2QC5A

Streptogramin b lyase structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
298
structure length
298
Chain Sequence
SEAWMNFYLEEFNLSIPDSGPYGITSSEDGKVWFTQHKANKISSLDQSGRIKEFEVPTPDAKVMCLIVSSLGDIWFTENGANKIGKLSKKGGFTEYPLPQPDSGPYGITEGLNGDIWFTQLNGDRIGKLTADGTIYEYDLPNKGSYPAFITLGSDNALWFTENQNNSIGRITNTGKLEEYPLPTNAAAPVGITSGNDGALWFVEIMGNKIGRITTTGEISEYDIPTPNARPHAITAGKNSEIWFTEWGANQIGRITNDNTIQEYQLQTENAEPHGITFGKDGSVWFALKCKIGKLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mechanism of the Staphylococcus cohnii virginiamycin B lyase (Vgb).
pubmed doi rcsb
source organism Staphylococcus cohnii
molecule tags Lyase
molecule keywords Streptogramin B lactonase
total genus 70
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2qc5A00
3EI3A 4FAND 3N0DA 4A2MA 5TEFA 4JT6C 5CXBA 3K27A 5HE3B 3PXSD 4J78A 1SQJA 5FKTA 4CZXA 1YFQA 2IUQA 3E0CA 2UZXB 4GMBA 3GFCA 2IWFA 3DXKC 5GXHA 4HDJA 4A7JA 2P9NC 2H6QA 5B4WA 1TYQC 5EALA 3ORVD 4O45A 4PSXB 2CN2A 3SHFA 5HE1B 3SCYA 4E5ZA 3UVMA 2I0SA 1GP2B 5C2WB 1K8KC 1VYHC 3DM0A 3OKWA 2HKMA 4A11B 4O3UB 2CO0A 3K26A 5FKRA 3C9CA 3HFQA 4D6VA 3EI1B 3AFCA 2TRCB 2H14A 3JZHA 1U2VC 4J84A 3OL2A 3EU7A 2YNOA 5SXMA 3OKYA 4YVDA 3EI4B 1R5MA 4PSWB 1K32A 5IJ8E 5I5JA 5FXYA 3MKQA 4QL1A 1GXRA 4GQBB 2OIZA 3C75H 3A0FA 2YNPA 3DWLC 1MDAH 3UVLA 2AH1A 4J79A 2CNXA 4ESGA 3GREA 4ERYA 5C9ZB 5C2VB 2HJ4A 3SFZA 5AJAA 5FQDA 3JRPA 1N6DA 3EMHA 2XL2A 4BL0A 2CE9A 3OKYB 3BG0A 2PBIB 4CC9A 3MMYA 2IUVA 3PSCB 3IKOA 4PXWA 2I0RA 4FB1D 1JJUB 5I5IA 4FA9D 4XEIC 3KRXB 4J0WA 4FA5D 4GM9A 3F3GA 3V5WB 3MZLA 5TEEA 4E5ZB 3BWSA 2GC4A 1N6EA 2PM9A 4A0AA 4GGDA 2UZYB 3OTTA 4JSXC 3EI1A 4JT5C 2IURA 3RRMC 3OL2B 4L1QD 4R7AB 2OVQB 2I3TA 4J8GA 3AL8B 3L4MD 4L3GD 1U4CA 5EARA 1XKSA 5A2Qg 2XU7A 1B9XA 3IJ1A 4A0BB 2AGWA 3MKSB 4J87A 1PBYB 5FA5B 5CXCA 4X61B 3EI3B 3J80g 5EMLB 5IGOA 4BH6A 2HJBA 3IIYA 3I7NA 5EMKB 2AGLA 3JROA 2MTAH 5TDHB 2Z2OA 3SN6B 4KFMB 4AEZA 5HE2B 3UVKA 2G9AA 2J56H 4CZYA 2H9MA 5HQGA 5FKQA 1RI6A 3VA6A 3I7HA 4EWRA 3ODTA 4MK0B 2Z2PA 3PXTD 3SXTD 4ES0A 3EWEA 4FA4D 3B7FA 2HXCA 2AH0A 1A0RB 5K1CC 2AGXA 2O9KA 4CI1A 5AMSA 2AGZA 3I8EA 4E54B 2H47A 4O9DA 3JB9L 3JZGA 4E54A 3I7OA 3UVOA 1PI6A 3DXMC 3EG6A 4JSVC 3ZWLB 1OLZA 2P9KC 3V7DB 4OWRA 4I79A 3FM0A 2YMUA 3IJCA 4G56B 4ZOXA 5IJ7E 5CYKB 2CO0C 2PM6B 2XL3A 4CI2A 5CYKA 4GM3A 4GQ1A 4CI8A 2CN3A 4ZOZA 3PE7A 3EI4A 2YBAA 3U4YA 5EAMA 4J77A 4JSPC 5EM2A 4AOWA 2H13A 3CFVA 4QT8A 2H6NA 4O1QD 4JXMA 4Z8LA 4CY3A 2H3XA 4PC0A 3CFSB 4FWWA 2QXVA 3N0EA 4PBYA 5TF2A 5IGQA 5H1MA 3UKRC 1MG2A 2OK4A 2J57G 4O3TB 5EMJB 3RLMD 2BBKH 2YNNA 4J0XA 1P22A 2HKRA 3C99A 4GGAA 5K19A 3SVWD 4H5IA 1JMZB 4A2LA 5AFU3 2B5MA 4U1EI 5IC7A 3SJLD 2HESX 4L3HD 4H5JA 2B4EA 4J73A 1OMWB 3NVNA 1GOTB 4IMMA 5CXBB 3AL8A 3MZKA 2YB8B 3VH0A 3EI2B 2IWKA 4A11A 5HE0B 1SHYB 3RN0D 3J81g 4NSXA 4JD2C 3I8CA 3UVNA 4GQ2P 3PVWB 2H9PA 3EI2A 3IIWA 4LG8A 1N6FA 2I0TA 3W15A 1Q47A 2B5NA 4GM8A 4LG9A 3I7KA 4LGNA 3RFGA 4GZ8A 2P9LC 3KRWB 4J81A 3RSEC 2B5LA 2P9IC 5GMKn 1PGUA 2H9NA 2GNQA 3I7LA 3UKUC 4CY5A 1XHMA 3C5MA 1PEVA 3F3FA 4PNKB 5EMMB 1NR0A 3MXXA 5KDOB 4XYIA 3UR4A 2AQ5A 2H9LA 4A0BA 3PVUB 3FRXA 3CIKB 4XYHA 1ERJA 4ZOYA 4A08A 4QQEA 5I5MA 4ERQA 4A0AB 3OW8A 4GGCA 4ZN4A 3DSMA 4D0KA 4A08B 2XYIA 3IJ0A 4L9OA 3AH8B 4J86A 3RN1D 2OJYA 2P9PC 3SWSD 3SBRA 3I2NA 1S4UX 4X60B 1L0QA 2HYEA 4Y7RA 2OK6A 4PBZA 3RMZD 3I89A 4K3JB 4U7AA 4IA9A 2EBSA 3NVQA 4K3ID 4J82A 3V9FA 3SBQA 1B9YA 4FAVD 5H17A 3NVXA 4A09B 