2QCFA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain (asp312asn mutant) of human ump synthase bound to 5-fluoro-ump
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 101
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcfA00
1IF2A 2ATMA 2O7SA 1P1XA 4ZQRA 2QCMA 1KTNA 1Z44A 4JEQA 3NG3A 5KZMA 3BG5A 4RXGA 2GQAA 4LVGA 4NJKA 3W7HA 1JUKA 3NGJA 1FXPA 1LBMA 5CKSA 2NXIA 3IIZA 3IIXA 5AN7A 1OABA 1VH7A 3TW6A 1ZFJA 3KRZA 2Q3RA 1LOSA 4XBSA 5C6MA 2WJZA 1H7XA 4FNQA 4O11A 4JTKA 5LNRA 1RD5A 2C15A 3GVGA 4IJBA 5FF7A 4DPQA 4MYAA 2PRLA 1OFDA 3E9AA 5FF0A 5A8GA 5IM51 1EIXA 1V5XA 3C6CA 3W83A 4K8HA 1JQXA 3FKRA 3TAKA 1D3GA 1KFBA 4HSOA 3ABSA 2DU2A 1EPXA 4ADUA 4MOZA 1TJPA 3NQAA 4K7VA 2A0NA 1ZALA 1JULA 3DKJA 3FA5A 2NXGA 4JTIA 1M7PA 2VFFA 2CLOA 5FF4A 3P74A 3QH2A 3UYCA 4BWLC 1LOQA 1VYPX 3NVTA 1PV8A 2Q3OA 3I68A 4A22A 2QCGA 4XTDA 3CPRA 1TPUA 5LHFA 4BR1A 1KTBA 3L66A 4MY1A 4PODA 1B57A 4JTHA 4PL1A 1Z42A 1EA0A 1FCUA 4UTUA 4N02A 2H3BA 1YTEA 3NPUA 1JCNA 1SO6A 2WO5A 3O6YX 1S5TA 4UFMA 4O54A 3P82A 1AG1O 2CLKA 2E6AA 2V5LA 3H54A 1B9BA 2A7PA 1KM0A 4DF0A 3PUOA 4UFLA 2YDAA 1OYBA 1VLWA 3B03A 4OU1A 2I1OA 3S6DA 4UTJA 1XM3A 2YGYA 1XXXA 2JKAA 4ORMA 1H1ZA 1OF8A 3FLUA 3MI3A 4GUFA 5G4WA 3DGRA 3O8AA 4E2BA 2DZSA 1OFEA 3W22A 1W1ZA 4O28A 1VLIA 3SSJA 1H1YA 3BO9A 4Z1CA 4O10A 4S2BA 2V2HA 3TUUA 3W1MA 4XBKA 4RCXA 1R47A 5C2XA 4LVFA 2BLEA 4QSHA 4EF8A 4LS0A 2AQWA 5KZDA 3Q94A 3LCWA 5K4XA 1H62A 4DQWA 2J6XA 2FLIA 4O1BA 3CIWA 2FB2A 3LLDA 2QCLA 3N34A 1TV7A 3G3DA 4JTEA 3E02A 5EL1A 2WSRA 2CZ5A 3Q58A 1IXQA 5J5RA 1EP3A 2VFIA 3W7MA 4LC6A 4RKAA 4CNNA 3NAVA 4NVTA 3W2KA 3SJ3A 3MYOA 4DPPA 4IMEA 2GJNA 2C16A 2FFCA 3P62A 3W7DA 4UNLA 3NOEA 1VQTA 1B4EA 1K8XA 3C52A 5EYWA 4RR4A 2PURA 3N9RA 4O13A 3S5OA 3INPA 4E0CA 5FEZA 1AL7A 3GDKA 1K7FA 4LNYA 2YX0A 5KTLA 4HKPA 3MYPA 4ZQCA 2ZCGA 5K4ZA 4UFKA 2HSAA 4UTMA 1IIHA 5D33A 2OT0A 1OFOA 4MZ1A 4M6QA 4B5NA 1F6KA 1VCFA 5G2IA 2BSLA 1OK6A 3NPVA 1ZCOA 3SZ8A 4UFHA 4O52A 2RH9A 1KM5A 3TR2A 3R13A 1OFRA 3BW2A 2EGZA 2Q8LA 1DOSA 3NDOA 1EB3A 3NPXA 4ZL1A 3PBWA 1WBHA 3NQ2A 3MHFA 2G96A 2CZEA 3KHJA 3STCA 1R2RA 4N9BA 1F5ZA 4LV4A 3DFPA 3KAOA 1PIIA 3G1FA 3F4WA 3CHVA 1VHCA 3W1TA 3QJAA 2CWNA 3S8HA 3EWUA 2Y89A 2QKFA 2Y70A 4UMBA 5EY5A 1A5SA 2A4AA 4MJZA 1LOLA 5CZ0A 3NXFA 1U5JA 3H55A 2Y7GA 2TYSA 4GUIA 3CWOX 2WSYA 2HS8A 3OIXA 2J24A 2VFHA 3W2UA 2J88A 5G1TA 4WXYA 3STEA 4UTKA 2DZTA 4WJEA 4O1CA 3PB2A 4UTWC 4IX2A 1ME7A 2VOMA 3EWZA 4QITA 5G1YA 1GVOA 3DI0A 1LM1A 1YDOA 3GDTA 3A9IA 4QJ1A 1PVNA 3U2OA 1A5BA 1UBSA 3TFXA 4R7JA 4DELA 1KA9F 5F4SA 1NEYA 1TPH1 4O50A 5D38A 5D02A 4HNNA 4CCCA 1R46A 3H53A 4MZYA 5CPOA 5LNVA 3DXIA 2QAPA 3GX9A 1N7KA 4O57A 2E6FA 1QPQA 2KZHA 2NV2A 5TQLA 3C0JA 3C4UA 3FIGA 1C9DA 4AHPA 3RFAA 3M9YA 1L9WA 1EWDA 5I3HA 4HPXA 5D09A 2ZZ1A 3T7VA 3W9ZA 4CQ9A 1ME8A 2IQTA 4N9EA 4DO4A 1ICQA 2QCDA 4HNTA 4MKNA 1OX4A 3KVLA 3BGGA 3O63A 2X1UA 3QSRA 3ABQA 1PCWA 2B7QA 2JGYA 4I7VA 3QPZA 4IGHA 2Y7FA 3WJZA 1GG1A 1TSIA 2ZZ7A 4OQVA 4TMBA 4K38A 3W70A 5SWUA 1ICPA 1LRTA 1L2UA 3I65A 3S1UA 3CT7A 3S1VA 3UQNA 4AB4A 3OVQA 2X1RA 4Q4KA 3GXPA 4H6KA 4IXXA 1KFCA 1AK5A 1J5TA 4JTTA 1TPVA 2ZDRA 3W71A 3PG9A 5D2VA 4WY0F 3LDVA 4A29A 3UPWA 2BZNA 4WZHA 5K9XA 4C1LA 1P5BA 2YCEA 3BLIA 3TDFA 3Q2DA 1W3NA 3BLFA 4MLJA 5D2WA 2GVJA 3P5ZA 2OT1A 4O16A 1I8JA 4HHPA 7TIMA 1BWLA 4M6PA 3RF9A 3RLUA 4ALDA 3MWAA 4GUGA 2P10A 4H3DA 1VS1A 4N6EA 1EP1A 1XFBA 3PG8A 3IIPA 5E1QA 2E5DA 5TBOA 1FDZA 3KVKA 2QUVA 1BTMA 4P2VA 2CW6A 2ZTJA 3FOKA 3W1NA 5LZLA 5AYZA 1VCVA 2CLIA 4H4IA 4BI5A 3LOTA 1NF0A 2GVGA 4O4VA 5I3GA 1KBIA 3W1RA 1GWJA 2BTMA 3MBFA 3P8JA 2W79A 3G8RA 4NQ1A 1SZEA 4Z0SA 3I7RA 5K2ZA 2B7NA 2QCDB 4AWUA 1F2JA 2Z0IA 3A24A 1OX4B 3B06A 5D2XA 3LXAA 3TQ0A 1SUXA 4UTTA 2VFDA 4PTNA 3OVPA 4OV4A 2DZWA 4TO8A 1XUZA 1DL3A 1W56A 1FXQA 3W86A 1H61A 1GVQA 1GEQA 5HJLA 3C2EA 1O5XA 3LHWA 1W5NA 1TPDA 3W2LA 2BWGA 3P80A 1HTIA 1LDCA 2VEIA 5AC6A 1GTHA 3LI1A 4O53A 1SSDA 5HWMA 1TTQA 2FQIA 3G24A 3W7IA 3P60A 4PH6A 4N2YA 2Z6IA 3WK1A 4JTSA 1I2QA 1CW2A 2E6DA 1YADA 3B4UA 3HPSA 3ATYA 3EWWA 1EUAA 3HIJA 3R5EA 3E12A 1QMLA 2VELA 3A22A 5L6UA 4BI7A 4QAIA 3R8RA 3N73A 3NL2A 3Q37A 4N4PA 1LYXA 3DH7A 1X7FA 2JKEA 3MBDA 3R2GA 4ONVA 5H91A 3G1HA 2ABBA 3MW7A 3BW3A 3W7JA 4M6VA 3P67A 3SR7A 5LNUA 3K30A 5LNWA 3NQ6A 3EWXA 1P4CA 2ISVA 3G0XA 1EP2A 3DHFA 1JUBA 3SI9A 1LLZA 2CFFA 3PY2A 3SFKA 4FNPA 2E5CA 1RQEA 4JD4A 1QFEA 3O6CA 3W1LA 3P81A 2VXNA 5AFDA 1SR9A 1OG0A 3L0NA 3STGA 3KOFA 1S5VA 2E1DA 1X1ZA 3PBVA 3MI2A 3PWAA 1KV5A 4KKXA 1MEIA 3TXZA 3LM7A 1M5WA 2C19A 4PL2A 3MP5A 3LCHA 2B7PA 5EKYA 1KW1A 4R34A 3IV3A 1P0KA 4AAJA 2AAMA 3HO8A 5CGQA 2ZZ2A 2ZZ5A 2NUWA 3NM1A 4NJHA 1NAL1 4UMAA 3QFEA 4O15A 3NL3A 4ADSA 2B7OA 3EX6A 4O14A 3NZ1A 2QDHA 5F2IA 3CC1A 3NQGA 3FEMA 4K6AA 4UR8A 4LVAA 3AJXA 3NQEA 1F7BA 2R91A 1QDSA 4IMDA 3U6WA 4Q32A 4RZ5A 3P7YA 1OF6A 4Y9AA 3DU0A 4QNWA 4JGDA 3G1XA 5I3FA 2ABAA 2C3ZA 3HQ1A 3UWVA 4AHQA 1QOQA 3G1AA 4MY8A 4NXKA 3M5ZA 3SGZA 4GBUA 2WV8A 3QMSA 1HG3A 4OBTA 2JKPA 1W5QA 4KWVA 4K7YA 3TX9A 2QEZA 5LKYA 1AW2A 3MUXA 4AF0A 2QJGA 5HWNA 3BLEA 1JVNA 1T8XA 3T44A 3ABRA 2ZFAA 4KWWA 