2QCFA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain (asp312asn mutant) of human ump synthase bound to 5-fluoro-ump
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFENRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase (UMP synthase)
total genus 101
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcfA00
4DO6A 4MLRA 2CW6A 4DF2A 3NXFA 3FJ6A 1MO0A 3HO8A 4EVZA 3HGOA 3G1DA 3W7NA 3O16A 2Y7FA 5FF0A 4Y96A 2JBMA 1O60A 3OEXA 3KRSA 3KAOA 4Z1AA 5LGZA 1AMKA 2ZRUA 3A21A 1O4UA 4FHAA 3TAOA 2NV1A 1FXPA 1R46A 1ZFJA 5EL1A 2FB2A 4I9AA 4CLMA 3GNDA 2DJLA 3U2OA 1XC4A 3LV5A 4IPJA 4PC8A 2QJGA 4A2SA 3KVLA 3FEMA 1IF2A 1RQEA 2YGYA 4MKNA 1KM0A 3FJLA 3C4UA 2EPHA 2DZPA 2E1DA 2R91A 3C3NA 1XDLA 2YPIA 1JUKA 2YX0A 3PULA 3SSJA 3W2LA 1PHQA 3NGJA 2PRMA 2VFHA 2NLIA 2ZCGA 3ATYA 3NEVA 4Y6GA 5I3FA 3EB2A 4HNTA 2E6DA 1KW1A 3DFQA 4LOCA 1TPFA 3LXBA 3UWVA 1TREA 4GFSA 3HG4A 1HFBA 4K7VA 1VHNA 1X8FA 3W1TA 4DEFA 2F84A 4LUIA 4WOZA 5D02A 2BSLA 3VKJA 4JYEA 4ONVA 3T44A 3S5ZA 2FQIA 2CLHA 3NDOA 4OGZA 3LHWA 4GXMA 3O15A 3PG9A 4K37A 3TC6A 2X2GA 3MYOA 3NYZA 3S1XA 3W1LA 4BI5A 2Y89A 1H7OA 4JXCA 5HR7A 1K8YA 2OJPA 3N14A 2CLIA 3L2IA 4IXHA 5G4EA 5K9DA 1OF8A 1XBVA 1DJQA 4GUHA 4Z1BA 5BOOA 1QOQA 3NQGA 3P81A 5K9CA 1QAPA 1AW1A 3S42A 1GG1A 3QC3A 1TRDA 4JIPA 1TYGA 4LS1A 4HIBA 3P8JA 2B0MA 2X16A 4ALDA 2GVLA 3UY8A 3H54A 4RZ4A 2GPTA 2V2HA 1L6YA 1M7PA 1ME8A 1S5TA 2O7SA 4UFJA 5AFDA 3W9ZA 2YYTA 4POCA 1GWJA 3EWYA 3W87A 4O1CA 4N4PA 3W2KA 2QUUA 1LZOA 3HF3A 5G2HA 1OX6A 3LHUA 4LV4A 3ZS4A 3E12A 4E2DA 3GDLA 2FDSA 4JICA 1LRQA 2CLMA 3M16A 1F74A 2O7QA 3U8GA 5LHEA 1LM1A 3PB0A 1SZEA 5DCBA 2G95A 1MXSA 5CG7A 1FCBA 4ZQNA 4UTTA 2A1YA 4PCFA 3UPBA 1QWGA 2AAMA 4DO4A 4WY0A 5F2GA 1J5TA 2TMDA 4HKPA 3LBMA 3FKKA 3LX9A 4MPQA 3RLVA 4I7WA 4FNPA 3Q94A 3EKZA 4MVAA 2ZA3A 5BRBA 1N7KA 4ZQCA 1OFQA 4YWIA 1KLZA 1DORA 3CM4A 3S5OA 3C2FA 2CLFA 2CZEA 3EXRA 6TIMA 2BLEA 4O50A 3U6WA 1YDNA 2AGKA 4RCXA 1ICSA 3KVMA 4TU1A 3W2MA 2QDHA 3W2UA 4HNNA 3NQDA 5CSSA 5D09A 1TV8A 3RU6A 4DF0A 1JVNA 4DPQA 4O11A 3GK0A 3FOKA 4RJEA 5DLCA 1KV5A 2DZTA 3QW4B 4LVAA 1WAUA 1L6WA 4OWGA 1XFBA 2WNZA 2QR6A 1W56A 4GUFA 4OBTA 1A5BA 1U83A 1VGAA 4IJBA 3MBFA 2Q8LA 3O8AA 2Y63A 2VOMA 2DZUA 3KVJA 1SPQA 1E51A 3G24A 4P2VA 5FEWA 5J5RA 1KFLA 1L9WA 3L0GA 3RFAA 3M5YA 3W75A 5EMUA 2ISSA 1T8XA 1JCXA 1KM2A 2NZLA 3W7EA 5D2WA 5IBXA 3C52A 4LVBA 3CWOX 3PBVA 3FLUA 5MHBA 1GT8A 1K3UA 4O12A 4FX6M 3H53A 3YPIA 3M43A 1OK6A 3BO9A 3QYQA 2B7OA 3PWAA 5EBUA 1OFRA 1UUMA 3QMRA 1KM3A 4UTIA 3AO0A 2Y88A 4O0ZA 3DGRA 1T0OA 2ZDRA 1JCMP 2J24A 4QAIA 4CCEA 2CZDA 4GC4A 2G5WA 4QM1A 4BR1A 5A8GA 1VCVA 2Z0IA 3TIMA 4O57A 1RPXA 1BKSA 4HN4A 3EWXA 3W1MA 1HG3A 5K3VA 1KFEA 4LNYA 3S1VA 3B4UA 4A29A 4M7SA 2YZRA 4NJJA 3TW6A 1YPFA 4UMCA 5AHFA 4S2CA 1EEPA 4TO8A 3UZJA 3GDKA 2JKPA 3NM3A 3B03A 3PF3A 1WV2A 3EEGA 1OFEA 3C2OA 1RD5A 5GVJA 4NQ1A 1FBAA 1R2SA 4RK8A 3W2JA 3BLEA 1P0KA 2ZZ5A 5F1UA 1WBJA 1D3GA 1KFJA 4ZMGA 4GJ1A 3OVQA 3A24A 2RKXA 3EWZA 3L0KA 3TMQA 1LORA 3C2EA 1H1YA 3G1VA 2WO5A 1F05A 3M0ZA 3G8RA 3P5ZA 3GIYA 4IWWA 4K38A 1CX9A 3CTLA 2JGQA 1UB3A 1GYLA 3WJWA 5G1TA 4JTSA 3TSDA 5D30A 4NJKA 5DCEA 3LV6A 4MY9A 1YXDA 1YTKA 3O6DA 3A5FA 4UNLA 3I68A 5D04C 2E6AA 2TRSA 1OG0A 2H90A 2ZZ4A 1IXNA 2C6QA 5HQEA 2ZRXA 4JYDA 3LHZA 3NZ1A 4EF8A 4X22A 3W7DA 1SSGA 2HSAA 3GXNA 3P61A 4N6EA 2YR1A 1QDSA 1Z41A 3EXTA 4KWVA 4AHPA 4UTUA 1KLYA 3T40A 3TJLA 4GE8A 1VR6A 3QQ0A 5AHLA 3W84A 1NFBA 2J9YA 1FCVA 2QCNA 1DJNA 2V5BA 1KTBA 3AJXA 1U5JA 5HULA 3DAQA 1VRDA 3L65A 3CC1A 3CEUA 4O4VA 3ZWTA 4RV8A 3DI1A 1G4PA 4Z0JA 1A5SA 3HJZA 3HPSA 5F4SA 3PSWA 5G4WA 4WUIA 1Q3NA 