2QC5A

Streptogramin b lyase structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
298
structure length
298
Chain Sequence
SEAWMNFYLEEFNLSIPDSGPYGITSSEDGKVWFTQHKANKISSLDQSGRIKEFEVPTPDAKVMCLIVSSLGDIWFTENGANKIGKLSKKGGFTEYPLPQPDSGPYGITEGLNGDIWFTQLNGDRIGKLTADGTIYEYDLPNKGSYPAFITLGSDNALWFTENQNNSIGRITNTGKLEEYPLPTNAAAPVGITSGNDGALWFVEIMGNKIGRITTTGEISEYDIPTPNARPHAITAGKNSEIWFTEWGANQIGRITNDNTIQEYQLQTENAEPHGITFGKDGSVWFALKCKIGKLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogramin B lactonase
publication title Crystal structure and mechanism of the Staphylococcus cohnii virginiamycin B lyase (Vgb).
pubmed doi rcsb
source organism Staphylococcus cohnii
molecule tags Lyase
total genus 70
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2qc5A00
1U2VC 4OZUA 4G56B 5CXBA 1PI6A 5IC7A 3MKQA 2AGYA 3SJLD 2EBSA 4GM9A 2B5MA 2I0SA 5TEFA 4N14A 3JRPA 4J81A 3EI4A 1P22A 1FWXA 3IJCA 5TDHB 4E5ZB 3L4OD 3ULEC 3V5WB 3VH0A 4QL1A 3OTTA 4PC0A 1ERJA 4GM3A 5FLXg 2GC7A 3PXTD 3J80g 3SBRA 4NSXA 5C9ZB 1GXRA 3IKOA 4CY2A 4J77A 5C2WB 4KFMB 3SBQA 3EI1A 3RN0D 4H5IA 4D6VA 4PSXB 4CI8A 3N0DA 2H9PA 4MK0B 3SWSD 3UVLA 4A09B 3DSMA 2PM9B 1SQ9A 3RSEC 3UR4A 4E5ZA 4A0BB 3UVOA 5EMMB 5IGOA 4FWWA 3A0FA 4JSVC 2AGLA 2P9LC 4GMBA 4ES0A 5H14A 3SLED 4BL0A 1MG2A 1N6DA 4FA9D 2TRCB 2Q7QA 5B4WA 4PXWA 1NEXB 2J57G 3PXSD 1PGUA 4UI9R 2YB8B 5GXHA 1JMXB 2OK6A 2UZYB 4J78A 3UVKA 4A09A 2PM9A 4J73A 5H17A 2XL2A 3IIYA 2YNNA 4CI2A 5HYNB 2OVQB 3C9CA 4CI3A 4Y5RD 5AFU3 3OKTA 4QQEA 3EMHA 3C75H 4PNKB 3MZKA 3UVMA 3BG0A 4GGAA 3DXKC 3L4MD 1MG3A 3ZWLB 3PXWD 3KRXB 2HESX 5CYKB 2G9AA 2HXCA 1MDAH 5GXIA 2OJYA 2O9KA 2P9NC 4O3UB 2XL3A 4CC9A 3SMRA 3I7HA 4A2LA 3RN1D 5FKRA 2B5NA 4QT8A 3EI1B 3NVQA 2I0RA 4J79A 1SHYB 4A08B 3C5MA 2XU7A 4FAVD 1K32A 4ZOVA 2H6QA 5K1CC 3NVNA 1GP2B 3I8CA 2CNXA 5FKTA 4QRJA 1Q47A 2CE9A 3PVWB 4CZVA 5CYKA 2OVPB 2H9NA 4JSXC 5EARA 5FXYA 4A7JA 4Y7RA 4D0KA 2G99A 2H9MA 4GM8A 2YMUA 3P4FA 4ERZA 2XYIA 4OWRA 3RFHA 4CI1A 5AJAA 5JWZA 3RFGA 1XHMA 3OKWA 4ZN4A 4EWRA 2HYEA 2I3TA 4A08A 5EALA 4U1EI 5IGQA 1NR0A 5H1MA 5FKQA 3I7NA 4LG8A 2P9KC 3PSCB 5AMSA 3SCYA 4X60B 3OW8A 4XEIC 4O45A 4U7AA 1QNIA 2H13A 3JZNA 4GQ2P 4GGCA 1A0RB 3U4YA 2IAAA 2B4EA 2H3XA 3JPXA 3I7LA 4AEZA 3FRXA 3DWLC 3MZLA 5I5IA 3BWSA 4ZOZA 4A11B 3DXMC 3AFCA 1RI6A 4CZYA 2H14A 2AGZA 2HKMA 3OL2B 4A2MA 2J56H 3AL8B 5IT9g 2AH0A 4AOWA 1XKSA 4LG9A 4L1QD 2H6NA 3J81g 4J86A 2P9PC 3I7PA 4GGDA 1GOTB 4PBZA 1K8KC 3UKUC 4JSPC 5GSAA 4FHLA 4R7AB 3IJ0A 3AH8B 3EG6A 4L3HD 5HE3B 3JROA 4BUJC 2QXVA 4JT5C 4L9OA 1JJUB 1R5MA 3VA6A 3EWEA 3K26A 5C2VB 4O9DA 2IWFA 1OLZA 3JZHA 1TYQC 3K27A 4A11A 3CFSB 2CN2A 5HE0B 4IA9A 5EMLB 3UVNA 2P9UC 4A0AB 3OL2A 4FB1D 4X61B 2IUPA 3AL8A 5A2Qg 1N6FA 2Z2OA 3KRWB 3VGZA 4J82A 2HJBA 4CY1A 4J84A 2P9IC 5FQDA 4GZ8A 3I7OA 3FM0A 5EMKB 5HE1B 5EMJB 4CZXA 2B5LA 2AH1A 3FGBA 3IIWA 4X63B 2BCJB 3W15A 4YVDA 2IUQA 2BBKH 2OIZA 4GQBB 3B7FA 3JB9L 3I2NA 4A0AA 4H5JA 2IURA 4IMMA 3SVWD 1SQJA 3NVXA 3PE7A 5FA5B 5TF2A 3V9FA 5THAA 5K19A 5EM2B 3MXXA 3F3GA 5KDOB 2I3SA 2UZXB 4PSWB 2J55H 2I0TA 3EI3B 2PM6B 4CY5A 3CIKB 3EU7A 4ZOXA 4J0WA 2P9SC 4Z8LA 4I79A 2Z2NA 3DM0A 3F3PA 3AL9A 2GC4A 3GFCA 1OMWB 2HJ4A 5HE2B 5EAMA 2YBAA 5EAPA 3SXTD 1JOFA 3IJ1A 5CXCB 4E54B 4FA5D 3E0CA 4O3TB 2PM7B 4CY3A 1XIPA 3I89A 5EM2A 3CFVA 4JD2C 4ZOYA 5IJ7E 2QC5A 3N0EA 3EI3A 4J8BA 2AQ5A 4J87A 4FA4D 2CN3A 2CE8A 3MMYA 3MKSB 2H47A 3GREA 4ERYA 5I5JA 3EI2B 2H68A 4L3GD 1TBGA 3I7KA 5GMKn 4ERQA 