  4EMY A;  3FVU A;  1C7G A;  2VMT A;  4RKD A;  1S08 A;  4ZAS A;  2CJH A;  5BJ4 A;  2FNU A;  3LY1 A;  4ITG A;  2W7D A;  1M0Q A;  2PO3 A;  2W7E A;  3II0 A;  4ATP A;  3CBF A;  5DJ1 A;  1SFF A;  3F9T A;  4ZWM A;  5E5I A;  1EG5 A;  2BWO A;  3FDB A;  4A0R A;  2VMR A;  2W8V A;  1DFO A;  3LVM A;  4OMA A;  3WLX A;  2NMP A;  4B98 A;  3A8U X;  3QI6 A;  4K2I A;  2WKA A;  4ZLV A;  4TV7 A;  3BCX A;  3E2Z B;  2DR1 A;  3HVY A;  2HOX A;  2VIA A;  3PD6 A;  2W7M A;  1TOI A;  2HOZ A;  4B9B A;  3W1H A;  1EQB A;  3FD0 A;  4PFN A;  3ZRP A;  4XAU A;  4JF0 A;  1AJS B;  2CJG A;  3FZ7 A;  2R5E A;  4MSO A;  1G4V A;  1AHG A;  2O0R A;  4IYO A;  4MKK A;  5EIG B;  4EU1 A;  1RVY A;  2Q7W A;  1AJR A;  2X5F A;  4OYT A;  2ZY3 A;  3NYU A;  1M7Y A;  3IF2 A;  2CH1 A;  2YRR A;  3BV0 A;  3JW9 A;  4CVQ A;  2BIG A;  4AOA A;  1TOE A;  5M46 A;  3DU4 A;  4O6Z A;  1I48 A;  2OKK A;  2YKY A;  4KXK A;  1SPA A;  2VI8 A;  2Z20 A;  3AAT A;  1ASF A;  2D64 A;  1IAX A;  2Z9U A;  3TCM A;  8AAT A;  4ZWV A;  1TAS A;  2Z1Z A;  1PMM A;  4A0F A;  2VGS A;  1V2E A;  5EAV A;  3FZ6 A;  3DRD A;  1ZOB A;  1E5E A;  3EUC A;  4E3Q A;  3WKS A;  2ZYJ A;  3R9A A;  1AY4 A;  7AAT A;  1KL2 A;  5KTB A;  1IX8 A;  2WK8 A;  1OXO A;  2F8J A;  1B5P A;  2HUU A;  1ASB A;  1B9I A;  4A6T A;  2ZJG A;  5EQC A;  3PAA A;  3EI9 A;  4WXF A;  1ARS A;  2AEV A;  1VEF A;  2BI5 A;  3ASA A;  4AO9 A;  3FQ7 A;  2OAT A;  1D7U A;  3KKI A;  4IXZ A;  1ORD A;  3GJU A;  1TPL A;  2YRI A;  3BCA A;  1BQA A;  1D7R A;  2C0R A;  2VGU A;  4Y0D A;  4JEV A;  2AY5 A;  1CL1 A;  1CZE A;  1WST A;  4CBR A;  3ELE A;  2X3L A;  1BJN A;  3PGY A;  1AMQ A;  2ZY4 A;  3HLM A;  1I43 A;  2R5C A;  4ZSY A;  1LW4 A;  1GC3 A;  1AKC A;  4XEW A;  3LWS A;  1AHY A;  3FQA A;  3A9Y A;  1DGD A;  1S0A A;  4CXQ A;  5AX8 A;  3DR7 A;  1LC8 A;  2E54 A;  4ZDO A;  2W7H A;  3F6T A;  2JGT A;  1DJ9 A;  3DOD A;  2ZY5 A;  1ASL A;  2VYC A;  1FG3 A;  1KL1 A;  1TOK A;  3FDD A;  3VAX A;  5TF5 A;  1EJI A;  4E1O A;  4L0O A;  4PVF A;  3AEO A;  4W91 A;  2HUF A;  1ECX A;  4GEB A;  4ISY A;  4LNM A;  4LNL A;  1AAM A;  1C7O A;  2YOB A;  1X2A A;  5M49 A;  3WX9 A;  3GZD A;  4FFC A;  2OQX A;  2JJH A;  1DJE A;  1O4S A;  1ELU A;  1AY8 A;  4MQP A;  2EZ2 A;  3QM2 A;  4W5K A;  1LC7 A;  5D5S A;  2W7I A;  1CQ8 A;  2CY8 A;  