1JQVA 4A2RA 2DORA 1QO5A 2G95A 4L4LA 2GOUA 4FIRA 1OJXA 2DJXA 2V2CA 4AMAA 2ISSA 4ZMGA 1VPXA 4O1DA 4FB7A 1TIMA 1TPEA 1SZFA 1K3UA 4I7WA 4LY8A 4UTLA 3NQDA 3W87A 1N8FA 1WDWA 1UUMA 1KFJA 4ML9A 1V7YA 5G2WA 3M5VA 4RJEA 1VCGA 1W5OA 2QR6A 4HIBA 1SSGA 5LGZA 1I45A 2WSQA 1F74A 2X1TA 4E2DA 3G1YA 3LCFA 3EXTA 1QCWA 1O4UA 4PFMA 4OGZA 1XI3A 1SW0A 2FJKA 2V9DA 4UTWA 4HN4A 1FWNA 1FWTA 2QCNA 4GRSA 1PS9A 1YXDA 3G0SA 3NNTA 1L6WA 1X6UA 1R2TA 4RK8A 2OJPA 5CSSA 3GDLA 1Y0EA 1JCJA 2BX7A 4WQ6A 3FFSA 4E38A 3PBUA 4MZ8A 1RVGA 3LTPA 3N14A 3W2MA 4BFAA 5G5IA 1LZOA 3LRKA 5DN1A 3TMQA 1LORA 3A23A 3PBYA 4LOCA 1C8VA 3NQFA 3W7OA 4OWGA 3L0GA 4KFOA 4NXSA 2WPBA 3O05A 1QPRA 3TW7A 3AO0A 1XC4A 3QMRA 2PRHA 5C55A 3DHDA 3NM3A 3OHIA 4AF0B 3UZ5A 5FEWA 1ZY9A 1IXNA 3QW4B 3BGJA 4GUHA 2NXHA 3UY7A 2ZRYA 4JX4A 1FCVA 3RMJA 1GZGA 4NJJA 2QUTA 3M43A 3F1QA 3QQ0A 5G4EA 1GT8A 1NVMA 4OT7A 2CLFA 1RQBA 3JR2A 4HNUA 3LCIA 1YXCA 2YXGA 3SY5A 3BG9A 2GQ9A 2JK2A 3I6RA 4LT9A 2C18A 1FX6A 3S5ZA 3UWWA 1GJPA 5AC7A 3GKFA 5AHMA 3G1VA 2QAFA 2G5WA 1TMHA 1M7OA 3UXDA 3OEXA 5U4NA 1YTDA 4K37A 3QC3A 3UNDA 4CNOA 1NF7A 2QJIA 2AGKA 2ZRVA 4Q33A 1H51A 3RLVA 1EEPA 4UCGA 3UZJA 3BW4A 3MHGA 3QRHA 3UWZA 1X1OA 4FEZA 2FB3A 3EXRA 4O12A 2ZRWA 3C2VA 4N6FA 5CPMA 1FWWA 4P61A 1SU5A 2HMCA 5F4WA 5AYYA 4U28A 1QAPA 5T26A 4OE7A 1QO2A 1YPIA 1BWKA 1KM6A 2FTPA 3LI0A 2ZRUA 4FX8A 1XCFA 1XDMA 3NL6A 3GNDA 3CB8A 3CLMA 3EX3A 2A6NA 2ISWA 3QSTA 2DZXA 4IQLA 1XKYA 1W3TA 1TQJA 2R94A 3QEZA 2V82A 3VFLA 5FI8A 5AHIA 2CLHA 1ZAIA 1TB3A 6TIMA 4ZVJA 2A2IA 3LERA 3VCRA 1TTJA 3NQVA 1UUOA 1WBJA 2V8ZA 3B0VC 4WY0A 5BNKA 2A5HA 1TV5A 4YCPA 3PF3A 3GXNA 3TFCA 3IGSA 3M47A 1YDNA 5H2ZA 1JJKA 3LHZA 1YYAA 3LXCA 3LBCA 1JCXA 2PE4A 1DJQA 3FKKA 3EXSA 3IIOA 4M7TA 4TX9A 3LRLA 3NO5A 4OV9A 3P84A 2G97A 1G6CA 5CZJA 3N9SA 1MZHA 3GB6A 1Q6OA 4JYEA 3S1WA 3HF3A 2PC4A 2ZRXA 4XWUA 3LX9A 2EKCA 2TMDA 4FX6M 5ABTA 3B05A 1RV8A 2H90A 1TRDA 5DLCA 5HULA 3QZEA 4YXGA 3HG4A 3HG3A 1UJPA 1A50A 3KVJA 1H7PA 3W1PA 2WNQA 2V0TA 3JRKA 4JR5A 5AC8A 2E77A 5L9FA 5D32A 2ATSA 1LP6A 1M6JA 2YYUA 3PR2A 3O06A 4UTIA 1SO4A 1F76A 1H7OA 2XN2A 2RHGA 5F2MA 2WKJA 3M1ZA 5G2HA 1MEHA 4EIVA 1LBLA 1VR6A 2X2GA 1WQ5A 1PL9A 1KLZA 3A5VA 4XKYA 5FF3A 2VEPA 1XBZA 3VE9A 3W7LA 2F84A 1QNVA 1R30A 1XL9A 4ORIA 5FEXA 1WXJA 3LHUA 5D2TA 4DBDA 3L0KA 3W88A 3VNDA 4OHQA 3LV6A 3L68A 4WXZA 2OX1A 4O8RA 3USBA 1MEWA 2Q8ZA 2ZA1A 2V81A 1VRDA 4FNUA 3BG3A 3THAA 1ZNNA 4J9JA 1SFJA 4QIUA 1D3HA 4M19A 3TK7A 1G67A 5HR6A 3M6YA 4JYFA 4LS2A 3FYPA 4O4WA 2X1SA 3ZWTA 3C2FA 1HFBA 2RDWA 5DY3A 4WY0B 1EX5A 4JX5A 3UWUA 1LRNA 3QM3A 4Y6GA 4QISA 1T96A 5F4XA 4PC8A 1XBXA 2QF7A 4JN6A 3LCXA 2VKZG 1ZENA 2NX1A 3O15A 4AVFA 1CI1A 4I7UA 5D37A 4C1KA 4MFEA 5AYXA 2UV8G 2TRSA 5HQEA 2E68A 1KFLA 1K8ZA 4TU1A 5AHFA 1QOPA 3W7GA 3N3MA 4D2JA 4FF7A 2X16A 4JTUA 1U83A 5AHNA 1PHQA 1H7NA 4MY9A 2BXVA 3KX6A 4S1FA 4CCEA 3N2XA 4YL2A 2QUUA 1FCQA 4UXDA 3L5LA 4IOTA 2VEMA 3JS3A 1BKSA 5CPNA 1EUNA 1B3OA 4JNMA 2ZRZA 4DF2A 3NQMA 1I2PA 2TPSA 2EF9A 4BWLA 1I2NA 1ADOA 1LTDA 4W9TA 4CNPA 1TPB1 1NFBA 3TNOA 1TPC1 3HG2A 3L67A 2H8XA 1ME9A 1C29A 3GKAA 1OFBA 4LUJA 4UIOA 1BEUA 1ZAHA 3GNNA 3SIZA 3DFNA 1HO4A 4POCA 2QJHA 4NNCA 5CPLA 3BPWA 3QPYA 5IBXC 3O6DA 4MLRA 1HUVA 1YLVA 4FXSA 4K36A 4EOUA 5AHEA 2CLLA 4WUIA 3UD6A 2ALDA 4WD0A 4MFDA 1YDVA 3F4NA 3S5YA 1G7VA 1S5WA 1THFD 4AHOA 1FUYA 1NSJA 1RPXA 5KSWA 3O16A 3NYZA 3GAKA 2NWSA 3HB9A 4A21A 1HO1A 1TTPA 4CLMA 4HNVA 2Y6ZA 3HGOA 4HSNA 3DFSA 3SGUA 3CQ0A 2P1FA 4RXFA 4UMCA 1DQWA 2CLEA 4FNSA 4CQAA 1VGAA 1KM3A 1MSSA 2DZUA 3TJXA 1OHLA 4PA8A 2F7FA 4IUOA 4BI6A 1W3IA 1JR1A 2D73A 3ZR4A 1ZJIA 3M16A 3O1NA 4JTJA 3WJYA 1RQHA 1PCKA 3L9CA 5CSRA 3RNDA 2RDTA 3GDRA 4Z1BA 1JRCA 3HG5A 3GR7A 4O1AA 1VYSX 5J5DA 1SQ7A 3EX4A 1QWGA 2C6QA 5D30A 5HNRA 4UFIA 4QQ3A 5I3KA 3PVFA 4JX6A 1LBFA 3ATZA 1KM1A 2YYTA 3IRDA 4N9DA 3S42A 4IPIA 4IPJA 3G1SA 2OCZA 1DJNA 3QQ1A 1G4PA 4GWEA 3FJLA 3TC6A 4FX7A 1KLYA 1D9EA 3BK0A 3DFQA 3QF0A 4FO4A 2NUYA 1DQXA 1K8YA 2R8WA 1GYLA 1H5YA 4U4MA 3RK8A 1XUUA 2GPTA 4MJMA 1YTKA 3L21A 1YXYA 2X30A 2P0OA 3G18A 3HOJA 5DBTA 2HTMA 2Y7EA 3LTYA 3YPIA 2A1YA 4UUIA 1DBTA 1HL2A 5DCDA 4JTLA 4NT0A 2WQPA 1W0MA 4O19A 4UFJA 2I9EA 3V75A 3E0IA 3ABOA 4AEOA 1KM4A 3EKLA 5FEPA 1GTEA 1MO0A 1H50A 2A7NA 4K8EA 3TSDA 2ZZ6A 4O0ZA 2R14A 2Y7DA 3W2JA 1MXSA 3EB2A 3KFTA 3L5AA 4NUWA 3TROA 3ZFHA 3IVTA 1OK4A 3CTLA 3TMLA 3HPXA 4RX0A 1A53A 3IEBA 2YFNA 4IXHA 3WK0A 2YZRA 3W7PA 5I3IA 1WOAA 1FDJA 3NQ7A 2Z2UA 4YWIA 4LRSA 4RLIA 1TREA 1UASA 1O95A 4NNAA 2V30A 4XZ9A 4O18A 2J9ZA 2GVLA 3W85A 3S9YA 3GR8A 4DO5A 3TV8A 3B04A 3PUEA 3DKLA 2YPIA 4TR9A 1DHPA 1FCBA 5HINA 3TQVA 1G7UA 3TXVA 3GZ3A 3SECA 2NV1A 3W76A 5LGXA 4NX5A 3KVMA 4JDYA 4JY8A 1G4SA 2EPHA 3EWBX 5BMXA 3FS2A 1LRQA 2E09A 4HT3A 2Y85A 3W7NA 2NZLA 5K7JA 1T99A 5DBUA 1OFPA 3C56A 5KMYA 1KBJA 1TPWA 3LHYA 1OYAA 1OFQA 3TKFA 3LCLA 5DY2A 1ZAJA 3UWQA 5F2GA 5KZEA 3W75A 5KINA 4GUJA 2B0MA 3OA3A 3QW3A 2J9YA 3HJZA 3W1AA 2V2DA 5HUPA 3E96A 4ADTA 4UTTC 3OVRA 3RU6A 3W6YA 3TJLA 5EBUA 5LNSA 3DFOA 3TA6A 4DO6A 1TYGA 3TE9A 2XN1A 2YR1A 3IGUA 1GVSA 2WOQA 4BF9A 3FYOA 3VKJA 3PSVA 1FQ0A 3GLCA 2NX9A 