4J8GA 2HKRA 1S4UX 1L0QA 3HFQA 1B9YA 4ESGA 5CXCA 3ODTA 3V7DB 3C99A 4E54A 4JT6C 3JZGA 5IJ8E 4J0XA 5I5MA 1GG2B 2IWKA 2AGWA 4XYHA 2H9LA 3SN6B 2IUVA 4FAND 1N6EA 2GNQA 4HDJA 2Z2PA 1PBYB 2YNOA 3I8EA 2H6KA 3EI2A 3SFZA 2OVRB 3BG1A 4A0BA 3SBPA 5SXMA 3SHFA 2W18A 3OKYB 5FKSA 3UKRC 5CXBB 2OK4A 2PBIB 3PSLA 3JAMg 4K3JB 1PEVA 2MTAH 5HQGA 4JSNC 2YNPA 1U4CA 4XYIA 4TZ4A 3PVUB 2CO0A 3RRMC 3EI4B 4X3EA 5TEEA 3RMZD 4JXMA 4PBYA 4FA1D 2AGXA 4BH6A 3ORVD 4GQ1A 4LGNA 3RLMD 1JMZB 4K3ID 3F3FA 4O1QD 1VYHC 1YFQA 3OKYA 2CO0C 1B9XA
chains in the Genus database with same CATH superfamily
1U2VC 4OZUA 4G56B 5CXBA 3OF7A 4D9SA 1PI6A 5IC7A 3MKQA 2AGYA 4UM9A 3SJLD 4AMZA 2EBSA 4JHNA 2XE4A 4GM9A 2B5MA 2I0SA 3KCIA 4WK0A 5TEFA 4N14A 3JRPA 2JKXA 3EI4A 4J81A 1VZ3A 1P22A 4WK2A 1FWXA 3IJCA 5TDHB 4E5ZB 3ZDXA 3L4OD 3ULEC 3V5WB 3VH0A 4QL1A 3OTTA 5E6UA 3IJEA 4PC0A 1ERJA 4JHPC 4GM3A 5FLXg 2GC7A 3PXTD 3J80g 2VDNA 4G55A 1U8CA 4NSXA 3SBRA 4BP8A 5C9ZB 1GXRA 3IKOA 3DDUA 4CY2A 4J77A 5C2WB 4KFMB 1JV2A 1C9IA 3SBQA 5M5VA 1JTDB 5FFGA 3EI1A 3RN0D 4H5IA 4D6VA 4PSXB 4AMYA 4CI8A 3N0DA 2H9PA 4MK0B 2EIEA 3SWSD 3UVLA 4A09B 3DSMA 2PM9B 1SQ9A 3QHYB 3RSEC 3UR4A 5E6RA 4E5ZA 4A0BB 2VZ3A 3EQ9A 1H2XA 3UVOA 4NENA 5EMMB 5IGOA 4FWWA 3A0FA 4JSVC 2AGLA 2P9LC 4GMBA 4ES0A 5H14A 3SLED 4BL0A 1MG2A 4WJKA 1N6DA 4O2WA 4FA9D 2TRCB 2Q7QA 5B4WA 2HU5A 4PXWA 1NEXB 2J57G 3PXSD 1PGUA 4UI9R 4RE6A 4RE5A 4G1MA 4O02A 1UOPA 3GC3B 2YB8B 5GXHA 1JMXB 2OK6A 2UZYB 4J78A 3UVKA 4A09A 2PM9A 4J73A 5H17A 1QFMA 3NIDA 2XL2A 3IIYA 2YNNA 4CI2A 5HYNB 2OVQB 3C9CA 1GOHA 3NIGA 3V4VA 4CI3A 4Y5RD 5AFU3 1E5TA 3OKTA 4QQEA 3EMHA 3C75H 4PNKB 3MZKA 3UVMA 3BG0A 4GGAA 3DXKC 3L4MD 4UM8A 1MG3A 3ZWLB 3PXWD 1O6GA 3KRXB 3NIFA 2HESX 5M5UA 5CYKB 2G9AA 2HXCA 1MDAH 5GXIA 2OJYA 2O9KA 2P9NC 3ZDYA 2QR5A 4O3UB 3IURA 2XL3A 4CC9A 3K72A 3SMRA 3I7HA 4A2LA 3RN1D 5FKRA 2B5NA 3FCSA 4QT8A 3EI1B 5M5SA 4AX4A 3NVQA 2I0RA 4J79A 1SHYB 4NAAA 4A08B 3C5MA 1UTCA 2XU7A 4FAVD 1QFSA 1K32A 4ZOVA 2H6QA 5K1CC 3NVNA 4BCCA 1GP2B 3I8CA 3FCUA 2CNXA 3ZDZA 1TYEA 4QRJA 5FKTA 1Q47A 2CE9A 1I2MB 3PVWB 4CZVA 5CYKA 2OVPB 2H9NA 4JSXC 5EARA 5FFOA 5FXYA 4Y7RA 4A7JA 4D0KA 2G99A 2H9MA 1UOQA 4GM8A 3VI3A 2EIBA 2YMUA 3P4FA 4ERZA 2XYIA 4OWRA 3RFHA 4CI1A 3ZE0A 5AJAA 5JWZA 3RFGA 4MMZA 2HU7A 1XHMA 3OKWA 4ZN4A 4EWRA 2HYEA 4AN1A 2I3TA 4NBMA 3O4GA 4A08A 5EALA 4U1EI 5IGQA 1NR0A 5H1MA 5FKQA 3I7NA 4LG8A 2P9KC 3PSCB 3ZE2A 1E8NA 2HU8A 5AMSA 3SCYA 3EQ8A 4X60B 3OW8A 4XEIC 4O45A 4U7AA 1QNIA 2H13A 3JZNA 4GQ2P 4IRZA 4GGCA 1A0RB 2EIDA 3U4YA 2IAAA 2B4EA 2H3XA 2VDLA 4DNUA 3JPXA 3I7LA 4AEZA 2VDOA 3FRXA 3DWLC 3MZLA 5I5IA 3BWSA 4ZOZA 4A11B 3DXMC 3AFCA 3MVDK 1RI6A 4CZYA 2H14A 2AGZA 2HKMA 3OL2B 4A2MA 2J56H 1H2YA 3AL8B 5IT9g 4AN0A 2AH0A 1L5GA 4AOWA 1XKSA 4LG9A 4L1QD 2H6NA 2EICA 3ZE1A 3J81g 4J86A 2P9PC 3I7PA 4GGDA 1GOTB 4PBZA 1K8KC 3UKUC 4JSPC 5GSAA 3IVMA 2VDPA 4FHLA 4R7AB 3IJ0A 3IUJA 2VDMA 3AH8B 3EG6A 2VDKA 4L3HD 5HE3B 3JROA 4BUJC 2QXVA 4JT5C 4L9OA 1JJUB 1R5MA 3VA6A 3EWEA 3K26A 5C2VB 4O9DA 2IWFA 1OLZA 1YR2A 3JZHA 1TYQC 3K27A 1E8MA 4A11A 2BKLA 3CFSB 2CN2A 5HE0B 4IA9A 5EMLB 3UVNA 2P9UC 4WK4A 4A0AB 3OL2A 4FB1D 4BCDA 4L1MA 4X61B 2IUPA 3AL8A 5A2Qg 1N6FA 2Z2OA 3KRWB 3VGZA 4J82A 5C86A 2HJBA 4CY1A 3MUOA 1M1XA 3EQ7A 3O4IA 4Z7QA 3T3MA 4J84A 2P9IC 4MMYA 5FQDA 4GZ8A 1BPOA 3I7OA 3GD1I 3FM0A 5EMKB 5HE1B 5EMJB 4CZXA 2B5LA 2AH1A 3FGBA 3IIWA 1A12A 4X63B 2VZ1A 2BCJB 3W15A 5C92A 3IULA 4YVDA 2IUQA 2BBKH 2OIZA 4GQBB 3B7FA 2WQ8A 