3GZ3A 1W0MA 3LCFA 4NUWA 5HJLA 2J9ZA 2QDGA 4UTJA 1HTIA 1K7EA 5I3GA 2BXVA 4RZ5A 2FJKA 5CSRA 2NX3A 4LRSA 5AHNA 2ZZ1A 3L5LA 1H5YA 2HS6A 5KSWA 4MLJA 2CFFA 3P80A 3TQ0A 4KKXA 4ZQPA 3MHUA 1SO3A 2P0OA 3EX6A 1X1OA 3IIPA 2QJHA 3M44A 1KV8A 4QJ1A 1LRNA 1TTJA 1A5AA 1G4EA 3NL3A 2VENA 1DV7A 4O16A 1A53A 1W37A 3F4NA 2J6XA 4HT3A 1XM3A 1VZWA 5KTLA 1M7OA 1EPXA 3STEA 2PC4A 3TK7A 4EIVA 2I9EA 4RR4A 4JTLA 3LCWA 1YXCA 2C13A 3S1UA 1BEUA 3NQ2A 1DOSA 1Y0EA 1FXQA 2B7PA 3QRHA 4LS0A 1O94A 1G7VA 1O5KA 3MHGA 4NVTA 2VEKA 5F4WA 1RQBA 3WJZA 1TJPA 2PURA 4PL1A 2WNNA 2CLKA 2F7FA 4NZFA 3LTYA 3M5XA 3ZWSA 4XUGA 3KRUA 4M6PA 1EA0A 1GOXA 3W72A 4QQ3A 5BMXA 3W7HA 1UCWA 1OFDA 1XUUA 2YW4A 2NXGA 4R7JA 3LBCA 3GX9A 1EWDA 4ZL1A 1JULA 3M5ZA 3W7LA 2E5CA 3OHIA 1W5QA 4M6VA 3JRKA 3W6YA 2DP3A 4MJZA 4XKYB 4UTWC 4FEZA 3EX4A 4BFAA 3NL6A 3S8HA 1JRBA 5F1VA 3PB2A 3QF0A 4GNJA 5D2VA 5K4ZA 2QF7A 1K7XA 5CZSA 1Z48A 4RZ6A 3F03K 1QFEA 3BG5A 1NEYA 1GTEA 1FCQA 1WQ5A 2V8ZA 4AF0B 2FB3A 2ZZ6A 1AW2A 1Q6LA 2C3ZA 5LNSA 3N3MA 3NPXA 4ML9A 3O05A 3CB8A 1NVMA 4MYXA 2QCCA 4H6KA 4JX4A 3THAA 5AYZA 1TPDA 1H1ZA 4NX5A 4UTLA 4LVGA 2TYSA 1DL3A 2G96A 1VS1A 1KFBA 1TIMA 4OHQA 3UY7A 4I7VA 1BWKA 3UD6A 3WJYA 3BARA 1KTNA 3W1RA 5C54A 2YW3A 1LLWA 1WA3A 2ZRYA 3BGJA 4RKAA 2RDUA 3TUUA 4O15A 1W3TA 1IXPA 3P62A 3P60A 4O13A 1K8XA 3G1HA 3H55A 4NJGA 2VFIA 3EX2A 3EWUA 3W1QA 3WK0A 3B0UX 1VH7A 1Q45A 5D2YA 1MSSA 2YFNA 5CZJA 3IRDA 5LNVA 1F6PA 3CHVA 2W0UA 1N8FA 1GJPA 1ZAHA 2H3DA 4MZ1A 5LSMA 1FWRA 4MY1A 2Y61A 3BW4A 4UFKA 2A6NA 3E02A 3LCGA 4AH7A 4XQ6A 1LBFA 1KM1A 1MEHA 3W23A 3W1AA 1YPIA 4O1BA 4JYFA 3SECA 2P1FA 2GQAA 1JUEA 5D38A 4JY9A 2RH9A 1SW0A 1JJKA 1W3NA 1GVSA 5D32A 1UASA 3G0XA 3IEBA 4Y9AA 1QO2A 3NQ6A 3DFSA 4AWUA 3NNTA 3W07A 1W54A 4JTJA 3IV3A 3INPA 1H7WA 1TPUA 1KBIA 5DCDA 3E9AA 3M7WA 3NQFA 3BGGA 4Z08A 2QAFA 3TAKA 1IIGA 3W73A 3A23A 4N4QA 4AAJA 2A85A 3HPZA 3P67A 3GYEA 3A5VA 4ICNA 4LRTA 3FS2A 2RDTA 1FWWA 2TSYA 4NXKA 3T78A 1D9EA 4UMBA 3GKFA 1OK4A 4BK9A 4QNEA 4HHPA 4M5PA 3F4WA 2CWNA 2XN1A 1TMHA 5D33A 3STCA 4RX0A 4ZZ9A 3Q2DA 3C8FA 4GRSA 4LT9A 3ANYA 1H7PA 3GAYA 5AHMA 2WOQA 3NQCA 5D03A 2C15A 4C1KA 2XN2A 2DU2A 4JDBA 3UXAA 3QZEA 4CCDA 1R47A 4E2BA 2NWSA 2J27A 1DKWA 3KOFA 4OT7A 4CQ8A 3CT7A 1EP1A 4P61A 2GQ8A 3IIOA 1XKYA 3GDRA 3OVRA 3QJAA 4NJIA 2VFEA 4AHOA 3I6RA 3LXAA 5AC8A 3MWAA 3LRKA 3W1XA 4JD4A 3TH6A 2FIQA 2A7RA 1I2NA 1N55A 4UFHA 3TV8A 2A2IA 3W1PA 2RFGA 4ADSA 3L68A 1YXYA 4UC5A 1JCLA 5HNRA 5ABTA 1CW2A 2JKAA 4L4MA 4Q4KA 3W76A 5AB3A 5I3HA 3M47A 3W70A 3TDFA 5EY5A 4FNSA 4ADTA 3MI2A 2XN0A 3W83A 4KFPA 1KM6A 1PIIA 1QMLA 5HWNA 4UNKA 1TQXA 3WJSA 4LC6A 4UCGA 3WK2A 3LCXA 1GVOA 4X3ZA 1VHCA 4N02A 3GXTA 4E0CA 3NPWA 1GG0A 4MIMA 1WYIA 2GUUA 4RXGA 1LBLA 1EX5A 2P10A 3CU2A 1BWLA 1D3HA 3KHJA 2I1OA 3S5NA 2FPVA 4A22A 1SUXA 2OX1A 3Q58A 3UWUA 3R8RA 1QPRA 3QW3A 1F6KA 5HWJA 4AWTA 5DBTA 3WJXA 1W5NA 4ORMA 3GB6A 3IGSA 1HO1A 2NV2A 3TFXA 3P74A 3DXIA 1L6SA 4AF0A 5FF4A 3LHVA 4Q32A 4CQ9A 5AC7A 2Z6IA 1ADOA 5C6MA 5CPNA 5E93A 1X7FA 3N9RA 4XTDA 1DQWA 4LV9A 1XBXA 3VNDA 4IMEA 4JDYA 5C2XA 3MMTA 1LOQA 3BV4A 3R12A 1GVFA 1PCKA 4WQ6A 3G18A 4MOZA 3E0IA 4O0KA 5EYWA 4NJHA 1T96A 3KRZA 1G67A 3GKAA 2ATSA 5FESA 3GLCA 3DH7A 2CLEA 1H60A 1RV8A 4EWND 5HUOA 1I2QA 4O17A 1ZALA 3L67A 1QNVA 3IGUA 2Y6ZA 1AK5A 2FTPA 2OCZA 2JK2A 4WZHA 1A5CA 2G97A 3QEZA 4UIOA 3TROA 5IM51 4Z0SA 3M1ZA 5E0KA 2V0TA 3NQEA 3NL5A 4N9EA 3W85A 3RMJA 1FDZA 3PY2A 3R5EA 2WV8A 3HG3A 3DFOA 3FA5A 3S6DA 1QPOA 4O14A 5LNRA 4KFOA 2QUTA 3UWWA 3D0CA 4DXVA 1L2UA 4NNCA 1WDWA 2OT0A 3GR8A 1WOBA 3C61A 3W74A 3GDMA 2WSYA 2PCQA 4IX0A 4WX2A 1SFLA 1EIXA 5AOUA 3ZFHA 4WD0A 