3OBKA 1A5AA 1SPQA 5AHLA 1L6YA 2EAWA 4MYXA 3PSWA 1W31A 3W84A 3W1QA 1K7EA 4A2SA 4ZQMA 2A7RA 1OYCA 4NU7A 5D04C 1I2OA 3ZS4A 3L65A 4FNTA 2GUUA 4JIQA 3D0CA 1OFAA 3IGXA 4RZ6A 6ALDA 4Y8FA 3TCEA 3EX2A 1IIGA 2H8ZA 2I14A 5C54A 3I7QA 3C2OA 5FESA 4DXVA 5CG7A 5E93A 1ALDA 1KFEA 3WJWA 3TU9A 2FPTA 5BOOA 5K9CA 3PM6A 3NA8A 3MMTA 3E49A 4AWSA 3G8EA 1W5PA 4MIMA 1SFLA 3NQ8A 2WNNA 1XBVA 5D03A 2J9XA 1KM2A 2QCHA 1J2WA 3T4CA 4BK9A 2A85A 2PCQA 4IMFA 3LV5A 1JCLA 3G1DA 1UCWA 4HPJA 4UNKA 4ZZ9A 2YFOA 4Z0JA 2PRMA 1WAUA 4QNEA 1JCYA 1AMKA 1ONRA 2H6RA 4IX0A 2DJLA 2J27A 3PAJA 3M41A 3TH6A 4N9CA 3I7SA 1YPFA 2Y62A 4Z1DA 4IMCA 2W0UA 4JTFA 3DAQA 1K02A 2Y63A 3P8IA 1ML1A 1ZHAA 2VFGA 5GVJA 1TO3A 2OMAA 4LVDA 5HUOA 3UPBA 3LHTA 3EWYA 1O5KA 4NNBA 4KFPA 3GIYA 1H7WA 3PB0A 3W7KA 5D05A 3W23A 1PE1A 2C1HA 2QCFA 3LHVA 4GFSA 4MUZA 3ANYA 5CZTA 3S5NA 1EWEA 1N55A 4M5PA 3O07A 4ICNA 3IVUA 2VC6A 3W1UA 4WX2A 3PULA 5BMWA 4X22A 3WJSA 3T78A 3LBMA 4Y90A 5EMUA 2C13A 1GVFA 5CZSA 3B8DA 1GQNA 5U7SA 1DV7A 4X9SA 4K39A 1F73A 4FNRA 2Z6JA 4GC4A 3DBPA 1B4KA 2EHHA 2ZQ0A 3N19B 5F2LA 5K3VA 1FWSA 3C8FA 3M0ZA 5DCEA 3WK3A 4FHAA 1I2RA 1DVJA 2RFGA 1TJRA 2RKXA 3THQA 1VC4A 3BV4A 3G0UA 1Q6QA 3CM4A 3W07A 3B0PA 1GOXA 3QMTA 3DI1A 1FWRA 2W6RA 3STFA 3GXTA 3NQCA 3TAOA 3EKZA 3TC7A 4DEFA 1ICSA 3W2NA 5IBXA 4TIMA 2GQ8A 2GJLA 1KTCA 2Y88A 1I4NA 3DZ1A 3OG3A 4WOQA 2ZZ4A 1AL8A 1OX6A 4CQ8A 5LSMA 2A21A 4LC8A 3LTSA 3PUDA 3C2RA 3W73A 2YSWA 3HMJG 3LCGA 1OX5A 3NEVA 4KFNA 1WYIA 3U8GA 4ZQNA 5TIMA 3CEUA 4I9AA 4LS1A 5A5WA 3W7QA 1E51A 3GAYA 2NWRA 2ZA2A 3MHUA 4GJ1A 2C14A 4JDBA 1RZMA 1PHWA 4JXCA 4JYDA 1CX9A 1TV8A 4GE8A 1JCMP 1J4EA 1Q6RA 5DXXA 3HPZA 3MO7A 1L6SA 1K03A 3L2IA 3M5XA 3KRUA 3P5YA 4UR7A 1UB3A 2XFWA 3FJ6A 4AH7A 3N2MA 4XUGA 3L5MA 1SW7A 4FXRA 4G1KA 2Y61A 4RZ4A 1JUEA 2XN0A 1A5CA 2QCEA 5KITA 1KFKA 3MI6A 3G22A 1XBYA 1TTIA 2NLIA 3KXQA 3SW6A 2FDSA 4IMGA 3TSBA 4GXMA 1WX0A 1G69A 3T55A 2YW3A 4JIPA 3G3MA 3R89A 3UXAA 3NPWA 3LXBA 1FDYA 3HBLA 3CEPA 2O7QA 1LCOA 3BARA 1G4EA 4Y96A 5MHBA 1K7XA 3WFAA 3W1XA 4R53A 1F05A 4EWND 5BW6A 3C61A 2ZYFA 4JS3A 4EVZA 3LB0A 1X8FA 3S0CA 2FPVA 2YW4A 1WA3A 4O0KA 3GK0A 3CU2A 3W3OA 3A21A 1W5MA 5BRBA 4R33A 5K9DA 1AW1A 1IXOA 2B4GA 2V5BA 1GPWA 1Z48A 4GNJA 2CU0A 1H7RA 3UWYA 8TIMA 1H60A 5E0KA 5I3JA 3ZWSA 1QR7A 1FBAA 1W37A 2FIQA 3PS7A 1O60A 1G4TA 3HGRA 1LLWA 2Z1BA 1DKWA 3MJYA 3PC0A 4NJIA 4RV8A 2QCCA 3LRMA 4NJGA 4N4QA 3M5YA 3NZRA 3B0UX 2CLMA 2QDGA 2C0AA 4LU0A 4L4MA 4CCDA 3HGJA 1SO3A 2A6LA 1GG0A 2CZDA 3EEGA 1Q45A 1SW3A 3W74A 3BVJA 2DZVA 4ZQOA 1P0NA 2DP3A 4LTSA 5DXYA 1TRIA 3CWNA 4S2CA 3W7CA 5EPDA 4JY9A 4XKYB 4MPQA 2TSYA 2OZ0A 5HWJA 5HR7A 3DFTA 1TCDA 2E5BA 2H3DA 5D2YA 1SO5A 4X3ZA 3QYQA 3W72A 1VYRA 4QM1A 3W7EA 3TQKA 4DF1A 3A5FA 5F1VA 1IGSA 1GYNA 3UY8A 1DORA 4NX0A 5FF2A 4Z1AA 3T40A 1VZWA 3VE7A 1RR2A 3ELFA 4DBEA 1R2SA 4AXKA 3LGEA 4A3UA 4FIQA 4PCFA 5HMSA 1WOBA 3WJXA 4ZQPA 1S3HA 5AOUA 4Z08A 3F03K 1W54A 3MP4A 1GVRA 2WNZA 2ZZ3A 1T0OA 4LUIA 3V1PA 3IIVA 1QPOA 2ZBTA 5AB3A 3C3NA 4MVAA 3W7RA 4IWWA 2FPYA 2NX3A 2CZFA 3M44A 1TPFA 2VENA 3IVSA 3S1XA 2VFEA 1VJIA 4EF9A 1AW5A 1SZGA 1Q3NA 4NZJA 4JICA 2E6YA 1H63A 3NL5A 1F6PA 3TSMA 1O94A 1Z41A 4AWTA 4TMCA 1QPNA 2DZPA 2ZA3A 1XDLA 3KRSA 4LVBA 3HGSA 2VEKA 1Q6LA 5DCBA 1TQXA 4YMZA 5C5YA 3CIXA 4WOZA 3MP3A 4M7SA 4XQ6A 4JTGA 4PEKA 5F1UA 4YLWA 4XTIA 2ZTKA 3EX1A 1OVDA 3LLFA 1LROA 3VI2A 3WK2A 4LWWA 1FY6A 1JRBA 4YCOA 4LV9A 5EA9A 1W8SA 4LRTA 1KV8A 3TIMA 4X2RA 3DENA 2RDUA 2HS6A 2JBMA 3GDMA 2NUXA 3R12A 1VHNA 3M7WA 1IXPA 3P61A 5DELA 2LLEA 3NR0A 4O17A 1SZNA 1WV2A 3GYEA 2JGQA 5LHEA 4NZFA 4UTHA 4UC5A 4LW7A
chains in the Genus database with same CATH superfamily
1X6NA 1EXPA 1IF2A 3DHPA 2O7SA 4OTKA 3S9ZA 1KTNA 3BG5A 4RXGA 2GQAA 1PYFA 3MPGA 1FHVA 3W7HA 1JUKA 1FXPA 3UJFA 5CKSA 2V6AA 1UMYA 5BXPA 3IIXA 1S39A 1A5NC 1VH7A 1ZFJA 1E55A 3VK5A 3EAUA 1VPYA 2Q3RA 6REQA 2WC4A 3ABXA 4UQCA 1V0KA 4GGHA 3J7HA 1FKWA 3IRSA 3UP8A 1M68A 1RD5A 2VX4A 5FF7A 1G9HA 2G3JA 1OQFA 5GJMA 2NQLA 3FXGA 1AUSL 2C1GA 4DUOA 5IM51 5BXTA 3C6CA 4ZXLA 1P48A 1QTWA 3VGFA 2PWDA 3TAKA 2QF8A 4H9YA 2ZIDA 2DVXA 3RUBL 1JFXA 1BHGA 3E0LA 4AIUA 8CGTA 2W3ZA 3T0CA 2CLOA 4BWLC 2D1ZA 3NVTA 1ITCA 2O4QA 1PV8A 3HV9A 4LAKA 3V0UA 3T4WA 2WC7A 2XWEA 1DE6A 3C2YA 1S2CA 2WJFA 4MY1A 1N8IA 2YXXA 1PZ2A 1EGZA 1S5NA 1EBHA 1Z42A 2D0HA 3SM0A 1YRRA 2J25A 3GBEA 3NSXA 1Q5MA 3DC8A 2OVLA 6XIAA 2CLKA 2V5LA 4RNHA 1KM0A 2VD8A 3VKBA 2E4TA 2I5GA 3ITYA 4FMVA 4GI9A 1VLWA 3B03A 4FAMA 3GVWA 1XIFA 1XM3A 3QVQA 4ORMA 1E9ZB 1L6GA 4XB3A 4GUFA 2POTA 3MI3A 4JFWA 3RHGA 4DIAA 3AXIA 4IGNA 1OFEA 2BDQA 1R3QA 5FKYA 1KD0A 4Q8NA 5C2CA 3WQEA 3BO9A 3FHAA 4S2BA 2OZ3A 4QBXA 1W3KA 4XBKA 3TN5A 3UWEA 4NI3A 4RW5A 3TJ4A 1P7TA 4AX7A 1QNPA 1MRAA 4EF8A 5KZDA 1JF5A 1H62A 4AU0A 4HHMA 2J6XA 1LUCA 2FDMA 3PBGA 2WPGA 3CIWA 2FB2A 3LLDA 2QCLA 1HVQA 3Q58A 1QU4A 1UZ1A 1EP3A 3UJSA 2VFIA 1KC7A 4RKAA 4CNNA 2X05A 4H9UA 4NVTA 2X40A 1O5QA 3FJNA 3SJ3A 4G2DA 1TELA 2J7FA 3M0KA 2WSKA 3N13A 3R8GA 4REQB 4UNLA 2HVMA 4ZENA 3SAZA 5A6SA 3WD0A 5H1WA 4E0CA 4JL1A 4J4KA 4PMJA 1MW2A 5DRCA 4LNYA 3AHVA 1QVBA 1S5MA 4PUEA 4HKPA 5K4ZA 