3JB9L 3O4HA 3I2NA 4A0AA 4H5JA 2IURA 4IMMA 1UOOA 3SVWD 2XZGA 1SQJA 3VI4A 3NVXA 3PE7A 4DNVA 4QAMA 5FA5B 5TF2A 3V9FA 5THAA 5K19A 1C9LA 5EM2B 3MXXA 3F3GA 5KDOB 2I3SA 2UZXB 4PSWB 2J55H 2I0TA 3EI3B 2PM6B 4BP9A 4CY5A 3IUMA 3CIKB 3EU7A 4ZOXA 4J0WA 2P9SC 4Z8LA 4I79A 1K3IA 2Z2NA 3DM0A 3F3PA 1GOFA 3AL9A 2GC4A 3GFCA 1OMWB 2HJ4A 5HE2B 3MUNA 5EAMA 2YBAA 5EAPA 3SXTD 1JOFA 3IJ1A 5CXCB 1VE6A 4E54B 4FA5D 3E0CA 4O3TB 4Z7NA 2PM7B 4CY3A 1XIPA 3I89A 5EM2A 3CFVA 4JD2C 4ZOYA 5IJ7E 2QC5A 3N0EA 1VE7A 3T3PA 3EI3A 2VDRA 4J8BA 2AQ5A 4J87A 4FA4D 2CN3A 2CE8A 3MMYA 3MKSB 2H47A 3GREA 4ERYA 5HDBA 5M61A 5I5JA 3EI2B 2H68A 1H2WA 4L3GD 1TBGA 3I7KA 5GMKn 4ERQA 4J8GA 2HKRA 1S4UX 1L0QA 2QZPA 3O4JA 3HFQA 1B9YA 4ESGA 5E6SA 5CXCA 3ODTA 3V7DB 3C99A 4E54A 4JT6C 3JZGA 4MMXA 5IJ8E 4J0XA 5I5MA 1GG2B 2IWKA 2AGWA 4XYHA 2H9LA 3SN6B 2XDWA 2IUVA 4FAND 1N6EA 3V4PA 3K71A 2GNQA 4HDJA 4Z7OA 2Z2PA 1PBYB 2YNOA 3IUNA 3I8EA 2H6KA 3EI2A 3SFZA 2OVRB 3BG1A 4A0BA 3SBPA 5SXMA 3SHFA 4BCBA 2W18A 3OKYB 5FKSA 1GOGA 3UKRC 1T2XA 2OK4A 5CXBB 2PBIB 3PSLA 1VZ2A 3QI0A 3JAMg 3IUQA 4K3JB 3K6SA 1PEVA 1H2ZA 2MTAH 5HQGA 2VDQA 4JSNC 2YNPA 1U4CA 5M5TA 4XYIA 4TZ4A 1O6FA 3PVUB 2CO0A 3RRMC 3EI4B 4X3EA 5TEEA 4DNWA 5M5RA 3RMZD 4JXMA 1B9XA 4PBYA 4FA1D 2AGXA 4BH6A 3ORVD 4GQ1A 2VC2A 4G1EA 4LGNA 3RLMD 1JMZB 4K3ID 3F3FA 4O1QD 4NC4A 1VYHC 3OKYA 2CO0C 1YFQA
chains in the Genus database with same CATH topology
1U2VC 4OZUA 4G56B 5CXBA 1PI6A 5IC7A 3MKQA 2AGYA 3SJLD 2EBSA 4GM9A 2B5MA 2I0SA 5TEFA 4N14A 3JRPA 4J81A 3EI4A 1P22A 1FWXA 3IJCA 5TDHB 4E5ZB 3L4OD 3ULEC 3V5WB 3VH0A 4QL1A 3OTTA 4PC0A 1ERJA 4GM3A 5FLXg 2GC7A 3PXTD 3J80g 3SBRA 4NSXA 5C9ZB 1GXRA 3IKOA 4CY2A 4J77A 5C2WB 4KFMB 3SBQA 3EI1A 3RN0D 4H5IA 4D6VA 4PSXB 4CI8A 3N0DA 2H9PA 4MK0B 3SWSD 3UVLA 4A09B 3DSMA 2PM9B 1SQ9A 3RSEC 3UR4A 4E5ZA 4A0BB 3UVOA 5EMMB 5IGOA 4FWWA 3A0FA 4JSVC 2AGLA 2P9LC 4GMBA 4ES0A 5H14A 3SLED 4BL0A 1MG2A 1N6DA 4FA9D 2TRCB 2Q7QA 5B4WA 4PXWA 1NEXB 2J57G 3PXSD 1PGUA 4UI9R 2YB8B 5GXHA 1JMXB 2OK6A 2UZYB 4J78A 3UVKA 4A09A 2PM9A 4J73A 5H17A 2XL2A 3IIYA 2YNNA 4CI2A 5HYNB 2OVQB 3C9CA 4CI3A 4Y5RD 5AFU3 3OKTA 4QQEA 3EMHA 3C75H 4PNKB 3MZKA 3UVMA 3BG0A 4GGAA 3DXKC 3L4MD 1MG3A 3ZWLB 3PXWD 3KRXB 2HESX 5CYKB 2G9AA 2HXCA 1MDAH 5GXIA 2OJYA 2O9KA 2P9NC 4O3UB 2XL3A 4CC9A 3SMRA 3I7HA 4A2LA 3RN1D 5FKRA 2B5NA 4QT8A 3EI1B 3NVQA 2I0RA 4J79A 1SHYB 4A08B 3C5MA 2XU7A 4FAVD 1K32A 4ZOVA 2H6QA 5K1CC 3NVNA 1GP2B 3I8CA 2CNXA 5FKTA 4QRJA 1Q47A 2CE9A 3PVWB 4CZVA 5CYKA 2OVPB 2H9NA 4JSXC 5EARA 5FXYA 4A7JA 4Y7RA 4D0KA 2G99A 2H9MA 4GM8A 2YMUA 3P4FA 4ERZA 2XYIA 4OWRA 3RFHA 4CI1A 5AJAA 5JWZA 3RFGA 1XHMA 3OKWA 4ZN4A 4EWRA 2HYEA 2I3TA 4A08A 5EALA 4U1EI 5IGQA 1NR0A 5H1MA 5FKQA 3I7NA 4LG8A 2P9KC 3PSCB 5AMSA 3SCYA 4X60B 3OW8A 4XEIC 4O45A 4U7AA 1QNIA 2H13A 3JZNA 4GQ2P 4GGCA 1A0RB 3U4YA 2IAAA 2B4EA 2H3XA 3JPXA 3I7LA 4AEZA 3FRXA 3DWLC 3MZLA 5I5IA 3BWSA 4ZOZA 4A11B 3DXMC 3AFCA 1RI6A 4CZYA 2H14A 2AGZA 2HKMA 3OL2B 4A2MA 2J56H 3AL8B 5IT9g 2AH0A 4AOWA 1XKSA 4LG9A 4L1QD 2H6NA 3J81g 4J86A 2P9PC 3I7PA 4GGDA 1GOTB 4PBZA 1K8KC 3UKUC 4JSPC 5GSAA 4FHLA 4R7AB 3IJ0A 3AH8B 3EG6A 4L3HD 5HE3B 3JROA 4BUJC 2QXVA 4JT5C 4L9OA 1JJUB 1R5MA 3VA6A 3EWEA 3K26A 5C2VB 4O9DA 2IWFA 1OLZA 3JZHA 1TYQC 3K27A 4A11A 3CFSB 2CN2A 5HE0B 4IA9A 5EMLB 3UVNA 2P9UC 4A0AB 3OL2A 4FB1D 4X61B 2IUPA 3AL8A 5A2Qg 1N6FA 2Z2OA 3KRWB 3VGZA 4J82A 2HJBA 4CY1A 4J84A 2P9IC 5FQDA 4GZ8A 3I7OA 3FM0A 5EMKB 5HE1B 5EMJB 4CZXA 2B5LA 