2QC5A

Streptogramin b lyase structure
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
298
structure length
298
Chain Sequence
SEAWMNFYLEEFNLSIPDSGPYGITSSEDGKVWFTQHKANKISSLDQSGRIKEFEVPTPDAKVMCLIVSSLGDIWFTENGANKIGKLSKKGGFTEYPLPQPDSGPYGITEGLNGDIWFTQLNGDRIGKLTADGTIYEYDLPNKGSYPAFITLGSDNALWFTENQNNSIGRITNTGKLEEYPLPTNAAAPVGITSGNDGALWFVEIMGNKIGRITTTGEISEYDIPTPNARPHAITAGKNSEIWFTEWGANQIGRITNDNTIQEYQLQTENAEPHGITFGKDGSVWFALKCKIGKLNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogramin B lactonase
publication title Crystal structure and mechanism of the Staphylococcus cohnii virginiamycin B lyase (Vgb).
pubmed doi rcsb
source organism Staphylococcus cohnii
molecule tags Lyase
total genus 70
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2qc5A00
1JMZB 2G99A 3VA6A 4E54B 3RN1D 4GGAA 4A08A 2TRCB 3I7HA 4U1EI 2BBKH 3SVWD 5EAMA 3BG0A 4CC9A 2YNPA 4H5IA 5GSAA 5TF2A 3B7FA 5HE3B 3I8CA 5AMSA 4J79A 4GQ2P 4ZOZA 3FRXA 5CXBA 3EWEA 2PM7B 4CI3A 4J0WA 4A0AA 5THAA 3N0EA 4QT8A 4UI9R 3BG1A 5TEEA 3JB9L 2H9PA 4A0BB 4X60B 3VGZA 5EAPA 1PGUA 2AH0A 3UVNA 5IGQA 4CI8A 4L3HD 5HE0B 3IJCA 3EI1A 4J8BA 4D0KA 2GC4A 3EI1B 4OWRA 1RI6A 1NR0A 1NEXB 2H9MA 2I0RA 4H5JA 3I7PA 3PVWB 3AL8B 3SHFA 2B5NA 2Z2NA 5C9ZB 3OTTA 5FKSA 4Y7RA 3U4YA 5FQDA 3PVUB 3EI3B 1VYHC 5C2WB 4YVDA 2I0TA 3I89A 5CYKB 5IT9g 3BWSA 4Z8LA 5EALA 2H3XA 4FHLA 2B4EA 2IWKA 3OKTA 4A09A 2GC7A 4O3UB 1N6EA 4FA1D 4JSNC 4FAVD 4GZ8A 3OKYA 5FKQA 3OKYB 5EM2B 4JSPC 3SJLD 2HXCA 3I8EA 3C99A 3RLMD 1YFQA 2H6KA 5FKRA 4FA5D 4OZUA 4J87A 1P22A 1L0QA 3UVKA 3SBRA 3UKRC 5KDOB 3N0DA 4EWRA 3J80g 4R7AB 5TDHB 3I7NA 4ERZA 4J84A 5C2VB 2J56H 5K19A 5IGOA 4J73A 4X3EA 1GXRA 3NVNA 4CZVA 2UZYB 1GP2B 1MDAH 2B5LA 4AOWA 3AH8B 4CY2A 3IIYA 2PBIB 2PM6B 4E5ZA 3OKWA 2OVQB 3JRPA 1OLZA 2P9NC 4E54A 1XHMA 4GQBB 2HJ4A 2IUVA 3F3FA 4J77A 2H9NA 2CNXA 3AL9A 1SHYB 4X61B 5H14A 2I3SA 3F3GA 3JZHA 3V9FA 4X63B 3SBQA 2AGYA 2OK6A 3MKQA 2H47A 3A0FA 3DSMA 4AEZA 4PC0A 3DWLC 3PXSD 5HE2B 1FWXA 1Q47A 2IAAA 3IJ0A 3L4MD 4A0BA 2Q7QA 2GNQA 3F3PA 4QQEA 2OIZA 5H1MA 4JSXC 3ODTA 4BL0A 2BCJB 1JMXB 3ULEC 3RMZD 3K27A 1TYQC 4ZOYA 4O45A 4D6VA 3EU7A 1PEVA 2J57G 3AL8A 2H6QA 3EI3A 2OVPB 5I5IA 1OMWB 3V5WB 5I5MA 5EARA 3IKOA 4O9DA 4TZ4A 4O3TB 5CYKA 5EMJB 5HQGA 1R5MA 3SMRA 4XYIA 4ZN4A 3EG6A 3P4FA 5AFU3 1N6FA 4LG9A 3JZNA 3RSEC 2PM9B 2YMUA 5JWZA 1B9YA 3SCYA 3KRXB 2UZXB 4GGDA 2Z2OA 5EM2A 2MTAH 4JT5C 5HE1B 2O9KA 2AGZA 4ESGA 4JT6C 3I7OA 2AQ5A 2H13A 2HKRA 4ZOVA 4U7AA 2HJBA 4BH6A 2P9PC 4FWWA 4MK0B 1XIPA 4J82A 3EI4B 4LG8A 3V7DB 4CI2A 1GG2B 4FB1D 4CY1A 5IC7A 4CY3A 2XL2A 4A11B 3AFCA 4PSXB 3UVMA 2OJYA 2QC5A 4BUJC 4GM9A 3L4OD 3RRMC 3MXXA 2W18A 3SXTD 3EMHA 4NSXA 3I7KA 3MMYA 5B4WA 2I0SA 4XYHA 4FA4D 2YNOA 3PSCB 1K32A 4J8GA 4L9OA 1SQ9A 2IUQA 2XU7A 4FAND 1XKSA 3J81g 4GMBA 2P9KC 3FGBA 4HDJA 2YBAA 3C9CA 1A0RB 1SQJA 2AGXA 5GMKn 3GFCA 5CXCB 4A2MA 4CZXA 1ERJA 5K1CC 4J81A 2AGLA 3SWSD 3SFZA 3PXTD 4LGNA 5EMMB 3SBPA 4ERYA 4GGCA 1B9XA 3DXKC 3I2NA 2J55H 2CE8A 1U4CA 1MG2A 2AGWA 3JAMg 3HFQA 4A08B 2HKMA 3SLED 3GREA 1S4UX 2HYEA 4GM3A 2IUPA 4ERQA 3ZWLB 2OK4A 5CXBB 3UVLA 4A0AB 1TBGA 4J0XA 3NVQA 2XYIA 4PSWB 3RFHA 3OW8A 4PNKB 4PXWA 3K26A 2Z2PA 3DXMC 4PBZA 5EMLB 2H9LA 3UVOA 1MG3A 4J86A 3RFGA 4IA9A 2CO0C 5GXHA 2HESX 4JSVC 5GXIA 2CN2A 1JJUB 3VH0A 4QRJA 5EMKB 5FA5B 2PM9A 2XL3A 2I3TA 2YNNA 2OVRB 3SN6B 4ZOXA 2H14A 3FM0A 4K3JB 1N6DA 3MZLA 3RN0D 1PI6A 4CY5A 3IJ1A 5I5JA 4J78A 3ORVD 1GOTB 2IWFA 4GQ1A 