3PDX A;  1MDZ A;  3AV7 A;  5FT4 A;  3CQ4 A;  1T3I A;  4LNJ A;  3N4X A;  4XQ2 A;  1ASD A;  3B46 A;  3E2Z A;  4MGR A;  1TAR A;  1YAA A;  3K7Y A;  1BKG A;  2QB2 A;  4Q31 A;  5G09 A;  2AY3 A;  4M2K A;  1AIB A;  4WB0 B;  4E77 A;  4F5L A;  2QMA A;  2W8T A;  4FL0 A;  1XEY A;  4OCA A;  4QGR A;  3DR4 A;  2VMX A;  2BI1 A;  4JF1 A;  1ASM A;  3PA9 A;  2GB3 A;  1V72 A;  4U2H A;  5G4I A;  2YKX A;  1YIZ A;  3NYT A;  4Q6R A;  4F5G A;  4IXS A;  1JF9 A;  2Z61 A;  1KMK A;  2QB3 A;  2BI9 A;  2DGM A;  1Z3Z A;  3OP7 A;  1LKC A;  4K2M A;  4WD2 A;  4F5K A;  4Y0H A;  3WZF A;  4A6R A;  3ATH A;  3BWN A;  2WB6 A;  2ZY2 A;  1UU0 A;  3RBL A;  3BB8 A;  3MAF A;  3FTB A;  4UHO A;  1MGV A;  4OT8 A;  5I92 A;  1RV3 A;  1Z7D A;  1BJ4 A;  1YNU A;  2DOU A;  2W8U A;  4WYD A;  2W7K A;  1CJ0 A;  2XH1 A;  3JWA A;  3RI6 A;  4NOG A;  3WKR A;  1ASC A;  3ELP A;  1X28 A;  2FQ6 A;  3NX3 A;  4RJ0 A;  3CQ6 A;  5FT5 A;  3ECD A;  4ZSW A;  3QHX A;  3R4T A;  3PIU A;  4RJY A;  1QJ3 A;  3T32 A;  1C9C A;  4ADE A;  4P3M A;  4RKC A;  4JEZ A;  1YJS A;  3KGX A;  4JEX A;  1DTY A;  1ARG A;  2YKV A;  4ADB A;  4JEY A;  3QGU A;  3WY7 A;  1IX6 A;  3USF A;  4H51 A;  2WK9 A;  4TMR A;  3RUY A;  3AEJ A;  3VOM A;  5FT8 A;  3AEP A;  1JS6 A;  2Z9X A;  1DGE A;  1GC2 A;  4RM1 A;  1BJW A;  3GZD C;  4UHN A;  3MKJ A;  3NUB A;  4A00 A;  2VGV A;  1IX7 A;  2WK7 A;  3MC6 A;  4KAM A;  3H7F A;  4XJO A;  5K8B A;  3G7Q A;  4XJM A;  2AY9 A;  3GZC A;  2ZSL A;  1GEY A;  4WYF A;  4J5U A;  2YHK A;  1OXP A;  1JS3 A;  4MY5 A;  2BYJ A;  3EI7 A;  2QSR A;  4PIW A;  4ITX A;  3GWP A;  1B8G A;  1PMO A;  1QJ5 A;  2VMU A;  2Z9V A;  3UAK A;  1I41 A;  4R5Z A;  2KFP A;  1SVV A;  2CAN A;  2ZUK A;  2EPJ A;  3FCR A;  1VP4 A;  4E3R A;  4J8L A;  4OTL A;  3FFR A;  4F4E A;  2W8W A;  4IW7 A;  2AY2 A;  1UKJ A;  2DGK A;  4HVK A;  1X0M A;  2V1P A;  1M0O A;  4AZJ A;  4IY7 A;  3FSL A;  1AAW A;  4P7Y A;  1ZOD A;  1H0C A;  4OC9 A;  2DKB A;  3JU7 A;  1WYV A;  1M4N A;  4A0G A;  3COG A;  3GR9 A;  3TAT A;  2AY1 A;  1I29 A;  3BWN C;  1RV4 A;  2OGA A;  5E3K A;  2FYF A;  1AHF A;  3CQ5 A;  2DGL A;  3BWO A;  2VMN A;  1GDE A;  1OHY A;  3AEN A;  2C7T A;  2D65 A;  2JJE A;  4CXR A;  4DGT A;  3MEB A;  3LG0 A;  2CJD A;  2G7J A;  3N4S A;  1IAY A;  1WYT B;  3EI6 A;  3N5M A;  1FC4 A;  