2QC5A

Streptogramin b lyase structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
298
structure length
298
Chain Sequence
SEAWMNFYLEEFNLSIPDSGPYGITSSEDGKVWFTQHKANKISSLDQSGRIKEFEVPTPDAKVMCLIVSSLGDIWFTENGANKIGKLSKKGGFTEYPLPQPDSGPYGITEGLNGDIWFTQLNGDRIGKLTADGTIYEYDLPNKGSYPAFITLGSDNALWFTENQNNSIGRITNTGKLEEYPLPTNAAAPVGITSGNDGALWFVEIMGNKIGRITTTGEISEYDIPTPNARPHAITAGKNSEIWFTEWGANQIGRITNDNTIQEYQLQTENAEPHGITFGKDGSVWFALKCKIGKLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mechanism of the Staphylococcus cohnii virginiamycin B lyase (Vgb).
pubmed doi rcsb
source organism Staphylococcus cohnii
molecule tags Lyase
molecule keywords Streptogramin B lactonase
total genus 70
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2qc5A00
5HE2B 3FRXA 4O3TB 5FLXg 3I89A 4FHLA 2J55H 3I7HA 2HESX 2XL2A 3IJ1A 3E0CA 4D6VA 2B5MA 4FA9D 4LG8A 3V9FA 4CI2A 2I3TA 2AGLA 4JSXC 3B7FA 2HXCA 2BCJB 4XEIC 3SLED 5IC7A 3PE7A 4JT6C 5GXIA 1QNIA 4TZ4A 2IWKA 3VA6A 2PM7B 3SHFA 1JMXB 1GP2B 4L9OA 4L1QD 2HKRA 4A0BB 4LGNA 2H47A 3CFSB 4QQEA 2B5NA 3OKWA 4K3ID 5HE1B 2YNOA 2AGWA 2H6NA 2OJYA 3ULEC 1P22A 3OKYB 5I5JA 1PEVA 4CY1A 2H6KA 4CZVA 2YBAA 1JMZB 2GNQA 5TEEA 1K8KC 4HDJA 2J56H 4J86A 3EI2A 5TEFA 3SWSD 3AFCA 3EI1A 5IJ8E 4GZ8A 5AJAA 4BH6A 4O3UB 4FWWA 3W15A 4BUJC 4O9DA 2H9LA 3IJCA 3RN0D 3K27A 4O45A 4J78A 3DWLC 4JSVC 3ORVD 4JXMA 3EI2B 4XYIA 3U4YA 4GGAA 3FM0A 3UR4A 4PC0A 4FA4D 5EARA 5EAMA 4ZN4A 3OTTA 3SBRA 2CNXA 4X3EA 3SBQA 4A11A 4QL1A 3EI3B 4X63B 5JWZA 4UI9R 2PM9A 3JAMg 3CFVA 2CO0C 2OVPB 3OKYA 4Z8LA 5GXHA 3FGBA 3ODTA 3BG0A 3I8CA 3RSEC 3PXWD 5HE3B 4N14A 5B4WA 3RRMC 2OVQB 2H13A 4ZOVA 4J79A 2H68A 2GC4A 4KFMB 3N0DA 4A0AB 4J82A 4ERYA 3J81g 4GM9A 5CXCB 1N6EA 1PGUA 3JRPA 2H14A 3SJLD 4FAVD 3SN6B 3EI1B 3RFHA 3I8EA 2HJ4A 4CY5A 1MDAH 2IUPA 4FA5D 5H1MA 4MK0B 3JZHA 3JZNA 1GG2B 4CY2A 4A08B 3C75H 3MKSB 4G56B 5EMLB 2AQ5A 4FA1D 2CN2A 2PM9B 2B4EA 4QRJA 4R7AB 1B9YA 2EBSA 2Z2NA 1NEXB 4GGDA 2TRCB 2HYEA 3EWEA 3ZWLB 3PXTD 4GQ1A 2UZYB 2CE8A 1GXRA 2J57G 5HE0B 3PVUB 4PSXB 4JT5C 2IAAA 1R5MA 1Q47A 1JOFA 1FWXA 3EI4B 5IGOA 3PVWB 3JZGA 4U7AA 3EI4A 1B9XA 4Y5RD 5AMSA 4CC9A 4PBZA 3EG6A 2P9KC 4J77A 5TF2A 2H6QA 4PNKB 3RN1D 5IJ7E 4AOWA 1MG3A 4GQ2P 3SXTD 2Z2PA 2CN3A 5HQGA 2IUVA 2H3XA 4E54B 1OMWB 3EU7A 1NR0A 3A0FA 4A2LA 1A0RB 5H14A 4GM3A 2AGXA 2OK6A 5CYKA 4J81A 5C9ZB 5AFU3 3SCYA 3C99A 3K26A 3OL2A 3AL9A 3RLMD 5THAA 2AH0A 3BG1A 4ERQA 3GFCA 3OW8A 3PXSD 2I0SA 4L3HD 3PSCB 2H9PA 3MZLA 4J0WA 1N6FA 2PM6B 4Y7RA 3NVQA 3UKUC 4AEZA 2XL3A 3JROA 4CI3A 2YMUA 3J80g 3UVKA 2GC7A 4XYHA 5SXMA 4LG9A 1XKSA 2P9IC 1PI6A 2CE9A 1RI6A 1SHYB 1XIPA 3I7LA 3KRXB 2P9SC 3IIYA 3L4OD 3MXXA 3UVNA 4CZYA 2W18A 3UKRC 2AGZA 4PBYA 3DXMC 4EWRA 3NVXA 3SFZA 1GOTB 4PXWA 1JJUB 1SQJA 3MZKA 3F3FA 2YNNA 3VH0A 3HFQA 2XYIA 4CY3A 4A0AA 2G99A 1TYQC 4CI1A 5FKTA 4A09B 4CI8A 5C2VB 1TBGA 5FXYA 3I7NA 4E54A 4ESGA 4A09A 3I7KA 4H5IA 1U2VC 5CYKB 1MG2A 2YNPA 2OIZA 4BL0A 4K3JB 3OKTA 3V5WB 2PBIB 2P9PC 3L4MD 4A7JA 4H5JA 4CZXA 1XHMA 4YVDA 2AGYA 5GSAA 3SBPA 3I7OA 2G9AA 5FA5B 4JD2C 5CXBB 3VGZA 3F3PA 5FQDA 3EMHA 1VYHC 1SQ9A 4L3GD 3MMYA 2QC5A 2I0RA 3AH8B 2XU7A 5A2Qg 1N6DA 3CIKB 1U4CA 4O1QD 3I7PA 2QXVA 5EAPA 4E5ZB 5C2WB 3GREA 2P9UC 4GMBA 4OWRA 5I5MA 3BWSA 3IKOA 4ERZA 2IWFA 3SVWD 2Z2OA 4E5ZA 3NVNA 4JSPC 2H9MA 2YB8B 5EM2A 4ZOYA 5GMKn 4J8BA 2AH1A 4ZOZA 3V7DB 4JSNC 4QT8A 3AL8A 3P4FA 3F3GA 5IT9g 4X60B 2IUQA 3DXKC 5CXCA 4PSWB 2Q7QA 5I5IA 4FAND 5TDHB 2HJBA 