3SLED 5THAA 2P9SC 5FLXg 1JOFA 4FHLA 4CZVA 2IAAA 3RFHA 3SMRA 1JMXB 3ULEC 5HYNB 4OZUA 2OVRB 3AL9A 2IUPA 1XIPA 2I3SA 5EAPA 3FGBA 2P9UC 4JSNC 3F3PA 4ERZA 2J55H 5CXCB 4CY2A 2PM9B 3JZNA 3JAMg 5EM2B 3P4FA 3PSLA 2CE8A 3OKTA 4X3EA 2BCJB 3VGZA 4TZ4A 4UI9R 1SQ9A 3L4OD 4N14A 1QNIA 3SBPA 3I7PA 2QC5A 1MG3A 2H68A 1FWXA 5GXIA 4J8BA 4A09A 2H6KA 4ZOVA 4CY1A 2W18A 4Y5RD 5GSAA 2AGYA 4FA1D 4BUJC 3BG1A 5IT9g 4CI3A 5JWZA 2GC7A 2OVPB 5H14A 3JPXA 2G99A 1NEXB 5FKSA 4QRJA 4X63B 1TBGA 2Z2NA 2Q7QA 3PXWD 2PM7B 1GG2B
chains in the Genus database with same CATH superfamily
3EI3A 4FAND 3N0DA 4A2MA 4NENA 5TEFA 4JT6C 5CXBA 3K27A 4L1MA 5HE3B 3PXSD 4J78A 1SQJA 5FKTA 4CZXA 1YFQA 2IUQA 2HU8A 3E0CA 2UZXB 4GMBA 4G1EA 3GFCA 2IWFA 3DXKC 4MMYA 5GXHA 4HDJA 4A7JA 2P9NC 3V4VA 4BCDA 2H6QA 5B4WA 1TYQC 5EALA 3ORVD 4O45A 4PSXB 2CN2A 3SHFA 5HE1B 3SCYA 4E5ZA 3UVMA 2I0SA 1GP2B 5C2WB 1K8KC 1VYHC 3DM0A 3OKWA 2HKMA 4WK2A 4A11B 4O3UB 2CO0A 3K26A 5FKRA 1K3IA 3C9CA 3HFQA 1O6GA 3O4IA 3IUQA 4D6VA 3AFCA 3EI1B 4WJKA 2TRCB 2H14A 3JZHA 1U2VC 3K71A 1M1XA 2VDQA 1E8NA 4RE6A 4NAAA 2HU5A 3OL2A 3EU7A 4J84A 2YNOA 1QFMA 3OKYA 4YVDA 5SXMA 3EI4B 1R5MA 4PSWB 1K32A 5IJ8E 5I5JA 5FXYA 3MKQA 4QL1A 1GXRA 2VDKA 4GQBB 2OIZA 3C75H 4UM8A 1E5TA 3A0FA 2YNPA 3DWLC 1MDAH 3UVLA 2AH1A 2CNXA 1VE7A 4J79A 4ESGA 3GREA 4ERYA 5C9ZB 5C2VB 4G55A 2HJ4A 3SFZA 5AJAA 1GOFA 5FQDA 3JRPA 1N6DA 3EMHA 2XL2A 4BL0A 2CE9A 3OKYB 3BG0A 2PBIB 3ZE1A 4CC9A 3MMYA 2IUVA 3PSCB 3IKOA 4PXWA 2I0RA 4FB1D 1JJUB 5I5IA 4FA9D 4XEIC 3KRXB 4J0WA 4FA5D 2VDMA 4GM9A 3F3GA 3V5WB 3MZLA 5TEEA 4E5ZB 1H2XA 2GC4A 3BWSA 1N6EA 2VZ1A 2EIDA 1C9LA 2PM9A 4G1MA 2HU7A 4A0AA 4GGDA 3EQ7A 3IUMA 2UZYB 3OTTA 5E6RA 3O4JA 4JSXC 5HDBA 4AN1A 4JT5C 3EI1A 2IURA 3RRMC 3ZDZA 2BKLA 3OL2B 4L1QD 4R7AB 2OVQB 2I3TA 4J8GA 5M5SA 2QR5A 3AL8B 3L4MD 4L3GD 4WK4A 1U4CA 5EARA 1XKSA 4BCCA 5A2Qg 2XU7A 1B9XA 3IJ1A 4A0BB 2VDPA 2AGWA 3MKSB 4J87A 1PBYB 4AMZA 5FA5B 5CXCA 4X61B 5M5RA 3EI3B 3J80g 3O4GA 5EMLB 5IGOA 4BH6A 2HJBA 3IIYA 1UOQA 4RE5A 3I7NA 5EMKB 2AGLA 3JROA 2MTAH 5TDHB 2XDWA 2Z2OA 3SN6B 3ZDYA 5E6UA 4KFMB 4AEZA 5HE2B 3UVKA 2G9AA 4IRZA 1C9IA 2J56H 4CZYA 4NC4A 2H9MA 3FCUA 3IULA 5HQGA 4MMXA 1H2WA 5FKQA 1A12A 2EIBA 1RI6A 3VA6A 3I7HA 4EWRA 3ODTA 4MK0B 2Z2PA 3PXTD 3SXTD 4ES0A 3EWEA 4FA4D 1VE6A 4DNUA 1H2YA 2HXCA 3B7FA 3IUNA 2AH0A 3VI4A 1A0RB 5K1CC 2AGXA 2O9KA 4CI1A 5AMSA 2AGZA 3I8EA 4E54B 2H47A 2VDNA 1TYEA 4AMYA 4O9DA 3JB9L 3JZGA 4E54A 4BP8A 5M5VA 3I7OA 3UVOA 1PI6A 3DXMC 3EG6A 4JSVC 3ZWLB 4AN0A 1OLZA 2P9KC 3MVDK 4JHNA 1L5GA 3V7DB 4OWRA 4I79A 3FM0A 2YMUA 3IJCA 2VC2A 4G56B 4ZOXA 5IJ7E 5CYKB 2CO0C 2PM6B 2XL3A 4CI2A 5CYKA 4NBMA 4GM3A 4Z7NA 4GQ1A 4CI8A 2CN3A 4ZOZA 3PE7A 3EI4A 2YBAA 1O6FA 3U4YA 5EAMA 4J77A 3T3PA 4JSPC 5EM2A 4AOWA 2H13A 2EICA 3CFVA 4QT8A 2H6NA 4O1QD 4JXMA 4Z8LA 4CY3A 2H3XA 1H2ZA 1YR2A 4PC0A 3NIDA 3CFSB 5FFOA 4FWWA 3QI0A 2QXVA 3N0EA 4PBYA 2XE4A 5TF2A 2QZPA 4BP9A 5H1MA 3UKRC 1MG2A 5IGQA 2OK4A 2J57G 4O3TB 4BCBA 1QFSA 5EMJB 3RLMD 2BBKH 2YNNA 3EQ8A 1BPOA 1P22A 2HKRA 3C99A 1VZ2A 4GGAA 4J0XA 5K19A 3SVWD 4H5IA 4MMZA 1JMZB 5FFGA 4A2LA 5AFU3 2B5MA 4U1EI 5IC7A 5C86A 3SJLD 2HESX 4Z7OA 5M61A 4L3HD 4H5JA 2B4EA 4J73A 1OMWB 3NVNA 2EIEA 1GOTB 1UOPA 4IMMA 5CXBB 3AL8A 4O02A 3MZKA 2YB8B 3VH0A 3EI2B 2IWKA 4A11A 5HE0B 1SHYB 3RN0D 3MUNA 3J81g 4NSXA 4JD2C 3I8CA 3UVNA 4GQ2P 3PVWB 2H9PA 3EI2A 3IIWA 4DNWA 4LG8A 1N6FA 2I0TA 3W15A 1Q47A 2B5NA 2XZGA 3O4HA 4GM8A 4LG9A 3I7KA 4LGNA 3RFGA 4GZ8A 2P9LC 