4UFKA 3UA4A 2F38A 5A2AA 4O1EA 3NDZA 4EPKA 2OT0A 4Q7BA 1OGGA 1TJ1A 2L5HA 5G2IA 5CPTA 3IGHX 3NPVA 1W1VA 4O52A 1KM5A 2ZUVA 2Q8LA 4QRNA 3QV8A 3QKZA 5EU9A 4DRSA 3NQ2A 3MHFA 4AZIA 4IISA 2ANUA 4W5UA 1F5ZA 1IEQA 1S1PA 2DH3A 1PIIA 1IEXA 1UIPA 4H8VA 1WUFA 1BAGA 3D6NA 3SUTA 3D46A 3QOMA 1UHVA 3EWUA 1M03A 4ZTXA 4FS9A 1HN1A 2YBUA 1YBQA 2TYSA 4I5RA 4XZBA 1HL9A 1V6YA 4UTKA 1D8WA 4LCQA 4O1CA 3GHUA 3PB2A 3T8QA 3U5YA 1OD0A 4ATWA 1KBKA 1HXJA 3A13A 1ME7A 1GJUA 1Q8JA 1V0NA 4KRZA 1LM1A 4C5YA 2XDFA 3WH8A 4QJ1A 4PMYA 3U2OA 1XHGA 1UBSA 3GG0A 4K2SA 1QRQA 5F4SA 5D38A 1TKKA 3NFUA 3EOEA 4HNNA 1R46A 4A05A 4Q6JA 5D8WA 3DXIA 2QAPA 3VOFA 3CV7A 1OM0A 2QPSA 2YCLB 2E6FA 5DMLA 3UNTA 3C0JA 4AHPA 3RFAA 5I3HA 1EWDA 1F8IA 1AD1A 3QZ6A 1C7SA 2ZZ1A 4CQ9A 2WZEA 1S2AA 1ICQA 4L6HA 3K1GA 2WM0A 3VGDA 1WCGA 1YKWA 4L7ZA 2GDUA 4DYJA 3W70A 3APYA 1LRTA 3I65A 3WKZA 3UQNA 5EFFA 4MNJA 4QFUA 1XYMA 3CHDA 2GGHA 3SN0A 2X1RA 4JFUA 4GIAA 2DH2A 4H6KA 4ZEPA 2FZMA 1OB0A 4IT1A 1AK5A 3CZGA 2V5KA 2GGIA 4C7FA 2HEJA 2E3ZA 3MCMA 5D2VA 4A29A 4M8UA 3UPWA 2BZNA 2QNEA 3NZQA 1HJWA 4KRTA 3QLDA 3BLFA 4WJXA 5CGMA 2OB3A 4LUSB 1VIWA 4NYUA 3H24A 3N11A 4CVWA 3V0TA 3BCJA 4M6PA 3WBAA 4ALDA 4H7VA 4E2OA 3CBWA 4D6GA 4GUGA 1EL3A 3OLEA 3PG8A 5MKGA 5E1QA 2E5DA 4A3QA 5TBOA 3TZFA 4R85A 3ARYA 2IXUA 4AYGA 4YTUA 2QUVA 1G94A 1QNQA 4BS0A 1U5HA 1EIBA 2YKKA 2CCRA 1E0TA 4H4IA 2INZA 3W02A 1V7AA 5CC5A 1E5NA 1TX2A 1U22A 2GVGA 4O4VA 3W1RA 4DYEA 1M04A 2V3FA 1Q65A 4MJ4A 3G8RA 4MB3A 4NQ1A 2QCDB 4CVUA 3BE7A 1C3FA 3R94A 4FOUA 1SUXA 1WUEA 1VFFA 2X0YA 3T0DA 1GEHA 4TO8A 4GXPA 1FXQA 3FNDA 5C0QA 4ICMA 5JVLA 2YBVA 4PUWA 3L4VA 1GVQA 2HVNA 5CC3A 1DJYA 4IL0A 3I3BA 1TPDA 2G8ZA 2BWGA 1XYZA 1HTIA 3NO3A 1LDCA 3BAIA 2DUAA 2ACQA 1LT8A 1QHOA 3U2CA 2ZX9A 2WVTA 3P60A 3TP4A 2FGBA 4N2YA 1F61A 2Z6IA 3ZZ1A 2E6DA 2WWCA 3B4UA 4R88A 5DMNA 4GQ0A 2VZVA 3R5EA 2NQZA 1QMLA 3RLGA 2VELA 2GGGA 1EX1A 5L6UA 1UR9A 3R8RA 3R0UA 1F8MA 3KHDA 3R2GA 1ZQ5A 4FI4A 1X1NA 1ADSA 2G50A 2WHKA 1W8GA 4M6VA 3SR7A 1V3LA 4QXIA 3EWXA 3G0XA 3TYEA 1JUBA 1CGTA 3SFKA 2E5CA 4DN1A 1X96A 4LFYA 1JYXA 1SR9A 3L0NA 2WMKA 3FXYA 2GJXA 3PBVA 3Q67A 5IXEA 1S2UA 3TXZA 3ZMRA 3LM7A 2DSWA 1Y5WA 2C19A 4PFHA 2B7PA 2FTWA 3LMZA 3DEQA 1RPKA 3IV3A 1MYRA 4H00A 2PDCA 2ZZ2A 5E9XA 2NUWA 3IAQA 4RDWA 3T2PA 2BGNE 3APGA 5JIPA 2QDHA 5F2IA 3VIIA 3AJXA 1W9DM 1QDSA 4IMDA 2OEMA 4C6JA 4Q32A 2ZWYA 3P7YA 4UWMA 4Y9AA 2ABAA 4AHQA 4MAZA 2R82A 4LCRA 4QE1A 4NXKA 1I6NA 4BQ3A 4GBUA 2WHMA 1B3YA 8RUCA 3C5QA 3L23A 2QEZA 4AF0A 1ODUA 3HFTA 5EMLA 1JQVA 1UD2A 3JVAA 5FSDC 2GOUA 4ES4A 2DVUA 4FIRA 1OJXA 2V2CA 3TC3A 3MWCA 5D8ZA 3UESA 3GNOA 1TPEA 4ZCWA 1SZFA 3ANVA 3URNA 1DWIM 1MNZA 4I7WA 4LY8A 4U2YA 3KS6A 3BLOA 4B2DD 1BQCA 4C6DA 1UR2A 1HKKA 1GUVA 1N8FA 3TTYA 3ARQA 4FA3A 3POCA 1BFNA 1F4AA 2QR6A 1CXLA 2G3FA 3EA3A 5LGZA 4FOJA 5I23A 2WSQA 4L1GA 1TV4A 3E5PA 4XZWA 2XVLA 3FGCB 5A94A 2Z2AA 3ICJA 3A6OA 4HU8A 2V9DA 3GU9A 1FWNA 2PA6A 4GRSA 1YXDA 3G0SA 4GYPA 1L6WA 3KM8A 3GHRA 1R2TA 3ZSTA 3GFYA 3SUSA 5CSSA 1JCJA 1UC4A 3FFSA 2ZX6A 1ISZA 4HSHA 4BFAA 5G5IA 5DN1A 3VKCA 3N25A 4L4PA 1AMYA 3TMQA 4BZYA 1JIBA 2PPGA 3OGRA 4KBXA 2WXDM 4H9VA 4E3TA 4Q4MA 3L0GA 3PWGA 4DWSA 1B3ZA 1QPRA 3QMRA 5C55A 2WB5A 3RPMA 3UZ5A 1ZY9A 1UPPA 3QW4B 5GNYA 2NXHA 4HVXA 1W9PA 3VDHA 5I0DA 1FCVA 3FSUA 2J6VA 4CU8A 1GZGA 1BRLB 5G4EA 1NVMA 3B8TA 3R7MA 2QPUA 1KKRA 1PIGA 3EPNA 2CLFA 3QZAA 2GDVA 4F0KA 3CUZA 3SY5A 2JK2A 4WR3A 5C9RA 3CAKA 3S5ZA 1M1BA 3LN3A 3UWWA 3GU1A 4JQAA 2AL2B 3G1VA 5U4NA 3QC3A 4Z42C 5B80A 2QJIA 1X7IA 3R43A 2C79A 2AGKA 1H51A 3VIMA 3GDBA 3LK6A 3MZ2A 4PTMA 1PKNA 3WELA 4FEZA 4AZBA 1J6PA 1FWWA 4GPNA 3CUJA 1IQ8A 5AYYA 2OKTA 5HQMA 1R8LA 4AXNA 1QAPA 1YPIA 3H7RA 2OELA 1PJ9A 1BTCA 2ZRUA 4FX8A 3CB8A 2A6NA 2ZXAA 2OTDA 3RN6A 1NDYA 1ISXA 1MQRA 1XKYA 4W4QA 2VWSA 3VFLA 4NY2A 3KEHA 1BG4A 4PCPA 3QHOA 1EJTC 2PBOA 1W1B1 3NQVA 1W91A 3B0VC 3PF3A 3VGHA 3TFCA 4B5VA 3OQEA 3M47A 1JJKA 1OSEA 1I75A 3LXCA 1JCXA 2PE4A 4HD5A 3EXSA 5JH1A 1UUQA 2O0TA 3LRLA 4RE4A 3P84A 4S3AA 3I4EA 5CZJA 3G6MA 1K9TA 4XWUA 3LX9A 5C9XA 4FX6M 3CV6A 2H90A 2AGTA 2PWGA 2BY0A 3WH7A 4D6FA 1VB9A 3KVJA 3CPGA 2WNQA 1F4HA 4L9XA 3KL5A 3GG7A 3AS1A 1EHAA 1M6JA 3SCVA 2XWDA 4HK6A 5CBBA 3ZOAA 4H6EA 2XN2A 1E6SM 3K46A 1QWKA 2WKJA 2X2GA 4W8AA 5FF3A 2NQJA 3AHZA 2QJMA 3OB8A 1IHIA 1R30A 3S1GA 4DBDA 4H1ZA 3L0KA 2XZ7A 5DT7A 4EPDC 3LV6A 2ALRA 1B54A 2OX1A 4MM1A 4FNUA 4QIUA 8XIAA 3THDA 3N9KA 1HJXA 1G67A 5HR6A 1CB2A 2I56A 2DSKA 2X1SA 1RAKA 2RDWA 5M3WA 4WY0B 2OOGA 4JX5A 3MSYA 1MDLA 3VZZA 3I3DA 2GFTA 3QBUA 2DV0A 2ZUSA 3IJLA 3LCXA 2E25A 1WDSA 1WZLA 2CITA 2QIIA 1V77A 4IF2A 1JAKA 3OJGA 4XSLA 5D37A 4C1KA 5HPCA 4I3GA 1JZ5A 2TRSA 2E68A 3GHSA 1TWWA 1RJPA 1BKHA 5AHFA 1GGOA 4PUKA 3ECQA 4JTUA 1U83A 5E6ZA 2VZUA 1XIDA 2BXVA 3SURA 1RP8A 5I07A 1C8XA 1TA3B 2ESCA 3JS3A 5CPNA 4J3WA 1EUNA 5REQA 3WNOA 4JNMA 4WGXA 4BHYA 2WMIA 3N15A 3UU0A 4GACA 4Y9MA 1NOUA 1I2NA 2IPFA 4GIEA 2PODA 2E67A 1YHTA 3L67A 1AA1B 3BAJA 3GKAA 3T2QA 4QJ3B 1BEUA 4ZO8A 2ACRA 3DFNA 4POCA 1MUWA 4NNCA 2IPJA 4HB7A 3BPWA 3QPYA 2C8NA 3O6DA 2VNCA 1HUVA 3PJXA 4FXSA 3VIPA 2Z1KA 3DG7A 3OGSA 2ALDA 