2OK4A 2O9KA 2H9NA 2BBKH 4ES0A 4A08A 5FKSA 3UVLA 5EMMB 4GQBB 1PBYB 4J87A 4GGCA 3C9CA 2CO0A 5FKQA 2I0TA 3UVMA 1ERJA 4J84A 2IURA 2OVRB 1L0QA 3EI3A 4U1EI 3DM0A 2I3SA 4I79A 5EALA 4J0XA 2B5LA 4A0BA 1S4UX 4IMMA 3RFGA 1OLZA 4X61B 4OZUA 4FB1D 2HKMA 4A11B 4ZOXA 4GM8A 3C5MA 5CXBA 3UVOA 5H17A 4A2MA 5IGQA 3MKQA 3JPXA 3N0EA 5EM2B 3SMRA 3I2NA 4IA9A 3IJ0A 3JB9L 5EMJB 5K19A 3DSMA 4J73A 4J8GA 4D0KA 3AL8B 5EMKB 3RMZD 5KDOB 1K32A 1YFQA 3PSLA 2P9NC 2UZXB 2MTAH 3IIWA 3KRWB 5FKRA 5K1CC 4NSXA 5HYNB 2P9LC 3OL2B
chains in the Genus database with same CATH superfamily
5HE2B 3FRXA 3FCSA 4DNVA 4O3TB 5FLXg 2VDLA 3I89A 1UOQA 4FHLA 4G1MA 1M1XA 2J55H 3I7HA 4G1EA 2HESX 2XL2A 3IJ1A 3NIDA 3E0CA 4D6VA 2B5MA 4RE6A 4FA9D 3IVMA 4LG8A 3V9FA 4CI2A 2I3TA 2AGLA 4JSXC 3B7FA 2HXCA 1QFSA 2BCJB 4XEIC 3SLED 5IC7A 3PE7A 4JT6C 5GXIA 1QNIA 4TZ4A 2IWKA 4AN0A 3VA6A 2PM7B 3SHFA 1JMXB 1GP2B 4L9OA 4L1QD 2HKRA 4A0BB 4LGNA 2H47A 3CFSB 4QQEA 2B5NA 3OKWA 1U8CA 4K3ID 3IUJA 5HE1B 3K71A 2YNOA 2AGWA 2H6NA 2OJYA 3ULEC 1P22A 3OKYB 5M5UA 5I5JA 2VDNA 1PEVA 4CY1A 2H6KA 4CZVA 2YBAA 1JMZB 3NIFA 2GNQA 5TEEA 1K8KC 4HDJA 2J56H 4J86A 3EI2A 3IUNA 1H2XA 5TEFA 3SWSD 3AFCA 3EI1A 5IJ8E 3IJEA 4GZ8A 5AJAA 3MUOA 3T3MA 1H2YA 4BH6A 4AMYA 4O3UB 4FWWA 3W15A 4BUJC 4O9DA 2BKLA 5E6RA 3ZE0A 2H9LA 4WK2A 3IJCA 3RN0D 3K27A 4O45A 4J78A 1GOHA 4BCDA 3DWLC 3EQ9A 4NC4A 4JSVC 3ORVD 4JXMA 3EI2B 4XYIA 3U4YA 3ZDZA 2EIDA 4GGAA 3FM0A 3UR4A 4PC0A 4FA4D 5EARA 5EAMA 4ZN4A 3OTTA 3SBRA 2CNXA 4X3EA 1UTCA 3SBQA 4A11A 5FFGA 4QL1A 1H2WA 3EI3B 4X63B 5JWZA 1E8NA 2PM9A 4UI9R 3JAMg 3CFVA 2CO0C 2OVPB 3OKYA 4Z8LA 5GXHA 3FGBA 3IURA 3QI0A 3ODTA 3BG0A 3I8CA 3RSEC 3PXWD 5HE3B 3MUNA 4N14A 2VDKA 5B4WA 3RRMC 2OVQB 2H13A 4ZOVA 4J79A 2H68A 2GC4A 4BCCA 4KFMB 1K3IA 3N0DA 4A0AB 4J82A 4ERYA 2VDMA 1TYEA 3J81g 4GM9A 1N6EA 1PGUA 5CXCB 2QR5A 4DNWA 3JRPA 1GOFA 2H14A 3SJLD 4FAVD 1QFMA 3SN6B 3T3PA 5M5SA 4Z7OA 3EI1B 3RFHA 3I8EA 4DNUA 2HJ4A 3V4VA 4CY5A 1MDAH 2IUPA 4FA5D 1C9IA 5H1MA 1H2ZA 4MK0B 3JZHA 1I2MB 3JZNA 1GG2B 4CY2A 4A08B 4WK4A 5C92A 3C75H 3O4JA 4G56B 3MKSB 5EMLB 2AQ5A 4AMZA 4FA1D 2CN2A 2PM9B 4MMZA 2B4EA 4QRJA 4R7AB 1B9YA 5E6UA 2EBSA 2Z2NA 1NEXB 4GGDA 2TRCB 2HYEA 3EWEA 3ZWLB 4L1MA 3PXTD 3MVDK 4NENA 4GQ1A 2UZYB 3DDUA 2CE8A 1GXRA 2J57G 5HE0B 3PVUB 4PSXB 4JT5C 2IAAA 3EQ8A 3ZE2A 1R5MA 2VDRA 1Q47A 1JOFA 3GC3B 1FWXA 3EI4B 5IGOA 3PVWB 1VZ3A 3JZGA 2VDQA 4U7AA 4Z7QA 3EI4A 1B9XA 4Y5RD 5AMSA 4CC9A 4PBZA 3EG6A 2P9KC 2HU7A 3IUMA 4J77A 5TF2A 1L5GA 5M5RA 2H6QA 4PNKB 3RN1D 5IJ7E 4AOWA 1MG3A 4GQ2P 3SXTD 2Z2PA 2CN3A 5HQGA 2IUVA 2H3XA 4E54B 1OMWB 3EU7A 1NR0A 3A0FA 4A2LA 1A0RB 5H14A 3O4HA 4GM3A 2AGXA 2OK6A 5CYKA 4J81A 5C9ZB 5AFU3 3SCYA 3C99A 3K26A 3OL2A 3AL9A 4UM8A 5THAA 3RLMD 2AH0A 3BG1A 4ERQA 1E5TA 4D9SA 2EIBA 3GFCA 5FFOA 3OW8A 4Z7NA 3PXSD 2I0SA 4L3HD 3PSCB 2H9PA 3MZLA 4J0WA 4O02A 2HU8A 1N6FA 2PM6B 4Y7RA 3NVQA 3UKUC 4AEZA 2XL3A 2VC2A 3JROA 4AX4A 2YMUA 4CI3A 3K6SA 3J80g 1VZ2A 3OF7A 3UVKA 2GC7A 3K72A 4XYHA 5SXMA 2VZ1A 4LG9A 4IRZA 1XKSA 2P9IC 1PI6A 2QZPA 4MMXA 2CE9A 5M61A 1RI6A 1SHYB 1XIPA 1T2XA 1O6FA 3I7LA 1E8MA 2P9SC 3KRXB 4AN1A 3GD1I 3IIYA 3L4OD 3MXXA 4QAMA 3UVNA 2W18A 4CZYA 3UKRC 4MMYA 3NIGA 1YR2A 2AGZA 4PBYA 3DXMC 4EWRA 3NVXA 1C9LA 1BPOA 2WQ8A 3SFZA 1GOTB 4PXWA 1JJUB 4JHPC 1SQJA 3MZKA 3F3FA 4G55A 2YNNA 5M5VA 3VH0A 3HFQA 2XYIA 4CY3A 4RE5A 4A0AA 2G99A 1TYQC 4WK0A 4CI1A 5FKTA 3ZDXA 4A09B 4CI8A 5C2VB 1TBGA 5M5TA 5FXYA 3O4IA 3I7NA 3KCIA 4NAAA 4E54A 4ESGA 