3KRWB 3OF7A 4J81A 3RSEC 2B5LA 2P9IC 1I2MB 5GMKn 1PGUA 2H9NA 2GNQA 3I7LA 4O2WA 3K6SA 3UKUC 4CY5A 1XHMA 3C5MA 1PEVA 3F3FA 4PNKB 5EMMB 1NR0A 3MXXA 5KDOB 3K72A 4XYIA 3UR4A 4QAMA 2AQ5A 2H9LA 2WQ8A 3V4PA 4DNVA 4A0BA 3PVUB 3KCIA 3FRXA 3CIKB 4XYHA 1ERJA 4D9SA 4ZOYA 4A08A 4QQEA 5I5MA 4ERQA 4A0AB 3OW8A 4GGCA 4ZN4A 3DSMA 4D0KA 4A08B 2XYIA 3IJ0A 4L9OA 3AH8B 1T2XA 4J86A 3RN1D 2VDLA 3IVMA 2OJYA 3IURA 2P9PC 3SWSD 3DDUA 3SBRA 3I2NA 1S4UX 4X60B 2VDOA 1L0QA 3QHYB 4JHPC 2HYEA 4Y7RA 2OK6A 3GD1I 4PBZA 4UM9A 3RMZD 3I89A 4K3JB 4U7AA 4IA9A 2EBSA 3NVQA 4K3ID 1VZ3A 4J82A 3V9FA 3SBQA 1B9YA 1JV2A 4FAVD 3MUOA 3NVXA 5H17A 4A09B 3SLED 5THAA 2P9SC 5FLXg 1JOFA 4FHLA 3NIFA 4CZVA 1JTDB 2IAAA 5M5UA 3RFHA 3SMRA 1JMXB 5C92A 3T3MA 3ULEC 3ZE2A 5HYNB 3EQ9A 4OZUA 2OVRB 2VZ3A 3AL9A 2IUPA 1U8CA 1XIPA 2I3SA 3NIGA 4Z7QA 5EAPA 3FGBA 1UTCA 2P9UC 4JSNC 3F3PA 4ERZA 2J55H 5CXCB 4CY2A 2PM9B 3JZNA 3JAMg 5EM2B 3P4FA 3PSLA 2CE8A 3OKTA 4X3EA 2JKXA 2BCJB 3VGZA 4TZ4A 4UI9R 3ZDXA 1SQ9A 1GOHA 3L4OD 1E8MA 4AX4A 4N14A 1QNIA 3SBPA 3I7PA 2QC5A 1MG3A 2H68A 1FWXA 2VDRA 3GC3B 1UOOA 1GOGA 3FCSA 3VI3A 5GXIA 3IJEA 4J8BA 4A09A 2H6KA 4ZOVA 4CY1A 2W18A 4Y5RD 5GSAA 4WK0A 2AGYA 4FA1D 4BUJC 5E6SA 3BG1A 5IT9g 4CI3A 5JWZA 2GC7A 2OVPB 5H14A 3JPXA 2G99A 3IUJA 1NEXB 5FKSA 3ZE0A 4QRJA 4X63B 1TBGA 5M5TA 2Z2NA 2Q7QA 3PXWD 2PM7B 1GG2B
chains in the Genus database with same CATH topology
3EI3A 4FAND 3N0DA 4A2MA 5TEFA 4JT6C 5CXBA 3K27A 5HE3B 3PXSD 4J78A 1SQJA 5FKTA 4CZXA 1YFQA 2IUQA 3E0CA 2UZXB 4GMBA 3GFCA 2IWFA 3DXKC 5GXHA 4HDJA 4A7JA 2P9NC 2H6QA 5B4WA 1TYQC 5EALA 3ORVD 4O45A 4PSXB 2CN2A 3SHFA 5HE1B 3SCYA 4E5ZA 3UVMA 2I0SA 1GP2B 5C2WB 1K8KC 1VYHC 3DM0A 3OKWA 2HKMA 4A11B 4O3UB 2CO0A 3K26A 5FKRA 3C9CA 3HFQA 4D6VA 3EI1B 3AFCA 2TRCB 2H14A 3JZHA 1U2VC 4J84A 3OL2A 3EU7A 2YNOA 5SXMA 3OKYA 4YVDA 3EI4B 1R5MA 4PSWB 1K32A 5IJ8E 5I5JA 5FXYA 3MKQA 4QL1A 1GXRA 4GQBB 2OIZA 3C75H 3A0FA 2YNPA 3DWLC 1MDAH 3UVLA 2AH1A 4J79A 2CNXA 4ESGA 3GREA 4ERYA 5C9ZB 5C2VB 2HJ4A 3SFZA 5AJAA 5FQDA 3JRPA 1N6DA 3EMHA 2XL2A 4BL0A 2CE9A 3OKYB 3BG0A 2PBIB 4CC9A 3MMYA 2IUVA 3PSCB 3IKOA 4PXWA 2I0RA 4FB1D 1JJUB 5I5IA 4FA9D 4XEIC 3KRXB 4J0WA 4FA5D 4GM9A 3F3GA 3V5WB 3MZLA 5TEEA 4E5ZB 3BWSA 2GC4A 1N6EA 2PM9A 4A0AA 4GGDA 2UZYB 3OTTA 4JSXC 3EI1A 4JT5C 2IURA 3RRMC 3OL2B 4L1QD 4R7AB 2OVQB 2I3TA 4J8GA 3AL8B 3L4MD 4L3GD 1U4CA 5EARA 1XKSA 5A2Qg 2XU7A 1B9XA 3IJ1A 4A0BB 2AGWA 3MKSB 4J87A 1PBYB 5FA5B 5CXCA 4X61B 3EI3B 3J80g 5EMLB 5IGOA 4BH6A 2HJBA 3IIYA 3I7NA 5EMKB 2AGLA 3JROA 2MTAH 5TDHB 2Z2OA 3SN6B 4KFMB 4AEZA 5HE2B 3UVKA 2G9AA 2J56H 4CZYA 2H9MA 5HQGA 5FKQA 1RI6A 3VA6A 3I7HA 4EWRA 3ODTA 4MK0B 2Z2PA 3PXTD 3SXTD 4ES0A 3EWEA 4FA4D 3B7FA 2HXCA 2AH0A 1A0RB 5K1CC 2AGXA 2O9KA 4CI1A 5AMSA 2AGZA 3I8EA 4E54B 2H47A 4O9DA 3JB9L 3JZGA 4E54A 3I7OA 3UVOA 1PI6A 3DXMC 3EG6A 4JSVC 3ZWLB 1OLZA 2P9KC 3V7DB 4OWRA 4I79A 3FM0A 2YMUA 3IJCA 4G56B 4ZOXA 5IJ7E 5CYKB 2CO0C 2PM6B 2XL3A 4CI2A 5CYKA 4GM3A 4GQ1A 4CI8A 2CN3A 4ZOZA 3PE7A 3EI4A 2YBAA 3U4YA 5EAMA 4J77A 4JSPC 5EM2A 4AOWA 2H13A 3CFVA 4QT8A 2H6NA 4O1QD 4JXMA 4Z8LA 4CY3A 2H3XA 4PC0A 3CFSB 4FWWA 2QXVA 3N0EA 4PBYA 5TF2A 5IGQA 5H1MA 3UKRC 1MG2A 2OK4A 2J57G 4O3TB 5EMJB 3RLMD 2BBKH 2YNNA 4J0XA 1P22A 2HKRA 3C99A 4GGAA 5K19A 3SVWD 4H5IA 1JMZB 4A2LA 5AFU3 2B5MA 4U1EI 5IC7A 3SJLD 2HESX 4L3HD 4H5JA 2B4EA 4J73A 1OMWB 3NVNA 1GOTB 4IMMA 5CXBB 3AL8A 3MZKA 2YB8B 3VH0A 3EI2B 2IWKA 4A11A 5HE0B 1SHYB 3RN0D 3J81g 4NSXA 4JD2C 