3HGJA 5D37A 5G2WA 4GBUA 5E1QA 3PBUA 1VYRA 2ATMA 1IXOA 2Y7EA 3B05A 1YDOA 4JS3A 4I7UA 4IMFA 3W22A 2B7QA 3C2VA 3TJXA 2Z1BA 3MI6A 4GUIA 3R2GA 3CPRA 1H50A 4JX5A 1PCWA 5CZ0A 2IQTA 1FDJA 3PR2A 4MZ8A 4XBKA 1OJXA 3LTSA 3BW3A 1O5XA 3LLDA 4R33A 2DJXA 2VFDA 4IOTA 2E68A 4MY8A 2HTMA 5KITA 4K8EA 2X1TA 3BG3A 3OBKA 1VQTA 5FF7A 4QNWA 4XWUA 5EPDA 2A0NA 5I3KA 1P4CA 3O63A 3IIXA 1TPEA 3K30A 3EWWA 2Z6JA 4O10A 2GJNA 1F5ZA 3TE9A 5KINA 2A5HA 3L21A 4Z1CA 3N2MA 3HPXA 1IGSA 4M7TA 3MW7A 4HNVA 3QH2A 1A50A 5H2ZA 1C9DA 1FUYA 1ZJIA 1I8JA 1TV5A 4U28A 3RLUA 2VELA 1ICQA 3MYPA 3TA6A 1VJIA 1TSIA 2QKFA 5LGXA 3GVGA 4K6AA 4BWLA 3LTPA 3N73A 1JR1A 2W6RA 2EGZA 1HUVA 3TQKA 4AWSA 2NWRA 3SFKA 3NG3A 4FF7A 1ZAIA 1OVDA 5F2IA 1AL7A 1K7FA 2VFGA 2NX1A 3DFNA 3HIJA 2ZRVA 3G3MA 1V7YA 1OYBA 5DXYA 4TMBA 1SO5A 4S1FA 3TNOA 2QCDB 3DBPA 4U4MA 3TSBA 2QCMA 3T7VA 5D2XA 2J88A 4O8RA 3L5MA 4UTTC 3QSRA 4GUJA 3W1NA 4AB4A 3RK8A 4D2JA 1F73A 3W1UA 1Q6QA 1I2RA 3ATZA 2AQWA 1SW3A 3B0VC 2Y7GA 4AMAA 3LCIA 3CEPA 1VLIA 3G1AA 3IIVA 4H3DA 2V5LA 2ZRZA 4FNRA 4QISA 3NAVA 3NR0A 5LKYA 2BTMA 1OHLA 1G4TA 1PL9A 2C0AA 2QJIA 2A7NA 4AXKA 2XFWA 5DXXA 3UWYA 3QPYA 2HS8A 3QSTA 2YSWA 2QCFA 3DFPA 2EF9A 4UTMA 2V9DA 1ICPA 3SIZA 1B4KA 4AEOA 4HNUA 2RDWA 2ABAA 1FY6A 4JTEA 3NQMA 2ABBA 1TPC1 2E09A 2DZSA 5HINA 2ZA1A 2C18A 3JS3A 1GVRA 4CNOA 1HO4A 1NF0A 3VE7A 3P82A 3EXSA 1M5WA 4LUJA 5TQLA 5H91A 1V5XA 1XUZA 3LI1A 3WFAA 2C14A 4FX8A 3FFSA 3HGRA 3LHTA 3HOJA 4TMCA 4HPJA 1ZNNA 3UQNA 4JY8A 3EWBX 5FF2A 1THFD 3PS7A 4FIRA 3W71A 3QMTA 2KZHA 4IPIA 2VKZG 1EUAA 4PH6A 3IVTA 4EF9A 1K02A 5CKSA 1KFKA 4J9JA 3IGXA 3TW7A 3L66A 3NM1A 3UPWA 3FYOA 2V2DA 2NUYA 5LZLA 4FNTA 3RF9A 1LP6A 2JGYA 2A6LA 1KM5A 1DQXA 1SU5A 1H7XA 1SO6A 5EKYA 5K2ZA 3EX1A 2B4GA 3HQ1A 1OF6A 3W7RA 3TSMA 1B3OA 3PBWA 3OG3A 1IXQA 1VPXA 4YCOA 3C0JA 2CLLA 8TIMA 2ZYFA 1RR2A 1YYAA 3CIWA 3NOEA 4KWWA 1TPB1 4K7YA 2VEMA 2JKEA 2QEZA 3LM7A 1JCNA 3KVKA 1WX0A 1DBTA 4IGHA 4FNUA 1Z44A 3B06A 1IIHA 4ORIA 3UZ5A 3S0CA 3SGZA 3G0UA 1SQ7A 1PV8A 3HB9A 3W88A 3P84A 3TX9A 1YTEA 3THQA 4MYAA 4FXSA 2WQPA 4DPPA 1GTHA 1WXJA 5CPMA 1LROA 4UFMA 3G0SA 3ABRA 3LDVA 1XXXA 3IVSA 2UV8G 5G1YA 3MBDA 4O18A 1ONRA 2OT1A 4UMAA 3MP3A 1ALDA 3DHDA 1B4EA 1QR7A 2Y7DA 3TKFA 1GEQA 3DENA 3LLFA 1GPWA 1EWEA 2RHGA 1P5BA 3W7CA 4FB7A 2E77A 2V2CA 5CPLA 2Y85A 4NT0A 3LGEA 1LCOA 1OX4A 2X1UA 4UUIA 4LWWA 1TPVA 3W7OA 3BW2A 2I14A 3W2NA 2YYUA 1XI3A 5HMSA 4NU7A 1FWTA 3HGSA 3O6YX 1R30A 1ZHAA 5BMWA 4E38A 4PTNA 5FF3A 4PA8A 1MZHA 1LYXA 3M6YA 4HSOA 2C16A 2NXIA 4M6QA 4MZYA 3VE9A 1OYAA 2NUXA 3I65A 3TQVA 1Q6OA 2D73A 3G22A 4YMZA 4JGDA 4TX9A 1MEIA 1GYNA 5C55A 1VCFA 3TU9A 3M9YA 3O07A 3GR7A 4ZQOA 2R8WA 1QOPA 3QM3A 3PVFA 3T4CA 4QITA 3OA3A 1YLVA 3I7SA 1ZCOA 5DBUA 2TPSA 3G8EA 1B57A 4A2RA 7TIMA 2B7NA 1Q6RA 5DN1A 5BW6A 2WSRA 3PUDA 4XBSA 5AYXA 4H4IA 2WJZA 3Q37A 4O19A 3WK3A 3VFLA 1XDMA 3TCEA 2V81A 3E49A 1I2PA 2H8XA 2ZTJA 4LW7A 4FO4A 3C2RA 3I7QA 5TBOA 3F1QA 2QAPA 3MJYA 3PC0A 4GWEA 1UBSA 2ZQ0A 1H63A 1LOLA 1DVJA 5T26A 4LVFA 4JTTA 2ZZ3A 3W7GA 2GVJA 4JTIA 2QCHA 2PE4A 1PVNA 3SR7A 3G1YA 1T99A 2Q3OA 3HG5A 4NXSA 4Y8FA 1ML1A 2X1RA 1W31A 2QCLA 4DELA 1XL9A 1RZMA 4C1LA 1SZGA 2DORA 1GVQA 3P7YA 4BI6A 1NF7A 1YADA 3FIGA 1K03A 1OFOA 3NQ8A 4OU1A 3PSVA 3DKJA 2WKJA 5CZTA 1TTQA 4JR5A 4R34A 1W5MA 1VLWA 4R53A 2OZ0A 1XCFA 3NO5A 4YL2A 2ZTKA 1OFAA 2E5BA 4UR8A 3GAKA 4HPXA 3O1NA 3IVUA 1S5WA 3NPUA 2VC6A 5AHIA 2NX9A 3UWQA 4TR9A 2W79A 4O28A 2H8ZA 2ZRWA 4N9DA 3S9YA 1WOAA 3PM6A 4MUZA 1W1ZA 5C5YA 5HUPA 2ISVA 2A7PA 5HR6A 5F2MA 5U7SA 4UTHA 4MFEA 4GUGA 5FEXA 3CQ0A 4Q33A 2Y62A 4S2BA 2H3BA 1SFJA 3NQ7A 1CI1A 5L9FA 1R2TA 1XBZA 