4A09A 3I7KA 4H5IA 2VDOA 1U2VC 5CYKB 1MG2A 2YNPA 2OIZA 4BL0A 4K3JB 3OKTA 3V5WB 2PBIB 2P9PC 3L4MD 4A7JA 4BP8A 4UM9A 4BCBA 3O4GA 4H5JA 4CZXA 1XHMA 4YVDA 2AGYA 5GSAA 3SBPA 3I7OA 2G9AA 5FA5B 4JD2C 4NBMA 4O2WA 5CXBB 3F3PA 5FQDA 3VGZA 3ZDYA 3EMHA 1A12A 1VYHC 1SQ9A 1O6GA 4L3GD 3MMYA 2QC5A 2I0RA 3AH8B 2XU7A 5A2Qg 1N6DA 2EICA 3CIKB 1U4CA 3V4PA 4O1QD 3I7PA 3EQ7A 2QXVA 2JKXA 4BP9A 5EAPA 1UOOA 4E5ZB 5C2WB 3GREA 2P9UC 4GMBA 4OWRA 5I5MA 3BWSA 3IKOA 3VI3A 4ERZA 2IWFA 3SVWD 2Z2OA 4E5ZA 3NVNA 4JSPC 2H9MA 2YB8B 5EM2A 4ZOYA 5GMKn 4J8BA 1VE6A 3QHYB 2AH1A 2EIEA 4ZOZA 3V7DB 4JSNC 4QT8A 3AL8A 3P4FA 3F3GA 5IT9g 5C86A 4JHNA 4X60B 3VI4A 2HU5A 2IUQA 3DXKC 5CXCA 4PSWB 2Q7QA 5I5IA 4FAND 5TDHB 1JTDB 2HJBA 2OK4A 2O9KA 2H9NA 2VDPA 2BBKH 4ES0A 4A08A 5FKSA 5HDBA 3UVLA 5EMMB 3FCUA 4GQBB 1PBYB 4J87A 4GGCA 3C9CA 2CO0A 5FKQA 2I0TA 3UVMA 1ERJA 4J84A 2IURA 2OVRB 1VE7A 1L0QA 3EI3A 4U1EI 3DM0A 2I3SA 4I79A 5EALA 2XE4A 4J0XA 3ZE1A 2B5LA 4A0BA 1S4UX 4IMMA 3RFGA 1OLZA 4X61B 5E6SA 4OZUA 4FB1D 2HKMA 4A11B 3IULA 4ZOXA 4GM8A 3C5MA 5CXBA 3UVOA 5H17A 2XZGA 1JV2A 4A2MA 3IUQA 5IGQA 3MKQA 3JPXA 3N0EA 5EM2B 3SMRA 3I2NA 4IA9A 4WJKA 3IJ0A 3JB9L 5EMJB 5K19A 3DSMA 4J73A 4J8GA 2XDWA 3AL8B 4D0KA 5EMKB 3RMZD 1GOGA 1UOPA 5KDOB 1K32A 1YFQA 3PSLA 2P9NC 2UZXB 2MTAH 3IIWA 2VZ3A 3KRWB 5FKRA 5K1CC 4NSXA 5HYNB 2P9LC 3OL2B
chains in the Genus database with same CATH topology
5HE2B 3FRXA 4O3TB 5FLXg 3I89A 4FHLA 2J55H 3I7HA 2HESX 2XL2A 3IJ1A 3E0CA 4D6VA 2B5MA 4FA9D 4LG8A 3V9FA 4CI2A 2I3TA 2AGLA 4JSXC 3B7FA 2HXCA 2BCJB 4XEIC 3SLED 5IC7A 3PE7A 4JT6C 5GXIA 1QNIA 4TZ4A 2IWKA 3VA6A 2PM7B 3SHFA 1JMXB 1GP2B 4L9OA 4L1QD 2HKRA 4A0BB 4LGNA 2H47A 3CFSB 4QQEA 2B5NA 3OKWA 4K3ID 5HE1B 2YNOA 2AGWA 2H6NA 2OJYA 3ULEC 1P22A 3OKYB 5I5JA 1PEVA 4CY1A 2H6KA 4CZVA 2YBAA 1JMZB 2GNQA 5TEEA 1K8KC 4HDJA 2J56H 4J86A 3EI2A 5TEFA 3SWSD 3AFCA 3EI1A 5IJ8E 4GZ8A 5AJAA 4BH6A 4O3UB 4FWWA 3W15A 4BUJC 4O9DA 2H9LA 3IJCA 3RN0D 3K27A 4O45A 4J78A 3DWLC 4JSVC 3ORVD 4JXMA 3EI2B 4XYIA 3U4YA 4GGAA 3FM0A 3UR4A 4PC0A 4FA4D 5EARA 5EAMA 4ZN4A 3OTTA 3SBRA 2CNXA 4X3EA 3SBQA 4A11A 4QL1A 3EI3B 4X63B 5JWZA 4UI9R 2PM9A 3JAMg 3CFVA 2CO0C 2OVPB 3OKYA 4Z8LA 5GXHA 3FGBA 3ODTA 3BG0A 3I8CA 3RSEC 3PXWD 5HE3B 4N14A 5B4WA 3RRMC 2OVQB 2H13A 4ZOVA 4J79A 2H68A 2GC4A 4KFMB 3N0DA 4A0AB 4J82A 4ERYA 3J81g 4GM9A 5CXCB 1N6EA 1PGUA 3JRPA 2H14A 3SJLD 4FAVD 3SN6B 3EI1B 3RFHA 3I8EA 2HJ4A 4CY5A 1MDAH 2IUPA 4FA5D 5H1MA 4MK0B 3JZHA 3JZNA 1GG2B 4CY2A 4A08B 3C75H 3MKSB 4G56B 5EMLB 2AQ5A 4FA1D 2CN2A 2PM9B 2B4EA 4QRJA 4R7AB 1B9YA 2EBSA 2Z2NA 1NEXB 4GGDA 2TRCB 2HYEA 3EWEA 3ZWLB 3PXTD 4GQ1A 2UZYB 2CE8A 1GXRA 2J57G 5HE0B 3PVUB 4PSXB 4JT5C 2IAAA 1R5MA 1Q47A 1JOFA 1FWXA 3EI4B 5IGOA 3PVWB 3JZGA 4U7AA 3EI4A 1B9XA 4Y5RD 5AMSA 4CC9A 4PBZA 3EG6A 2P9KC 4J77A 5TF2A 2H6QA 4PNKB 3RN1D 5IJ7E 4AOWA 1MG3A 4GQ2P 3SXTD 2Z2PA 2CN3A 5HQGA 2IUVA 2H3XA 4E54B 1OMWB 3EU7A 1NR0A 3A0FA 4A2LA 1A0RB 5H14A 4GM3A 2AGXA 2OK6A 5CYKA 4J81A 5C9ZB 5AFU3 3SCYA 3C99A 3K26A 3OL2A 3AL9A 3RLMD 5THAA 2AH0A 3BG1A 4ERQA 3GFCA 3OW8A 3PXSD 2I0SA 4L3HD 3PSCB 2H9PA 3MZLA 4J0WA 1N6FA 2PM6B 4Y7RA 3NVQA 3UKUC 4AEZA 2XL3A 3JROA 4CI3A 2YMUA 3J80g 3UVKA 2GC7A 4XYHA 5SXMA 4LG9A 1XKSA 2P9IC 1PI6A 2CE9A 1RI6A 1SHYB 1XIPA 3I7LA 3KRXB 2P9SC 3IIYA 3L4OD 3MXXA 3UVNA 4CZYA 2W18A 3UKRC 2AGZA 4PBYA 3DXMC 4EWRA 3NVXA 3SFZA 1GOTB 4PXWA 1JJUB 1SQJA 3MZKA 3F3FA 2YNNA 3VH0A 3HFQA 2XYIA 4CY3A 4A0AA 2G99A 1TYQC 4CI1A 5FKTA 