3W15A 3NVXA 4I79A 4O1QD 4XEIC 2CO0A 2CN3A 3E0CA 3DM0A 4A09B 3CFVA 4JXMA 4GM8A 4QL1A 4L3GD 5AJAA 3EI4A 2P9LC 1U2VC 3CIKB 4N14A 3JPXA 5A2Qg 5FLXg 3I7LA 5TEFA 1QNIA 3C75H 1JOFA 4A11A 3MZKA 3KRWB 4A7JA 4PBYA 1PBYB 4CI1A 4KFMB 2AH1A 2P9IC 3UR4A 5HYNB 2P9UC 5IJ8E 2H6NA 3JZGA 3MKSB 4JD2C 3OL2A 3EI2A 3OL2B 3EI2B 2QXVA 4K3ID 4FA9D 5H17A 3IIWA 2CE9A 2YB8B 2H68A 3PXWD 2IURA 4L1QD 3JROA 2G9AA 4Y5RD 1K8KC 4A2LA 3UKUC 4ES0A 5IJ7E 3PSLA 4CZYA 5CXCA 5FKTA 2EBSA 3C5MA 2P9SC 5SXMA 3CFSB 5FXYA 3PE7A 2B5MA 4IMMA 4E5ZB 4G56B
chains in the Genus database with same CATH superfamily
1JMZB 2G99A 3IUMA 3VA6A 4E54B 3RN1D 1L5GA 4GGAA 4A08A 1UTCA 2TRCB 3I7HA 4U1EI 2BBKH 3SVWD 5EAMA 3BG0A 4CC9A 2YNPA 1JV2A 4H5IA 5GSAA 1UOQA 3V4PA 5TF2A 3B7FA 5HE3B 3I8CA 5AMSA 4G1MA 4RE6A 4J79A 4O02A 4GQ2P 4MMYA 3FRXA 4ZOZA 5CXBA 3EWEA 2PM7B 4CI3A 4J0WA 4A0AA 5THAA 3N0EA 4G1EA 4QT8A 4JHNA 4UI9R 3BG1A 5TEEA 3JB9L 4L1MA 2H9PA 4A0BB 4X60B 3ZE2A 3VGZA 5EAPA 1PGUA 2AH0A 4WK4A 3UVNA 5IGQA 4CI8A 2VZ3A 4L3HD 5HE0B 3IJCA 3EI1A 4J8BA 4D0KA 2GC4A 3EI1B 4OWRA 1RI6A 4AMYA 1NR0A 1NEXB 2H9MA 1C9IA 1VE6A 3MVDK 2EICA 2I0RA 4H5JA 4BP9A 2VDPA 3I7PA 3AL8B 3PVWB 2B5NA 2Z2NA 3SHFA 5C9ZB 3OTTA 5FKSA 1O6GA 4Y7RA 3U4YA 5FQDA 3PVUB 3EI3B 4RE5A 1VYHC 5C2WB 4YVDA 1A12A 2VDMA 1BPOA 2I0TA 3I89A 2VDNA 1GOFA 3IULA 5CYKB 5IT9g 3BWSA 4Z8LA 3EQ8A 5EALA 2H3XA 4FHLA 3K6SA 2B4EA 2IWKA 3OKTA 4A09A 2GC7A 4O3UB 3T3PA 1T2XA 1N6EA 3K71A 4FA1D 4JSNC 4FAVD 4GZ8A 3OKYA 5FKQA 3OKYB 5EM2B 1QFMA 4JSPC 3SJLD 2HXCA 3I8EA 4AMZA 1H2YA 3O4IA 3C99A 3RLMD 1YFQA 2H6KA 5FKRA 4FA5D 4OZUA 4QAMA 4J87A 1P22A 1L0QA 3O4JA 3UVKA 3SBRA 3UKRC 5KDOB 3N0DA 2VZ1A 4EWRA 3J80g 2EIBA 4MMXA 3NIDA 4R7AB 5TDHB 3I7NA 2QZPA 4ERZA 4J84A 5C2VB 2J56H 5K19A 5IGOA 4BCCA 4DNWA 4WK0A 4J73A 4X3EA 1GXRA 3NVNA 4CZVA 2UZYB 5E6SA 1GP2B 3DDUA 1VZ2A 1MDAH 2B5LA 2VDRA 2XDWA 4AOWA 3AH8B 4CY2A 3IIYA 4BP8A 4JHPC 2PBIB 2PM6B 4E5ZA 3OKWA 2OVQB 3JRPA 1OLZA 2P9NC 4E54A 1XHMA 4GQBB 2HJ4A 2IUVA 2EIDA 3F3FA 3KCIA 4J77A 2H9NA 5HDBA 3IUQA 2CNXA 3AL9A 1SHYB 4BCBA 4O2WA 4X61B 5H14A 2I3SA 3F3GA 3JZHA 3V9FA 4X63B 2JKXA 3SBQA 3T3MA 4NENA 2AGYA 2OK6A 3MKQA 2H47A 3A0FA 3DSMA 4AEZA 4PC0A 3DWLC 3PXSD 5HE2B 1FWXA 2QR5A 4AN1A 2HU8A 1Q47A 2IAAA 3IJ0A 3L4MD 4A0BA 2Q7QA 2GNQA 3F3PA 4QQEA 2OIZA 5H1MA 4JSXC 1H2WA 3ODTA 4BL0A 1I2MB 2BCJB 1JMXB 3ULEC 3RMZD 1E8NA 3IUNA 3K27A 3QHYB 1TYQC 4ZOYA 4O45A 4D6VA 3EU7A 1PEVA 2J57G 3AL8A 2H6QA 3EI3A 3O4GA 2OVPB 5I5IA 1OMWB 3V5WB 5I5MA 5EARA 3O4HA 3IKOA 2VDLA 4O9DA 4TZ4A 4O3TB 5CYKA 5EMJB 5HQGA 1R5MA 4AX4A 5C92A 3SMRA 1JTDB 5M61A 4XYIA 4ZN4A 3EG6A 3EQ7A 3P4FA 5AFU3 1N6FA 4LG9A 3JZNA 1VZ3A 3RSEC 2PM9B 2YMUA 5JWZA 1B9YA 5FFOA 3SCYA 3KRXB 2UZXB 4GGDA 2Z2OA 5EM2A 2MTAH 1H2ZA 4JT5C 5HE1B 2O9KA 3VI3A 2AGZA 4ESGA 4JT6C 3I7OA 4UM9A 5M5SA 1E5TA 3MUNA 2AQ5A 2H13A 2HKRA 4ZOVA 4U7AA 3FCSA 2HJBA 4Z7QA 4BH6A 2P9PC 4FWWA 4MK0B 1UOPA 1XIPA 4J82A 3EI4B 5M5RA 1GOGA 2HU7A 4DNUA 5M5TA 4LG8A 5FFGA 3V7DB 4CI2A 1GG2B 4FB1D 4CY1A 5IC7A 4CY3A 2XL2A 4A11B 3AFCA 3IUJA 4PSXB 3UVMA 2OJYA 2QC5A 4BUJC 4GM9A 3L4OD 3RRMC 3MXXA 2W18A 3SXTD 3IURA 3EMHA 4NSXA 3I7KA 3MMYA 5B4WA 2I0SA 4XYHA 4FA4D 2YNOA 3PSCB 1E8MA 2XE4A 1K32A 4J8GA 4L9OA 1SQ9A 4Z7NA 2VC2A 2IUQA 2XU7A 4FAND 1XKSA 3J81g 4GMBA 2P9KC 3FGBA 3OF7A 4HDJA 2YBAA 5E6UA 3C9CA 1A0RB 1SQJA 2AGXA 3VI4A 4WJKA 5GMKn 3GFCA 5CXCB 4A2MA 4CZXA 1ERJA 3FCUA 5K1CC 4J81A 2AGLA 3SWSD 3SFZA 3V4VA 3PXTD 4LGNA 5EMMB 3GC3B 3SBPA 4ERYA 3ZDYA 4GGCA 1B9XA 4D9SA 3DXKC 1K3IA 3I2NA 2J55H 1U8CA 2CE8A 1U4CA 1MG2A 2AGWA 3JAMg 2EIEA 3HFQA 4NAAA 4A08B 3IJEA 2HKMA 3SLED 4G55A 3GREA 1S4UX 2HYEA 4GM3A 2IUPA 4ERQA 1H2XA 4BCDA 3ZWLB 2OK4A 5CXBB 3IVMA 3UVLA 4A0AB 2BKLA 1TBGA 4J0XA 3NVQA 2XYIA 4PSWB 3RFHA 3OW8A 1YR2A 2XZGA 1UOOA 4PNKB 3ZDXA 1M1XA 4PXWA 3K26A 2Z2PA 3DXMC 3K72A 4PBZA 5EMLB 2H9LA 3UVOA 1MG3A 4J86A 3RFGA 4IA9A 2CO0C 2VDQA 2HESX 4JSVC 5GXIA 5GXHA 2CN2A 1JJUB 1VE7A 3VH0A 4QRJA 1C9LA 4NC4A 5EMKB 5M5VA 3ZE1A 5FA5B 2PM9A 2XL3A 2I3TA 3MUOA 2YNNA 5E6RA 2HU5A 2OVRB 3SN6B 4ZOXA 2H14A 3FM0A 4K3JB 1N6DA 3MZLA 3RN0D 1PI6A 4CY5A 3IJ1A 5I5JA 4J78A 3ORVD 1GOTB 2IWFA 4GQ1A 3W15A 3NVXA 4NBMA 4I79A 4O1QD 4XEIC 4UM8A 2WQ8A 2CO0A 2CN3A 3E0CA 4DNVA 5C86A 3DM0A 2VDKA 1O6FA 4A09B 3CFVA 4JXMA 3EQ9A 4GM8A 4QL1A 3GD1I 4L3GD 5AJAA 1GOHA 3EI4A 4MMZA 2P9LC 1U2VC 3CIKB 4N14A 3JPXA 5A2Qg 5FLXg 3I7LA 5TEFA 1QNIA 3C75H 1JOFA 4A11A 3MZKA 3KRWB 4A7JA 4IRZA 4PBYA 1PBYB 4CI1A 4WK2A 3QI0A 4KFMB 2AH1A 2P9IC 5M5UA 3UR4A 5HYNB 2P9UC 5IJ8E 2H6NA 3JZGA 3MKSB 4JD2C 4AN0A 3OL2A 3EI2A 3ZE0A 3OL2B 4Z7OA 3EI2B 2QXVA 4K3ID 4FA9D 3ZDZA 5H17A 3IIWA 2CE9A 2YB8B 2H68A 3PXWD 2IURA 4L1QD 4G56B 3JROA 1QFSA 2G9AA 4Y5RD 3NIFA 1K8KC 4A2LA 3UKUC 4ES0A 5IJ7E 1TYEA 3PSLA 4CZYA 5CXCA 5FKTA 2EBSA 3C5MA 2P9SC 5SXMA 3CFSB 5FXYA 3PE7A 2B5MA 4IMMA 4E5ZB 3NIGA 2VDOA
chains in the Genus database with same CATH topology
1JMZB 2G99A 3VA6A 4E54B 3RN1D 4GGAA 4A08A 2TRCB 3I7HA 4U1EI 2BBKH 3SVWD 5EAMA 3BG0A 4CC9A 2YNPA 4H5IA 5GSAA 5TF2A 3B7FA 5HE3B 3I8CA 5AMSA 4J79A 4GQ2P 4ZOZA 3FRXA 5CXBA 3EWEA 2PM7B 4CI3A 4J0WA 4A0AA 5THAA 3N0EA 4QT8A 4UI9R 3BG1A 5TEEA 3JB9L 2H9PA 4A0BB 4X60B 3VGZA 5EAPA 1PGUA 2AH0A 3UVNA 5IGQA 4CI8A 4L3HD 5HE0B 3IJCA 3EI1A 4J8BA 4D0KA 2GC4A 3EI1B 4OWRA 1RI6A 1NR0A 1NEXB 2H9MA 2I0RA 4H5JA 3I7PA 3PVWB 3AL8B 3SHFA 2B5NA 2Z2NA 5C9ZB 3OTTA 5FKSA 4Y7RA 3U4YA 5FQDA 3PVUB 3EI3B 1VYHC 5C2WB 4YVDA 2I0TA 3I89A 5CYKB 5IT9g 3BWSA 4Z8LA 5EALA 2H3XA 4FHLA 2B4EA 2IWKA 3OKTA 4A09A 2GC7A 4O3UB 1N6EA 4FA1D 4JSNC 4FAVD 4GZ8A 3OKYA 5FKQA 3OKYB 5EM2B 4JSPC 3SJLD 2HXCA 3I8EA 3C99A 3RLMD 1YFQA 2H6KA 5FKRA 4FA5D 4OZUA 4J87A 1P22A 1L0QA 3UVKA 3SBRA 3UKRC 5KDOB 3N0DA 4EWRA 3J80g 4R7AB 5TDHB 3I7NA 4ERZA 4J84A 5C2VB 2J56H 5K19A 5IGOA 4J73A 4X3EA 1GXRA 3NVNA 4CZVA 2UZYB 1GP2B 1MDAH 2B5LA 4AOWA 3AH8B 4CY2A 3IIYA 2PBIB 2PM6B 4E5ZA 3OKWA 2OVQB 3JRPA 1OLZA 2P9NC 4E54A 1XHMA 4GQBB 2HJ4A 2IUVA 3F3FA 4J77A 2H9NA 2CNXA 3AL9A 1SHYB 4X61B 5H14A 2I3SA 3F3GA 3JZHA 3V9FA 4X63B 3SBQA 2AGYA 2OK6A 3MKQA 2H47A 3A0FA 3DSMA 4AEZA 4PC0A 3DWLC 3PXSD 5HE2B 1FWXA 1Q47A 2IAAA 3IJ0A 3L4MD 4A0BA 2Q7QA 2GNQA 3F3PA 4QQEA 2OIZA 5H1MA 4JSXC 3ODTA 4BL0A 2BCJB 1JMXB 3ULEC 3RMZD 3K27A 1TYQC 4ZOYA 4O45A 4D6VA 3EU7A 1PEVA 2J57G 3AL8A 2H6QA 3EI3A 2OVPB 5I5IA 1OMWB 3V5WB 5I5MA 5EARA 3IKOA 4O9DA 4TZ4A 4O3TB 5CYKA 5EMJB 5HQGA 1R5MA 3SMRA 4XYIA 4ZN4A 3EG6A 3P4FA 5AFU3 1N6FA 4LG9A 3JZNA 3RSEC 2PM9B 2YMUA 5JWZA 1B9YA 3SCYA 3KRXB 2UZXB 4GGDA 2Z2OA 5EM2A 2MTAH 4JT5C 5HE1B 2O9KA 2AGZA 4ESGA 4JT6C 3I7OA 2AQ5A 2H13A 2HKRA 4ZOVA 4U7AA 2HJBA 4BH6A 2P9PC 4FWWA 4MK0B 1XIPA 4J82A 3EI4B 4LG8A 3V7DB 4CI2A 1GG2B 4FB1D 4CY1A 5IC7A 4CY3A 2XL2A 4A11B 3AFCA 4PSXB 3UVMA 2OJYA 2QC5A 4BUJC 4GM9A 3L4OD 3RRMC 3MXXA 2W18A 3SXTD 3EMHA 4NSXA 3I7KA 3MMYA 5B4WA 2I0SA 4XYHA 4FA4D 2YNOA 3PSCB 1K32A 4J8GA 4L9OA 1SQ9A 2IUQA 2XU7A 4FAND 1XKSA 3J81g 4GMBA 2P9KC 3FGBA 4HDJA 2YBAA 3C9CA 