3I8CA 3UVNA 4GQ2P 3PVWB 2H9PA 3EI2A 3IIWA 4LG8A 1N6FA 2I0TA 3W15A 1Q47A 2B5NA 4GM8A 4LG9A 3I7KA 4LGNA 3RFGA 4GZ8A 2P9LC 3KRWB 4J81A 3RSEC 2B5LA 2P9IC 5GMKn 1PGUA 2H9NA 2GNQA 3I7LA 3UKUC 4CY5A 1XHMA 3C5MA 1PEVA 3F3FA 4PNKB 5EMMB 1NR0A 3MXXA 5KDOB 4XYIA 3UR4A 2AQ5A 2H9LA 4A0BA 3PVUB 3FRXA 3CIKB 4XYHA 1ERJA 4ZOYA 4A08A 4QQEA 5I5MA 4ERQA 4A0AB 3OW8A 4GGCA 4ZN4A 3DSMA 4D0KA 4A08B 2XYIA 3IJ0A 4L9OA 3AH8B 4J86A 3RN1D 2OJYA 2P9PC 3SWSD 3SBRA 3I2NA 1S4UX 4X60B 1L0QA 2HYEA 4Y7RA 2OK6A 4PBZA 3RMZD 3I89A 4K3JB 4U7AA 4IA9A 2EBSA 3NVQA 4K3ID 4J82A 3V9FA 3SBQA 1B9YA 4FAVD 5H17A 3NVXA 4A09B 3SLED 5THAA 2P9SC 5FLXg 1JOFA 4FHLA 4CZVA 2IAAA 3RFHA 3SMRA 1JMXB 3ULEC 5HYNB 4OZUA 2OVRB 3AL9A 2IUPA 1XIPA 2I3SA 5EAPA 3FGBA 2P9UC 4JSNC 3F3PA 4ERZA 2J55H 5CXCB 4CY2A 2PM9B 3JZNA 3JAMg 5EM2B 3P4FA 3PSLA 2CE8A 3OKTA 4X3EA 2BCJB 3VGZA 4TZ4A 4UI9R 1SQ9A 3L4OD 4N14A 1QNIA 3SBPA 3I7PA 2QC5A 1MG3A 2H68A 1FWXA 5GXIA 4J8BA 4A09A 2H6KA 4ZOVA 4CY1A 2W18A 4Y5RD 5GSAA 2AGYA 4FA1D 4BUJC 3BG1A 5IT9g 4CI3A 5JWZA 2GC7A 2OVPB 5H14A 3JPXA 2G99A 1NEXB 5FKSA 4QRJA 4X63B 1TBGA 2Z2NA 2Q7QA 3PXWD 2PM7B 1GG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI3 A;  4FAN D;  3N0D A;  4A2M A;  5TEF A;  4JT6 C;  5CXB A;  3K27 A;  5HE3 B;  3PXS D;  4J78 A;  1SQJ A;  5FKT A;  4CZX A;  1YFQ A;  2IUQ A;  3E0C A;  2UZX B;  4GMB A;  3GFC A;  2IWF A;  3DXK C;  5GXH A;  4HDJ A;  4A7J A;  2P9N C;  2H6Q A;  5B4W A;  1TYQ C;  5EAL A;  3ORV D;  4O45 A;  4PSX B;  2CN2 A;  3SHF A;  5HE1 B;  3SCY A;  4E5Z A;  3UVM A;  2I0S A;  1GP2 B;  5C2W B;  1K8K C;  1VYH C;  3DM0 A;  3OKW A;  2HKM A;  4A11 B;  4O3U B;  2CO0 A;  3K26 A;  5FKR A;  3C9C A;  3HFQ A;  4D6V A;  3EI1 B;  3AFC A;  2TRC B;  2H14 A;  3JZH A;  1U2V C;  4J84 A;  3OL2 A;  3EU7 A;  2YNO A;  5SXM A;  3OKY A;  4YVD A;  3EI4 B;  1R5M A;  4PSW B;  1K32 A;  5IJ8 E;  5I5J A;  5FXY A;  3MKQ A;  4QL1 A;  1GXR A;  4GQB B;  2OIZ A;  3C75 H;  3A0F A;  2YNP A;  3DWL C;  1MDA H;  3UVL A;  2AH1 A;  4J79 A;  2CNX A;  4ESG A;  3GRE A;  4ERY A;  5C9Z B;  5C2V B;  2HJ4 A;  3SFZ A;  5AJA A;  5FQD A;  3JRP A;  1N6D A;  3EMH A;  2XL2 A;  4BL0 A;  2CE9 A;  3OKY B;  3BG0 A;  2PBI B;  4CC9 A;  3MMY A;  2IUV A;  3PSC B;  3IKO A;  4PXW A;  2I0R A;  4FB1 D;  1JJU B;  5I5I A;  4FA9 D;  4XEI C;  3KRX B;  4J0W A;  4FA5 D;  4GM9 A;  3F3G A;  3V5W B;  3MZL A;  5TEE A;  4E5Z B;  3BWS A;  2GC4 A;  1N6E A;  2PM9 A;  4A0A A;  4GGD A;  2UZY B;  3OTT A;  4JSX C;  3EI1 A;  4JT5 C;  2IUR A;  3RRM C;  3OL2 B;  4L1Q D;  4R7A B;  2OVQ B;  2I3T A;  4J8G A;  3AL8 B;  3L4M D;  4L3G D;  1U4C A;  5EAR A;  1XKS A;  5A2Q g;  2XU7 A;  1B9X A;  3IJ1 A;  4A0B B;  2AGW A;  3MKS B;  4J87 A;  1PBY B;  5FA5 B;  5CXC A;  4X61 B;  3EI3 B;  3J80 g;  5EML B;  5IGO A;  4BH6 A;  2HJB A;  3IIY A;  3I7N A;  5EMK B;  2AGL A;  3JRO A;  2MTA H;  5TDH B;  2Z2O A;  3SN6 B;  4KFM B;  4AEZ A;  5HE2 B;  3UVK A;  2G9A A;  2J56 H;  4CZY A;  2H9M A;  5HQG A;  5FKQ A;  1RI6 A;  3VA6 A;  3I7H A;  4EWR A;  3ODT A;  4MK0 B;  2Z2P A;  3PXT D;  3SXT D;  4ES0 A;  3EWE A;  4FA4 D;  3B7F A;  2HXC A;  2AH0 A;  1A0R B;  5K1C C;  2AGX A;  2O9K A;  4CI1 A;  5AMS A;  2AGZ A;  3I8E A;  4E54 B;  2H47 A;  4O9D A;  3JB9 L;  3JZG A;  4E54 A;  3I7O A;  3UVO A;  1PI6 A;  3DXM C;  3EG6 A;  4JSV C;  3ZWL B;  1OLZ A;  2P9K C;  3V7D B;  4OWR A;  4I79 A;  3FM0 A;  2YMU A;  3IJC A;  4G56 B;  4ZOX A;  5IJ7 