4A09B 4CI8A 5C2VB 1TBGA 5FXYA 3I7NA 4E54A 4ESGA 4A09A 3I7KA 4H5IA 1U2VC 5CYKB 1MG2A 2YNPA 2OIZA 4BL0A 4K3JB 3OKTA 3V5WB 2PBIB 2P9PC 3L4MD 4A7JA 4H5JA 4CZXA 1XHMA 4YVDA 2AGYA 5GSAA 3SBPA 3I7OA 2G9AA 5FA5B 4JD2C 5CXBB 3VGZA 3F3PA 5FQDA 3EMHA 1VYHC 1SQ9A 4L3GD 3MMYA 2QC5A 2I0RA 3AH8B 2XU7A 5A2Qg 1N6DA 3CIKB 1U4CA 4O1QD 3I7PA 2QXVA 5EAPA 4E5ZB 5C2WB 3GREA 2P9UC 4GMBA 4OWRA 5I5MA 3BWSA 3IKOA 4ERZA 2IWFA 3SVWD 2Z2OA 4E5ZA 3NVNA 4JSPC 2H9MA 2YB8B 5EM2A 4ZOYA 5GMKn 4J8BA 2AH1A 4ZOZA 3V7DB 4JSNC 4QT8A 3AL8A 3P4FA 3F3GA 5IT9g 4X60B 2IUQA 3DXKC 5CXCA 4PSWB 2Q7QA 5I5IA 4FAND 5TDHB 2HJBA 2OK4A 2O9KA 2H9NA 2BBKH 4ES0A 4A08A 5FKSA 3UVLA 5EMMB 4GQBB 1PBYB 4J87A 4GGCA 3C9CA 2CO0A 5FKQA 2I0TA 3UVMA 1ERJA 4J84A 2IURA 2OVRB 1L0QA 3EI3A 4U1EI 3DM0A 2I3SA 4I79A 5EALA 4J0XA 2B5LA 4A0BA 1S4UX 4IMMA 3RFGA 1OLZA 4X61B 4OZUA 4FB1D 2HKMA 4A11B 4ZOXA 4GM8A 3C5MA 5CXBA 3UVOA 5H17A 4A2MA 5IGQA 3MKQA 3JPXA 3N0EA 5EM2B 3SMRA 3I2NA 4IA9A 3IJ0A 3JB9L 5EMJB 5K19A 3DSMA 4J73A 4J8GA 4D0KA 3AL8B 5EMKB 3RMZD 5KDOB 1K32A 1YFQA 3PSLA 2P9NC 2UZXB 2MTAH 3IIWA 3KRWB 5FKRA 5K1CC 4NSXA 5HYNB 2P9LC 3OL2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 B;  3FRX A;  4O3T B;  5FLX g;  3I89 A;  4FHL A;  2J55 H;  3I7H A;  2HES X;  2XL2 A;  3IJ1 A;  3E0C A;  4D6V A;  2B5M A;  4FA9 D;  4LG8 A;  3V9F A;  4CI2 A;  2I3T A;  2AGL A;  4JSX C;  3B7F A;  2HXC A;  2BCJ B;  4XEI C;  3SLE D;  5IC7 A;  3PE7 A;  4JT6 C;  5GXI A;  1QNI A;  4TZ4 A;  2IWK A;  3VA6 A;  2PM7 B;  3SHF A;  1JMX B;  1GP2 B;  4L9O A;  4L1Q D;  2HKR A;  4A0B B;  4LGN A;  2H47 A;  3CFS B;  4QQE A;  2B5N A;  3OKW A;  4K3I D;  5HE1 B;  2YNO A;  2AGW A;  2H6N A;  2OJY A;  3ULE C;  1P22 A;  3OKY B;  5I5J A;  1PEV A;  4CY1 A;  2H6K A;  4CZV A;  2YBA A;  1JMZ B;  2GNQ A;  5TEE A;  1K8K C;  4HDJ A;  2J56 H;  4J86 A;  3EI2 A;  5TEF A;  3SWS D;  3AFC A;  3EI1 A;  5IJ8 E;  4GZ8 A;  5AJA A;  4BH6 A;  4O3U B;  4FWW A;  3W15 A;  4BUJ C;  4O9D A;  2H9L A;  3IJC A;  3RN0 D;  3K27 A;  4O45 A;  4J78 A;  3DWL C;  4JSV C;  3ORV D;  4JXM A;  3EI2 B;  4XYI A;  3U4Y A;  4GGA A;  3FM0 A;  3UR4 A;  4PC0 A;  4FA4 D;  5EAR A;  5EAM A;  4ZN4 A;  3OTT A;  3SBR A;  2CNX A;  4X3E A;  3SBQ A;  4A11 A;  4QL1 A;  3EI3 B;  4X63 B;  5JWZ A;  4UI9 R;  2PM9 A;  3JAM g;  3CFV A;  2CO0 C;  2OVP B;  3OKY A;  4Z8L A;  5GXH A;  3FGB A;  3ODT A;  3BG0 A;  3I8C A;  3RSE C;  3PXW D;  5HE3 B;  4N14 A;  5B4W A;  3RRM C;  2OVQ B;  2H13 A;  4ZOV A;  4J79 A;  2H68 A;  2GC4 A;  4KFM B;  3N0D A;  4A0A B;  4J82 A;  4ERY A;  3J81 g;  4GM9 A;  5CXC B;  1N6E A;  1PGU A;  3JRP A;  2H14 A;  3SJL D;  4FAV D;  3SN6 B;  3EI1 B;  3RFH A;  3I8E A;  2HJ4 A;  4CY5 A;  1MDA H;  2IUP A;  4FA5 D;  5H1M A;  4MK0 B;  3JZH A;  3JZN A;  1GG2 B;  4CY2 A;  4A08 B;  3C75 H;  3MKS B;  4G56 B;  5EML B;  2AQ5 A;  4FA1 D;  2CN2 A;  2PM9 B;  2B4E A;  4QRJ A;  4R7A B;  1B9Y A;  2EBS A;  2Z2N A;  1NEX B;  4GGD A;  2TRC B;  2HYE A;  3EWE A;  3ZWL B;  3PXT D;  4GQ1 A;  2UZY B;  2CE8 A;  1GXR A;  2J57 G;  5HE0 B;  3PVU B;  4PSX B;  4JT5 C;  2IAA A;  1R5M A;  1Q47 A;  1JOF A;  1FWX A;  3EI4 B;  5IGO A;  3PVW B;  3JZG A;  4U7A A;  3EI4 A;  1B9X A;  4Y5R D;  5AMS A;  4CC9 A;  4PBZ A;  3EG6 A;  2P9K C;  4J77 A;  5TF2 A;  2H6Q A;  4PNK B;  3RN1 D;  5IJ7 E;  4AOW A;  1MG3 A;  4GQ2 P;  3SXT D;  2Z2P A;  2CN3 A;  5HQG A;  2IUV A;  2H3X A;  4E54 B;  1OMW B;  3EU7 A;  1NR0 A;  