1A0RB 1SQJA 2AGXA 5GMKn 3GFCA 5CXCB 4A2MA 4CZXA 1ERJA 5K1CC 4J81A 2AGLA 3SWSD 3SFZA 3PXTD 4LGNA 5EMMB 3SBPA 4ERYA 4GGCA 1B9XA 3DXKC 3I2NA 2J55H 2CE8A 1U4CA 1MG2A 2AGWA 3JAMg 3HFQA 4A08B 2HKMA 3SLED 3GREA 1S4UX 2HYEA 4GM3A 2IUPA 4ERQA 3ZWLB 2OK4A 5CXBB 3UVLA 4A0AB 1TBGA 4J0XA 3NVQA 2XYIA 4PSWB 3RFHA 3OW8A 4PNKB 4PXWA 3K26A 2Z2PA 3DXMC 4PBZA 5EMLB 2H9LA 3UVOA 1MG3A 4J86A 3RFGA 4IA9A 2CO0C 5GXHA 2HESX 4JSVC 5GXIA 2CN2A 1JJUB 3VH0A 4QRJA 5EMKB 5FA5B 2PM9A 2XL3A 2I3TA 2YNNA 2OVRB 3SN6B 4ZOXA 2H14A 3FM0A 4K3JB 1N6DA 3MZLA 3RN0D 1PI6A 4CY5A 3IJ1A 5I5JA 4J78A 3ORVD 1GOTB 2IWFA 4GQ1A 3W15A 3NVXA 4I79A 4O1QD 4XEIC 2CO0A 2CN3A 3E0CA 3DM0A 4A09B 3CFVA 4JXMA 4GM8A 4QL1A 4L3GD 5AJAA 3EI4A 2P9LC 1U2VC 3CIKB 4N14A 3JPXA 5A2Qg 5FLXg 3I7LA 5TEFA 1QNIA 3C75H 1JOFA 4A11A 3MZKA 3KRWB 4A7JA 4PBYA 1PBYB 4CI1A 4KFMB 2AH1A 2P9IC 3UR4A 5HYNB 2P9UC 5IJ8E 2H6NA 3JZGA 3MKSB 4JD2C 3OL2A 3EI2A 3OL2B 3EI2B 2QXVA 4K3ID 4FA9D 5H17A 3IIWA 2CE9A 2YB8B 2H68A 3PXWD 2IURA 4L1QD 3JROA 2G9AA 4Y5RD 1K8KC 4A2LA 3UKUC 4ES0A 5IJ7E 3PSLA 4CZYA 5CXCA 5FKTA 2EBSA 3C5MA 2P9SC 5SXMA 3CFSB 5FXYA 3PE7A 2B5MA 4IMMA 4E5ZB 4G56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMZ B;  2G99 A;  3VA6 A;  4E54 B;  3RN1 D;  4GGA A;  4A08 A;  2TRC B;  3I7H A;  4U1E I;  2BBK H;  3SVW D;  5EAM A;  3BG0 A;  4CC9 A;  2YNP A;  4H5I A;  5GSA A;  5TF2 A;  3B7F A;  5HE3 B;  3I8C A;  5AMS A;  4J79 A;  4GQ2 P;  4ZOZ A;  3FRX A;  5CXB A;  3EWE A;  2PM7 B;  4CI3 A;  4J0W A;  4A0A A;  5THA A;  3N0E A;  4QT8 A;  4UI9 R;  3BG1 A;  5TEE A;  3JB9 L;  2H9P A;  4A0B B;  4X60 B;  3VGZ A;  5EAP A;  1PGU A;  2AH0 A;  3UVN A;  5IGQ A;  4CI8 A;  4L3H D;  5HE0 B;  3IJC A;  3EI1 A;  4J8B A;  4D0K A;  2GC4 A;  3EI1 B;  4OWR A;  1RI6 A;  1NR0 A;  1NEX B;  2H9M A;  2I0R A;  4H5J A;  3I7P A;  3PVW B;  3AL8 B;  3SHF A;  2B5N A;  2Z2N A;  5C9Z B;  3OTT A;  5FKS A;  4Y7R A;  3U4Y A;  5FQD A;  3PVU B;  3EI3 B;  1VYH C;  5C2W B;  4YVD A;  2I0T A;  3I89 A;  5CYK B;  5IT9 g;  3BWS A;  4Z8L A;  5EAL A;  2H3X A;  4FHL A;  2B4E A;  2IWK A;  3OKT A;  4A09 A;  2GC7 A;  4O3U B;  1N6E A;  4FA1 D;  4JSN C;  4FAV D;  4GZ8 A;  3OKY A;  5FKQ A;  3OKY B;  5EM2 B;  4JSP C;  3SJL D;  2HXC A;  3I8E A;  3C99 A;  3RLM D;  1YFQ A;  2H6K A;  5FKR A;  4FA5 D;  4OZU A;  4J87 A;  1P22 A;  1L0Q A;  3UVK A;  3SBR A;  3UKR C;  5KDO B;  3N0D A;  4EWR A;  3J80 g;  4R7A B;  5TDH B;  3I7N A;  4ERZ A;  4J84 A;  5C2V B;  2J56 H;  5K19 A;  5IGO A;  4J73 A;  4X3E A;  1GXR A;  3NVN A;  4CZV A;  2UZY B;  1GP2 B;  1MDA H;  2B5L A;  4AOW A;  3AH8 B;  4CY2 A;  3IIY A;  2PBI B;  2PM6 B;  4E5Z A;  3OKW A;  2OVQ B;  3JRP A;  1OLZ A;  2P9N C;  4E54 A;  1XHM A;  4GQB B;  2HJ4 A;  2IUV A;  3F3F A;  4J77 A;  2H9N A;  2CNX A;  3AL9 A;  1SHY B;  4X61 B;  5H14 A;  2I3S A;  3F3G A;  3JZH A;  3V9F A;  4X63 B;  3SBQ A;  2AGY A;  2OK6 A;  3MKQ A;  2H47 A;  3A0F A;  3DSM A;  4AEZ A;  4PC0 A;  3DWL C;  3PXS D;  5HE2 B;  1FWX A;  1Q47 A;  2IAA A;  3IJ0 A;  3L4M D;  4A0B A;  2Q7Q A;  2GNQ A;  3F3P A;  4QQE A;  2OIZ A;  5H1M A;  4JSX C;  3ODT A;  4BL0 A;  2BCJ B;  1JMX B;  3ULE C;  3RMZ D;  3K27 A;  1TYQ C;  4ZOY A;  4O45 A;  4D6V A;  3EU7 A;  1PEV A;  2J57 G;  3AL8 A;  2H6Q A;  3EI3 A;  2OVP B;  5I5I A;  1OMW B;  3V5W B;  5I5M A;  5EAR A;  3IKO A;  4O9D A;  4TZ4 A;  4O3T B;  5CYK A;  5EMJ B;  5HQG A;  1R5M A;  3SMR A;  4XYI A;  4ZN4 A;  3EG6 A;  3P4F