4WD0A 3S5YA 1G7VA 4AHOA 1HF6A 1FUYA 3CZLA 1RPXA 5KSWA 3GAKA 4HNVA 2Y6ZA 4HSNA 3DFSA 3PZQA 1A3WA 1Q6FA 4CQAA 1KM3A 4ERAA 2DZUA 2WZMA 1WDPA 1XH2A 1FWIC 5EBAA 4BI6A 4GZJA 4JIHA 2R24A 3F4DA 4CUCA 3M16A 3CYJA 4PB3A 1PCKA 3FAWA 2RDTA 1DWGM 3KL0A 1TZ9A 5C2GA 4XD5A 5H8PA 3MUAA 4L64A 3VM5A 4UFIA 5HNRA 1LBFA 3ATZA 3GG8A 2QUMA 4IPJA 5A3HA 3H8AA 4FX7A 4W8BA 3DFQA 2NUYA 1H5YA 3D3FA 3RK8A 3TYDA 5JBEA 2POZA 3WNMA 1UPMB 2VC9A 2P0OA 1TZ7A 1JZ8A 1HL2A 3VKAA 1W0MA 4O19A 4UFJA 3A12A 3V75A 3E0IA 1KM4A 5FEPA 4YWSA 1H50A 4K8EA 4CEXC 4KGLA 5M2FX 1XPYA 4OZOA 2P88A 1M53A 1MXSA 3L2LA 5I09A 3EB2A 1E0UA 3ZFHA 1OK4A 2IMRA 1XP3A 2GLKA 3OW1A 3PP7A 3WK0A 1JNEA 2YCIX 1E4MM 3NQ7A 2Z2UA 4NZ3A 1PKLA 1TREA 2V67A 4NNAA 2V30A 3BLLA 1OG6A 3WL1A 2NT0A 3GR8A 3PZGA 3GXDA 3DKLA 4PTWA 3UR5A 1G7UA 1XD0A 3W76A 1G4SA 1R85A 1KXQA 3SSZA 5BMXA 3FS2A 1LRQA 3WUBA 4HT3A 1CZ1A 5LXXA 5CJ5A 3K4DA 4E4PA 4J7RA 3VM7A 3WQWA 3M0XA 3C56A 5KMYA 1KBJA 3LHYA 4YPJA 1QNSA 3T0BA 2I57A 4IQEA 5AYIA 2P76A 3NDYA 5KZEA 5F2GA 3W75A 1GVYA 3IUIA 5EMYA 3OA3A 1W1A1 3W1AA 1CCWB 4REQA 3VOGA 1IR1A 3ABZA 3OVRA 4Y8EA 5EBUA 2XIQA 2XN1A 2V68A 1UG6A 2YR1A 1GVSA 1CXKA 2V5CA 3SQLA 7PTDA 1XLIA 3MMDA 4U3AA 3I4KA 1BXBA 1PTGA 4QGCA 3W1QA 1K7EA 2V38A 4ZQMA 4XBJA 1TWZA 2A7RA 3BSGA 3REQA 1CXHA 2QXWA 1FH9A 2E9MA 1K6AA 3ZS4A 3L65A 4FNTA 3BOXA 4DXKA 3D0CA 3RPDA 1B90A 1G01A 4KEUA 4Y8FA 4OUIA 4PSPA 2I14A 1JEZA 1W2PA 1CDGA 3I7QA 2VOTA 3N29A 3MSDA 5FESA 1NDWA 2Z27A 2WVVB 4DXVA 4LBUA 3MTWA 1ALDA 4CU7A 1HVXA 3R10A 1JZ7A 3NA8A 1XLDA 4OBSA 1XG3A 1E0VA 3K8MA 2WNNA 5D03A 1E6RA 2ZXQA 3OU8A 1KM2A 1U33A 4BK9A 1KXTA 2A85A 1UOZA 1JCLA 1UCWA 4MWAD 3FHQA 1EYWA 2YCJA 4UNKA 2Z1WA 4Z0JA 1UQZA 4DB7A 1UZHA 4JHMA 4IIHA 1AMKA 3SUVA 1AJ0A 4ZE4A 1R3SA 3AYSA 3SQSA 4IX0A 4LQ1A 1YQ2A 2DJLA 2J27A 3PAJA 1LG2A 2R1LA 1YPFA 2IKHA 2ZVRA 1PX8A 3VTRA 2W0UA 4JTFA 2PDYA 4XIAA 2Y63A 5XIAA 4GMEA 2AMXA 5LA0A 4QDWA 5I5RA 3RMEA 1TO3A 1E1CB 3LHTA 1O5KA 1YMYA 4NNBA 4X0VA 3WQCA 1UR8A 1BYDA 3GIYA 3KBNA 4QROA 3CL8A 1H49A 1FA2A 3ANYA 3WLIA 3TA9A 3GC4A 2YLAA 3ONCA 4UOQA 2HK0A 3CAVA 3WLSA 4EXAA 4X22A 4MNKA 4Y90A 5EMUA 4ACYA 2C13A 4B16A 1VFMA 4O8AA 2PBGA 4GC4A 2EHHA 2ZQ0A 3W27A 4QJ4B 4BQ5A 5F2LA 1E3XA 3GW3A 4PB5A 3WK3A 3KCOA 4AIEA 1U2YA 2RFGA 2RKXA 1TMLA 1VC4A 3BV4A 3G0UA 2E0PA 3CM4A 3ZVIA 3W07A 1PAMA 3B0PA 3DI1A 2J7BA 3CYVA 3STFA 3E0FA 3CHCA 3SJNA 2WMHA 2OYLA 4Q4OA 3EKZA 4FK9A 3M07A 2GJLA 5DEZA 3DZ1A 4MKSA 1QATA 2WMJA 1AL8A 1OX6A 3CHFA 1NDVA 1ECEA 3M0MA 3C2RA 5ENLA 5JMUA 1CTNA 1R3RA 3NEVA 3ITGA 1WYIA 3H4GA 3BQ6A 4I9AA 4LS1A 3W7QA 4DJEA 3UF9A 3RDKA 1RZMA 1PHWA 4JYDA 3WQ6A 4GE8A 1J4EA 3EDFA 1FWCC 3OYXA 1WZKA 5DXXA 3N18A 3HPZA 3LNPA 1J10A 4R7WA 3A64A 3MO7A 4A8LA 1K03A 3M5XA 3KRUA 4GIRA 4UR7A 3NWRA 3ZVHB 4JIRA 1SW7A 4FXRA 4B3LA 1BWVA 1VRXA 5AVNA 4AQLA 5KITA 3ZLFA 1XBYA 4GQQA 3SW6A 2FDSA 3TSBA 4GXMA 1EQPA 2YW3A 3H2AA 4RE0A 5E0FA 3K8KA 3R89A 3M0YA 4NRRA 4C6PA 3HBLA 3AYVA 3AU6A 2QIWA 1B3XA 1HGYA 4DXXA 3JZEA 4W93A 5C9WA 1KGXA 3C61A 3I6TA 3PAOA 4PTVA 4AEFA 2ZYFA 1UR4A 3UR7A 1TJ0A 1O12A 1J0KA 1WA3A 4O0KA 4KCVA 3OBAA 3W3OA 1W5MA 5BRBA 4R33A 3HZ3A 3B8SA 1AW1A 4RW3A 2CHRA 2V5BA 1GPWA 4NP7A 3F2DA 1R9XA 2CU0A 4C6FA 1QR7A 1FBAA 1W37A 2FIQA 2X41A 2Z1BA 4RV8A 2F6UA 1XYCA 2NT1A 4Z2IA 1QASA 4F48A 1GG0A 3EEGA 1SW3A 3W74A 2J8GA 3HM7A 3W7CA 5EPDA 4ICCX 4JY9A 3HV8A 4MPQA 3KRBA 4MWAB 1SO5A 3VKDA 3TQKA 4ATLA 3SEPA 3C0LA 4ZODA 1IGSA 3DYMA 1BVNP 4HN8A 2VEGA 4RNFA 3T40A 1EJ7L 4P7QA 3WMLA 3CV2A 3LGEA 3GXMA 4LYRA 1UZDA 4JFSA 2BY2A 3AOFA 5T9BG 4M1RA 1R7OA 1QT1A 4LUIA 1UP2A 4UQDA 3V1PA 3IIVA 5C8BB 1C9WA 2FPYA 2CZFA 3WLMA 1TPFA 2VENA 3IVSA 3S1XA 2VFEA 1XX1A 1UW9A 4JICA 3AICA 3NL5A 3TSMA 1Z41A 4AWTA 4TMCA 1HP5A 1XDLA 2PWFA 5A6AA 2ZDSA 4NHVA 4US5A 3BICA 1Y7VA 2VEKA 1P6CA 5DCBA 4YHEA 3MANA 1FTXA 4IH3A 4M51A 2PCEA 4JTGA 5F1UA 4YLWA 3BMVA 2Z1SA 4GC3A 2BB0A 4E3VA 2VI0A 1LROA 4J3TA 4YCOA 3TYZA 3WLRA 4GBDA 5FD0A 4ZXOA 3WNLA 3DENA 1DXFA 2RDUA 2HS6A 1XSKA 3WO8A 3PFRA 2NUXA 2OFJA 4PMUA 2CKRA 2VCAA 1VHNA 4X9YA 2ZWZA 1U5VA 5DELA 1CLXA 5LHEA 1SZNA 1DIKA 1HKMA 1YPXA 3BZGA 4LW7A 5CQ1A 5CPSA 3OYZA 3TN3A 1QI2A 4YU1A 2D2JA 2OSYA 5ABFB 1E1FA 3KP0A 5LIXX 3NG3A 3HA1A 5EMMA 3FGCA 1K9FA 3SBFA 2VCBA 1S2VA 1IZCA 4GJJA 2YDRA 4H9TA 1OABA 3RCNA 1BLIA 3ZQ9A 2F61A 1LOSA 4MHBA 2OWCA 4Q8MA 2REQB 1H7XA 4O11A 2OU4A 3W6LA 2C15A 4OIFA 5E70A 4WF7A 4MYAA 2PRLA 1EGMA 2XVKA 3B4YA 3N12A 3VKKA 1V5XA 4TUFA 4PRTA 1D3GA 4HSOA 1R0MA 4M6UA 1OEPA 2DU2A 5HMDA 3NQAA 2V69A 4DJDA 1VBGA 4GFIA 1ZALA 3SY1A 2JALA 3DECA 1OIFA 1TE1A 4L5ZA 3DKJA 1XG4A 3FA5A 1XSIA 3ALFA 4JTIA 1M7PA 2VFFA 5CLTA 1RVKA 1JZ4A 5FF4A 4L61A 5FCZA 4JOMA 1EZWA 3GTIA 5A2BA 2RJHA 4D8LA 3LPPA 4RPPA 3I68A 5C7HA 1TPUA 2QV5A 4BR1A 4MADA 3CASA 3ARVA 4JTHA 1NFGA 3RRAA 1YE4A 2AL2A 5HNTA 4YVPA 1VFTA 1YTEA 1JCNA 1JG9A 3E1F1 1SO6A 3O6YX 4UFMA 1DIEA 4PSRA 3VD4A 1HGWA 3KBMA 4F2BA 3H54A 4GGBA 4DF0A 4IJCA 1S2TA 4UFLA 1QI5A 2YDAA 3CV1A 1OYBA 3VD5A 3WH6A 4B9ZA 2CC0A 3N3TA 1DJWA 1H5VA 3OIHA 3S6DA 1VENA 2OQLA 4UTJA 6REQB 2YGYA 1XXXA 3OLIA 1MDRA 1BYCA 1H1ZA 1DJGA 3FLUA 1V6TA 4L9ZA 