3A0F A;  4A2L A;  1A0R B;  5H14 A;  4GM3 A;  2AGX A;  2OK6 A;  5CYK A;  4J81 A;  5C9Z B;  5AFU 3;  3SCY A;  3C99 A;  3K26 A;  3OL2 A;  3AL9 A;  3RLM D;  5THA A;  2AH0 A;  3BG1 A;  4ERQ A;  3GFC A;  3OW8 A;  3PXS D;  2I0S A;  4L3H D;  3PSC B;  2H9P A;  3MZL A;  4J0W A;  1N6F A;  2PM6 B;  4Y7R A;  3NVQ A;  3UKU C;  4AEZ A;  2XL3 A;  3JRO A;  4CI3 A;  2YMU A;  3J80 g;  3UVK A;  2GC7 A;  4XYH A;  5SXM A;  4LG9 A;  1XKS A;  2P9I C;  1PI6 A;  2CE9 A;  1RI6 A;  1SHY B;  1XIP A;  3I7L A;  3KRX B;  2P9S C;  3IIY A;  3L4O D;  3MXX A;  3UVN A;  4CZY A;  2W18 A;  3UKR C;  2AGZ A;  4PBY A;  3DXM C;  4EWR A;  3NVX A;  3SFZ A;  1GOT B;  4PXW A;  1JJU B;  1SQJ A;  3MZK A;  3F3F A;  2YNN A;  3VH0 A;  3HFQ A;  2XYI A;  4CY3 A;  4A0A A;  2G99 A;  1TYQ C;  4CI1 A;  5FKT A;  4A09 B;  4CI8 A;  5C2V B;  1TBG A;  5FXY A;  3I7N A;  4E54 A;  4ESG A;  4A09 A;  3I7K A;  4H5I A;  1U2V C;  5CYK B;  1MG2 A;  2YNP A;  2OIZ A;  4BL0 A;  4K3J B;  3OKT A;  3V5W B;  2PBI B;  2P9P C;  3L4M D;  4A7J A;  4H5J A;  4CZX A;  1XHM A;  4YVD A;  2AGY A;  5GSA A;  3SBP A;  3I7O A;  2G9A A;  5FA5 B;  4JD2 C;  5CXB B;  3VGZ A;  3F3P A;  5FQD A;  3EMH A;  1VYH C;  1SQ9 A;  4L3G D;  3MMY A;  2QC5 A;  2I0R A;  3AH8 B;  2XU7 A;  5A2Q g;  1N6D A;  3CIK B;  1U4C A;  4O1Q D;  3I7P A;  2QXV A;  5EAP A;  4E5Z B;  5C2W B;  3GRE A;  2P9U C;  4GMB A;  4OWR A;  5I5M A;  3BWS A;  3IKO A;  4ERZ A;  2IWF A;  3SVW D;  2Z2O A;  4E5Z A;  3NVN A;  4JSP C;  2H9M A;  2YB8 B;  5EM2 A;  4ZOY A;  5GMK n;  4J8B A;  2AH1 A;  4ZOZ A;  3V7D B;  4JSN C;  4QT8 A;  3AL8 A;  3P4F A;  3F3G A;  5IT9 g;  4X60 B;  2IUQ A;  3DXK C;  5CXC A;  4PSW B;  2Q7Q A;  5I5I A;  4FAN D;  5TDH B;  2HJB A;  2OK4 A;  2O9K A;  2H9N A;  2BBK H;  4ES0 A;  4A08 A;  5FKS A;  3UVL A;  5EMM B;  4GQB B;  1PBY B;  4J87 A;  4GGC A;  3C9C A;  2CO0 A;  5FKQ A;  2I0T A;  3UVM A;  1ERJ A;  4J84 A;  2IUR A;  2OVR B;  1L0Q A;  3EI3 A;  4U1E I;  3DM0 A;  2I3S A;  4I79 A;  5EAL A;  4J0X A;  2B5L A;  4A0B A;  1S4U X;  4IMM A;  3RFG A;  1OLZ A;  4X61 B;  4OZU A;  4FB1 D;  2HKM A;  4A11 B;  4ZOX A;  4GM8 A;  3C5M A;  5CXB A;  3UVO A;  5H17 A;  4A2M A;  5IGQ A;  3MKQ A;  3JPX A;  3N0E A;  5EM2 B;  3SMR A;  3I2N A;  4IA9 A;  3IJ0 A;  3JB9 L;  5EMJ B;  5K19 A;  3DSM A;  4J73 A;  4J8G A;  4D0K A;  3AL8 B;  5EMK B;  3RMZ D;  5KDO B;  1K32 A;  1YFQ A;  3PSL A;  2P9N C;  2UZX B;  2MTA H;  3IIW A;  3KRW B;  5FKR A;  5K1C C;  4NSX A;  5HYN B;  2P9L C;  3OL2 B; 
#chains in the Genus database with same CATH topology
 5HE2 B;  3FRX A;  3FCS A;  4DNV A;  4O3T B;  5FLX g;  2VDL A;  3I89 A;  1UOQ A;  4FHL A;  4G1M A;  1M1X A;  2J55 H;  3I7H A;  4G1E A;  2HES X;  2XL2 A;  3IJ1 A;  3NID A;  3E0C A;  4D6V A;  2B5M A;  4RE6 A;  4FA9 D;  3IVM A;  4LG8 A;  3V9F A;  4CI2 A;  2I3T A;  2AGL A;  4JSX C;  3B7F A;  2HXC A;  1QFS A;  2BCJ B;  4XEI C;  3SLE D;  5IC7 A;  3PE7 A;  4JT6 C;  5GXI A;  1QNI A;  4TZ4 A;  2IWK A;  4AN0 A;  3VA6 A;  2PM7 B;  3SHF A;  1JMX B;  1GP2 B;  4L9O A;  4L1Q D;  2HKR A;  4A0B B;  4LGN A;  2H47 A;  3CFS B;  4QQE A;  2B5N A;  3OKW A;  1U8C A;  4K3I D;  3IUJ A;  5HE1 B;  3K71 A;  2YNO A;  2AGW A;  2H6N A;  2OJY A;  3ULE C;  1P22 A;  3OKY B;  5M5U A;  5I5J A;  2VDN A;  1PEV A;  4CY1 A;  2H6K A;  4CZV A;  2YBA A;  1JMZ B;  3NIF A;  2GNQ A;  5TEE A;  1K8K C;  4HDJ A;  2J56 H;  4J86 A;  3EI2 A;  3IUN A;  1H2X A;  5TEF