A;  5AFU 3;  1N6F A;  4LG9 A;  3JZN A;  3RSE C;  2PM9 B;  2YMU A;  5JWZ A;  1B9Y A;  3SCY A;  3KRX B;  2UZX B;  4GGD A;  2Z2O A;  5EM2 A;  2MTA H;  4JT5 C;  5HE1 B;  2O9K A;  2AGZ A;  4ESG A;  4JT6 C;  3I7O A;  2AQ5 A;  2H13 A;  2HKR A;  4ZOV A;  4U7A A;  2HJB A;  4BH6 A;  2P9P C;  4FWW A;  4MK0 B;  1XIP A;  4J82 A;  3EI4 B;  4LG8 A;  3V7D B;  4CI2 A;  1GG2 B;  4FB1 D;  4CY1 A;  5IC7 A;  4CY3 A;  2XL2 A;  4A11 B;  3AFC A;  4PSX B;  3UVM A;  2OJY A;  2QC5 A;  4BUJ C;  4GM9 A;  3L4O D;  3RRM C;  3MXX A;  2W18 A;  3SXT D;  3EMH A;  4NSX A;  3I7K A;  3MMY A;  5B4W A;  2I0S A;  4XYH A;  4FA4 D;  2YNO A;  3PSC B;  1K32 A;  4J8G A;  4L9O A;  1SQ9 A;  2IUQ A;  2XU7 A;  4FAN D;  1XKS A;  3J81 g;  4GMB A;  2P9K C;  3FGB A;  4HDJ A;  2YBA A;  3C9C A;  1A0R B;  1SQJ A;  2AGX A;  5GMK n;  3GFC A;  5CXC B;  4A2M A;  4CZX A;  1ERJ A;  5K1C C;  4J81 A;  2AGL A;  3SWS D;  3SFZ A;  3PXT D;  4LGN A;  5EMM B;  3SBP A;  4ERY A;  4GGC A;  1B9X A;  3DXK C;  3I2N A;  2J55 H;  2CE8 A;  1U4C A;  1MG2 A;  2AGW A;  3JAM g;  3HFQ A;  4A08 B;  2HKM A;  3SLE D;  3GRE A;  1S4U X;  2HYE A;  4GM3 A;  2IUP A;  4ERQ A;  3ZWL B;  2OK4 A;  5CXB B;  3UVL A;  4A0A B;  1TBG A;  4J0X A;  3NVQ A;  2XYI A;  4PSW B;  3RFH A;  3OW8 A;  4PNK B;  4PXW A;  3K26 A;  2Z2P A;  3DXM C;  4PBZ A;  5EML B;  2H9L A;  3UVO A;  1MG3 A;  4J86 A;  3RFG A;  4IA9 A;  2CO0 C;  5GXH A;  2HES X;  4JSV C;  5GXI A;  2CN2 A;  1JJU B;  3VH0 A;  4QRJ A;  5EMK B;  5FA5 B;  2PM9 A;  2XL3 A;  2I3T A;  2YNN A;  2OVR B;  3SN6 B;  4ZOX A;  2H14 A;  3FM0 A;  4K3J B;  1N6D A;  3MZL A;  3RN0 D;  1PI6 A;  4CY5 A;  3IJ1 A;  5I5J A;  4J78 A;  3ORV D;  1GOT B;  2IWF A;  4GQ1 A;  3W15 A;  3NVX A;  4I79 A;  4O1Q D;  4XEI C;  2CO0 A;  2CN3 A;  3E0C A;  3DM0 A;  4A09 B;  3CFV A;  4JXM A;  4GM8 A;  4QL1 A;  4L3G D;  5AJA A;  3EI4 A;  2P9L C;  1U2V C;  3CIK B;  4N14 A;  3JPX A;  5A2Q g;  5FLX g;  3I7L A;  5TEF A;  1QNI A;  3C75 H;  1JOF A;  4A11 A;  3MZK A;  3KRW B;  4A7J A;  4PBY A;  1PBY B;  4CI1 A;  4KFM B;  2AH1 A;  2P9I C;  3UR4 A;  5HYN B;  2P9U C;  5IJ8 E;  2H6N A;  3JZG A;  3MKS B;  4JD2 C;  3OL2 A;  3EI2 A;  3OL2 B;  3EI2 B;  2QXV A;  4K3I D;  4FA9 D;  5H17 A;  3IIW A;  2CE9 A;  2YB8 B;  2H68 A;  3PXW D;  2IUR A;  4L1Q D;  3JRO A;  2G9A A;  4Y5R D;  1K8K C;  4A2L A;  3UKU C;  4ES0 A;  5IJ7 E;  3PSL A;  4CZY A;  5CXC A;  5FKT A;  2EBS A;  3C5M A;  2P9S C;  5SXM A;  3CFS B;  5FXY A;  3PE7 A;  2B5M A;  4IMM A;  4E5Z B;  4G56 B; 
#chains in the Genus database with same CATH topology
 1JMZ B;  2G99 A;  3IUM A;  3VA6 A;  4E54 B;  3RN1 D;  1L5G A;  4GGA A;  4A08 A;  1UTC A;  2TRC B;  3I7H A;  4U1E I;  2BBK H;  3SVW D;  5EAM A;  3BG0 A;  4CC9 A;  2YNP A;  1JV2 A;  4H5I A;  5GSA A;  1UOQ A;  3V4P A;  5TF2 A;  3B7F A;  5HE3 B;  3I8C A;  5AMS A;  4G1M A;  4RE6 A;  4J79 A;  4O02 A;  4GQ2 P;  4MMY A;  3FRX A;  4ZOZ A;  5CXB A;  3EWE A;  2PM7 B;  4CI3 A;  4J0W A;  4A0A A;  5THA A;  3N0E A;  4G1E A;  4QT8 A;  4JHN A;  4UI9 R;  3BG1 A;  5TEE A;  3JB9 L;  4L1M A;  2H9P A;  4A0B B;  4X60 B;  3ZE2 A;  3VGZ A;  5EAP A;  1PGU A;  2AH0 A;  4WK4 A;  3UVN A;  5IGQ A;  4CI8 A;  2VZ3 A;  4L3H D;  5HE0 B;  3IJC A;  3EI1 A;  4J8B A;  4D0K A;  2GC4 A;  3EI1 B;  4OWR A;  1RI6 A;  4AMY A;  1NR0 A;  1NEX B;  2H9M A;  1C9I A;  1VE6 A;  3MVD K;  2EIC A;  2I0R A;  4H5J A;  4BP9 A;  2VDP A;  3I7P A;  3AL8 B;  3PVW