E;  5CYK B;  2CO0 C;  2PM6 B;  2XL3 A;  4CI2 A;  5CYK A;  4GM3 A;  4GQ1 A;  4CI8 A;  2CN3 A;  4ZOZ A;  3PE7 A;  3EI4 A;  2YBA A;  3U4Y A;  5EAM A;  4J77 A;  4JSP C;  5EM2 A;  4AOW A;  2H13 A;  3CFV A;  4QT8 A;  2H6N A;  4O1Q D;  4JXM A;  4Z8L A;  4CY3 A;  2H3X A;  4PC0 A;  3CFS B;  4FWW A;  2QXV A;  3N0E A;  4PBY A;  5TF2 A;  5IGQ A;  5H1M A;  3UKR C;  1MG2 A;  2OK4 A;  2J57 G;  4O3T B;  5EMJ B;  3RLM D;  2BBK H;  2YNN A;  4J0X A;  1P22 A;  2HKR A;  3C99 A;  4GGA A;  5K19 A;  3SVW D;  4H5I A;  1JMZ B;  4A2L A;  5AFU 3;  2B5M A;  4U1E I;  5IC7 A;  3SJL D;  2HES X;  4L3H D;  4H5J A;  2B4E A;  4J73 A;  1OMW B;  3NVN A;  1GOT B;  4IMM A;  5CXB B;  3AL8 A;  3MZK A;  2YB8 B;  3VH0 A;  3EI2 B;  2IWK A;  4A11 A;  5HE0 B;  1SHY B;  3RN0 D;  3J81 g;  4NSX A;  4JD2 C;  3I8C A;  3UVN A;  4GQ2 P;  3PVW B;  2H9P A;  3EI2 A;  3IIW A;  4LG8 A;  1N6F A;  2I0T A;  3W15 A;  1Q47 A;  2B5N A;  4GM8 A;  4LG9 A;  3I7K A;  4LGN A;  3RFG A;  4GZ8 A;  2P9L C;  3KRW B;  4J81 A;  3RSE C;  2B5L A;  2P9I C;  5GMK n;  1PGU A;  2H9N A;  2GNQ A;  3I7L A;  3UKU C;  4CY5 A;  1XHM A;  3C5M A;  1PEV A;  3F3F A;  4PNK B;  5EMM B;  1NR0 A;  3MXX A;  5KDO B;  4XYI A;  3UR4 A;  2AQ5 A;  2H9L A;  4A0B A;  3PVU B;  3FRX A;  3CIK B;  4XYH A;  1ERJ A;  4ZOY A;  4A08 A;  4QQE A;  5I5M A;  4ERQ A;  4A0A B;  3OW8 A;  4GGC A;  4ZN4 A;  3DSM A;  4D0K A;  4A08 B;  2XYI A;  3IJ0 A;  4L9O A;  3AH8 B;  4J86 A;  3RN1 D;  2OJY A;  2P9P C;  3SWS D;  3SBR A;  3I2N A;  1S4U X;  4X60 B;  1L0Q A;  2HYE A;  4Y7R A;  2OK6 A;  4PBZ A;  3RMZ D;  3I89 A;  4K3J B;  4U7A A;  4IA9 A;  2EBS A;  3NVQ A;  4K3I D;  4J82 A;  3V9F A;  3SBQ A;  1B9Y A;  4FAV D;  5H17 A;  3NVX A;  4A09 B;  3SLE D;  5THA A;  2P9S C;  5FLX g;  1JOF A;  4FHL A;  4CZV A;  2IAA A;  3RFH A;  3SMR A;  1JMX B;  3ULE C;  5HYN B;  4OZU A;  2OVR B;  3AL9 A;  2IUP A;  1XIP A;  2I3S A;  5EAP A;  3FGB A;  2P9U C;  4JSN C;  3F3P A;  4ERZ A;  2J55 H;  5CXC B;  4CY2 A;  2PM9 B;  3JZN A;  3JAM g;  5EM2 B;  3P4F A;  3PSL A;  2CE8 A;  3OKT A;  4X3E A;  2BCJ B;  3VGZ A;  4TZ4 A;  4UI9 R;  1SQ9 A;  3L4O D;  4N14 A;  1QNI A;  3SBP A;  3I7P A;  2QC5 A;  1MG3 A;  2H68 A;  1FWX A;  5GXI A;  4J8B A;  4A09 A;  2H6K A;  4ZOV A;  4CY1 A;  2W18 A;  4Y5R D;  5GSA A;  2AGY A;  4FA1 D;  4BUJ C;  3BG1 A;  5IT9 g;  4CI3 A;  5JWZ A;  2GC7 A;  2OVP B;  5H14 A;  3JPX A;  2G99 A;  1NEX B;  5FKS A;  4QRJ A;  4X63 B;  1TBG A;  2Z2N A;  2Q7Q A;  3PXW D;  2PM7 B;  1GG2 B; 
#chains in the Genus database with same CATH topology
 3EI3 A;  4FAN D;  3N0D A;  4A2M A;  4NEN A;  5TEF A;  4JT6 C;  5CXB A;  3K27 A;  4L1M A;  5HE3 B;  3PXS D;  4J78 A;  1SQJ A;  5FKT A;  4CZX A;  1YFQ A;  2IUQ A;  2HU8 A;  3E0C A;  2UZX B;  4GMB A;  4G1E A;  3GFC A;  2IWF A;  3DXK C;  4MMY A;  5GXH A;  4HDJ A;  4A7J A;  2P9N C;  3V4V A;  4BCD A;  2H6Q A;  5B4W A;  1TYQ C;  5EAL A;  3ORV D;  4O45 A;  4PSX B;  2CN2 A;  3SHF A;  5HE1 B;  3SCY A;  4E5Z A;  3UVM A;  2I0S A;  1GP2 B;  5C2W B;  1K8K C;  1VYH C;  3DM0 A;  3OKW A;  2HKM A;  4WK2 A;  4A11 B;  4O3U B;  2CO0 A;  3K26 A;  5FKR A;  1K3I A;  3C9C A;  3HFQ A;  1O6G A;  3O4I A;  3IUQ A;  4D6V A;  3AFC A;  3EI1 B;  4WJK A;  2TRC B;  2H14 A;  3JZH A;  1U2V C;  3K71 A;  1M1X A;  2VDQ A;  1E8N A;  4RE6 A;  4NAA A;  2HU5 A;  3OL2 A;  3EU7 A;  4J84 A;  2YNO A;  1QFM A;  3OKY A;  4YVD A;  5SXM A;  3EI4 B;  1R5M A;  4PSW