A;  3SWS D;  3AFC A;  3EI1 A;  5IJ8 E;  3IJE A;  4GZ8 A;  5AJA A;  3MUO A;  3T3M A;  1H2Y A;  4BH6 A;  4AMY A;  4O3U B;  4FWW A;  3W15 A;  4BUJ C;  4O9D A;  2BKL A;  5E6R A;  3ZE0 A;  2H9L A;  4WK2 A;  3IJC A;  3RN0 D;  3K27 A;  4O45 A;  4J78 A;  1GOH A;  4BCD A;  3DWL C;  3EQ9 A;  4NC4 A;  4JSV C;  3ORV D;  4JXM A;  3EI2 B;  4XYI A;  3U4Y A;  3ZDZ A;  2EID A;  4GGA A;  3FM0 A;  3UR4 A;  4PC0 A;  4FA4 D;  5EAR A;  5EAM A;  4ZN4 A;  3OTT A;  3SBR A;  2CNX A;  4X3E A;  1UTC A;  3SBQ A;  4A11 A;  5FFG A;  4QL1 A;  1H2W A;  3EI3 B;  4X63 B;  5JWZ A;  1E8N A;  2PM9 A;  4UI9 R;  3JAM g;  3CFV A;  2CO0 C;  2OVP B;  3OKY A;  4Z8L A;  5GXH A;  3FGB A;  3IUR A;  3QI0 A;  3ODT A;  3BG0 A;  3I8C A;  3RSE C;  3PXW D;  5HE3 B;  3MUN A;  4N14 A;  2VDK A;  5B4W A;  3RRM C;  2OVQ B;  2H13 A;  4ZOV A;  4J79 A;  2H68 A;  2GC4 A;  4BCC A;  4KFM B;  1K3I A;  3N0D A;  4A0A B;  4J82 A;  4ERY A;  2VDM A;  1TYE A;  3J81 g;  4GM9 A;  1N6E A;  1PGU A;  5CXC B;  2QR5 A;  4DNW A;  3JRP A;  1GOF A;  2H14 A;  3SJL D;  4FAV D;  1QFM A;  3SN6 B;  3T3P A;  5M5S A;  4Z7O A;  3EI1 B;  3RFH A;  3I8E A;  4DNU A;  2HJ4 A;  3V4V A;  4CY5 A;  1MDA H;  2IUP A;  4FA5 D;  1C9I A;  5H1M A;  1H2Z A;  4MK0 B;  3JZH A;  1I2M B;  3JZN A;  1GG2 B;  4CY2 A;  4A08 B;  4WK4 A;  5C92 A;  3C75 H;  3O4J A;  4G56 B;  3MKS B;  5EML B;  2AQ5 A;  4AMZ A;  4FA1 D;  2CN2 A;  2PM9 B;  4MMZ A;  2B4E A;  4QRJ A;  4R7A B;  1B9Y A;  5E6U A;  2EBS A;  2Z2N A;  1NEX B;  4GGD A;  2TRC B;  2HYE A;  3EWE A;  3ZWL B;  4L1M A;  3PXT D;  3MVD K;  4NEN A;  4GQ1 A;  2UZY B;  3DDU A;  2CE8 A;  1GXR A;  2J57 G;  5HE0 B;  3PVU B;  4PSX B;  4JT5 C;  2IAA A;  3EQ8 A;  3ZE2 A;  1R5M A;  2VDR A;  1Q47 A;  1JOF A;  3GC3 B;  1FWX A;  3EI4 B;  5IGO A;  3PVW B;  1VZ3 A;  3JZG A;  2VDQ A;  4U7A A;  4Z7Q A;  3EI4 A;  1B9X A;  4Y5R D;  5AMS A;  4CC9 A;  4PBZ A;  3EG6 A;  2P9K C;  2HU7 A;  3IUM A;  4J77 A;  5TF2 A;  1L5G A;  5M5R A;  2H6Q A;  4PNK B;  3RN1 D;  5IJ7 E;  4AOW A;  1MG3 A;  4GQ2 P;  3SXT D;  2Z2P A;  2CN3 A;  5HQG A;  2IUV A;  2H3X A;  4E54 B;  1OMW B;  3EU7 A;  1NR0 A;  3A0F A;  4A2L A;  1A0R B;  5H14 A;  3O4H A;  4GM3 A;  2AGX A;  2OK6 A;  5CYK A;  4J81 A;  5C9Z B;  5AFU 3;  3SCY A;  3C99 A;  3K26 A;  3OL2 A;  3AL9 A;  4UM8 A;  5THA A;  3RLM D;  2AH0 A;  3BG1 A;  4ERQ A;  1E5T A;  4D9S A;  2EIB A;  3GFC A;  5FFO A;  3OW8 A;  4Z7N A;  3PXS D;  2I0S A;  4L3H D;  3PSC B;  2H9P A;  3MZL A;  4J0W A;  4O02 A;  2HU8 A;  1N6F A;  2PM6 B;  4Y7R A;  3NVQ A;  3UKU C;  4AEZ A;  2XL3 A;  2VC2 A;  3JRO A;  4AX4 A;  2YMU A;  4CI3 A;  3K6S A;  3J80 g;  1VZ2 A;  3OF7 A;  3UVK A;  2GC7 A;  3K72 A;  4XYH A;  5SXM A;  2VZ1 A;  4LG9 A;  4IRZ A;  1XKS A;  2P9I C;  1PI6 A;  2QZP A;  4MMX A;  2CE9 A;  5M61 A;  1RI6 A;  1SHY B;  1XIP A;  1T2X A;  1O6F A;  3I7L A;  1E8M A;  2P9S C;  3KRX B;  4AN1 A;  3GD1 I;  3IIY A;  3L4O D;  3MXX A;  4QAM A;  3UVN A;  2W18 A;  4CZY A;  3UKR C;  4MMY A;  3NIG A;  1YR2 A;  2AGZ A;  4PBY A;  3DXM C;  4EWR A;  3NVX A;  1C9L A;  1BPO A;  2WQ8 A;  3SFZ A;  1GOT B;  4PXW A;  1JJU B;  4JHP C;  1SQJ A;  3MZK A;  3F3F A;  4G55 A;  2YNN A;  5M5V A;  3VH0 A;  3HFQ A;  2XYI A;  4CY3 A;  4RE5 A;  4A0A A;  2G99 A;  1TYQ C;  4WK0 A;  4CI1 A;  5FKT A;  3ZDX A;  4A09 B;  4CI8 A;  5C2V B;  1TBG A;  5M5T A;  5FXY A;  3O4I A;  3I7N A;  3KCI A;  4NAA A;  4E54 A;  4ESG A;  4A09 A;  