B;  2B5N A;  2Z2N A;  3SHF A;  5C9Z B;  3OTT A;  5FKS A;  1O6G A;  4Y7R A;  3U4Y A;  5FQD A;  3PVU B;  3EI3 B;  4RE5 A;  1VYH C;  5C2W B;  4YVD A;  1A12 A;  2VDM A;  1BPO A;  2I0T A;  3I89 A;  2VDN A;  1GOF A;  3IUL A;  5CYK B;  5IT9 g;  3BWS A;  4Z8L A;  3EQ8 A;  5EAL A;  2H3X A;  4FHL A;  3K6S A;  2B4E A;  2IWK A;  3OKT A;  4A09 A;  2GC7 A;  4O3U B;  3T3P A;  1T2X A;  1N6E A;  3K71 A;  4FA1 D;  4JSN C;  4FAV D;  4GZ8 A;  3OKY A;  5FKQ A;  3OKY B;  5EM2 B;  1QFM A;  4JSP C;  3SJL D;  2HXC A;  3I8E A;  4AMZ A;  1H2Y A;  3O4I A;  3C99 A;  3RLM D;  1YFQ A;  2H6K A;  5FKR A;  4FA5 D;  4OZU A;  4QAM A;  4J87 A;  1P22 A;  1L0Q A;  3O4J A;  3UVK A;  3SBR A;  3UKR C;  5KDO B;  3N0D A;  2VZ1 A;  4EWR A;  3J80 g;  2EIB A;  4MMX A;  3NID A;  4R7A B;  5TDH B;  3I7N A;  2QZP A;  4ERZ A;  4J84 A;  5C2V B;  2J56 H;  5K19 A;  5IGO A;  4BCC A;  4DNW A;  4WK0 A;  4J73 A;  4X3E A;  1GXR A;  3NVN A;  4CZV A;  2UZY B;  5E6S A;  1GP2 B;  3DDU A;  1VZ2 A;  1MDA H;  2B5L A;  2VDR A;  2XDW A;  4AOW A;  3AH8 B;  4CY2 A;  3IIY A;  4BP8 A;  4JHP C;  2PBI B;  2PM6 B;  4E5Z A;  3OKW A;  2OVQ B;  3JRP A;  1OLZ A;  2P9N C;  4E54 A;  1XHM A;  4GQB B;  2HJ4 A;  2IUV A;  2EID A;  3F3F A;  3KCI A;  4J77 A;  2H9N A;  5HDB A;  3IUQ A;  2CNX A;  3AL9 A;  1SHY B;  4BCB A;  4O2W A;  4X61 B;  5H14 A;  2I3S A;  3F3G A;  3JZH A;  3V9F A;  4X63 B;  2JKX A;  3SBQ A;  3T3M A;  4NEN A;  2AGY A;  2OK6 A;  3MKQ A;  2H47 A;  3A0F A;  3DSM A;  4AEZ A;  4PC0 A;  3DWL C;  3PXS D;  5HE2 B;  1FWX A;  2QR5 A;  4AN1 A;  2HU8 A;  1Q47 A;  2IAA A;  3IJ0 A;  3L4M D;  4A0B A;  2Q7Q A;  2GNQ A;  3F3P A;  4QQE A;  2OIZ A;  5H1M A;  4JSX C;  1H2W A;  3ODT A;  4BL0 A;  1I2M B;  2BCJ B;  1JMX B;  3ULE C;  3RMZ D;  1E8N A;  3IUN A;  3K27 A;  3QHY B;  1TYQ C;  4ZOY A;  4O45 A;  4D6V A;  3EU7 A;  1PEV A;  2J57 G;  3AL8 A;  2H6Q A;  3EI3 A;  3O4G A;  2OVP B;  5I5I A;  1OMW B;  3V5W B;  5I5M A;  5EAR A;  3O4H A;  3IKO A;  2VDL A;  4O9D A;  4TZ4 A;  4O3T B;  5CYK A;  5EMJ B;  5HQG A;  1R5M A;  4AX4 A;  5C92 A;  3SMR A;  1JTD B;  5M61 A;  4XYI A;  4ZN4 A;  3EG6 A;  3EQ7 A;  3P4F A;  5AFU 3;  1N6F A;  4LG9 A;  3JZN A;  1VZ3 A;  3RSE C;  2PM9 B;  2YMU A;  5JWZ A;  1B9Y A;  5FFO A;  3SCY A;  3KRX B;  2UZX B;  4GGD A;  2Z2O A;  5EM2 A;  2MTA H;  1H2Z A;  4JT5 C;  5HE1 B;  2O9K A;  3VI3 A;  2AGZ A;  4ESG A;  4JT6 C;  3I7O A;  4UM9 A;  5M5S A;  1E5T A;  3MUN A;  2AQ5 A;  2H13 A;  2HKR A;  4ZOV A;  4U7A A;  3FCS A;  2HJB A;  4Z7Q A;  4BH6 A;  2P9P C;  4FWW A;  4MK0 B;  1UOP A;  1XIP A;  4J82 A;  3EI4 B;  5M5R A;  1GOG A;  2HU7 A;  4DNU A;  5M5T A;  4LG8 A;  5FFG A;  3V7D B;  4CI2 A;  1GG2 B;  4FB1 D;  4CY1 A;  5IC7 A;  4CY3 A;  2XL2 A;  4A11 B;  3AFC A;  3IUJ A;  4PSX B;  3UVM A;  2OJY A;  2QC5 A;  4BUJ C;  4GM9 A;  3L4O D;  3RRM C;  3MXX A;  2W18 A;  3SXT D;  3IUR A;  3EMH A;  4NSX A;  3I7K A;  3MMY A;  5B4W A;  2I0S A;  4XYH A;  4FA4 D;  2YNO A;  3PSC B;  1E8M A;  2XE4 A;  1K32 A;  4J8G A;  4L9O A;  1SQ9 A;  4Z7N A;  2VC2 A;  2IUQ A;  2XU7 A;  4FAN D;  1XKS A;  3J81 g;  4GMB A;  2P9K C;  3FGB A;  3OF7 A;  4HDJ A;  2YBA A;  5E6U A;  3C9C A;  1A0R B;  1SQJ A;  2AGX A;  3VI4 A;  4WJK A;  5GMK n;  3GFC A;  5CXC B;  4A2M A;  4CZX A;  1ERJ A;  3FCU A;  5K1C C;  4J81 A;  2AGL A;  3SWS D;  3SFZ A;  3V4V A;  3PXT D;  4LGN A;  5EMM B;  3GC3 B;  3SBP A;  4ERY A;  3ZDY A;  4GGC A;  1B9X