2OGE A;  1S07 A;  2GSA A;  4WB0 A;  2BYL A;  3H14 A;  3HQT A;  4WYE A;  2YCP A;  3I16 A;  1LK9 A;  1Y4I A;  2HUI A;  2VMO A;  4BMK A;  4ZDP A;  1CS1 A;  4K2B A;  4ZM3 A;  2CTZ A;  2VGZ A;  4IYO B;  3G0T A;  1O69 A;  4ZM4 A;  1MLZ A;  2ZC0 A;  3PJ0 A;  4GDY A;  1G4X A;  2E7J A;  2ZP7 A;  3VK3 A;  5C6U A;  4WLJ A;  4K05 A;  1W7N A;  2CB1 A;  1AMA A;  3ASB A;  4N0W A;  3ACZ A;  5LHA A;  3AEJ C;  1KKJ A;  3E6G A;  3EZS A;  1CZC A;  1GEW A;  3QN6 A;  1D2F A;  4GE9 A;  3TFU A;  1FG7 A;  2XBN A;  4I8A A;  4IX8 A;  1P3W A;  2EZ1 A;  2EH6 A;  1PG8 A;  3EIA A;  3MC6 C;  1AHX A;  3TFT A;  2GQN A;  4Y0I A;  3JWB A;  3ZRR A;  1AIC A;  1WYU B;  2PB2 A;  4RIZ A;  2VLH A;  3A9Z A;  3B1C A;  2FKI A;  4DQ6 A;  3DYD A;  3NYS A;  3ZZJ A;  1UU2 A;  2ORD A;  3NTJ A;  3UWC A;  1M6S A;  2CFB A;  3TQX A;  1ART A;  5M4D A;  3RBF A;  3B1E A;  1QIR A;  2X5D A;  2YKU A;  4RIT A;  5EFS A;  3NNK A;  2EO5 A;  1UU1 A;  2D63 A;  3VK4 A;  3P1T A;  2VMS A;  3BS8 A;  4LC3 A;  5G2P A;  2QLR A;  2JJF A;  3N0L A;  4N0B A;  4BHD A;  4IXO A;  1AJS A;  3Q8N A;  1TOG A;  2HP1 A;  3LV2 A;  5G2Q A;  3PPL A;  3CAI A;  5EIG A;  3FRK A;  1ELQ A;  5F9S A;  1QZ9 A;  2O7C A;  3DC1 A;  4R5F A;  2VGW A;  2D5Y A;  3B8X A;  1J04 A;  3NUI A;  1LS3 A;  1B5O A;  3N75 A;  4ZDL A;  1ASE A;  3ZRQ A;  2D66 A;  2BWN A;  3BC8 A;  4ADC A;  1E5F A;  1CL2 A;  4XK1 A;  3FFH A;  1DKA A;  3HDO A;  2QA3 A;  1OHW A;  4UOY A;  4EFF A;  5G4J A;  3E77 A;  1B4X A;  3P6K A;  4CBS A;  3A2B A;  2BIA A;  4F5I A;  3BCB A;  4MQR A;  5F8V A;  9AAT A;  4F5J A;  1IJI A;  1S09 A;  1SZK A;  2JJG A;  1MDO A;  5E4Z A;  1O62 A;  2FM1 A;  1JG8 A;  2BHX A;  1C4K A;  4W1X A;  3RCH B;  4WBT A;  1W7M A;  4MKJ A;  1N2T A;  4WYG A;  3VP6 A;  3W1J A;  4LW4 A;  1ASN A;  1SZU A;  5FT6 A;  2VIB A;  1YOO A;  4AH3 A;  2HZP A;  4DBC A;  5HDM A;  3OKS A;  4WLH A;  1SF2 A;  5BJ3 A;  4U1T A;  1CQ6 A;  3ZZK A;  4TN4 A;  3G8M A;  2QBT A;  1M0P A;  4GE4 A;  1V2F A;  2O1B A;  4OBV A;  1X29 A;  1M0N A;  3ISL A;  3DXV A;  4JE5 A;  3L44 A;  1AMR A;  2D7Z A;  3WGB A;  2A1V A;  1AMS A;  2BI2 A;  3E9K A;  3PDB B;  1S06 A;  4F5H A;  1WYT A;  4WXB A;  2BI3 A;  1XI9 A;  2YCT A;  1BS0 A;  1G7W A;  4RLG A;  3LVK A;  4WP0 A;  4RAE A;  2V0Y A;  3EI5 A;  4WYA A;  3N7N A;  2VMZ A;  1MAQ A;  2BKW A;  1QIS A;  2VGT A;  1AKB A;  3K28 A;  3NDN A;  2FN6 A;  3EZ1 A;  4WYC A;  2VMP A;  3D6K A;  4W8I A;  4R2N A;  1KMJ A;  3L8A A;  2GMU A;  1IUG A;  2VLF A;  4M2J A;  1WKH A;  4F5M A;  4ZAH A;  1H1C A;  1D7S A;  5EAA A;  5G0A A;  2R2N A;  1OAT A;  3I4J A;  3UE8 A;  2VMY A;  2TPL A;  1BJO B;  2VI9 A;  3B1D A;  3DXW A;  3K40 A;  3WCO A;  2E7U A;  3FVS A;  4GE7 A;  1J32 A;  2EGY A;  1YJZ A;  2CIN A;  2W7G A;  1WYU A;  1BQD A;  3MAF B;  3KGW A;  4UQV A;  5J8Q A;  1GEX A;  1RVU A;  1GC0 A;  4WXG A;  4BA4 A;  1AX4 A;  4JE5 D;  4A6U A;  4A72 A;  2W7L A;  4EB5 A;  2CH2 A;  1QGN A;  4LW2 A;  2PB0 A;  3F0H A;  2OKJ A;  2D61 A;  1QIT A;  2EYQ A;  3HBX A;  2HOY A;  1GBN A;  5DJ9 A;  1G7X A;  5D95 A;  1O61 A;  1MAP A;  3MAU A;  1ARI A;  2JIS A;  3PD6 B;  4XJL A;  4Q75 A;  2DKJ A;  5HXX A;  5IWQ A;  1TAT A;  3JZL A;  1AIA A;  2C44 A;  2VMV A;  4XJP A;  3AEM A;  4ATQ A;  5LH9 A;  4PFF A;  1MLY A;  3H9X A;  2X8U A;  1U08 A;  1IVR A;  4M2M A;  3LVL B;  1GCK A;  3WGC A;  4AO4 A;  1LC5 A;  3HMU A;  2W7J A;  4HF8 A;  4R8D A;  1WKG A;  3BN1 A;  1BT4 A;  3A9X A;  3GBX A;  5EUN A;  2AY7 A;  4MQQ A;  1C7N A;  1C0N A;  1N31 A;  4EB7 A;  2VMW A;  2CST A;  3WCN A;  1W7L A;  1AY5 A;  3VK2 A;  4JEW A;  2C81 A;  3LVJ A;  2FNI A;  2YCN A;  3RCH A;  3FZ8 A;  1DJU A;  1OHV A;  1VJO A;  2Z67 A;  4A0H A;  2VMQ A;  2BIE A;  1ASA A;  3QBO A;  3AOW A;  1IBJ A;  5M4B A;  1CQ7 A;  1GD9 A;  2Z1Y A;  3KE3 A;  1ASG A;  2Z9W A;  4BA5 A;  5DX5 A;  2HP2 A;  2W7F A;  3QPG A;  2RFV A;  4ADD A;  3NRA A;  1BW0 A;  3HT4 A;  3HL2 A;  5HHY A;  1W3U A;  1TOJ A;  5DB5 A;  1GC4 A;  2AY4 A;  2E7I A;  3JTX A;  1N8P A;  1WYV B;  4KYO A;  1PFF A;  4W1V A;  4GRX A;  3GSB A;  3PDB A;  3NU8 A;  1ZC9 A;  3NU7 A;  3AEN B;  1V2D A;  2HOR A;  1B9H A;  1M32 A;  4AZK A;  2W8J A;  2R5C B;  4H63 Q;  2AAT A;  2AY8 A;  3N4R A;  1YIY A;  3MBB A;  1MDX A;  3MAD A;  4BQ0 A;  1AKA A;  4GSA A;  1ARH A;  2JG2 A;  4F5F A;  1YJY A;  1D7V A;  4UHM A;  2BWP A;  3E2F A;  4OBU A;  5EUE A;  5EUD A;  3FQ8 A;  3IHJ A;  2G6W A;  3AEL A;  2R0T A;  1AHE A;  3I5T A;  3M5U A;  3DZZ A;  3EI8 A;  3FKD A;  3E2Y A;  2GMS A;  3EIB A;  2AEU A;  3RQ1 A;  2D7Y A;  1W23 A;  3GET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...