2AH1A 3FGBA 3IIWA 4X63B 2BCJB 3W15A 4YVDA 2IUQA 2BBKH 2OIZA 4GQBB 3B7FA 3JB9L 3I2NA 4A0AA 4H5JA 2IURA 4IMMA 3SVWD 1SQJA 3NVXA 3PE7A 5FA5B 5TF2A 3V9FA 5THAA 5K19A 5EM2B 3MXXA 3F3GA 5KDOB 2I3SA 2UZXB 4PSWB 2J55H 2I0TA 3EI3B 2PM6B 4CY5A 3CIKB 3EU7A 4ZOXA 4J0WA 2P9SC 4Z8LA 4I79A 2Z2NA 3DM0A 3F3PA 3AL9A 2GC4A 3GFCA 1OMWB 2HJ4A 5HE2B 5EAMA 2YBAA 5EAPA 3SXTD 1JOFA 3IJ1A 5CXCB 4E54B 4FA5D 3E0CA 4O3TB 2PM7B 4CY3A 1XIPA 3I89A 5EM2A 3CFVA 4JD2C 4ZOYA 5IJ7E 2QC5A 3N0EA 3EI3A 4J8BA 2AQ5A 4J87A 4FA4D 2CN3A 2CE8A 3MMYA 3MKSB 2H47A 3GREA 4ERYA 5I5JA 3EI2B 2H68A 4L3GD 1TBGA 3I7KA 5GMKn 4ERQA 4J8GA 2HKRA 1S4UX 1L0QA 3HFQA 1B9YA 4ESGA 5CXCA 3ODTA 3V7DB 3C99A 4E54A 4JT6C 3JZGA 5IJ8E 4J0XA 5I5MA 1GG2B 2IWKA 2AGWA 4XYHA 2H9LA 3SN6B 2IUVA 4FAND 1N6EA 2GNQA 4HDJA 2Z2PA 1PBYB 2YNOA 3I8EA 2H6KA 3EI2A 3SFZA 2OVRB 3BG1A 4A0BA 3SBPA 5SXMA 3SHFA 2W18A 3OKYB 5FKSA 3UKRC 5CXBB 2OK4A 2PBIB 3PSLA 3JAMg 4K3JB 1PEVA 2MTAH 5HQGA 4JSNC 2YNPA 1U4CA 4XYIA 4TZ4A 3PVUB 2CO0A 3RRMC 3EI4B 4X3EA 5TEEA 3RMZD 4JXMA 4PBYA 4FA1D 2AGXA 4BH6A 3ORVD 4GQ1A 4LGNA 3RLMD 1JMZB 4K3ID 3F3FA 4O1QD 1VYHC 1YFQA 3OKYA 2CO0C 1B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V C;  4OZU A;  4G56 B;  5CXB A;  1PI6 A;  5IC7 A;  3MKQ A;  2AGY A;  3SJL D;  2EBS A;  4GM9 A;  2B5M A;  2I0S A;  5TEF A;  4N14 A;  3JRP A;  4J81 A;  3EI4 A;  1P22 A;  1FWX A;  3IJC A;  5TDH B;  4E5Z B;  3L4O D;  3ULE C;  3V5W B;  3VH0 A;  4QL1 A;  3OTT A;  4PC0 A;  1ERJ A;  4GM3 A;  5FLX g;  2GC7 A;  3PXT D;  3J80 g;  3SBR A;  4NSX A;  5C9Z B;  1GXR A;  3IKO A;  4CY2 A;  4J77 A;  5C2W B;  4KFM B;  3SBQ A;  3EI1 A;  3RN0 D;  4H5I A;  4D6V A;  4PSX B;  4CI8 A;  3N0D A;  2H9P A;  4MK0 B;  3SWS D;  3UVL A;  4A09 B;  3DSM A;  2PM9 B;  1SQ9 A;  3RSE C;  3UR4 A;  4E5Z A;  4A0B B;  3UVO A;  5EMM B;  5IGO A;  4FWW A;  3A0F A;  4JSV C;  2AGL A;  2P9L C;  4GMB A;  4ES0 A;  5H14 A;  3SLE D;  4BL0 A;  1MG2 A;  1N6D A;  4FA9 D;  2TRC B;  2Q7Q A;  5B4W A;  4PXW A;  1NEX B;  2J57 G;  3PXS D;  1PGU A;  4UI9 R;  2YB8 B;  5GXH A;  1JMX B;  2OK6 A;  2UZY B;  4J78 A;  3UVK A;  4A09 A;  2PM9 A;  4J73 A;  5H17 A;  2XL2 A;  3IIY A;  2YNN A;  4CI2 A;  5HYN B;  2OVQ B;  3C9C A;  4CI3 A;  4Y5R D;  5AFU 3;  3OKT A;  4QQE A;  3EMH A;  3C75 H;  4PNK B;  3MZK A;  3UVM A;  3BG0 A;  4GGA A;  3DXK C;  3L4M D;  1MG3 A;  3ZWL B;  3PXW D;  3KRX B;  2HES X;  5CYK B;  2G9A A;  2HXC A;  1MDA H;  5GXI A;  2OJY A;  2O9K A;  2P9N C;  4O3U B;  2XL3 A;  4CC9 A;  3SMR A;  3I7H A;  4A2L A;  3RN1 D;  5FKR A;  2B5N A;  4QT8 A;  3EI1 B;  3NVQ A;  2I0R A;  4J79 A;  1SHY B;  4A08 B;  3C5M A;  2XU7 A;  4FAV D;  1K32 A;  4ZOV A;  2H6Q A;  5K1C C;  3NVN A;  1GP2 B;  3I8C A;  2CNX A;  5FKT A;  4QRJ A;  1Q47 A;  2CE9 A;  3PVW B;  4CZV A;  5CYK A;  2OVP B;  2H9N A;  4JSX C;  5EAR A;  5FXY A;  4A7J A;  4Y7R A;  4D0K A;  2G99 A;  2H9M A;  4GM8 A;  2YMU A;  3P4F A;  4ERZ A;  2XYI A;  4OWR A;  3RFH A;  4CI1 A;  5AJA A;  5JWZ A;  3RFG A;  1XHM A;  3OKW A;  4ZN4 A;  4EWR A;  2HYE A;  2I3T A;  4A08 A;  5EAL A;  4U1E I;  5IGQ A;  1NR0 A;  5H1M A;  5FKQ A;  3I7N A;  4LG8 A;  2P9K C;  3PSC B;  5AMS A;  3SCY A;  4X60 B;  3OW8 A;  4XEI C;  4O45 A;  4U7A A;  1QNI A;  2H13 A;  3JZN A;  4GQ2 P;  4GGC A;  1A0R B;  3U4Y A;  2IAA A;  2B4E A;  2H3X A;  3JPX A;  3I7L A;  4AEZ A;  3FRX A;  3DWL C;  3MZL A;  5I5I A;  3BWS A;  4ZOZ A;  4A11 B;  3DXM C;  3AFC A;  