2EHHA 3VCRA 5LHFA 2X1SA 1AW5A 2VEPA 5LNWA 5FEPA 2GJLA 4JNMA 5AN7A 4IMCA 2R94A 4A21A 4LU0A 4UXDA 3ELFA 2PRHA 4CCCA 1PE1A 5K4XA 3TFCA 4OQVA 1K8ZA 1BTMA 3DHFA 1S5VA 1UJPA 4O54A 2Q3RA 2QCDA 5BNKA 4BWLC 1UUOA 3V75A 3LXCA 3QPZA 5L6UA 3LHYA 2QCEA 4IQLA 3LOTA 5KZMA 1JUBA 1YDVA 3LERA 3GNNA 5CPOA 3TMLA 4OE7A 1TRIA 3STGA 4HSNA 4UFIA 3NVTA 3QFEA 1FX6A 1I2OA 4WXZA 4O53A 1TB3A 1JQVA 3G1FA 1NSJA 1VCGA 2NXHA 4UR7A 4RXFA 4EOUA 3FKRA 3DKLA 1I45A 3DI0A 1KBJA 2J9XA 2CU0A 3S1WA 3PUEA 1SW7A 3JR2A 3O6CA 4N2YA 5K7JA 1EUNA 2ZA2A 1PS9A 5EA9A 2E6FA 4A3UA 1M6JA 3S5YA 1G69A 1W8SA 4TIMA 3W7JA 1AG1O 1FCUA 4QIUA 4G1KA 5FI8A 2CLOA 1F2JA 3BPWA 5TIMA 3NPVA 2YXGA 4BF9A 1TJRA 4YXGA 5HWMA 4FXRA 2WPBA 2FPTA 4XKYA 4O1DA 5KZEA 4L4LA 3UNDA 1W5OA 4IMGA 3MO7A 1R2RA 4JTUA 3ZR4A 3NQAA 1ME9A 1F76A 4XZ9A 1EP3A 3VI2A 3MP4A 2OMAA 2FLIA 5SWUA 3STFA 3PAJA 1TTIA 5U4NA 4LS2A 4N9BA 2BWGA 3LI0A 4LC8A 4NZJA 4Z1DA 3N2XA 4O4WA 4JTGA 1LOSA 3M41A 4UTKA 3DU0A 1C29A 1G7UA 3T55A 1F7BA 2GOUA 3SGUA 4CQAA 2WNQA 6ALDA 1ZENA 1P0NA 3PUOA 2PRLA 1OX4B 3LCLA 4DO5A 2CZ5A 4NNAA 1OFBA 2V30A 1QO5A 1S3HA 3MP5A 1HL2A 3FYPA 2ALDA 5AHEA 3LCHA 4DF1A 1MEWA 4JTKA 4YLWA 1GZGA 5AYYA 5KMYA 3SJ3A 1KA9F 1DHPA 4LTSA 1X1ZA 1FQ0A 2BX7A 4UTWA 4OV4A 2Z2UA 2C1HA 3SY5A 3L0NA 2V82A 3PG8A 5DELA 2ZZ2A 1TPWA 1ZAJA 3NL2A 4K8HA 5G2IA 4LY8A 2E5DA 3R13A 1RVGA 4WOQA 2QUVA 1QPQA 3ABQA 3W7QA 1LLZA 4KFNA 3OIXA 3GXPA 3BLFA 4O1AA 2FPYA 3MI3A 4LVDA 1O95A 4JIQA 3SZ8A 1J4EA 1H7RA 1X6UA 2A21A 3W86A 4K39A 3BG9A 4MFDA 4N9CA 4Y90A 3EKLA 2ISWA 1KTCA 5CGQA 1QCWA 3QMSA 3KXQA 3P8IA 1P1XA 1H7NA 1TTPA 4M19A 1JQXA 4DBEA 4B5NA 1H51A 2QCGA 1TQJA 4CNNA 4FX7A 4N6FA 3HMJG 1TO3A 1PHWA 3N34A 3NZRA 2WSQA 4UFLA 4X9SA 3DZ1A 3M5VA 4OV9A 4WXYA 4AVFA 3LRMA 4NNBA 1XBYA 1G6CA 3WK1A 2VXNA 5AC6A 3W7MA 3SI9A 1AL8A 1NAL1 1SO4A 1ME7A 1YTDA 1H61A 2YCEA 1SSDA 4FIQA 5FEZA 1JCYA 1SR9A 3B04A 4AHQA 1QPNA 3N9SA 4PFMA 2C19A 3UYCA 1RQHA 1VYSX 1TV7A 1OABA 3NQVA 4RLIA 4ZQMA 1Z42A 1LTDA 4X2RA 4O52A 3LB0A 2CZFA 3UXDA 1JRCA 4W9TA 3HG2A 3ABSA 3BVJA 1LDCA 2YFOA 3USBA 3CLMA 3C6CA 5DY2A 3PBYA 5KZDA 1KFCA 2ZBTA 4ZVJA 3BK0A 2LLEA 3CIXA 4WY0B 1SZFA 5IBXC 1FWNA 1TPH1 2FFCA 2YDAA 3UWZA 3P5YA 4JN6A 1C8VA 4NX0A 1OYCA 4WY0F 4IXXA 2A4AA 5K9XA 5I3IA 2ZFAA 1W3IA 3GDTA 2VEIA 3L9CA 1FDYA 3W7KA 3SW6A 1W5PA 2X30A 5DY3A 3LRLA 3ABOA 4IUOA 1OX5A 1OFPA 1ZY9A 4IX2A 3MUXA 4XTIA 2EKCA 3O06A 2GQ9A 1B9BA 3C56A 4JTHA 3HBLA 4WJEA 2GVGA 4PEKA 2ZZ7A 3TXVA 1TCDA 4BI7A 4IMDA 1FWSA 3N19B 5D2TA 1H62A 5F2LA 3V1PA 2DZWA 3R89A 3TC7A 4JEQA 4ADUA 2VFFA 4MJMA 4ZQRA 1J2WA 2Y70A 2R14A 4DQWA 2NUWA 3I7RA 3W3OA 5A5WA 4QSHA 2DZVA 1WBHA 1G4SA 1GQNA 2HMCA 1VC4A 5F4XA 3B8DA 4JTFA 4JX6A 3BLIA 4FNQA 1EB3A 5I3JA 2DZXA 3TR2A 1SZNA 4CNPA 1JCJA 1EP2A 3G1SA 3L5AA 3OVPA 3B0PA 3G3DA 1I4NA 3RNDA 5J5DA 3W7IA 4DBDA 2EAWA 3E96A 4PL2A 5G5IA 3KX6A 3G1XA 4PODA 5D05A 5LNUA 3NA8A 3EX3A 3TXZA 3QQ1A 1LBMA 2H6RA 3W7PA 1LRTA 4K36A 1VYPX 3DFTA 3IIZA 3KFTA 1KM4A 3A9IA 3A22A 4YCPA 2BZNA 2E6YA 2Q8ZA 3CWNA 3MHFA
chains in the Genus database with same CATH superfamily