1KRCC 3W22A 1VLIA 1H1YA 4QSFA 2V5DA 5I02A 3ES8A 4INFA 1XGDA 1QW9A 1R47A 1OCBA 5C2XA 4LVFA 4LEQA 3WG6A 4QSHA 3Q94A 2YIHA 5BRQA 5K4XA 2OWXA 3VIGA 4OVXA 3U4AA 3N34A 4JTEA 5EL1A 1W1PA 5J5RA 3W7MA 3W24A 2PTYA 3BAWA 3W2KA 3W25A 1MW0A 4AZHA 5CZKA 2FJUB 4JPGA 4Z2LA 2GJNA 2C16A 4BKNA 3NOEA 1Z69A 2WLYA 1B4EA 4D6EA 1K8XA 5FA5A 4RR4A 3GR4A 2PURA 1H41A 3N9RA 3S5OA 4QEEA 3INPA 1BYAA 4JTAA 4PUJA 1LQ0A 3VCCA 4ZQCA 4Y9PA 2ZCGA 2GYIA 3ZJ8A 4N42A 1I0BA 2WC3A 1PZ3A 1ONXA 3U9IA 4F66A 3D5HA 1JDCA 2GSHA 3O0FA 1F6KA 2VDHA 2VX6A 3MKCA 3SZ8A 3LZ5A 4UFHA 3H26A 3TR2A 1OFRA 3BW2A 2BG5A 1UKPA 2ZXBA 1EB3A 3NPXA 1V79A 2HDJA 1XIBA 4CD7A 3EDJA 4LV4A 3LS9A 5J04A 1J79A 1H11A 1VIZA 1P7TB 3G1FA 3F4WA 3LSCA 4CNSA 4GK8A 3AZSA 1VHCA 2DQWA 1JGIA 5I79A 4ZBCA 2CWNA 3B0XA 1CECA 3ISIX 3ZJ6A 1VAHA 1TWIA 1WPCA 2A4AA 4Y9NA 1LOLA 3NXFA 1FWAC 1K6WA 4UCFA 2VR4A 2Y7GA 4V1YA 1Q7QA 3OIXA 4UZUA 1Q66A 3UERA 2BVTA 1ZU8A 4XO7A 1E6PA 4IG2A 2IPGA 3VIFA 4IX2A 1NWRA 4FLRA 4GYPC 4QITA 1GVOA 1YDOA 1BG9A 1IGWA 3SGGA 4PBGA 2RGLA 4U2ZA 1A5BA 4LYQA 1KA9F 2KAUC 1NEYA 5D02A 4O50A 4FR1A 2OPJA 3H2FA 1TA3A 3PPCA 1M01A 5EFDA 5I6SA 3WZ0E 4HTYA 7XIMA 1E6NA 3EBVA 2NV2A 5TQLA 2BHYA 3VABA 1S1RA 1ZP3A 5D09A 5CXPA 1OBAA 3T7VA 3W9ZA 4JNYA 4XZMX 1ME8A 3MV11 4EANA 1OX4A 3KVLA 3S2CA 3GNPA 2PDWA 3QSRA 2B7QA 2JGYA 4I7VA 2Z1XA 4OBRA 5GNZA 4OQVA 2OODA 2VURA 3RCMA 3PTDA 3U4FA 3VCNA 3RILA 1VF8A 2D2GA 1X8CA 3VINA 4ZSTA 3MO4A 2ZICA 3S1VA 2Y1HA 1JZ6A 4AB4A 4S39A 1XV8A 4Q4KA 3FYYA 1Q6EA 4IXXA 1KFCA 4XAGA 4L1WA 4W7UA 1H4PA 1J5TA 3CO8A 1YBQB 2J47A 2ZDRA 2OYKA 2GSEA 3PG9A 3ITLA 1CXEA 4WY0F 3CAQA 4WZHA 3WNPA 5HPOA 3I6EA 1P5BA 4QTGA 3BLIA 1L0PA 4ACZA 3W01A 1DWAM 3TDFA 4G8TA 1W3NA 1XR2A 4MLJA 3WCZA 4LPCA 4O16A 1JPKA 4AUBA 3GRIA 1I8JA 3B9OA 3G1RA 3C0SA 4NIRA 1ZJHA 2VL4A 5FJOA 3RPTA 3H2MA 1FDZA 1O6IA 4IIFA 1XH1A 4WIWA 1AODA 1BTMA 2OQYA 2OQHA 1AVAA 2CW6A 6XIMA 3W1NA 4C1NA 2CLIA 2GWNA 3LOTA 4RUBA 1NF0A 2WYSA 2BTMA 3P8JA 4AZ6A 2W79A 3CMGA 3GHTA 3I7RA 3SRFA 1QK0A 5HDRA 2Z0IA 2PZNA 3B06A 5HA7A 3LXAA 4AFYA 4UTTA 2DZWA 1DL3A 3ME3A 1ECQA 3EDDA 3ENLA 5I3DA 3LHWA 1W5NA 3W2LA 3P80A 3VUSA 2OEJA 1C90A 5F7UA 5AC6A 4K1WA 4E8DA 1V3KA 1TTQA 4QE5A 4HMEA 5HWMA 2FQIA 1FWDC 3ZIZA 3TYCA 1XRSA 1MUMA 2VWTA 2X7VA 3HPSA 3ATYA 3BCDA 3HN3A 5XINA 3HIJA 4FLOA 2FMOA 3NURA 5DMMA 3A22A 1UWSA 4BI7A 5AECA 3VUPA 3Q37A 4JIIX 1V3HA 1LYXA 2JKEA 3MBDA 1EF3A 3MW7A 4AMCA 4QP0A 4M56A 1FWJC 5MKGB 4DJFC 3AIRA 2H9AB 1IT7A 1GKQA 3K30A 1HKIA 1D3CA 1P4CA 2ISVA 4AZGA 2FHFA 4ZOBA 3SADA 3DHFA 4JTDA 3AZRA 4GZIA 5I7GA 3GH7A 3STGA 3CZKA 3KOFA 3P0XA 4KS0A 1B3VA 1X1ZA 4ZB5A 1MEIA 3AIWA 4PL2A 4RDVA 3LCHA 3OLDA 3WMSA 4DWSD 2GOKA 2J8TA 2FFIA 3BL3A 3VDAA 1E72M 2AAMA 2EBNA 3HO8A 2CBJA 4PMZA 2RDXA 1O1HA 1VEOA 4O15A 3NL3A 1DJZA 3AS3A 4XV0A 3CC1A 4KWOA 2ZC1A 2Z2BA 1IEIA 4U31A 4A3HA 2R91A 4XX6A 3U6WA 3WUEA 3VDCA 1VBHA 2Q6ZA 3DU0A 3M0JA 5A1AA 3A4AA 2C3ZA 4DBUA 1J01A 3B40A 3B3DA 1QOQA 4MY8A 4G7FA 1Q7ZA 3M5ZA 2WV8A 1R7AA 2NLYA 4OBTA 2NVDA 4KWVA 1B5TA 3TX9A 2VQUA 2WVVA 3MUXA 3R0KA 4B15A 2QJGA 1A80A 1RSCA 3WNKA 4Q4SA 3ABRA 4A2RA 2DORA 1QO5A 2G95A 3U2ZA 4CD4A 4L4LA 3PWIA 4DHGA 1J2BA 3STPA 1GORA 3K1DA 1PO9A 4GX9A 3IJ9A 2ISSA 4XD3A 4ZMGA 4P8VA 2VCCA 1X98A 4XAYA 1IEWA 1RCQA 4MB5A 4UTLA 3W87A 3F2BA 4ML9A 5G2WA 3VMOA 2IQ0A 1HJSA 2QDDA 4RJEA 1W5OA 3PJWA 2IUZA 2P3EA 2CBUA 1KCKA 2PLMA 1I45A 3S3GA 4E2DA 4QE4A 3LCFA 3PNUA 1QCWA 1O4UA 4PFMA 4OGZA 3WNNA 3CAWA 2C1IA 4AYSA 3P3BA 1RY0A 4JIEA 4A8IA 1YNQA 2CIPA 2DUZA 4RK8A 5DT5A 1XIHA 2OJPA 5ECVA 1Y0EA 1TG7A 4PEEA 2BX7A 3S2LA 4ASTA 3PBUA 3LTPA 3W2MA 3JU2A 1H1NA 3LRKA 3AHTA 3Q4DA 4OJYA 4QEHA 2CNCA 4GQGA 4LOCA 2XIMA 2BOFX 1C8VA 4OWGA 4MWAE 1SJCA 1E3ZA 4NXSA 3DDMA 3L4XA 3O05A 3N6QA 3AO0A 3MA8A 4NZ4A 1XC4A 2PRHA 4GXWA 3H6OA 2PDKA 2VZOA 3OHIA 4QCEA 4AF0B 4WDXA 4YN5A 3UY7A 2YDQA 2EXOA 1J11A 3QN3A 3V3WA 3WD3A 4LSBA 4NJJA 4LBRA 4UBPC 4HU3A 3T0AA 4M1BA 2E9LA 1CGUA 5JIWA 5HK4A 2ON3A 1CIUA 1UD3A 4LT9A 1ONEA 4DJFD 2C18A 5CAKA 3B8WA 5AHMA 3SFWA 1QXLA 2G5WA 2VMFA 3UXDA 3OEXA 4UQBA 4PN2A 4CNOA 3COTA 4H8UA 1EFZA 2ZRVA 3OODA 3SUUA 2ZXDA 4UCGA 4ZTYA 5H8MA 2OGJA 2D0FA 1I60A 3PK7A 2J4GA 3PZ9A 3EXRA 2D23A 3C2VA 1HL8A 3VYLA 3LM3A 2DGAA 3AMLA 4P61A 2ZE3A 1GHSA 1B30A 1SGJA 4NILA 2V3EA 1QI4A 1QO2A 4S3JA 1BWKA 1EJVC 3LI0A 1K4GA 1XDMA 3NL6A 2AQVA 3GNDA 3CLMA 3VMPA 1EKOA 3OO2A 3W37A 5D9MA 5HMFA 4AVOA 3QEZA 1P1MA 4DWSB 1MFVA 1PZ0A 1WBJA 4MJ2A 2V8ZA 2DQXA 5BNKA 2A5HA 3CJPA 2HNHA 3H4XA 2XVPA 3IGSA 5H2ZA 2W61A 1JPMA 1YYAA 1HQTA 2OSWA 3FKKA 2O55A 3CL7A 2XIBA 4I9JA 2DPEA 1G6CA 3PJTA 1KRMA 3GB6A 4W88A 1Q6OA 3FW6A 2PTXA 4JYEA 2PTDA 2PC4A 2ZRXA 3VD9A 2EKCA 2TMDA 5ABTA 3V18A 1SJDA 5HULA 4YXGA 3HG4A 1B1YA 4W86A 4F79A 1H7PA 1JI2A 3G6LA 2W4XA 2YL9A 3QTGA 2W27A 2E77A 1W3LA 1V51A 2YYUA 4UTIA 5HATA 2VEFA 4EPEC 3T81A 3F7JA 2RHGA 5G2HA 4ZE5A 3KE0A 1LBLA 1VR6A 1KLZA 3AMCA 1XBZA 3VE9A 2PZ0A 1UKSA 1R9YA 2Z00A 4KETA 1QNVA 4H41A 5FEXA 5D2TA 2Z1VA 3W29A 3L68A 3F4VA 4J3ZA 2HNEA 4O8RA 2VQTA 2ZA1A 2EEXA 2MUCA 2PDGA 2QQ6A 4M19A 3TK7A 4JYFA 3N2TA 3FYPA 4NKCA 4TV6A 5DY3A 1JGMA 3UWUA 