1RI6 A;  4CZY A;  2H14 A;  2AGZ A;  2HKM A;  3OL2 B;  4A2M A;  2J56 H;  3AL8 B;  5IT9 g;  2AH0 A;  4AOW A;  1XKS A;  4LG9 A;  4L1Q D;  2H6N A;  3J81 g;  4J86 A;  2P9P C;  3I7P A;  4GGD A;  1GOT B;  4PBZ A;  1K8K C;  3UKU C;  4JSP C;  5GSA A;  4FHL A;  4R7A B;  3IJ0 A;  3AH8 B;  3EG6 A;  4L3H D;  5HE3 B;  3JRO A;  4BUJ C;  2QXV A;  4JT5 C;  4L9O A;  1JJU B;  1R5M A;  3VA6 A;  3EWE A;  3K26 A;  5C2V B;  4O9D A;  2IWF A;  1OLZ A;  3JZH A;  1TYQ C;  3K27 A;  4A11 A;  3CFS B;  2CN2 A;  5HE0 B;  4IA9 A;  5EML B;  3UVN A;  2P9U C;  4A0A B;  3OL2 A;  4FB1 D;  4X61 B;  2IUP A;  3AL8 A;  5A2Q g;  1N6F A;  2Z2O A;  3KRW B;  3VGZ A;  4J82 A;  2HJB A;  4CY1 A;  4J84 A;  2P9I C;  5FQD A;  4GZ8 A;  3I7O A;  3FM0 A;  5EMK B;  5HE1 B;  5EMJ B;  4CZX A;  2B5L A;  2AH1 A;  3FGB A;  3IIW A;  4X63 B;  2BCJ B;  3W15 A;  4YVD A;  2IUQ A;  2BBK H;  2OIZ A;  4GQB B;  3B7F A;  3JB9 L;  3I2N A;  4A0A A;  4H5J A;  2IUR A;  4IMM A;  3SVW D;  1SQJ A;  3NVX A;  3PE7 A;  5FA5 B;  5TF2 A;  3V9F A;  5THA A;  5K19 A;  5EM2 B;  3MXX A;  3F3G A;  5KDO B;  2I3S A;  2UZX B;  4PSW B;  2J55 H;  2I0T A;  3EI3 B;  2PM6 B;  4CY5 A;  3CIK B;  3EU7 A;  4ZOX A;  4J0W A;  2P9S C;  4Z8L A;  4I79 A;  2Z2N A;  3DM0 A;  3F3P A;  3AL9 A;  2GC4 A;  3GFC A;  1OMW B;  2HJ4 A;  5HE2 B;  5EAM A;  2YBA A;  5EAP A;  3SXT D;  1JOF A;  3IJ1 A;  5CXC B;  4E54 B;  4FA5 D;  3E0C A;  4O3T B;  2PM7 B;  4CY3 A;  1XIP A;  3I89 A;  5EM2 A;  3CFV A;  4JD2 C;  4ZOY A;  5IJ7 E;  2QC5 A;  3N0E A;  3EI3 A;  4J8B A;  2AQ5 A;  4J87 A;  4FA4 D;  2CN3 A;  2CE8 A;  3MMY A;  3MKS B;  2H47 A;  3GRE A;  4ERY A;  5I5J A;  3EI2 B;  2H68 A;  4L3G D;  1TBG A;  3I7K A;  5GMK n;  4ERQ A;  4J8G A;  2HKR A;  1S4U X;  1L0Q A;  3HFQ A;  1B9Y A;  4ESG A;  5CXC A;  3ODT A;  3V7D B;  3C99 A;  4E54 A;  4JT6 C;  3JZG A;  5IJ8 E;  4J0X A;  5I5M A;  1GG2 B;  2IWK A;  2AGW A;  4XYH A;  2H9L A;  3SN6 B;  2IUV A;  4FAN D;  1N6E A;  2GNQ A;  4HDJ A;  2Z2P A;  1PBY B;  2YNO A;  3I8E A;  2H6K A;  3EI2 A;  3SFZ A;  2OVR B;  3BG1 A;  4A0B A;  3SBP A;  5SXM A;  3SHF A;  2W18 A;  3OKY B;  5FKS A;  3UKR C;  5CXB B;  2OK4 A;  2PBI B;  3PSL A;  3JAM g;  4K3J B;  1PEV A;  2MTA H;  5HQG A;  4JSN C;  2YNP A;  1U4C A;  4XYI A;  4TZ4 A;  3PVU B;  2CO0 A;  3RRM C;  3EI4 B;  4X3E A;  5TEE A;  3RMZ D;  4JXM A;  4PBY A;  4FA1 D;  2AGX A;  4BH6 A;  3ORV D;  4GQ1 A;  4LGN A;  3RLM D;  1JMZ B;  4K3I D;  3F3F A;  4O1Q D;  1VYH C;  1YFQ A;  3OKY A;  2CO0 C;  1B9X A; 
#chains in the Genus database with same CATH topology
 1U2V C;  4OZU A;  4G56 B;  5CXB A;  3OF7 A;  4D9S A;  1PI6 A;  5IC7 A;  3MKQ A;  2AGY A;  4UM9 A;  3SJL D;  4AMZ A;  2EBS A;  4JHN A;  2XE4 A;  4GM9 A;  2B5M A;  2I0S A;  3KCI A;  4WK0 A;  5TEF A;  4N14 A;  3JRP A;  2JKX A;  3EI4 A;  4J81 A;  1VZ3 A;  1P22 A;  4WK2 A;  1FWX A;  3IJC A;  5TDH B;  4E5Z B;  3ZDX A;  3L4O D;  3ULE C;  3V5W B;  3VH0 A;  4QL1 A;  3OTT A;  5E6U A;  3IJE A;  4PC0 A;  1ERJ A;  4JHP C;  4GM3 A;  5FLX g;  2GC7 A;  3PXT D;  3J80 g;  2VDN A;  4G55 A;  1U8C A;  4NSX A;  3SBR A;  4BP8 A;  5C9Z B;  1GXR A;  3IKO A;  3DDU A;  4CY2 A;  4J77 A;  5C2W B;  4KFM B;  1JV2 A;  1C9I A;  3SBQ A;  5M5V A;  1JTD B;  5FFG A;  3EI1 A;  3RN0 D;  4H5I A;  4D6V A;  4PSX B;  4AMY A;  4CI8 A;  3N0D A;  2H9P A;  4MK0 B;  2EIE A;  3SWS D;  3UVL A;  4A09 B;  3DSM A;  2PM9 B;  1SQ9 A;  3QHY B;  3RSE C;  3UR4 