4MLRA 1OEPA 3PZQA 2ACQA 2X7WA 1FWAC 4ZO6A 4KWSA 3N04A 4O0QA 1Q8JA 3O16A 4Y96A 2JBMA 3WN6A 4K68A 3KRSA 1ZJHA 4Z1AA 5LGZA 3VOHA 3QY7A 2GFTA 3VDCA 1FXPA 1UR4A 4Z2GA 4I9AA 2DPEA 1F4HA 1XIIA 4FXFA 3OGRA 3CUJA 3C4UA 2EPHA 2E1DA 4I8YA 2R91A 3AIQA 1EHAA 3IACA 4WF7A 4Q4RA 4YHEA 4KWOA 1RBOB 4HNTA 1MXGA 2UZ9A 1KW1A 3LXBA 5DANA 1TREA 3HG4A 1PJ9A 4M8UA 1VHNA 1X8FA 4LUIA 4WOZA 4EX4A 4MF4A 3SFWA 2CLHA 4PUDA 1AFSA 3NDOA 3LHWA 3QR1A 4P7NA 2XIOA 4IGMA 4TQTA 3RJYA 3W1LA 4PUWA 1H7OA 3LNPA 2CETA 1R85A 1K8YA 3N14A 2CLIA 2AL1A 1DJQA 1VP5A 2QULA 4DZIA 3LGGA 4GUHA 4Z1BA 4JQ1A 3CH0A 3SDOA 2EBNA 3E0WA 1TRDA 3NQBA 4C60A 3WZ0E 2J7CA 1S38A 2F2HA 1X38A 3P8JA 2CCRA 3E5PA 3L4WA 2DUZA 4X60A 3MV01 5BRPA 4RZ4A 5CC6A 2GPTA 1M7PA 1ME8A 5AFDA 4UFJA 1E5JA 4XD4A 3ITLA 3WEOA 5A69A 3RR4A 1UZ4A 4O1CA 5H1WA 4N4PA 3W2KA 3O6AA 4NILA 3VZYA 3HF3A 4PUJA 4LV4A 3OLGA 2ZWZA 3E12A 5E5CA 2CLMA 2YL8A 3A9BA 4S3GA 1RD6A 2BHUA 4YTTA 1GW9A 3U8GA 3THDA 1LM1A 4GG9A 3PB0A 4XAFA 1SZEA 4ZTYA 1EC8A 3K1DA 4JIEA 3EOOA 4ZQNA 4UTTA 2A1YA 3UG3A 4AIOA 3KP0A 3CS2A 4HKPA 3LX9A 3R0DA 3GU1A 4FNPA 1S2TA 2OODA 2G4FA 3FSTA 1C7TA 1E43A 4MAZA 4C1NA 1DORA 4ACYA 3C2FA 4BKNA 4HOZA 2CLFA 1R3SA 4O50A 4RCXA 3TVAA 4KCVA 4TU1A 3B97A 1CZ1A 1Z6KA 2QDHA 3W2UA 3RYSA 3EDEA 1Z7AA 3NQDA 2Q71A 5CGTA 3NCOA 4ATWA 1W9DM 1TV8A 1V6UA 1D2KA 2BXZA 1ONWA 1KV5A 1QBAA 1KC7A 4LVAA 2PODA 1W56A 2V5KA 1VIZA 1A5BA 4GCXA 1U83A 3I10A 1VGAA 4WKAA 4IIBA 2DZUA 3MUZ1 3KVJA 1SPQA 1BQGA 4P2VA 2HVMA 3ITYA 1JCXA 1KM2A 2NZLA 3W7EA 1KB3A 2EPNA 3M07A 3TYDA 3IAPA 3NXLA 3WCZA 4CNUA 5MHBA 3H53A 3BO9A 1MFUA 3PWAA 1AQ0A 2CHOA 4GPNA 3T6CA 5KEZA 4JFWA 2ZDRA 4OOUA 3CQJA 4CCEA 2Z26A 2Z0IA 3TYUA 1J01A 4HN4A 5K3VA 1KFEA 4JTAA 3ARQA 3B4UA 4A29A 5LIYX 2YZRA 3GE7A 4IP5A 3IK4A 5HBFA 5I02A 3NSMA 4TO8A 1P0DA 1W2VA 2JKPA 2V3FA 2D0HA 1PYFA 1RD5A 4NQ1A 3UR2A 1FBAA 5C70A 1R2SA 3KTXA 4ERAA 4CCZA 3W2JA 4FXJA 1XD0A 3GHRA 1P0KA 4UQDA 3KE0A 2HVOA 4L9YA 3C0SA 3N9KA 1X97A 4RNJA 3N6JA 3U0HA 5A6MA 1LORA 2JQXA 3D46A 3IWPA 3CTLA 3UVIA 3CHFA 2C7FA 4H9YA 1KCXA 4ZTXA 4F9JA 1HZYA 5D30A 2PDYA 4XZLX 2OB3A 4MY9A 4PTDA 3WBEA 1E71M 2PTYA 5HQEA 4WLCA 4JYDA 3NZ1A 3W7DA 2HSAA 3M4HA 5IRPA 4N6EA 1KLYA 3T40A 1V93A 1W1B1 4C6KA 3ERPA 4GE8A 3W84A 1NFBA 2J9YA 3LK6A 1TELA 3AJXA 3K4WA 3LA4A 3ZIZA 2PGEA 3U4AA 5DFAA 3CEUA 4O4VA 1IR2A 2AQVA 1AUSL 2B81A 1A5SA 3HJZA 1FWHC 3VNKA 4WUIA 1Q3NA 2JF7A 1SJCA 1W0MA 4NUWA 3EB4A 2VO5A 3G6LA 2BFGA 3KL3A 4HZ8A 4KF1A 1R3QA 1RBLA 2BXVA 1J11A 2NX3A 4LRSA 4UZUA 5AHNA 4FLQA 4K1GA 1H5YA 1PSCA 1KQYA 4MLJA 5KSWA 2ISDA 4EACA 3AMKA 4ZE5A 2VURA 1E6PA 2FVLA 2QJHA 1A5AA 2UWFA 1G4EA 1A53A 3SCVA 4WKHA 4W87A 2FTYA 3CJPA 5ABFB 5CCZA 4FZIA 3VDGA 1HW6A 3QV9A 1FWDC 4TV5A 2OXNA 2VVNA 4GVFA 2I9EA 1F3XA 1YXCA 1XLMA 4FLRA 4GACA 2I56A 3MUCA 1RJRA 4CVUA 1DOSA 4L80A 4C6LA 1RK5A 5T91A 1X98A 1G7VA 2VEKA 4B5WA 2Z1XA 3U2CA 2HDJA 1VFSA 1EL3A 4LGXA 1JNDA 4M6PA 4YPJA 1UH3A 1ZSXA 1EXPA 5BMXA 1RSCA 3W7HA 3C8NA 1XUUA 1V02A 2YW4A 4R7JA 4QTGA 3GX9A 2WMIA 2WC3A 3M5ZA 2PB1A 4BF5A 3CV2A 3S2CA 3OHIA 1QOXA 3M0JA 5LIKX 2OVLA 4CU8A 2WZHA 1G5AA 3FXGA 5ENLA 2VT0A 4BFAA 1CENA 1MWOA 1N8IA 1YNYA 3VNZA 4GNJA 4AIUA 3ZJ7A 4HNLA 1F8IA 2NV9A 2HROA 4QROA 3DDMA 3BG5A 3ARZA 4S39A 3V16A 2HQAA 1HT6A 3OLIA 1GKRA 4MYXA 2QCCA 4H6KA 4JQ4A 1UR1A 4H9MA 1J5SA 1VS1A 5HANA 1KFBA 1KXVA 1AQMA 4F79A 3AALA 3MMUA 1W9PA 1EO7A 4IUGA 5BYWA 2I5QA 2ZRYA 4RKAA 5A6JA 4O15A 3DC0A 4UQEA 1E6QM 4LAKA 4G7FA 3CV7A 1FHVA 3P60A 3EWDA 3G1HA 2GDVA 3N4AA 4V28A 8CGTA 4DWSA 3B0UX 3WK0A 3IRDA 3CPGA 3GTFA 2ON3A 2VNCA 3CHVA 1N8FA 2H3DA 3GIPA 4UFKA 3WLPA 3AZSA 2A6NA 3QKZA 3UFYA 3WLIA 3W23A 2VWSA 3RLHA 3SECA 2GQAA 4R9OA 2RH9A 1SW0A 2Z4GA 2PF0A 3EDDA 5D32A 5BU9A 5TD4A 4C5YA 4Y9AA 3WNPA 2QQ6A 2REQA 3BAWA 3NQ6A 3DFSA 5REQA 1CB7B 1GOKA 5DMYA 1TPUA 1KBIA 1P48A 3E9AA 4HPGA 5CZKA 3TAKA 1IIGA 1PZ1A 3FW6A 3A23A 4PCSA 3W73A 4AAJA 1XYCA 3GYEA 3A5VA 3VOJA 3FS2A 4LX4A 2FZ8A 3GDBA 3QFWA 4C6PA 3VTRA 1BVNP 3DHUA 1HKJA 4D6GA 1OK4A 1ZBWA 3NOYA 4HHPA 3PK7A 2CWNA 1XGEA 1JF5A 1RA0A 3Q2DA 3C8FA 4Q8UA 3WFZA 3ZR6A 4QCEA 1CGTA 1UZHA 5AHMA 2WOQA 2J4GA 5D03A 2DU2A 3KRBA 4MNJA 1OADA 3TYCA 3KOFA 