3AFBA 3UW6A 5F4XA 1MFUA 2QF7A 4JN6A 1RJRA 4KEZA 1ZENA 2NX1A 3ZO9A 2PF8A 3O15A 4UQ9A 3GUWA 1KBLA 1ZL1A 3IJQA 4GO9A 1KFLA 3N3MA 3MU7A 4GINA 4EACA 5BU9A 1W32A 4YNGA 1KCXA 2V3DA 4MY9A 1XCWA 4S1FA 5IOBA 3WD1A 5HNNA 4CCEA 2VEMA 4BQ2A 4ZFMA 1B3OA 2ZRZA 3NVDA 1YEYA 4BWLA 1RA5A 4CNPA 1TPB1 3TNOA 3AYRA 3HG2A 2H8XA 3LGDA 1ITUA 1I1XA 7TAAA 3OZYA 4HZ7A 1K70A 1MXDA 1N82A 3LBOA 5C7VA 1HO4A 2QJHA 4GZEA 2Y8UA 4A8RA 1REQA 1F3WA 3UCCA 4EOUA 5AHEA 4XO6A 4WUIA 4O1FA 1YIXA 1PX4A 2FVKA 3WF4A 3HQOA 1P0DA 2REQA 3O16A 4JHZA 2NWSA 3GNXA 3HB9A 4A21A 2DEPA 1TTPA 2G3NA 4CLMA 4DJEC 4CNUA 3SGUA 5AC5A 3AMDA 1TVPA 4H7ZA 2VRQA 2F6XA 1MSSA 1EDGA 1M41A 1RALA 3GC2A 4PA8A 2F7FA 1PWLA 1W3IA 1CEOA 4LNCA 7ODCA 4ZB0A 3ZR4A 1ZJIA 4JTJA 1XC6A 3L9CA 3LD5A 3RNDA 1OGBA 2GVYA 4Q6XA 4Z1BA 3HG5A 3GR7A 2W91A 4IPLA 3EX4A 4GNKB 2C6QA 1V8EA 5LYRA 1A49A 3KWXA 5I3KA 4D9PA 5IDIA 1TMQA 3LYEA 1KM1A 2YYTA 1UYQA 5IFPA 3ONBA 3PPHA 4WKHA 2J75A 1D9EA 1E9IA 5CG0A 3BK0A 1P0EA 5ABEA 1BPLB 2UZ9A 2R8WA 4U4MA 2DSVA 3GFZA 4JTCA 1HJUA 2GPTA 3L21A 2X30A 4C6NA 3GXIA 3BAYA 3LTYA 2Y7EA 3CH0A 2R1MA 4HPGA 2Y5SA 4NT0A 2HCVA 3UJRA 2I9EA 3EKLA 3HPFA 2A3EA 2ZZ6A 3HQPA 4O0ZA 2I16A 4LGXA 2FHCA 3L5AA 1Q4WA 4W89A 3VDGA 1XYAA 1ESWA 3TMLA 2QULA 3HPXA 4RX0A 1A53A 2YZRA 3W7PA 4W5ZA 1OT2A 1WOAA 1AH0A 2INEA 4YWIA 5A6KA 2J66A 4MTVA 1UASA 1ZJBA 4XZ9A 2J78A 3E38A 3WBYA 3RX4A 7REQA 2J9ZA 2JFEX 2SFPA 4V1XA 2XVGA 3VIOA 2YPIA 5HINA 3N2BA 1TVNA 2NV1A 3VVGA 1EPVA 5LGXA 5HXMA 2Y8KA 3KVMA 4NX5A 4JDYA 1W1YA 3BSHA 2E09A 2ZVIA 3KTSA 2J74A 1V0LA 1B3WA 1NWTA 4PMDA 4AIOA 3P14A 3SCOA 3TEVA 1OFQA 1TCMA 1V02A 5DY2A 5BWFA 5BXRA 4YTTA 4HNCA 3ZM8A 3E96A 4JQ4A 2PFHA 4MUPA 3TJLA 2Z4GA 5HBFA 5LNSA 1H0IA 3DFOA 2CPUA 4JTRA 2HISA 2R1NA 3HTWA 3RG6A 4BF9A 3NEHA 3N2CA 2BS9A 5EMJA 5ABGA 2EAWA 4MYXA 3PSWA 4ZO7A 1W31A 1EXBA 3KDOA 3KCLA 4NSBA 4P8XA 2NQ5A 2J62A 4HOZA 5EB8A 3R25A 4GG9A 3CQKA 3LMYA 4NU7A 5D04C 2XGIA 5LIKX 3UJ2A 2Y5JA 1BSIA 2GUUA 4PBEA 2OWWA 3QLLA 1OFAA 2A79A 1J0IA 1D7KA 1UP0A 5JBFA 1XQKA 3SCNA 3W26A 3IARA 4DJED 1KFEA 2WZTA 3WJWA 1NFPA 1XLFA 3CUHA 3AQUA 4OFCA 3NCOA 2Z26A 3E49A 3MUZ1 2OOFA 2BY1A 4AWSA 2UWFA 3SRKA 2PGRA 4GISA 1XBVA 1NQ6A 2J9XA 3GTFA 3NQBA 2QCHA 2PCQA 3E5BA 3G1DA 3GYCA 3H4WA 3IUHA 3W00A 3VXGA 1R87A 4QNEA 4GY0A 2XZ9A 4GVHA 2W63A 3PTMA 2GK1A 3H7UA 3URAA 1E6QM 4QLKA 3V5CA 3L2MA 4S38A 1UR3M 2E9BA 1K02A 3S6TA 4D6HA 5H6HA 3P8IA 1BGGA 2WWDA 1HZYA 3EWCA 5ECUA 5AZ0A 1ZHAA 1T41A 3UGVA 4E5TA 7A3HA 2OMAA 4LVDA 5I03A 5HUOA 3UPBA 2W92A 1ZJAA 3EWYA 2RUSA 2D20A 4IFRA 3RJYA 1OC6A 1GJWA 1K9DA 1VBUA 4MUZA 5CZTA 2PDQA 3SCSA 3S5NA 3UJEA 4IZGA 4M5PA 4ICNA 4JBRA 4WX2A 3REQB 3WJSA 4CQDA 1ZUAX 1JYNA 3DERA 1GVFA 1DV7A 4DJDC 2JF7A 5FIPA 1A47A 1F73A 2CHOA 2Z6JA 1WZAA 1FWSA 5DCEA 1EYEA 1P43A 4FHAA 1I2RA 5CSYA 3K8LA 4HZMA 4TVDA 1TJRA 1TR9A 3THQA 2Z25A 3GTHA 3N6HA 1GOXA 1FWRA 1JDAA 1S46A 2AL1A 4IPNB 1NDZA 4I9MA 1LL6A 3W2NA 5IBXA 2GQ8A 1YNPA 3VIJA 5TF0A 4CQ8A 1PSCA 2A21A 2JIEA 4C7DA 3W73A 3RR4A 3U3HA 3LCGA 4L65A 4FR6A 3U8GA 1E6XM 5IFTA 4AZCA 1XGZA 2XFFA 3GAYA 4U33A 2ZA2A 3MHUA 1BF6A 4GJ1A 3BMWA 3DOPA 4PCSA 2DZBA 1JCMP 1Q6RA 2R9RA 4W7VA 1JI1A 1L6SA 5JBDA 3L2IA 5LXEA 4IPPA 2XFWA 2G41A 3N2MA 5IDZA 4XUGA 3HURA 3MC5A 2VRJA 3IK4A 4RZ4A 1AZ2A 1M9HA 1A5CA 3VOHA 1KFKA 3FEQA 3KXQA 3T55A 4KF1A 2XH7A 5BOFA 1YW1A 4C6EA 2ODOA 3EB4A 4HHHA 3LXBA 4US5D 5JQ9A 1J96A 3VNLA 2O7QA 4R5EA 2XIOA 2HQAA 4QCFA 2I17A 1F05A 1DJIA 3DX5A 2PDXA 1DXEA 3KOWA 5DQPA 4JS3A 4EVZA 2VUYA 3S0CA 2YW4A 3GY1A 1MVYA 2XH4A 3CU2A 1UJQA 1I9CB 3BURA 5K9DA 4J1OA 2O9TA 1QPKA 4HA1A 4EE9A 2B4GA 6TAAA 3BZJA 1Z48A 3LQLA 4IICA 3UWYA 1H7RA 1ODZA 2EPNA 1XCXA 1UA3A 4TV5A 3MJYA 1DKWA 3DIPA 2BVWA 2YA2A 2VM8A 1J8VA 1AD4A 2BBFA 3M5YA 1JPIA 1XIIA 4IIDA 4NZ1A 4RDZA 3OGVA 2AMGA 1SMAA 3HGJA 1EZ2A 1AQ0A 2CZDA 2H9AA 4ZQOA 2DP3A 1FH7A 4LTSA 3NSNA 1TRIA 5DXYA 1E71M 2TSYA 4IUGA 5HWJA 1Q7MA 1TCDA 1MUCA 2E5BA 5D2YA 5A8MA 1Q2RA 3W72A 4L1XA 3W7EA 3A5FA 4X60A 3WLTA 1DORA 1TZZA 1W3HA 3B8UA 2R6OA 2O92A 3XISA 2BMBA 3IK2A 4FIQA 4PCFA 5HMSA 2GSJA 4DJDD 3VU2A 2ZZ3A 1T0OA 3W6MA 1E56A 1XYBA 3LG3A 5AB3A 3C3NA 2BP1A 2WSPA 4HOWA 1RUSA 4WSJA 1PWMA 4PCNA 5M17A 1AW5A 4DAFA 1SZGA 4NZJA 1KCLA 1H63A 4Q8OA 1F6PA 1RLDA 1GOKA 2ZA3A 3KRSA 2HBXA 3HGSA 3MDWA 1Q6LA 2HWGA 1EDQA 1QHZA 4PUDA 4QS5A 5C5YA 2HVOA 4WOZA 3MP3A 2PGWA 3LPFA 4DO7A 4D6JA 3ARWA 2ZTKA 1EBGA 3EX1A 3LA4A 1ISWA 3GFXA 1JRBA 2V63A 3TTSA 2XYLA 5EA9A 1SJBA 4IP7A 1W8SA 4LRTA 1B31A 3GBDA 2FGZA 5D9NA 3P61A 3WQ8A 3GYEA 1WV2A 2E28A 4NZFA 3TOPA 4WEVX 1XLEA 2R1PA 4EAYA 4AEEA 2QCMA 2A3HA 1XPGA 3ZYZA 5KZMA 4GYFA 3RM9A 3H7VA 4LVGA 4E4UA 4JQ3A 4NJKA 3RYSA 5J8LA 2NXIA 3IIZA 2D0GA 3TW6A 2AAAA 1IT0A 4XBSA 3DBNA 1QNRA 2WJZA 1EH9A 4Y9OA 3W82A 5LNRA 3WEZA 3GVGA 4DPQA 2ONEA 2QVHA 1OFDA 1GKRA 3WSUA 5A8GA 2HE8A 5FJPA 1EIXA 1SYTA 4K8HA 2NQHA 3FKRA 1ZBKA 1KFBA 3L4UA 3OA5A 3ABSA 3EDKA 1Q6CA 1UP3A 4NL1A 3ARXA 4HCLA 3OZOA 3P74A 3QH2A 4N0RA 2ZADA 4XZHA 2Q3OA 4A22A 3LPGA 3PZIA 5LHFA 1GW1A 4GVIA 4JTQA 3IANA 3EPOA 4DUVA 3L66A 3KUMA 1W6TA 4PODA 4A4AA 4NAFA 1RXOB 2FKPA 1HJQA 2B31A 4PL1A 1EA0A 