A;  4D9S A;  3DXK C;  1K3I A;  3I2N A;  2J55 H;  1U8C A;  2CE8 A;  1U4C A;  1MG2 A;  2AGW A;  3JAM g;  2EIE A;  3HFQ A;  4NAA A;  4A08 B;  3IJE A;  2HKM A;  3SLE D;  4G55 A;  3GRE A;  1S4U X;  2HYE A;  4GM3 A;  2IUP A;  4ERQ A;  1H2X A;  4BCD A;  3ZWL B;  2OK4 A;  5CXB B;  3IVM A;  3UVL A;  4A0A B;  2BKL A;  1TBG A;  4J0X A;  3NVQ A;  2XYI A;  4PSW B;  3RFH A;  3OW8 A;  1YR2 A;  2XZG A;  1UOO A;  4PNK B;  3ZDX A;  1M1X A;  4PXW A;  3K26 A;  2Z2P A;  3DXM C;  3K72 A;  4PBZ A;  5EML B;  2H9L A;  3UVO A;  1MG3 A;  4J86 A;  3RFG A;  4IA9 A;  2CO0 C;  2VDQ A;  2HES X;  4JSV C;  5GXI A;  5GXH A;  2CN2 A;  1JJU B;  1VE7 A;  3VH0 A;  4QRJ A;  1C9L A;  4NC4 A;  5EMK B;  5M5V A;  3ZE1 A;  5FA5 B;  2PM9 A;  2XL3 A;  2I3T A;  3MUO A;  2YNN A;  5E6R A;  2HU5 A;  2OVR B;  3SN6 B;  4ZOX A;  2H14 A;  3FM0 A;  4K3J B;  1N6D A;  3MZL A;  3RN0 D;  1PI6 A;  4CY5 A;  3IJ1 A;  5I5J A;  4J78 A;  3ORV D;  1GOT B;  2IWF A;  4GQ1 A;  3W15 A;  3NVX A;  4NBM A;  4I79 A;  4O1Q D;  4XEI C;  4UM8 A;  2WQ8 A;  2CO0 A;  2CN3 A;  3E0C A;  4DNV A;  5C86 A;  3DM0 A;  2VDK A;  1O6F A;  4A09 B;  3CFV A;  4JXM A;  3EQ9 A;  4GM8 A;  4QL1 A;  3GD1 I;  4L3G D;  5AJA A;  1GOH A;  3EI4 A;  4MMZ A;  2P9L C;  1U2V C;  3CIK B;  4N14 A;  3JPX A;  5A2Q g;  5FLX g;  3I7L A;  5TEF A;  1QNI A;  3C75 H;  1JOF A;  4A11 A;  3MZK A;  3KRW B;  4A7J A;  4IRZ A;  4PBY A;  1PBY B;  4CI1 A;  4WK2 A;  3QI0 A;  4KFM B;  2AH1 A;  2P9I C;  5M5U A;  3UR4 A;  5HYN B;  2P9U C;  5IJ8 E;  2H6N A;  3JZG A;  3MKS B;  4JD2 C;  4AN0 A;  3OL2 A;  3EI2 A;  3ZE0 A;  3OL2 B;  4Z7O A;  3EI2 B;  2QXV A;  4K3I D;  4FA9 D;  3ZDZ A;  5H17 A;  3IIW A;  2CE9 A;  2YB8 B;  2H68 A;  3PXW D;  2IUR A;  4L1Q D;  4G56 B;  3JRO A;  1QFS A;  2G9A A;  4Y5R D;  3NIF A;  1K8K C;  4A2L A;  3UKU C;  4ES0 A;  5IJ7 E;  1TYE A;  3PSL A;  4CZY A;  5CXC A;  5FKT A;  2EBS A;  3C5M A;  2P9S C;  5SXM A;  3CFS B;  5FXY A;  3PE7 A;  2B5M A;  4IMM A;  4E5Z B;  3NIG A;  2VDO A; 
#chains in the Genus database with same CATH homology
 1JMZ B;  2G99 A;  3VA6 A;  4E54 B;  3RN1 D;  4GGA A;  4A08 A;  2TRC B;  3I7H A;  4U1E I;  2BBK H;  3SVW D;  5EAM A;  3BG0 A;  4CC9 A;  2YNP A;  4H5I A;  5GSA A;  5TF2 A;  3B7F A;  5HE3 B;  3I8C A;  5AMS A;  4J79 A;  4GQ2 P;  4ZOZ A;  3FRX A;  5CXB A;  3EWE A;  2PM7 B;  4CI3 A;  4J0W A;  4A0A A;  5THA A;  3N0E A;  4QT8 A;  4UI9 R;  3BG1 A;  5TEE A;  3JB9 L;  2H9P A;  4A0B B;  4X60 B;  3VGZ A;  5EAP A;  1PGU A;  2AH0 A;  3UVN A;  5IGQ A;  4CI8 A;  4L3H D;  5HE0 B;  3IJC A;  3EI1 A;  4J8B A;  4D0K A;  2GC4 A;  3EI1 B;  4OWR A;  1RI6 A;  1NR0 A;  1NEX B;  2H9M A;  2I0R A;  4H5J A;  3I7P A;  3PVW B;  3AL8 B;  3SHF A;  2B5N A;  2Z2N A;  5C9Z B;  3OTT A;  5FKS A;  4Y7R A;  3U4Y A;  5FQD A;  3PVU B;  3EI3 B;  1VYH C;  5C2W B;  4YVD A;  2I0T A;  3I89 A;  5CYK B;  5IT9 g;  3BWS A;  4Z8L A;  5EAL A;  2H3X A;  4FHL A;  2B4E A;  2IWK A;  3OKT A;  4A09 A;  2GC7 A;  4O3U B;  1N6E A;  4FA1 D;  4JSN C;  4FAV D;  4GZ8 A;  3OKY A;  5FKQ A;  3OKY B;  5EM2 B;  4JSP C;  3SJL D;  2HXC A;  3I8E A;  3C99 A;  3RLM D;  1YFQ A;  2H6K A;  5FKR A;  4FA5 D;  4OZU A;  4J87 A;  1P22 A;  1L0Q A;  3UVK A;  3SBR A;  3UKR C;  5KDO B;  3N0D A;  4EWR A;  3J80 g;  4R7A B;  5TDH B;  3I7N A;  4ERZ A;  4J84 A;  5C2V B;  2J56 H;  5K19 A;  5IGO A;  4J73 A;  4X3E A;  1GXR A;  3NVN A;  4CZV A;  2UZY B;  1GP2 B;  1MDA H;  2B5L