A;  5E6R A;  4E5Z A;  4A0B B;  2VZ3 A;  3EQ9 A;  1H2X A;  3UVO A;  4NEN A;  5EMM B;  5IGO A;  4FWW A;  3A0F A;  4JSV C;  2AGL A;  2P9L C;  4GMB A;  4ES0 A;  5H14 A;  3SLE D;  4BL0 A;  1MG2 A;  4WJK A;  1N6D A;  4O2W A;  4FA9 D;  2TRC B;  2Q7Q A;  5B4W A;  2HU5 A;  4PXW A;  1NEX B;  2J57 G;  3PXS D;  1PGU A;  4UI9 R;  4RE6 A;  4RE5 A;  4G1M A;  4O02 A;  1UOP A;  3GC3 B;  2YB8 B;  5GXH A;  1JMX B;  2OK6 A;  2UZY B;  4J78 A;  3UVK A;  4A09 A;  2PM9 A;  4J73 A;  5H17 A;  1QFM A;  3NID A;  2XL2 A;  3IIY A;  2YNN A;  4CI2 A;  5HYN B;  2OVQ B;  3C9C A;  1GOH A;  3NIG A;  3V4V A;  4CI3 A;  4Y5R D;  5AFU 3;  1E5T A;  3OKT A;  4QQE A;  3EMH A;  3C75 H;  4PNK B;  3MZK A;  3UVM A;  3BG0 A;  4GGA A;  3DXK C;  3L4M D;  4UM8 A;  1MG3 A;  3ZWL B;  3PXW D;  1O6G A;  3KRX B;  3NIF A;  2HES X;  5M5U A;  5CYK B;  2G9A A;  2HXC A;  1MDA H;  5GXI A;  2OJY A;  2O9K A;  2P9N C;  3ZDY A;  2QR5 A;  4O3U B;  3IUR A;  2XL3 A;  4CC9 A;  3K72 A;  3SMR A;  3I7H A;  4A2L A;  3RN1 D;  5FKR A;  2B5N A;  3FCS A;  4QT8 A;  3EI1 B;  5M5S A;  4AX4 A;  3NVQ A;  2I0R A;  4J79 A;  1SHY B;  4NAA A;  4A08 B;  3C5M A;  1UTC A;  2XU7 A;  4FAV D;  1QFS A;  1K32 A;  4ZOV A;  2H6Q A;  5K1C C;  3NVN A;  4BCC A;  1GP2 B;  3I8C A;  3FCU A;  2CNX A;  3ZDZ A;  1TYE A;  4QRJ A;  5FKT A;  1Q47 A;  2CE9 A;  1I2M B;  3PVW B;  4CZV A;  5CYK A;  2OVP B;  2H9N A;  4JSX C;  5EAR A;  5FFO A;  5FXY A;  4Y7R A;  4A7J A;  4D0K A;  2G99 A;  2H9M A;  1UOQ A;  4GM8 A;  3VI3 A;  2EIB A;  2YMU A;  3P4F A;  4ERZ A;  2XYI A;  4OWR A;  3RFH A;  4CI1 A;  3ZE0 A;  5AJA A;  5JWZ A;  3RFG A;  4MMZ A;  2HU7 A;  1XHM A;  3OKW A;  4ZN4 A;  4EWR A;  2HYE A;  4AN1 A;  2I3T A;  4NBM A;  3O4G A;  4A08 A;  5EAL A;  4U1E I;  5IGQ A;  1NR0 A;  5H1M A;  5FKQ A;  3I7N A;  4LG8 A;  2P9K C;  3PSC B;  3ZE2 A;  1E8N A;  2HU8 A;  5AMS A;  3SCY A;  3EQ8 A;  4X60 B;  3OW8 A;  4XEI C;  4O45 A;  4U7A A;  1QNI A;  2H13 A;  3JZN A;  4GQ2 P;  4IRZ A;  4GGC A;  1A0R B;  2EID A;  3U4Y A;  2IAA A;  2B4E A;  2H3X A;  2VDL A;  4DNU A;  3JPX A;  3I7L A;  4AEZ A;  2VDO A;  3FRX A;  3DWL C;  3MZL A;  5I5I A;  3BWS A;  4ZOZ A;  4A11 B;  3DXM C;  3AFC A;  3MVD K;  1RI6 A;  4CZY A;  2H14 A;  2AGZ A;  2HKM A;  3OL2 B;  4A2M A;  2J56 H;  1H2Y A;  3AL8 B;  5IT9 g;  4AN0 A;  2AH0 A;  1L5G A;  4AOW A;  1XKS A;  4LG9 A;  4L1Q D;  2H6N A;  2EIC A;  3ZE1 A;  3J81 g;  4J86 A;  2P9P C;  3I7P A;  4GGD A;  1GOT B;  4PBZ A;  1K8K C;  3UKU C;  4JSP C;  5GSA A;  3IVM A;  2VDP A;  4FHL A;  4R7A B;  3IJ0 A;  3IUJ A;  2VDM A;  3AH8 B;  3EG6 A;  2VDK A;  4L3H D;  5HE3 B;  3JRO A;  4BUJ C;  2QXV A;  4JT5 C;  4L9O A;  1JJU B;  1R5M A;  3VA6 A;  3EWE A;  3K26 A;  5C2V B;  4O9D A;  2IWF A;  1OLZ A;  1YR2 A;  3JZH A;  1TYQ C;  3K27 A;  1E8M A;  4A11 A;  2BKL A;  3CFS B;  2CN2 A;  5HE0 B;  4IA9 A;  5EML B;  3UVN A;  2P9U C;  4WK4 A;  4A0A B;  3OL2 A;  4FB1 D;  4BCD A;  4L1M A;  4X61 B;  2IUP A;  3AL8 A;  5A2Q g;  1N6F A;  2Z2O A;  3KRW B;  3VGZ A;  4J82 A;  5C86 A;  2HJB A;  4CY1 A;  3MUO A;  1M1X A;  3EQ7 A;  3O4I A;  4Z7Q A;  3T3M A;  4J84 A;  2P9I C;  4MMY A;  5FQD A;  4GZ8 A;  1BPO A;  3I7O A;  3GD1 I;  3FM0 A;  5EMK B;  5HE1 B;  5EMJ B;  4CZX A;  2B5L A;  2AH1 A;  3FGB A;  3IIW A;  1A12 A;  4X63 B;  2VZ1 A;  2BCJ B;  3W15 A;  5C92 A;  3IUL A;  4YVD A;  2IUQ A;  2BBK H;  2OIZ A;  4GQB B;  3B7F A;  2WQ8 A;  3JB9 L;  3O4H A;  3I2N