4OT7A 3TTOA 3C5QA 1XKYA 3GDRA 3OVRA 1GOMA 4NJIA 3KBNA 1XYZA 4PRTA 3LXAA 2YZ5A 2W92A 4LEQA 4JD4A 3D5HA 3VNLA 3RO6A 1QHZA 2PDJA 4ADSA 3CV6A 3L68A 2WZTA 3RM8A 2WHLA 1CGWA 4UC5A 1JI2A 1J8VA 3W76A 5AB3A 3M47A 4A8IA 3VK5A 1QWKA 2CBUA 1IZCA 3B8TA 1QMLA 2G3JA 2YOCA 5HWNA 1LJYA 4ZFCA 4LC6A 4QP0A 4E0CA 1XYMA 2DZAA 3NZQA 5AECA 5I78A 3NPWA 4W5UA 3MUAA 4AZHA 5HPCA 2GUUA 4L6OA 1LBLA 2AQOA 1J0JA 1QHOA 3ARUA 2V3EA 3GBEA 1HVQA 4H8NA 1JZ4A 2FPVA 3PBMA 1UWSA 4NYUA 1YE6A 4JL2A 1XS2A 3PJUA 1QPRA 4IL0A 4DZHA 1JDAA 1Z8AA 3LNMA 1EYEA 2HXUA 4OECA 3SM0A 2WM0A 4AZCA 5IHRA 1XIFA 3B0YA 4ORMA 3DXIA 2X05A 2HXTA 1US3A 5FF4A 1OY0A 4KCWA 4D6EA 4S23A 1FWGC 1ADOA 3WD3A 3ES7A 1TV2A 1DQWA 2I7GA 4LYKA 1AJ2A 3R12A 1PCKA 4WQ6A 3G18A 2F6XA 3WFLA 5EYWA 3P14A 3QQWA 4M24A 5A6SA 1US0A 1CT5A 3DH7A 3GC2A 5LIUX 6REQA 2CLEA 1H60A 1RV8A 3AICA 5HUOA 4S3BA 1W8GA 3IGUA 3LUTA 1AK5A 2OCZA 2POTA 3ECQA 1GQJA 4WZHA 1ZUAX 2G97A 3QEZA 4C6EA 4Q8VA 3ANUA 1ZBKA 3NQEA 3NL5A 4N9EA 3PY2A 3FX4A 3COTA 3E74A 4J4KA 3GBDA 1GOIA 3HZ3A 3PAOA 4DXVA 4IHCA 4B4FA 1FP8A 2PF8A 1XPGA 1WDWA 2OT0A 2OO6A 3WLLA 1HQTA 4CU6A 3IS4A 2WQDA 5LXXA 4FMVA 4Y9NA 3PZIA 4GBUA 1QXLA 2WJEA 3OQEA 4CNTA 3VMOA 1IXOA 2Y7EA 4RW5A 3CGTA 5M2FX 3QHMA 4DX3A 3ARXA 2P50A 3C2VA 4NI8A 3QGVA 3MI6A 4GUIA 2PP3A 1BQCA 3TN3A 3CPRA 2HK1A 1V6YA 4IIFA 1FDJA 2R1PA 3PR2A 2RJHA 1OJXA 1GW1A 1OT1A 3LTSA 4REQA 9RUBA 2QS8A 3T05A 1V3IA 4HOXA 1E1EA 2V3DA 2E68A 1F3WA 2QMJA 1WP6A 1VQTA 1GZ1A 5FF7A 4QNWA 1RP9A 5EU9A 3THUA 2A0NA 4J27A 3SN0A 1P4CA 4TV6A 2CNCA 4MWAC 4H2HA 4C90A 2ZX6A 3L2LA 4Z1CA 4IT1A 6ENLA 4M7TA 1NFGA 2QV5A 4AVNA 3S3GA 1QW8A 1C9DA 3CHDA 1EX1A 1FUYA 1I8JA 3RLUA 4WDWA 2YKKA 3TA6A 1VJIA 3S9IA 1JR1A 2EGZA 1MW1A 3TQKA 4FF7A 4IIHA 3W29A 3OODA 3DFNA 2NX1A 3RRAA 4H6QA 3V5CA 5I03A 5DXYA 5JU6A 3WF0A 3WUBA 1SO5A 1UROA 2HE8A 4S1FA 2QCDB 4F2TA 3TSBA 3T7VA 2J88A 3SBFA 4GUJA 4AIEA 3W1NA 3VC5A 1BYCA 3H2CA 2QHAA 2DZBA 1I2RA 3ATZA 1SW3A 3QN3A 4CEUC 1LL6A 1T7LA 2IS7A 4NAFB 3NR0A 4MM1A 1S2WA 1G4TA 3U57A 2XFWA 3QPYA 3QSTA 8A3HA 1E3ZA 1W3HA 4Z2LA 1XYFA 1GVYA 4J2MA 2V9DA 3FGCA 4AEOA 2RDWA 1UKOA 1W9UA 2E09A 2DZSA 3JS3A 2ANUA 2X0YA 4AZ5A 4CNOA 1NF0A 3KOYA 2XVGA 3MPGA 4MNMA 4Q6XA 2OWWA 5XIAA 4Q8TA 3PTMA 3DG3A 3WH6A 4IPNB 1XUZA 3WFAA 3HGRA 4NKCA 5EBAA 1BLIA 1XSKA 1ZNNA 1K77A 3BSMA 2F6KA 1AA1B 2FZNA 2C8NA 4YTUA 1THFD 1KRAC 3GIQA 4FIRA 1J12A 1YEYA 2VKZG 4PH6A 4EF9A 3JUGA 6PTDA 1KFKA 3TW7A 2YLAA 4ZA0A 3NM1A 5FAJA 3UPWA 2PDMA 3BQ6A 3FYOA 5A3HA 5LZLA 3JW7A 1Y5WA 2FHCA 4DWSB 1DQXA 4DXXA 3RPDA 1FWCC 1E0UA 4UZSA 4JKKA 1E9LA 5C7VA 1OF6A 4HSHA 2HV5A 3PBWA 1IE7C 5FJOA 3WEMA 3C0JA 2CLLA 2VEMA 3VCNA 2REQB 3DIPA 1JCNA 4MB3A 1UP2A 1WX0A 4DO7A 4R27A 4H9XA 4IP7A 1G01A 3P6LA 2WXDM 3BL3A 3SGZA 4LEFA 3L2MA 2XIBA 2D23A 2NQJA 2WJDA 4DPPA 4FXSA 2AKZA 2WQPA 1WXJA 1KBKA 5CPMA 1O66A 1N8WA 5A8NA 3W28A 1D7KA 5FL1A 1M68A 3PZVA 1V3MA 4UMAA 1ALDA 3DHDA 1B4EA 1QR7A 2HISA 3DENA 2D2GA 1H41A 3LLFA 3EEZA 1FH7A 1XIMA 1P5BA 2E77A 2V2CA 3EGJA 3MDWA 5D9OA 2WK2A 1ZS2A 1EJ7L 2VC9A 4A35A 4QJ5B 3LGEA 1TJ1A 2X1UA 3KBJA 3IJQA 3W7OA 1EGZA 2I14A 5HMSA 3WLOA 1S1PA 3HGSA 1R9YA 5BMWA 3AQUA 4S3DA 3WH5A 3RILA 2E0PA 4DJDA 4M6QA 4FOKA 4FPSA 1XQLA 4LBSA 3V35A 3ZT7A 3G22A 1FHDA 3GW3A 3QGAC 4TVCA 5C55A 3V3WA 2R8WA 4D6DA 3LSBA 5DRIA 1YBQB 2J25A 3ITTA 4DY1A 1U1HA 5JIWA 1PDZA 1YLVA 1ZCOA 4DWDA 2TPSA 3G8EA 1B57A 7TIMA 5DN1A 1GORA 3OJGA 5AYXA 1QI4A 3EDFA 4GVIA 4HPHA 1DJYA 3BMWA 1I2PA 2P3EA 4JAWA 2R1MA 4FO4A 3ZSTA 3B8WA 3PC0A 4YNGA 3G77A 1UBSA 2ZQ0A 2BGNE 4ZR8A 1K9TA 4ZFMA 1H63A 3UPMA 3GC4A 3F5JA 2I16A 4QJ3B 3TLLA 3FGCB 4JTQA 2PE4A 2DQXA 