3I7K A;  4H5I A;  2VDO A;  1U2V C;  5CYK B;  1MG2 A;  2YNP A;  2OIZ A;  4BL0 A;  4K3J B;  3OKT A;  3V5W B;  2PBI B;  2P9P C;  3L4M D;  4A7J A;  4BP8 A;  4UM9 A;  4BCB A;  3O4G A;  4H5J A;  4CZX A;  1XHM A;  4YVD A;  2AGY A;  5GSA A;  3SBP A;  3I7O A;  2G9A A;  5FA5 B;  4JD2 C;  4NBM A;  4O2W A;  5CXB B;  3F3P A;  5FQD A;  3VGZ A;  3ZDY A;  3EMH A;  1A12 A;  1VYH C;  1SQ9 A;  1O6G A;  4L3G D;  3MMY A;  2QC5 A;  2I0R A;  3AH8 B;  2XU7 A;  5A2Q g;  1N6D A;  2EIC A;  3CIK B;  1U4C A;  3V4P A;  4O1Q D;  3I7P A;  3EQ7 A;  2QXV A;  2JKX A;  4BP9 A;  5EAP A;  1UOO A;  4E5Z B;  5C2W B;  3GRE A;  2P9U C;  4GMB A;  4OWR A;  5I5M A;  3BWS A;  3IKO A;  3VI3 A;  4ERZ A;  2IWF A;  3SVW D;  2Z2O A;  4E5Z A;  3NVN A;  4JSP C;  2H9M A;  2YB8 B;  5EM2 A;  4ZOY A;  5GMK n;  4J8B A;  1VE6 A;  3QHY B;  2AH1 A;  2EIE A;  4ZOZ A;  3V7D B;  4JSN C;  4QT8 A;  3AL8 A;  3P4F A;  3F3G A;  5IT9 g;  5C86 A;  4JHN A;  4X60 B;  3VI4 A;  2HU5 A;  2IUQ A;  3DXK C;  5CXC A;  4PSW B;  2Q7Q A;  5I5I A;  4FAN D;  5TDH B;  1JTD B;  2HJB A;  2OK4 A;  2O9K A;  2H9N A;  2VDP A;  2BBK H;  4ES0 A;  4A08 A;  5FKS A;  5HDB A;  3UVL A;  5EMM B;  3FCU A;  4GQB B;  1PBY B;  4J87 A;  4GGC A;  3C9C A;  2CO0 A;  5FKQ A;  2I0T A;  3UVM A;  1ERJ A;  4J84 A;  2IUR A;  2OVR B;  1VE7 A;  1L0Q A;  3EI3 A;  4U1E I;  3DM0 A;  2I3S A;  4I79 A;  5EAL A;  2XE4 A;  4J0X A;  3ZE1 A;  2B5L A;  4A0B A;  1S4U X;  4IMM A;  3RFG A;  1OLZ A;  4X61 B;  5E6S A;  4OZU A;  4FB1 D;  2HKM A;  4A11 B;  3IUL A;  4ZOX A;  4GM8 A;  3C5M A;  5CXB A;  3UVO A;  5H17 A;  2XZG A;  1JV2 A;  4A2M A;  3IUQ A;  5IGQ A;  3MKQ A;  3JPX A;  3N0E A;  5EM2 B;  3SMR A;  3I2N A;  4IA9 A;  4WJK A;  3IJ0 A;  3JB9 L;  5EMJ B;  5K19 A;  3DSM A;  4J73 A;  4J8G A;  2XDW A;  3AL8 B;  4D0K A;  5EMK B;  3RMZ D;  1GOG A;  1UOP A;  5KDO B;  1K32 A;  1YFQ A;  3PSL A;  2P9N C;  2UZX B;  2MTA H;  3IIW A;  2VZ3 A;  3KRW B;  5FKR A;  5K1C C;  4NSX A;  5HYN B;  2P9L C;  3OL2 B; 
#chains in the Genus database with same CATH homology
 5HE2 B;  3FRX A;  4O3T B;  5FLX g;  3I89 A;  4FHL A;  2J55 H;  3I7H A;  2HES X;  2XL2 A;  3IJ1 A;  3E0C A;  4D6V A;  2B5M A;  4FA9 D;  4LG8 A;  3V9F A;  4CI2 A;  2I3T A;  2AGL A;  4JSX C;  3B7F A;  2HXC A;  2BCJ B;  4XEI C;  3SLE D;  5IC7 A;  3PE7 A;  4JT6 C;  5GXI A;  1QNI A;  4TZ4 A;  2IWK A;  3VA6 A;  2PM7 B;  3SHF A;  1JMX B;  1GP2 B;  4L9O A;  4L1Q D;  2HKR A;  4A0B B;  4LGN A;  2H47 A;  3CFS B;  4QQE A;  2B5N A;  3OKW A;  4K3I D;  5HE1 B;  2YNO A;  2AGW A;  2H6N A;  2OJY A;  3ULE C;  1P22 A;  3OKY B;  5I5J A;  1PEV A;  4CY1 A;  2H6K A;  4CZV A;  2YBA A;  1JMZ B;  2GNQ A;  5TEE A;  1K8K C;  4HDJ A;  2J56 H;  4J86 A;  3EI2 A;  5TEF A;  3SWS D;  3AFC A;  3EI1 A;  5IJ8 E;  4GZ8 A;  5AJA A;  4BH6 A;  4O3U B;  4FWW A;  3W15 A;  4BUJ C;  4O9D A;  2H9L A;  3IJC A;  3RN0 D;  3K27 A;  4O45 A;  4J78 A;  3DWL C;  4JSV C;  3ORV D;  4JXM A;  3EI2 B;  4XYI A;  3U4Y A;  4GGA A;  3FM0 A;  3UR4 A;  4PC0 A;  4FA4 D;  5EAR A;  5EAM A;  4ZN4 A;  3OTT A;  3SBR A;  2CNX A;  4X3E A;  3SBQ A;  4A11 A;  4QL1 A;  3EI3 B;  4X63 B;  5JWZ A;  4UI9 R;  2PM9 A;  3JAM g;  3CFV A;  2CO0 C;  2OVP B;  3OKY A;  4Z8L A;  5GXH A;  3FGB A;  3ODT A;  3BG0 A;  3I8C A;  3RSE C;  3PXW D;  5HE3 B;  4N14 A;  5B4W A;  3RRM C;  2OVQ B;  2H13 A;  4ZOV A;  4J79 A;  2H68 A;  2GC4 A;  4KFM B;  3N0D A;  4A0A B;  4J82 A;  4ERY A;  