A;  4A0A A;  4H5J A;  2IUR A;  4IMM A;  1UOO A;  3SVW D;  2XZG A;  1SQJ A;  3VI4 A;  3NVX A;  3PE7 A;  4DNV A;  4QAM A;  5FA5 B;  5TF2 A;  3V9F A;  5THA A;  5K19 A;  1C9L A;  5EM2 B;  3MXX A;  3F3G A;  5KDO B;  2I3S A;  2UZX B;  4PSW B;  2J55 H;  2I0T A;  3EI3 B;  2PM6 B;  4BP9 A;  4CY5 A;  3IUM A;  3CIK B;  3EU7 A;  4ZOX A;  4J0W A;  2P9S C;  4Z8L A;  4I79 A;  1K3I A;  2Z2N A;  3DM0 A;  3F3P A;  1GOF A;  3AL9 A;  2GC4 A;  3GFC A;  1OMW B;  2HJ4 A;  5HE2 B;  3MUN A;  5EAM A;  2YBA A;  5EAP A;  3SXT D;  1JOF A;  3IJ1 A;  5CXC B;  1VE6 A;  4E54 B;  4FA5 D;  3E0C A;  4O3T B;  4Z7N A;  2PM7 B;  4CY3 A;  1XIP A;  3I89 A;  5EM2 A;  3CFV A;  4JD2 C;  4ZOY A;  5IJ7 E;  2QC5 A;  3N0E A;  1VE7 A;  3T3P A;  3EI3 A;  2VDR A;  4J8B A;  2AQ5 A;  4J87 A;  4FA4 D;  2CN3 A;  2CE8 A;  3MMY A;  3MKS B;  2H47 A;  3GRE A;  4ERY A;  5HDB A;  5M61 A;  5I5J A;  3EI2 B;  2H68 A;  1H2W A;  4L3G D;  1TBG A;  3I7K A;  5GMK n;  4ERQ A;  4J8G A;  2HKR A;  1S4U X;  1L0Q A;  2QZP A;  3O4J A;  3HFQ A;  1B9Y A;  4ESG A;  5E6S A;  5CXC A;  3ODT A;  3V7D B;  3C99 A;  4E54 A;  4JT6 C;  3JZG A;  4MMX A;  5IJ8 E;  4J0X A;  5I5M A;  1GG2 B;  2IWK A;  2AGW A;  4XYH A;  2H9L A;  3SN6 B;  2XDW A;  2IUV A;  4FAN D;  1N6E A;  3V4P A;  3K71 A;  2GNQ A;  4HDJ A;  4Z7O A;  2Z2P A;  1PBY B;  2YNO A;  3IUN A;  3I8E A;  2H6K A;  3EI2 A;  3SFZ A;  2OVR B;  3BG1 A;  4A0B A;  3SBP A;  5SXM A;  3SHF A;  4BCB A;  2W18 A;  3OKY B;  5FKS A;  1GOG A;  3UKR C;  1T2X A;  2OK4 A;  5CXB B;  2PBI B;  3PSL A;  1VZ2 A;  3QI0 A;  3JAM g;  3IUQ A;  4K3J B;  3K6S A;  1PEV A;  1H2Z A;  2MTA H;  5HQG A;  2VDQ A;  4JSN C;  2YNP A;  1U4C A;  5M5T A;  4XYI A;  4TZ4 A;  1O6F A;  3PVU B;  2CO0 A;  3RRM C;  3EI4 B;  4X3E A;  5TEE A;  4DNW A;  5M5R A;  3RMZ D;  4JXM A;  1B9X A;  4PBY A;  4FA1 D;  2AGX A;  4BH6 A;  3ORV D;  4GQ1 A;  2VC2 A;  4G1E A;  4LGN A;  3RLM D;  1JMZ B;  4K3I D;  3F3F A;  4O1Q D;  4NC4 A;  1VYH C;  3OKY A;  2CO0 C;  1YFQ A; 
#chains in the Genus database with same CATH homology
 1U2V C;  4OZU A;  4G56 B;  5CXB A;  1PI6 A;  5IC7 A;  3MKQ A;  2AGY A;  3SJL D;  2EBS A;  4GM9 A;  2B5M A;  2I0S A;  5TEF A;  4N14 A;  3JRP A;  4J81 A;  3EI4 A;  1P22 A;  1FWX A;  3IJC A;  5TDH B;  4E5Z B;  3L4O D;  3ULE C;  3V5W B;  3VH0 A;  4QL1 A;  3OTT A;  4PC0 A;  1ERJ A;  4GM3 A;  5FLX g;  2GC7 A;  3PXT D;  3J80 g;  3SBR A;  4NSX A;  5C9Z B;  1GXR A;  3IKO A;  4CY2 A;  4J77 A;  5C2W B;  4KFM B;  3SBQ A;  3EI1 A;  3RN0 D;  4H5I A;  4D6V A;  4PSX B;  4CI8 A;  3N0D A;  2H9P A;  4MK0 B;  3SWS D;  3UVL A;  4A09 B;  3DSM A;  2PM9 B;  1SQ9 A;  3RSE C;  3UR4 A;  4E5Z A;  4A0B B;  3UVO A;  5EMM B;  5IGO A;  4FWW A;  3A0F A;  4JSV C;  2AGL A;  2P9L C;  4GMB A;  4ES0 A;  5H14 A;  3SLE D;  4BL0 A;  1MG2 A;  1N6D A;  4FA9 D;  2TRC B;  2Q7Q A;  5B4W A;  4PXW A;  1NEX B;  2J57 G;  3PXS D;  1PGU A;  4UI9 R;  2YB8 B;  5GXH A;  1JMX B;  2OK6 A;  2UZY B;  4J78 A;  3UVK A;  4A09 A;  2PM9 A;  4J73 A;  5H17 A;  2XL2 A;  3IIY A;  2YNN A;  4CI2 A;  5HYN B;  2OVQ B;  3C9C A;  4CI3 A;  4Y5R D;  5AFU 3;  3OKT A;  4QQE A;  3EMH A;  3C75 H;  4PNK B;  3MZK A;  3UVM A;  3BG0 A;  4GGA A;  3DXK C;  3L4M D;  1MG3 A;  3ZWL B;  3PXW D;  3KRX B;  2HES X;  5CYK B;  2G9A A;  2HXC A;  1MDA H;  5GXI A;  2OJY A;  2O9K A;  2P9N C;  4O3U B;  2XL3 A;  4CC9 A;  3SMR A;  3I7H A;  4A2L A;  3RN1 D;  5FKR A;  2B5N A;  4QT8 