B;  1K32 A;  5IJ8 E;  5I5J A;  5FXY A;  3MKQ A;  4QL1 A;  1GXR A;  2VDK A;  4GQB B;  2OIZ A;  3C75 H;  4UM8 A;  1E5T A;  3A0F A;  2YNP A;  3DWL C;  1MDA H;  3UVL A;  2AH1 A;  2CNX A;  1VE7 A;  4J79 A;  4ESG A;  3GRE A;  4ERY A;  5C9Z B;  5C2V B;  4G55 A;  2HJ4 A;  3SFZ A;  5AJA A;  1GOF A;  5FQD A;  3JRP A;  1N6D A;  3EMH A;  2XL2 A;  4BL0 A;  2CE9 A;  3OKY B;  3BG0 A;  2PBI B;  3ZE1 A;  4CC9 A;  3MMY A;  2IUV A;  3PSC B;  3IKO A;  4PXW A;  2I0R A;  4FB1 D;  1JJU B;  5I5I A;  4FA9 D;  4XEI C;  3KRX B;  4J0W A;  4FA5 D;  2VDM A;  4GM9 A;  3F3G A;  3V5W B;  3MZL A;  5TEE A;  4E5Z B;  1H2X A;  2GC4 A;  3BWS A;  1N6E A;  2VZ1 A;  2EID A;  1C9L A;  2PM9 A;  4G1M A;  2HU7 A;  4A0A A;  4GGD A;  3EQ7 A;  3IUM A;  2UZY B;  3OTT A;  5E6R A;  3O4J A;  4JSX C;  5HDB A;  4AN1 A;  4JT5 C;  3EI1 A;  2IUR A;  3RRM C;  3ZDZ A;  2BKL A;  3OL2 B;  4L1Q D;  4R7A B;  2OVQ B;  2I3T A;  4J8G A;  5M5S A;  2QR5 A;  3AL8 B;  3L4M D;  4L3G D;  4WK4 A;  1U4C A;  5EAR A;  1XKS A;  4BCC A;  5A2Q g;  2XU7 A;  1B9X A;  3IJ1 A;  4A0B B;  2VDP A;  2AGW A;  3MKS B;  4J87 A;  1PBY B;  4AMZ A;  5FA5 B;  5CXC A;  4X61 B;  5M5R A;  3EI3 B;  3J80 g;  3O4G A;  5EML B;  5IGO A;  4BH6 A;  2HJB A;  3IIY A;  1UOQ A;  4RE5 A;  3I7N A;  5EMK B;  2AGL A;  3JRO A;  2MTA H;  5TDH B;  2XDW A;  2Z2O A;  3SN6 B;  3ZDY A;  5E6U A;  4KFM B;  4AEZ A;  5HE2 B;  3UVK A;  2G9A A;  4IRZ A;  1C9I A;  2J56 H;  4CZY A;  4NC4 A;  2H9M A;  3FCU A;  3IUL A;  5HQG A;  4MMX A;  1H2W A;  5FKQ A;  1A12 A;  2EIB A;  1RI6 A;  3VA6 A;  3I7H A;  4EWR A;  3ODT A;  4MK0 B;  2Z2P A;  3PXT D;  3SXT D;  4ES0 A;  3EWE A;  4FA4 D;  1VE6 A;  4DNU A;  1H2Y A;  2HXC A;  3B7F A;  3IUN A;  2AH0 A;  3VI4 A;  1A0R B;  5K1C C;  2AGX A;  2O9K A;  4CI1 A;  5AMS A;  2AGZ A;  3I8E A;  4E54 B;  2H47 A;  2VDN A;  1TYE A;  4AMY A;  4O9D A;  3JB9 L;  3JZG A;  4E54 A;  4BP8 A;  5M5V A;  3I7O A;  3UVO A;  1PI6 A;  3DXM C;  3EG6 A;  4JSV C;  3ZWL B;  4AN0 A;  1OLZ A;  2P9K C;  3MVD K;  4JHN A;  1L5G A;  3V7D B;  4OWR A;  4I79 A;  3FM0 A;  2YMU A;  3IJC A;  2VC2 A;  4G56 B;  4ZOX A;  5IJ7 E;  5CYK B;  2CO0 C;  2PM6 B;  2XL3 A;  4CI2 A;  5CYK A;  4NBM A;  4GM3 A;  4Z7N A;  4GQ1 A;  4CI8 A;  2CN3 A;  4ZOZ A;  3PE7 A;  3EI4 A;  2YBA A;  1O6F A;  3U4Y A;  5EAM A;  4J77 A;  3T3P A;  4JSP C;  5EM2 A;  4AOW A;  2H13 A;  2EIC A;  3CFV A;  4QT8 A;  2H6N A;  4O1Q D;  4JXM A;  4Z8L A;  4CY3 A;  2H3X A;  1H2Z A;  1YR2 A;  4PC0 A;  3NID A;  3CFS B;  5FFO A;  4FWW A;  3QI0 A;  2QXV A;  3N0E A;  4PBY A;  2XE4 A;  5TF2 A;  2QZP A;  4BP9 A;  5H1M A;  3UKR C;  1MG2 A;  5IGQ A;  2OK4 A;  2J57 G;  4O3T B;  4BCB A;  1QFS A;  5EMJ B;  3RLM D;  2BBK H;  2YNN A;  3EQ8 A;  1BPO A;  1P22 A;  2HKR A;  3C99 A;  1VZ2 A;  4GGA A;  4J0X A;  5K19 A;  3SVW D;  4H5I A;  4MMZ A;  1JMZ B;  5FFG A;  4A2L A;  5AFU 3;  2B5M A;  4U1E I;  5IC7 A;  5C86 A;  3SJL D;  2HES X;  4Z7O A;  5M61 A;  4L3H D;  4H5J A;  2B4E A;  4J73 A;  1OMW B;  3NVN A;  2EIE A;  1GOT B;  1UOP A;  4IMM A;  5CXB B;  3AL8 A;  4O02 A;  3MZK A;  2YB8 B;  3VH0 A;  3EI2 B;  2IWK A;  4A11 A;  5HE0 B;  1SHY B;  3RN0 D;  3MUN A;  3J81 g;  4NSX A;  4JD2 C;  3I8C A;  3UVN A;  4GQ2 P;  3PVW B;  2H9P A;  3EI2 A;  3IIW A;  4DNW A;  4LG8 A;  1N6F A;  2I0T A;  3W15 A;  1Q47 A;  2B5N A;  2XZG A;  3O4H A;  4GM8 A;  4LG9 A;  3I7K A;  4LGN A;  3RFG A;  4GZ8 A;  2P9L C;  3KRW B;  