A;  4AOW A;  3AH8 B;  4CY2 A;  3IIY A;  2PBI B;  2PM6 B;  4E5Z A;  3OKW A;  2OVQ B;  3JRP A;  1OLZ A;  2P9N C;  4E54 A;  1XHM A;  4GQB B;  2HJ4 A;  2IUV A;  3F3F A;  4J77 A;  2H9N A;  2CNX A;  3AL9 A;  1SHY B;  4X61 B;  5H14 A;  2I3S A;  3F3G A;  3JZH A;  3V9F A;  4X63 B;  3SBQ A;  2AGY A;  2OK6 A;  3MKQ A;  2H47 A;  3A0F A;  3DSM A;  4AEZ A;  4PC0 A;  3DWL C;  3PXS D;  5HE2 B;  1FWX A;  1Q47 A;  2IAA A;  3IJ0 A;  3L4M D;  4A0B A;  2Q7Q A;  2GNQ A;  3F3P A;  4QQE A;  2OIZ A;  5H1M A;  4JSX C;  3ODT A;  4BL0 A;  2BCJ B;  1JMX B;  3ULE C;  3RMZ D;  3K27 A;  1TYQ C;  4ZOY A;  4O45 A;  4D6V A;  3EU7 A;  1PEV A;  2J57 G;  3AL8 A;  2H6Q A;  3EI3 A;  2OVP B;  5I5I A;  1OMW B;  3V5W B;  5I5M A;  5EAR A;  3IKO A;  4O9D A;  4TZ4 A;  4O3T B;  5CYK A;  5EMJ B;  5HQG A;  1R5M A;  3SMR A;  4XYI A;  4ZN4 A;  3EG6 A;  3P4F A;  5AFU 3;  1N6F A;  4LG9 A;  3JZN A;  3RSE C;  2PM9 B;  2YMU A;  5JWZ A;  1B9Y A;  3SCY A;  3KRX B;  2UZX B;  4GGD A;  2Z2O A;  5EM2 A;  2MTA H;  4JT5 C;  5HE1 B;  2O9K A;  2AGZ A;  4ESG A;  4JT6 C;  3I7O A;  2AQ5 A;  2H13 A;  2HKR A;  4ZOV A;  4U7A A;  2HJB A;  4BH6 A;  2P9P C;  4FWW A;  4MK0 B;  1XIP A;  4J82 A;  3EI4 B;  4LG8 A;  3V7D B;  4CI2 A;  1GG2 B;  4FB1 D;  4CY1 A;  5IC7 A;  4CY3 A;  2XL2 A;  4A11 B;  3AFC A;  4PSX B;  3UVM A;  2OJY A;  2QC5 A;  4BUJ C;  4GM9 A;  3L4O D;  3RRM C;  3MXX A;  2W18 A;  3SXT D;  3EMH A;  4NSX A;  3I7K A;  3MMY A;  5B4W A;  2I0S A;  4XYH A;  4FA4 D;  2YNO A;  3PSC B;  1K32 A;  4J8G A;  4L9O A;  1SQ9 A;  2IUQ A;  2XU7 A;  4FAN D;  1XKS A;  3J81 g;  4GMB A;  2P9K C;  3FGB A;  4HDJ A;  2YBA A;  3C9C A;  1A0R B;  1SQJ A;  2AGX A;  5GMK n;  3GFC A;  5CXC B;  4A2M A;  4CZX A;  1ERJ A;  5K1C C;  4J81 A;  2AGL A;  3SWS D;  3SFZ A;  3PXT D;  4LGN A;  5EMM B;  3SBP A;  4ERY A;  4GGC A;  1B9X A;  3DXK C;  3I2N A;  2J55 H;  2CE8 A;  1U4C A;  1MG2 A;  2AGW A;  3JAM g;  3HFQ A;  4A08 B;  2HKM A;  3SLE D;  3GRE A;  1S4U X;  2HYE A;  4GM3 A;  2IUP A;  4ERQ A;  3ZWL B;  2OK4 A;  5CXB B;  3UVL A;  4A0A B;  1TBG A;  4J0X A;  3NVQ A;  2XYI A;  4PSW B;  3RFH A;  3OW8 A;  4PNK B;  4PXW A;  3K26 A;  2Z2P A;  3DXM C;  4PBZ A;  5EML B;  2H9L A;  3UVO A;  1MG3 A;  4J86 A;  3RFG A;  4IA9 A;  2CO0 C;  5GXH A;  2HES X;  4JSV C;  5GXI A;  2CN2 A;  1JJU B;  3VH0 A;  4QRJ A;  5EMK B;  5FA5 B;  2PM9 A;  2XL3 A;  2I3T A;  2YNN A;  2OVR B;  3SN6 B;  4ZOX A;  2H14 A;  3FM0 A;  4K3J B;  1N6D A;  3MZL A;  3RN0 D;  1PI6 A;  4CY5 A;  3IJ1 A;  5I5J A;  4J78 A;  3ORV D;  1GOT B;  2IWF A;  4GQ1 A;  3W15 A;  3NVX A;  4I79 A;  4O1Q D;  4XEI C;  2CO0 A;  2CN3 A;  3E0C A;  3DM0 A;  4A09 B;  3CFV A;  4JXM A;  4GM8 A;  4QL1 A;  4L3G D;  5AJA A;  3EI4 A;  2P9L C;  1U2V C;  3CIK B;  4N14 A;  3JPX A;  5A2Q g;  5FLX g;  3I7L A;  5TEF A;  1QNI A;  3C75 H;  1JOF A;  4A11 A;  3MZK A;  3KRW B;  4A7J A;  4PBY A;  1PBY B;  4CI1 A;  4KFM B;  2AH1 A;  2P9I C;  3UR4 A;  5HYN B;  2P9U C;  5IJ8 E;  2H6N A;  3JZG A;  3MKS B;  4JD2 C;  3OL2 A;  3EI2 A;  3OL2 B;  3EI2 B;  2QXV A;  4K3I D;  4FA9 D;  5H17 A;  3IIW A;  2CE9 A;  2YB8 B;  2H68 A;  3PXW D;  2IUR A;  4L1Q D;  3JRO A;  2G9A A;  4Y5R D;  1K8K C;  4A2L A;  3UKU C;  4ES0 A;  5IJ7 E;  3PSL A;  4CZY A;  5CXC A;  5FKT A;  2EBS A;  3C5M A;  2P9S C;  5SXM A;  3CFS B;  5FXY A;  3PE7 A;  2B5M A;  4IMM A;  4E5Z B;  4G56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...