A;  3EI1 B;  3NVQ A;  2I0R A;  4J79 A;  1SHY B;  4A08 B;  3C5M A;  2XU7 A;  4FAV D;  1K32 A;  4ZOV A;  2H6Q A;  5K1C C;  3NVN A;  1GP2 B;  3I8C A;  2CNX A;  5FKT A;  4QRJ A;  1Q47 A;  2CE9 A;  3PVW B;  4CZV A;  5CYK A;  2OVP B;  2H9N A;  4JSX C;  5EAR A;  5FXY A;  4A7J A;  4Y7R A;  4D0K A;  2G99 A;  2H9M A;  4GM8 A;  2YMU A;  3P4F A;  4ERZ A;  2XYI A;  4OWR A;  3RFH A;  4CI1 A;  5AJA A;  5JWZ A;  3RFG A;  1XHM A;  3OKW A;  4ZN4 A;  4EWR A;  2HYE A;  2I3T A;  4A08 A;  5EAL A;  4U1E I;  5IGQ A;  1NR0 A;  5H1M A;  5FKQ A;  3I7N A;  4LG8 A;  2P9K C;  3PSC B;  5AMS A;  3SCY A;  4X60 B;  3OW8 A;  4XEI C;  4O45 A;  4U7A A;  1QNI A;  2H13 A;  3JZN A;  4GQ2 P;  4GGC A;  1A0R B;  3U4Y A;  2IAA A;  2B4E A;  2H3X A;  3JPX A;  3I7L A;  4AEZ A;  3FRX A;  3DWL C;  3MZL A;  5I5I A;  3BWS A;  4ZOZ A;  4A11 B;  3DXM C;  3AFC A;  1RI6 A;  4CZY A;  2H14 A;  2AGZ A;  2HKM A;  3OL2 B;  4A2M A;  2J56 H;  3AL8 B;  5IT9 g;  2AH0 A;  4AOW A;  1XKS A;  4LG9 A;  4L1Q D;  2H6N A;  3J81 g;  4J86 A;  2P9P C;  3I7P A;  4GGD A;  1GOT B;  4PBZ A;  1K8K C;  3UKU C;  4JSP C;  5GSA A;  4FHL A;  4R7A B;  3IJ0 A;  3AH8 B;  3EG6 A;  4L3H D;  5HE3 B;  3JRO A;  4BUJ C;  2QXV A;  4JT5 C;  4L9O A;  1JJU B;  1R5M A;  3VA6 A;  3EWE A;  3K26 A;  5C2V B;  4O9D A;  2IWF A;  1OLZ A;  3JZH A;  1TYQ C;  3K27 A;  4A11 A;  3CFS B;  2CN2 A;  5HE0 B;  4IA9 A;  5EML B;  3UVN A;  2P9U C;  4A0A B;  3OL2 A;  4FB1 D;  4X61 B;  2IUP A;  3AL8 A;  5A2Q g;  1N6F A;  2Z2O A;  3KRW B;  3VGZ A;  4J82 A;  2HJB A;  4CY1 A;  4J84 A;  2P9I C;  5FQD A;  4GZ8 A;  3I7O A;  3FM0 A;  5EMK B;  5HE1 B;  5EMJ B;  4CZX A;  2B5L A;  2AH1 A;  3FGB A;  3IIW A;  4X63 B;  2BCJ B;  3W15 A;  4YVD A;  2IUQ A;  2BBK H;  2OIZ A;  4GQB B;  3B7F A;  3JB9 L;  3I2N A;  4A0A A;  4H5J A;  2IUR A;  4IMM A;  3SVW D;  1SQJ A;  3NVX A;  3PE7 A;  5FA5 B;  5TF2 A;  3V9F A;  5THA A;  5K19 A;  5EM2 B;  3MXX A;  3F3G A;  5KDO B;  2I3S A;  2UZX B;  4PSW B;  2J55 H;  2I0T A;  3EI3 B;  2PM6 B;  4CY5 A;  3CIK B;  3EU7 A;  4ZOX A;  4J0W A;  2P9S C;  4Z8L A;  4I79 A;  2Z2N A;  3DM0 A;  3F3P A;  3AL9 A;  2GC4 A;  3GFC A;  1OMW B;  2HJ4 A;  5HE2 B;  5EAM A;  2YBA A;  5EAP A;  3SXT D;  1JOF A;  3IJ1 A;  5CXC B;  4E54 B;  4FA5 D;  3E0C A;  4O3T B;  2PM7 B;  4CY3 A;  1XIP A;  3I89 A;  5EM2 A;  3CFV A;  4JD2 C;  4ZOY A;  5IJ7 E;  2QC5 A;  3N0E A;  3EI3 A;  4J8B A;  2AQ5 A;  4J87 A;  4FA4 D;  2CN3 A;  2CE8 A;  3MMY A;  3MKS B;  2H47 A;  3GRE A;  4ERY A;  5I5J A;  3EI2 B;  2H68 A;  4L3G D;  1TBG A;  3I7K A;  5GMK n;  4ERQ A;  4J8G A;  2HKR A;  1S4U X;  1L0Q A;  3HFQ A;  1B9Y A;  4ESG A;  5CXC A;  3ODT A;  3V7D B;  3C99 A;  4E54 A;  4JT6 C;  3JZG A;  5IJ8 E;  4J0X A;  5I5M A;  1GG2 B;  2IWK A;  2AGW A;  4XYH A;  2H9L A;  3SN6 B;  2IUV A;  4FAN D;  1N6E A;  2GNQ A;  4HDJ A;  2Z2P A;  1PBY B;  2YNO A;  3I8E A;  2H6K A;  3EI2 A;  3SFZ A;  2OVR B;  3BG1 A;  4A0B A;  3SBP A;  5SXM A;  3SHF A;  2W18 A;  3OKY B;  5FKS A;  3UKR C;  5CXB B;  2OK4 A;  2PBI B;  3PSL A;  3JAM g;  4K3J B;  1PEV A;  2MTA H;  5HQG A;  4JSN C;  2YNP A;  1U4C A;  4XYI A;  4TZ4 A;  3PVU B;  2CO0 A;  3RRM C;  3EI4 B;  4X3E A;  5TEE A;  3RMZ D;  4JXM A;  4PBY A;  4FA1 D;  2AGX A;  4BH6 A;  3ORV D;  4GQ1 A;  4LGN A;  3RLM D;  1JMZ B;  4K3I D;  3F3F A;  4O1Q D;  1VYH C;  1YFQ A;  3OKY A;  2CO0 C;  1B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...