3OF7 A;  4J81 A;  3RSE C;  2B5L A;  2P9I C;  1I2M B;  5GMK n;  1PGU A;  2H9N A;  2GNQ A;  3I7L A;  4O2W A;  3K6S A;  3UKU C;  4CY5 A;  1XHM A;  3C5M A;  1PEV A;  3F3F A;  4PNK B;  5EMM B;  1NR0 A;  3MXX A;  5KDO B;  3K72 A;  4XYI A;  3UR4 A;  4QAM A;  2AQ5 A;  2H9L A;  2WQ8 A;  3V4P A;  4DNV A;  4A0B A;  3PVU B;  3KCI A;  3FRX A;  3CIK B;  4XYH A;  1ERJ A;  4D9S A;  4ZOY A;  4A08 A;  4QQE A;  5I5M A;  4ERQ A;  4A0A B;  3OW8 A;  4GGC A;  4ZN4 A;  3DSM A;  4D0K A;  4A08 B;  2XYI A;  3IJ0 A;  4L9O A;  3AH8 B;  1T2X A;  4J86 A;  3RN1 D;  2VDL A;  3IVM A;  2OJY A;  3IUR A;  2P9P C;  3SWS D;  3DDU A;  3SBR A;  3I2N A;  1S4U X;  4X60 B;  2VDO A;  1L0Q A;  3QHY B;  4JHP C;  2HYE A;  4Y7R A;  2OK6 A;  3GD1 I;  4PBZ A;  4UM9 A;  3RMZ D;  3I89 A;  4K3J B;  4U7A A;  4IA9 A;  2EBS A;  3NVQ A;  4K3I D;  1VZ3 A;  4J82 A;  3V9F A;  3SBQ A;  1B9Y A;  1JV2 A;  4FAV D;  3MUO A;  3NVX A;  5H17 A;  4A09 B;  3SLE D;  5THA A;  2P9S C;  5FLX g;  1JOF A;  4FHL A;  3NIF A;  4CZV A;  1JTD B;  2IAA A;  5M5U A;  3RFH A;  3SMR A;  1JMX B;  5C92 A;  3T3M A;  3ULE C;  3ZE2 A;  5HYN B;  3EQ9 A;  4OZU A;  2OVR B;  2VZ3 A;  3AL9 A;  2IUP A;  1U8C A;  1XIP A;  2I3S A;  3NIG A;  4Z7Q A;  5EAP A;  3FGB A;  1UTC A;  2P9U C;  4JSN C;  3F3P A;  4ERZ A;  2J55 H;  5CXC B;  4CY2 A;  2PM9 B;  3JZN A;  3JAM g;  5EM2 B;  3P4F A;  3PSL A;  2CE8 A;  3OKT A;  4X3E A;  2JKX A;  2BCJ B;  3VGZ A;  4TZ4 A;  4UI9 R;  3ZDX A;  1SQ9 A;  1GOH A;  3L4O D;  1E8M A;  4AX4 A;  4N14 A;  1QNI A;  3SBP A;  3I7P A;  2QC5 A;  1MG3 A;  2H68 A;  1FWX A;  2VDR A;  3GC3 B;  1UOO A;  1GOG A;  3FCS A;  3VI3 A;  5GXI A;  3IJE A;  4J8B A;  4A09 A;  2H6K A;  4ZOV A;  4CY1 A;  2W18 A;  4Y5R D;  5GSA A;  4WK0 A;  2AGY A;  4FA1 D;  4BUJ C;  5E6S A;  3BG1 A;  5IT9 g;  4CI3 A;  5JWZ A;  2GC7 A;  2OVP B;  5H14 A;  3JPX A;  2G99 A;  3IUJ A;  1NEX B;  5FKS A;  3ZE0 A;  4QRJ A;  4X63 B;  1TBG A;  5M5T A;  2Z2N A;  2Q7Q A;  3PXW D;  2PM7 B;  1GG2 B; 
#chains in the Genus database with same CATH homology
 3EI3 A;  4FAN D;  3N0D A;  4A2M A;  5TEF A;  4JT6 C;  5CXB A;  3K27 A;  5HE3 B;  3PXS D;  4J78 A;  1SQJ A;  5FKT A;  4CZX A;  1YFQ A;  2IUQ A;  3E0C A;  2UZX B;  4GMB A;  3GFC A;  2IWF A;  3DXK C;  5GXH A;  4HDJ A;  4A7J A;  2P9N C;  2H6Q A;  5B4W A;  1TYQ C;  5EAL A;  3ORV D;  4O45 A;  4PSX B;  2CN2 A;  3SHF A;  5HE1 B;  3SCY A;  4E5Z A;  3UVM A;  2I0S A;  1GP2 B;  5C2W B;  1K8K C;  1VYH C;  3DM0 A;  3OKW A;  2HKM A;  4A11 B;  4O3U B;  2CO0 A;  3K26 A;  5FKR A;  3C9C A;  3HFQ A;  4D6V A;  3EI1 B;  3AFC A;  2TRC B;  2H14 A;  3JZH A;  1U2V C;  4J84 A;  3OL2 A;  3EU7 A;  2YNO A;  5SXM A;  3OKY A;  4YVD A;  3EI4 B;  1R5M A;  4PSW B;  1K32 A;  5IJ8 E;  5I5J A;  5FXY A;  3MKQ A;  4QL1 A;  1GXR A;  4GQB B;  2OIZ A;  3C75 H;  3A0F A;  2YNP A;  3DWL C;  1MDA H;  3UVL A;  2AH1 A;  4J79 A;  2CNX A;  4ESG A;  3GRE A;  4ERY A;  5C9Z B;  5C2V B;  2HJ4 A;  3SFZ A;  5AJA A;  5FQD A;  3JRP A;  1N6D A;  3EMH A;  2XL2 A;  4BL0 A;  2CE9 A;  3OKY B;  3BG0 A;  2PBI B;  4CC9 A;  3MMY A;  2IUV A;  3PSC B;  3IKO A;  4PXW A;  2I0R A;  4FB1 D;  1JJU B;  5I5I A;  4FA9 D;  4XEI C;  3KRX B;  4J0W A;  4FA5 D;  4GM9 A;  3F3G A;  3V5W B;  3MZL A;  5TEE A;  4E5Z B;  3BWS A;  2GC4 A;  1N6E A;  2PM9 A;  4A0A A;  4GGD A;  2UZY B;  3OTT A;  4JSX C;  3EI1 A;  4JT5 C;  2IUR A;  3RRM C;  3OL2 B;  4L1Q D;  4R7A B;  2OVQ B;  