4F0LA 2WVVB 3U3HA 4IICA 3KOXA 3CLWA 1ZTVA 4GYKA 2X1RA 4GNVA 1E6RA 2UY5A 3HPFA 1XL9A 4IMAA 3R0UA 4B92A 1SZGA 1E6ZA 1GVQA 3S6OA 1SJDA 1GUVA 4B15A 1NF7A 5HAOA 3NFUA 4OU1A 2GUYA 2EXOA 5BWAA 3IV8A 3TN4A 1IYXA 2PP0A 3S2NA 4F3HA 1W5MA 4GZ7A 4R53A 1SVDA 3VZXA 3ZLFA 3ZO9A 1ADDA 1OFAA 2E5BA 5C9XA 4FLOA 2PLCA 3H23A 1K1DA 3KHDA 1UZ1A 3STPA 2VC6A 5AHIA 4GISA 4GK8A 3UZWA 4TR9A 2W5FA 2H8ZA 4N9DA 3MKCA 4TVUA 3S9YA 3GVRA 3IARA 5HUPA 1CGXA 2ISVA 4OTKA 2VJXA 3RGTA 4UTHA 4MFEA 1OGSA 4K2SA 2QVHA 3M0HA 3OPSA 4AX6A 2WC7A 2H3BA 5DQPA 5L9FA 1XRTA 1XBZA 4Q3MA 3CWHA 4KT2A 1QW9A 2PD9A 2PTXA 1QNPA 3BLKA 2FFIA 3PZTA 5FEPA 2WMHA 5AYIA 4ICCX 4W7WA 5AN7A 4UQAA 4IMCA 1JEZA 4B3ZA 4A21A 4LU0A 4DJFA 4UXDA 1UUQA 2PRHA 3NDZA 1PE1A 5K4XA 3TFCA 1BTMA 3DHFA 3F5LA 4BQ5A 2XU2A 2PUZA 1MUWA 1E9YB 1XGZA 1JZ2A 1G9HA 3LS9A 3LXCA 3UNTA 5L6UA 2QCEA 4HPNA 4Q8MA 1X39A 3TMLA 3R11A 3GVQA 4UFIA 2ZXDA 3NVTA 4HHLA 1FX6A 1XLFA 3QVQA 5FSDC 1JQVA 3G1FA 3N13A 2Z1SA 3MVIA 5M3WA 1VCGA 4RXFA 3K8MA 4EOUA 4AYSA 4EPKA 1KBJA 2IPWA 4QEEA 5K7JA 4QE5A 3B8VA 2FGLA 5EA9A 1V79A 3RO8A 1M6JA 1FVPA 4HMDA 2HNHA 1RJQA 1SMAA 1AG1O 5T9BG 2Q8XA 4GNKB 4DJEC 3NPVA 1S2CA 1TJRA 3CZKA 3QR3A 5J8LA 3R94A 2HPMA 3MDUA 2EG8A 4XKYA 4O1DA 2XIJA 4L4LA 1W5OA 4IMGA 2YBVA 2BY1A 2FVKA 4OOZA 2VZTA 1HP5A 3PPCA 3VI2A 4L9XA 5AY7A 4GQ0A 2IW0A 1B1YA 1G0CA 5U4NA 4LS2A 2JEQA 2BWGA 4NZJA 5AVHA 2X1IA 2PBOA 3W81A 1LOSA 1ISZA 5D8ZA 3VKAA 3D47A 1C29A 3GVWA 2Z28A 1HGYA 2WWCA 1KXQA 3TNBA 1P0NA 3N17A 2ACUA 3R4IA 1HIZA 1OX4B 1TUXA 4DO5A 4C6FA 4MUPA 1OFBA 2V30A 2WHMA 1QO5A 1W1TA 3IJDA 2Z1KA 1EIBA 1HL2A 2ALDA 3LCHA 1DP0A 2DVTA 1MEWA 1UC4A 1AH0A 1GZGA 4YLWA 5AYYA 3SRHA 4H6RA 3FAXA 4GH3A 3VD4A 1E6SM 1YQ2A 3URQA 1L2QA 4PB3A 2V82A 3GH5A 3G5EA 1CXLA 1ZAJA 1V3KA 1BGGA 2HE5A 1NFPA 1TZ7A 1AODA 4P8XA 4ZO8A 3R13A 1RVGA 3AHTA 1E4MM 2QUVA 3OP2A 1LLZA 3OIXA 3GXPA 5IDIA 1QASA 1Y7VA 2DH3A 1HJQA 3MI3A 3KWXA 1J4EA 4K39A 4N9CA 4Y90A 3B9NA 4C65A 1I1WA 3H2AA 4I5XA 3TOPA 1T8QA 1SFTA 2H9AA 5CGQA 5JQ9A 3I6EA 4FOUA 3KXQA 3P8IA 1LG1A 1OD0A 5FJUA 1ECEA 4IH3A 4FX7A 1TO3A 3N34A 1BSIA 3DZ1A 4OV9A 3WDIA 3LRMA 1YX1A 3CAVA 2VXNA 2PDGA 3EPMA 2HVNA 2YL9A 5E0CA 4CN6A 4IM4A 3TN6A 5BCAA 4JFTA 4P7OA 1UWUA 5FEZA 3MSRA 2HBVA 2V67A 1Y5VA 4FP1A 1PPIA 3HQPA 3UYCA 3V4BA 1OABA 3NQVA 3VILA 4DYJA 5DO8A 2CZFA 2PWGA 4GX8A 3ABSA 1LDCA 2YFOA 4G2DA 3CLMA 3USBA 2ZBTA 4XZMX 3JZEA 2UY2A 2AGTA 3CZJA 5IBXC 1AD4A 3S2MA 4Q8WA 3MSYA 4S3EA 1TWWA 2RJGA 2HCVA 4WY0F 1W3IA 2UY3A 3KBVA 2QJJA 5DY3A 3LRLA 3GFZA 3MV11 3O0KA 1GPFA 5CPSA 1OX5A 4IUOA 5CXPA 1F07A 2BVDA 1R7AA 4B5VA 2DSUA 4R5EA 2GQ9A 4WJEA 1B9BA 1V0LA 4LYRA 3TXVA 2IPJA 3RIKA 1TCDA 4IMDA 4MNKA 1RHCA 3N19B 3OZYA 2DZWA 4DUXA 4HBKA 4ADUA 5C8BB 4ZQRA 2R14A 2WCSA 4DIAA 3I7RA 1R6WA 4QSHA 2DZVA 1WBHA 1G4SA 1OGGA 2FZMA 4PMXA 2HMCA 1VC4A 3BLIA 4FNQA 4A8NA 4ZCWA 4WJXA 5I3JA 3EYPA 3TR2A 1TZZA 2SFPA 4CNPA 3FA4A 3G1SA 1FFQA 4WHBA 3B0PA 3RNDA 3W7IA 2OSXA 2X8RA 4PODA 2VM8A 1T41A 3CMJA 2UBPC 5HJXA 3VA8A 3TXZA 3EX3A 4LANA 5LNUA 3AHVA 4MJ4A 1LBMA 3F4DA 1FH9A 4J3TA 3U9IA 4K36A 4AD0A 3DFTA 4BHYA 1KM4A 8RUCA 3VIPA 5M1TA 1CGUA 4W7VA 4DO6A 1JYVA 4F0HA 4DF2A 3NXFA 3WLNA 3WLRA 2E28A 1MO0A 4EVZA 3QZAA 3LQGA 1JIBA 4ZBCA 4IZGA 3W7NA 1XLIA 2VOTA 3VIHA 3OEXA 3ORWA 1GNXA 2F8QA 1AMKA 3TAOA 1R46A 2NT0A 2FB2A 2DJLA 1YNPA 3D6NA 1XC4A 3LV5A 1Q4NX 4IPJA 3CO8A 3LZ3A 2VI0A 4QLKA 1Z32X 3VZZA 2VWTA 4AY7A 1DYSA 3UCDA 1IF2A 2YGYA 1KM0A 4FLSA 3E5BA 2VX5A 4GO8A 1ZRQA 3DFHA 3C3NA 1XLCA 3NGFA 4XZBA 3SY8A 2G41A 2YL6A 3W2LA 1V4YA 2VFHA 2NLIA 2ZCGA 4HK6A 3VM5A 3ATYA 1UR2A 5AC4A 2BHZA 5HA7A 3EB2A 2E6DA 3CUFA 