3ZLHA 4HMNA 4B91A 3O7UA 4UTUA 4N02A 4EP8C 4GI8A 1XLKA 1S5TA 1T8QA 5E0CA 2XFRA 3P82A 4ZGYA 1JD9A 1IT8A 3G77A 5HANA 3UEQA 1CXFA 1B9BA 3B9DA 3KL3A 3PUOA 1PDZA 3V0SA 4HP5A 2CETA 3UETA 4K68A 3KLLA 3E2QA 1EDTA 1K4HA 1BF2A 2DZAA 2JKAA 2QW5A 4ZB2A 3DYOA 5G4WA 3WYZA 1V3MA 4AVNA 3AWOA 3O8AA 2WMFA 2DZSA 1N8WA 4C90A 1UD5A 2YB4A 3WF1A 1KR1A 2V2HA 3DGBA 3W1MA 4QS6A 2BLEA 4DWDA 2DSZA 3WF3A 2PTWA 1ADDA 5TNVA 3RRXA 4LUTB 1BVZA 4K8GA 3FN9A 1FWHC 3G3DA 3UG8A 2WSRA 2CZ5A 4DAIA 1IXQA 1R3YA 2EQDA 2PLCA 3TTOA 3WQGA 4A3YA 3FDGA 2YXOA 4A8NA 5I78A 3CHEA 3KLKA 7CGTA 3G2GA 4IMEA 3M0LA 2FFCA 1UKTA 3P62A 3W7DA 1O68A 1F3EA 1R38A 2BFGA 2Q09A 1VJZA 3C52A 3LPOA 1ENUA 4GCAA 4O13A 4KWUA 1F07A 1K7FA 2X0HA 2YX0A 4H2CA 5KTLA 5XIMA 3RM8A 4IP4A 4KH2A 3QYSA 2J7DA 1NIUA 3H2CA 5D33A 1XW8A 4MDOA 1ZTVA 4FXFA 3S6OA 2BSLA 2J7EA 1ZCOA 2BHUA 4DI8A 1NOWA 2EGZA 4J2PA 1DOSA 3NDOA 5BRPA 1M7XA 4ZL1A 1WBHA 2G96A 3UZYA 3ALGA 3STCA 1SFTA 1R2RA 4N9BA 1OD8A 4L56A 4ZO6A 2OGYA 4C6BA 3DFPA 4HTBA 3ZXWA 4FPSA 3GIPA 5FSEC 1W1IE 1XLAA 3L4WA 3S8HA 3KBJA 2VR2A 2Y89A 2QKFA 2Y70A 4MJZA 3S2JA 5CZ0A 4Q4PA 4FP1A 1U5JA 3H55A 3VO0A 4GUIA 3CWOX 2WSYA 2HS8A 4NF7A 3T9PA 2J24A 4CN6A 4LBSA 3PPFA 3F5KA 1ZGDA 2WMGA 2ZUWA 1XLHA 1XJBA 1XLJA 4WXYA 4J5NA 2DZTA 1ITQA 2X8RA 1D2KA 4V27A 4PMNA 1ELSA 1TUFA 3UZWA 3EWZA 5G1YA 2PGEA 3GDTA 1B0IA 2VZTA 1GQJA 1MWOA 2QV4A 4R7JA 4DELA 2FYMA 4CCCA 1GQIA 3NXLA 3S46A 2YL8A 3FK4A 3H53A 4WDTA 1TUXA 4MZYA 5CPOA 1E0WA 3S4TA 1N7KA 1POKA 1DJHA 3BAKA 3ZT7A 1AQMA 1QPQA 4G56A 3M9YA 4QR6A 4HPXA 4YS1A 2OXNA 3FDKA 2PDMA 3E74A 4N9EA 3H23A 5FJRA 1WKDA 3BGGA 3O63A 3QR0A 1C91A 2X1UA 3ABQA 1XINA 3WJZA 1RBOB 4LCSA 1TSIA 3QHMA 3EWDA 4K38A 3AIUA 1L2UA 3EPMA 4I90A 3H70A 3S1UA 3CT7A 3NUKA 4GNVA 2O9RA 5KEZA 4EAMA 1UBPC 3MB9A 1TWSA 4W8LA 4ECLA 2OLHA 3CLWA 4W87A 4JTTA 3S9IA 4GHRA 4IQDA 1A0CA 2YCEA 4IG2B 3Q2DA 5GJPA 3UGRA 2OT1A 4FXJA 3RF9A 3MWAA 2PC8A 2P10A 2VZSA 3IIPA 3LSBA 4S3DA 3NIYA 1EGVA 2IQDA 1TV2A 3KVKA 2ZTJA 5AYZA 1VCVA 4EXBA 4XSMA 5D9OA 3GQYA 2XIIA 3OHMB 1GWJA 2J13A 1SZEA 1NWUA 5DX7A 4HMCA 4AWUA 1VBJA 1F2JA 3A24A 5A6LA 1OX4B 5D2XA 3TQ0A 3PPGA 2VFDA 2FZBA 4WLCA 1XUZA 3GW0A 1W56A 3W86A 1YDYA 2VC7A 3R8HA 1H61A 1GEQA 4PMXA 2PF0A 5HJLA 3WDQA 2XIJA 4HU0A 4LY4A 1WKYA 4C6OA 1E40A 4CQBA 3B8IA 3MUIA 1RA0A 1RD6A 3WLKX 3Q45A 1E15A 2VEIA 1GTHA 2ACSA 4IL2A 2D3LA 3W7IA 3LU2A 4PH6A 1E4LA 1FHLA 5A2CA 3WK1A 4JTSA 1I2QA 1CW2A 1EUAA 3EOSA 3EMCA 3E12A 4HZ8A 5HQLA 3KTCA 4ACZB 3RITA 2R1KA 3GH4A 3LQGA 3KOZA 2Q71A 4QAIA 1DIOA 4ZOEA 3QGAC 2WBKA 4N4PA 4QX4A 3OPSA 3DH7A 3WDPP 3MUY1 1EJWC 4ONVA 3OOQA 3G1HA 2ABBA 4WSKA 2DUXA 3GIQA 4MWAC 4OUEA 4H2HA 1CWYA 2X2YA 4JL2A 3XINA 5LNUA 5LNWA 1K8CA 3NQ6A 8A3HA 1FFRA 1H3GA 1J0ZA 1LQ2A 3SI9A 1MZRA 2F9RA 4WGHA 1RQEA 1JYVA 4JD4A 1OC7A 1QFEA 3O6CA 3SN4A 4C1NB 4C6KA 3RX3A 4M82A 2D3NA 2Q02A 2BNJA 5AFDA 4PCTA 1QUMA 1OG0A 3L7RA 5DF0A 3TLQA 1KO0A 3NJ3A 2E1DA 3PZUA 1KV5A 2MNRA 4PRWA 1M5WA 2V5JA 3MP5A 2Y24A 3VGEA 1PYMA 5EKYA 3ORWA 2QDEA 4R34A 1P0KA 4AAJA 3B0YA 3PBMA 1KXVA 4J3UA 2Y5EA 3MUCA 1U1HA 1KKOA 3NM1A 2EG8A 1T6MA 4HOXA 4UMAA 2HE5A 5EMKA 3QFEA 5CAHA 3GO2A 4ADSA 3NQGA 3ZT6A 4AC7C 4K6AA 4HMDA 4F0HA 3NQEA 3M0HA 1VEPA 2WNWA 1GK8A 1BVWA 4RZ5A 3WEMA 2W5FA 2DT1A 2XISA 1OF6A 4JGDA 3HQ1A 2VDIA 3UXKA 1BD0A 2WJDA 1Y5VA 3SGZA 3QMSA 5BZAA 1W5QA 4K7YA 1RHCA 1AW2A 5HWNA 3BLEA 1JVNA 1T8XA 4NZ5A 1FRBA 1POJA 1CGWA 3BOLA 1UIOA 2DJXA 2VGBA 3T6CA 3CWHA 3SB0A 4O1DA 4H04A 1UD6A 3UT0A 1K3UA 4PULA 1UH2A 1WDWA 1KFJA 1Q8AA 1V7YA 4LF2A 4EWJA 1VCGA 4XK2A 4KQNA 3N6JA 1SSGA 5LA1A 4JCMA 1VFUA 3CUGA 1M3UA 4S3CA 3AYTA 3BMXA 1XI3A 1SW0A 4E4FA 1J0HA 4GH3A 5CSUA 4UTWA 1B2YA 1OY0A 1CGYA 1J12A 3MJMA 4TTGA 2PDUA 3GDLA 4A6GA 3D47A 1OZMA 2FH8A 4WQ6A 2PDIA 3WLPA 3MSGA 3N14A 2QZRA 1KWGA 5T8GA 3K5XA 2QT3A 3A23A 3PBYA 3LZ3A 5A8QA 3NQFA 4HK7A 4L80A 4C6LA 3TWBA 4XZLX 2WPBA 5LIYX 4D8ZA 3TW7A 5A95A 1SR0A 2BOEX 3EKGA 3DHDA 5PTDA 3NM3A 1S38A 4CEUC 4US6A 1FFQA 4GUHA 4IP5A 2NSOA 2QUTA 3QQ0A 1MW1A 1R86A 3MT1A 2I5QA 3OTRA 4IFKB 4OT7A 5CH9A 1RQBA 2WQDA 3JR2A 3PANA 4HNUA 4UQEA 1DQUA 3GVRA 1YXCA 2YXGA 3LCIA 3BG9A 3I6RA 4LALA 3BAXA 1MRQA 3NO1A 3DN5A 2PWUA 2QAFA 1OCQA 4ILSA 5HJXA 2GDQA 3V5FA 1TE6A 3VD3A 1QJWA 1XQLA 4NRSA 1A5MC 2IW0A 4LB4A 4Q33A 3RLVA 1EEPA 1KCZA 2HPMA 1PTDA 3UZJA 5G1MA 2FB3A 4O12A 4N6FA 4EPBC 5CPMA 3L4TA 5T9CE 1XD1A 4F0RA 2AKMA 2HMCA 3PTKA 5T26A 1KM6A 2FTPA 1V03A 3A4XA 1XCFA 2CXGA 1DYSA 2CKSA 1UROA 3IJ6A 1RK6A 4IQLA 1UWAA 3SQMA 5FOOA 1W3TA 3LUTA 2V82A 5FI8A 5AHIA 2WCAA 3CB3A 1ZAIA 4ZVJA 3LERA 3TN6A 4AD3A 3VCRA 1GQKA 1TTJA 1UUOA 3U57A 4YCPA 3GXNA 3CGTA 2VGGA 3FVMA 4C6CA 2DIJA 4U5KA 3LHZA 4O0QA 3LBCA 1JFHA 1DJQA 2OG9A 2QYGA 3K4AA 3AIEA 3N9SA 2PDHA 1JAEA 3HF3A 4F9JA 1A3XA 4QJ5B 2I9UA 2FZNA 3PUGA 3B05A 4NI8A 3R4IA 1TRDA 3SCTA 2EJ1A 4RDYA 4AD1A 5DLCA 3QZEA 2EPLX 5A8PA 1UJPA 2IKJA 3QY7A 1RBAA 3W1PA 2V0TA 4V28A 1KGWA 5AC8A 5L9FA 3PR2A 1SO4A 4GVFA 4AY7A 4AD5A 5E6YA 4DM1A 2J7GA 1MEHA 4EIVA 3EOLA 2O56A 1PL9A 3VD7A 4PMRA 1D8CA 2A3CA 2VEPA 4WHBA 3W7LA 2XINA 3C0QA 4ORIA 3LHUA 4H19A 2WCSA 3W88A 3VNDA 4OECA 4WXZA