2I3T A;  4J8G A;  3AL8 B;  3L4M D;  4L3G D;  1U4C A;  5EAR A;  1XKS A;  5A2Q g;  2XU7 A;  1B9X A;  3IJ1 A;  4A0B B;  2AGW A;  3MKS B;  4J87 A;  1PBY B;  5FA5 B;  5CXC A;  4X61 B;  3EI3 B;  3J80 g;  5EML B;  5IGO A;  4BH6 A;  2HJB A;  3IIY A;  3I7N A;  5EMK B;  2AGL A;  3JRO A;  2MTA H;  5TDH B;  2Z2O A;  3SN6 B;  4KFM B;  4AEZ A;  5HE2 B;  3UVK A;  2G9A A;  2J56 H;  4CZY A;  2H9M A;  5HQG A;  5FKQ A;  1RI6 A;  3VA6 A;  3I7H A;  4EWR A;  3ODT A;  4MK0 B;  2Z2P A;  3PXT D;  3SXT D;  4ES0 A;  3EWE A;  4FA4 D;  3B7F A;  2HXC A;  2AH0 A;  1A0R B;  5K1C C;  2AGX A;  2O9K A;  4CI1 A;  5AMS A;  2AGZ A;  3I8E A;  4E54 B;  2H47 A;  4O9D A;  3JB9 L;  3JZG A;  4E54 A;  3I7O A;  3UVO A;  1PI6 A;  3DXM C;  3EG6 A;  4JSV C;  3ZWL B;  1OLZ A;  2P9K C;  3V7D B;  4OWR A;  4I79 A;  3FM0 A;  2YMU A;  3IJC A;  4G56 B;  4ZOX A;  5IJ7 E;  5CYK B;  2CO0 C;  2PM6 B;  2XL3 A;  4CI2 A;  5CYK A;  4GM3 A;  4GQ1 A;  4CI8 A;  2CN3 A;  4ZOZ A;  3PE7 A;  3EI4 A;  2YBA A;  3U4Y A;  5EAM A;  4J77 A;  4JSP C;  5EM2 A;  4AOW A;  2H13 A;  3CFV A;  4QT8 A;  2H6N A;  4O1Q D;  4JXM A;  4Z8L A;  4CY3 A;  2H3X A;  4PC0 A;  3CFS B;  4FWW A;  2QXV A;  3N0E A;  4PBY A;  5TF2 A;  5IGQ A;  5H1M A;  3UKR C;  1MG2 A;  2OK4 A;  2J57 G;  4O3T B;  5EMJ B;  3RLM D;  2BBK H;  2YNN A;  4J0X A;  1P22 A;  2HKR A;  3C99 A;  4GGA A;  5K19 A;  3SVW D;  4H5I A;  1JMZ B;  4A2L A;  5AFU 3;  2B5M A;  4U1E I;  5IC7 A;  3SJL D;  2HES X;  4L3H D;  4H5J A;  2B4E A;  4J73 A;  1OMW B;  3NVN A;  1GOT B;  4IMM A;  5CXB B;  3AL8 A;  3MZK A;  2YB8 B;  3VH0 A;  3EI2 B;  2IWK A;  4A11 A;  5HE0 B;  1SHY B;  3RN0 D;  3J81 g;  4NSX A;  4JD2 C;  3I8C A;  3UVN A;  4GQ2 P;  3PVW B;  2H9P A;  3EI2 A;  3IIW A;  4LG8 A;  1N6F A;  2I0T A;  3W15 A;  1Q47 A;  2B5N A;  4GM8 A;  4LG9 A;  3I7K A;  4LGN A;  3RFG A;  4GZ8 A;  2P9L C;  3KRW B;  4J81 A;  3RSE C;  2B5L A;  2P9I C;  5GMK n;  1PGU A;  2H9N A;  2GNQ A;  3I7L A;  3UKU C;  4CY5 A;  1XHM A;  3C5M A;  1PEV A;  3F3F A;  4PNK B;  5EMM B;  1NR0 A;  3MXX A;  5KDO B;  4XYI A;  3UR4 A;  2AQ5 A;  2H9L A;  4A0B A;  3PVU B;  3FRX A;  3CIK B;  4XYH A;  1ERJ A;  4ZOY A;  4A08 A;  4QQE A;  5I5M A;  4ERQ A;  4A0A B;  3OW8 A;  4GGC A;  4ZN4 A;  3DSM A;  4D0K A;  4A08 B;  2XYI A;  3IJ0 A;  4L9O A;  3AH8 B;  4J86 A;  3RN1 D;  2OJY A;  2P9P C;  3SWS D;  3SBR A;  3I2N A;  1S4U X;  4X60 B;  1L0Q A;  2HYE A;  4Y7R A;  2OK6 A;  4PBZ A;  3RMZ D;  3I89 A;  4K3J B;  4U7A A;  4IA9 A;  2EBS A;  3NVQ A;  4K3I D;  4J82 A;  3V9F A;  3SBQ A;  1B9Y A;  4FAV D;  5H17 A;  3NVX A;  4A09 B;  3SLE D;  5THA A;  2P9S C;  5FLX g;  1JOF A;  4FHL A;  4CZV A;  2IAA A;  3RFH A;  3SMR A;  1JMX B;  3ULE C;  5HYN B;  4OZU A;  2OVR B;  3AL9 A;  2IUP A;  1XIP A;  2I3S A;  5EAP A;  3FGB A;  2P9U C;  4JSN C;  3F3P A;  4ERZ A;  2J55 H;  5CXC B;  4CY2 A;  2PM9 B;  3JZN A;  3JAM g;  5EM2 B;  3P4F A;  3PSL A;  2CE8 A;  3OKT A;  4X3E A;  2BCJ B;  3VGZ A;  4TZ4 A;  4UI9 R;  1SQ9 A;  3L4O D;  4N14 A;  1QNI A;  3SBP A;  3I7P A;  2QC5 A;  1MG3 A;  2H68 A;  1FWX A;  5GXI A;  4J8B A;  4A09 A;  2H6K A;  4ZOV A;  4CY1 A;  2W18 A;  4Y5R D;  5GSA A;  2AGY A;  4FA1 D;  4BUJ C;  3BG1 A;  5IT9 g;  4CI3 A;  5JWZ A;  2GC7 A;  2OVP B;  5H14 A;  3JPX A;  2G99 A;  1NEX B;  5FKS A;  4QRJ A;  4X63 B;  1TBG A;  2Z2N A;  2Q7Q A;  3PXW D;  2PM7 B;  1GG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...