3J81 g;  4GM9 A;  5CXC B;  1N6E A;  1PGU A;  3JRP A;  2H14 A;  3SJL D;  4FAV D;  3SN6 B;  3EI1 B;  3RFH A;  3I8E A;  2HJ4 A;  4CY5 A;  1MDA H;  2IUP A;  4FA5 D;  5H1M A;  4MK0 B;  3JZH A;  3JZN A;  1GG2 B;  4CY2 A;  4A08 B;  3C75 H;  3MKS B;  4G56 B;  5EML B;  2AQ5 A;  4FA1 D;  2CN2 A;  2PM9 B;  2B4E A;  4QRJ A;  4R7A B;  1B9Y A;  2EBS A;  2Z2N A;  1NEX B;  4GGD A;  2TRC B;  2HYE A;  3EWE A;  3ZWL B;  3PXT D;  4GQ1 A;  2UZY B;  2CE8 A;  1GXR A;  2J57 G;  5HE0 B;  3PVU B;  4PSX B;  4JT5 C;  2IAA A;  1R5M A;  1Q47 A;  1JOF A;  1FWX A;  3EI4 B;  5IGO A;  3PVW B;  3JZG A;  4U7A A;  3EI4 A;  1B9X A;  4Y5R D;  5AMS A;  4CC9 A;  4PBZ A;  3EG6 A;  2P9K C;  4J77 A;  5TF2 A;  2H6Q A;  4PNK B;  3RN1 D;  5IJ7 E;  4AOW A;  1MG3 A;  4GQ2 P;  3SXT D;  2Z2P A;  2CN3 A;  5HQG A;  2IUV A;  2H3X A;  4E54 B;  1OMW B;  3EU7 A;  1NR0 A;  3A0F A;  4A2L A;  1A0R B;  5H14 A;  4GM3 A;  2AGX A;  2OK6 A;  5CYK A;  4J81 A;  5C9Z B;  5AFU 3;  3SCY A;  3C99 A;  3K26 A;  3OL2 A;  3AL9 A;  3RLM D;  5THA A;  2AH0 A;  3BG1 A;  4ERQ A;  3GFC A;  3OW8 A;  3PXS D;  2I0S A;  4L3H D;  3PSC B;  2H9P A;  3MZL A;  4J0W A;  1N6F A;  2PM6 B;  4Y7R A;  3NVQ A;  3UKU C;  4AEZ A;  2XL3 A;  3JRO A;  4CI3 A;  2YMU A;  3J80 g;  3UVK A;  2GC7 A;  4XYH A;  5SXM A;  4LG9 A;  1XKS A;  2P9I C;  1PI6 A;  2CE9 A;  1RI6 A;  1SHY B;  1XIP A;  3I7L A;  3KRX B;  2P9S C;  3IIY A;  3L4O D;  3MXX A;  3UVN A;  4CZY A;  2W18 A;  3UKR C;  2AGZ A;  4PBY A;  3DXM C;  4EWR A;  3NVX A;  3SFZ A;  1GOT B;  4PXW A;  1JJU B;  1SQJ A;  3MZK A;  3F3F A;  2YNN A;  3VH0 A;  3HFQ A;  2XYI A;  4CY3 A;  4A0A A;  2G99 A;  1TYQ C;  4CI1 A;  5FKT A;  4A09 B;  4CI8 A;  5C2V B;  1TBG A;  5FXY A;  3I7N A;  4E54 A;  4ESG A;  4A09 A;  3I7K A;  4H5I A;  1U2V C;  5CYK B;  1MG2 A;  2YNP A;  2OIZ A;  4BL0 A;  4K3J B;  3OKT A;  3V5W B;  2PBI B;  2P9P C;  3L4M D;  4A7J A;  4H5J A;  4CZX A;  1XHM A;  4YVD A;  2AGY A;  5GSA A;  3SBP A;  3I7O A;  2G9A A;  5FA5 B;  4JD2 C;  5CXB B;  3VGZ A;  3F3P A;  5FQD A;  3EMH A;  1VYH C;  1SQ9 A;  4L3G D;  3MMY A;  2QC5 A;  2I0R A;  3AH8 B;  2XU7 A;  5A2Q g;  1N6D A;  3CIK B;  1U4C A;  4O1Q D;  3I7P A;  2QXV A;  5EAP A;  4E5Z B;  5C2W B;  3GRE A;  2P9U C;  4GMB A;  4OWR A;  5I5M A;  3BWS A;  3IKO A;  4ERZ A;  2IWF A;  3SVW D;  2Z2O A;  4E5Z A;  3NVN A;  4JSP C;  2H9M A;  2YB8 B;  5EM2 A;  4ZOY A;  5GMK n;  4J8B A;  2AH1 A;  4ZOZ A;  3V7D B;  4JSN C;  4QT8 A;  3AL8 A;  3P4F A;  3F3G A;  5IT9 g;  4X60 B;  2IUQ A;  3DXK C;  5CXC A;  4PSW B;  2Q7Q A;  5I5I A;  4FAN D;  5TDH B;  2HJB A;  2OK4 A;  2O9K A;  2H9N A;  2BBK H;  4ES0 A;  4A08 A;  5FKS A;  3UVL A;  5EMM B;  4GQB B;  1PBY B;  4J87 A;  4GGC A;  3C9C A;  2CO0 A;  5FKQ A;  2I0T A;  3UVM A;  1ERJ A;  4J84 A;  2IUR A;  2OVR B;  1L0Q A;  3EI3 A;  4U1E I;  3DM0 A;  2I3S A;  4I79 A;  5EAL A;  4J0X A;  2B5L A;  4A0B A;  1S4U X;  4IMM A;  3RFG A;  1OLZ A;  4X61 B;  4OZU A;  4FB1 D;  2HKM A;  4A11 B;  4ZOX A;  4GM8 A;  3C5M A;  5CXB A;  3UVO A;  5H17 A;  4A2M A;  5IGQ A;  3MKQ A;  3JPX A;  3N0E A;  5EM2 B;  3SMR A;  3I2N A;  4IA9 A;  3IJ0 A;  3JB9 L;  5EMJ B;  5K19 A;  3DSM A;  4J73 A;  4J8G A;  4D0K A;  3AL8 B;  5EMK B;  3RMZ D;  5KDO B;  1K32 A;  1YFQ A;  3PSL A;  2P9N C;  2UZX B;  2MTA H;  3IIW A;  3KRW B;  5FKR A;  5K1C C;  4NSX A;  5HYN B;  2P9L C;  3OL2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...