4A3HA 3W1TA 1MXDA 1R3WA 4UTFA 5D02A 2QJMA 4HHMA 4ONVA 3T44A 1KO0A 1L0PA 1J96A 3URAA 2QYGA 4OGZA 1ZBCA 1O1ZA 2X2GA 3MYOA 2Y89A 4JXCA 3WSUA 5DMNA 4WEVX 5HR7A 2PDIA 2OJPA 3UGVA 1KCZA 2WBGA 3L2IA 5G4EA 3TZNA 2ADAA 3NQGA 3CL6A 1QAPA 4DLFA 3N2CA 1GG1A 1HKWA 1J0IA 5CC7A 2B0MA 1JAEA 4XZNX 2V5JA 3T0CA 1WKFA 1L6YA 3UJEA 3W9ZA 2YYTA 3RITA 3V36A 2QUUA 5A6BD 3H2FA 3WF1A 3S6TA 4PR4A 3IUHA 2C79A 4ZXOA 5HMEA 1U30A 1V7AA 2WMGA 1M04A 3EB3A 4KS0A 1FCBA 2VD8A 1EBGA 2NQ5A 3RCNA 1QWGA 3O9NA 1T40A 1JDFA 4GC3A 4WY0A 1J5TA 2ALRA 1EKOA 3AAMA 4BCEA 1TKKA 4I7WA 1VEMA 3RG6A 1PTDA 3ZYZA 2ZA3A 2YB1A 5KETA 4HCLA 1UQZA 1KLZA 3MMDA 1PB0A 4DJFC 1JG9A 4JIHA 5C9RA 1ZCCA 1XHGA 4IP4A 3UA4A 1CNVA 1E0WA 3U6WA 4HMEA 4M80A 4AX7A 3W2MA 4C6DA 3B8SA 1MDRA 3SUSA 5D09A 3UG5A 2XH4A 5FKYA 1XX1A 4RJEA 4BA0A 3GTHA 2ZUTA 1OIMA 3LQLA 1WAUA 2PTZA 1L6WA 1HKIA 4I5UA 3UBPC 4IJBA 3MBFA 1VFMA 2OU4A 3O8AA 1CXKA 3FY1A 2ZUVA 1ZQ5A 2VOMA 4AEEA 4YTRA 2PWDA 5RUBA 3VDAA 1E51A 4EANA 1JAKA 4M82A 2EPMX 2ISSA 3PZ9A 5D2WA 5IBXA 4LVBA 1EJXC 4O12A 1PO9A 1OK6A 1OFRA 1VBGA 3QMRA 1OINA 2BGQA 3DGRA 2Q01A 1TX0A 3PTKA 4HTYA 4GYPC 5FCZA 4Q4OA 4YYCA 3WQ8A 3F2BA 4J2PA 1JCMP 1VAHA 3WQWA 4PBGA 2CZDA 2G5WA 4QM1A 3VOFA 2H9AB 5E9AA 1FWEC 1GZJA 1VCVA 5A8GA 4ERGA 3L7RA 3R10A 3TIMA 4O57A 1BXBA 2VGIA 5BWFA 4RZBA 3EWXA 2YB4A 3PFMA 3UGRA 1W17A 3WDRA 1NP0A 2YJQA 4UMCA 1WAWA 4S2CA 1CXFA 1Y5XA 4D1IA 3PF3A 1VFFA 2ZX8A 3C2OA 1LWIA 4RPPA 2OG9A 5I79A 4RK8A 3BLEA 5F1UA 1WBJA 1D3GA 4C6OA 3ME3A 2J7EA 7CGTA 2EG6A 4GJ1A 4FOJA 4JTCA 3C2EA 3RJXA 1H1YA 3G1VA 3B9EA 3P5ZA 5H8PA 1CX9A 2JEPA 1BHGA 2MNRA 1UB3A 1VBHA 4M51A 3KWSA 3H2OA 4NJKA 5JH1A 3LV6A 4EPEC 1N82A 1RLDA 2XH7A 3O2LA 3A5FA 4TXEA 3IUDA 3B4YA 1EZWA 2ZUWA 5D04C 4E6MA 1OG0A 2H90A 3XINA 1IXNA 1RAKA 1XQKA 1H0IA 4EF8A 4X22A 1SSGA 1KXHA 3H6OA 6A3HA 1BYDA 3UZYA 1QDSA 3LZ5A 4R7OA 3LMZA 3TJLA 1VR6A 1DTUA 1WUEA 4I8DA 4W88A 1U5JA 1VRDA 1NELA 4V1XA 3WNNA 1G4PA 1HKMA 3HPSA 3PSWA 2W62A 3W01A 4JL1A 3OG2A 1EZ2A 4F66A 5HJLA 5HXMA 3ABXA 3T0DA 4RZ5A 2FJKA 5MKGB 2P8CA 5CBBA 2VDIA 2IMRA 2ZX7A 3ZM8A 2G50A 2WVUA 3TQ0A 3LPPA 4ZQPA 3MHUA 2QIIA 1X1OA 2X09A 4KEMA 1LRNA 1TTJA 1W37A 3F4NA 2BB0A 4GXWA 5JBFA 4D1JA 1VZWA 4LUSA 4DXKA 1CGYA 1M7OA 3KTCA 3WQFA 2V63A 5J04A 2PC4A 4Z1YA 5GJPA 1E73M 3SCRA 1BVWA 1UA3A 4D6CA 5LA1A 3AUJA 4I6KA 4I6VA 3AHXA 1FXQA 1YPXA 2DSVA 3RX2A 1PKMA 3MHGA 2GSJA 3WJZA 2WNNA 3UXIA 4NZFA 3M5XA 3UYIA 4XUGA 4MKVA 3MKKA 3H4XA 1EA0A 4QBXA 5CLTA 4QQ3A 1W9BM 1Q6CA 1UCWA 2NXGA 3W02A 4N0RA 4ZL1A 4ZO7A 1JULA 3BSGA 3NUKA 2GGHA 3WF2A 3UEQA 3UZXA 1Q5MA 3WLSA 4M6VA 1UWTA 3GG1A 1R9XA 4KIEA 3W6YA 3R8HA 3VX1A 2BVYA 4FEZA 3NL6A 3BOFA 5DEZA 2W61A 4GGBA 5K4ZA 3T0AA 1WUFA 1RVKA 1Z48A 3EMCA 5A1AA 2OTDA 1GTEA 5C9ZA 4HN8A 3TEVA 4EAMA 2V8ZA 4ZOBA 3OZPA 3DG7A 2OQHA 2QLYA 5D8WA 5EFFA 1XRVA 3G2GA 5FL0A 6TAAA 1JD7A 1NVMA 3CB8A 5AYZA 3KDNA 4HU0A 4NX5A 1VFLA 2TYSA 1ZJBA 3FK4A 4HTBA 2G96A 3H4WA 4C6IA 4CKQA 2XFRA 4I7VA 1O68A 4B2DA 3BARA 1KTNA 5LIXX 2D24A 3ZR5A 4QDPA 5ABFA 1QTWA 2INFA 2CEQA 2RDUA 1RCXB 1CB2A 3O7UA 1C9WA 2J7GA 5I3DA 5H6HA 1K8XA 2G4JA 3H55A 1K70A 3EX2A 3NO3A 1BG9A 1OWQA 3MY9A 3UG8A 1VH7A 4G6CA 1MSSA 3UR5A 2YFNA 5CZJA 5LNVA 2VGGA 3AFBA 1XIHA 1W9XA 3DFYA 4LF1A 1FWRA 4MZ1A 4FS9A 3WBWA 1V3HA 3E02A 1LQAA 4XQ6A 3A4JA 3QHOA 4R7WA 4XIMA 2GSEA 1LBFA 1KM1A 3GQYA 1AQHA 5D4YA 4JYFA 4ILSA 2FMNA 1B3YA 5AVNA 3FSUA 3GG0A 1O5QA 1W3NA 3V0TA 5A8QA 1UASA 3GG8A 1BTCA 1QO2A 5I5RA 4OFCA 1XJBA 2PZ0A 3W07A 1XLEA 5I0DA 1L8PA 1OCBA 3IAQA 3IJLA 5DCDA 4ZXLA 2PDCA 4BQ2A 4Z08A 2WZMA 2R1LA 4G5DA 4B91A 3A3HA 4N4QA 3KLKA 4DWSC 4NZCA 1EC9A 1EJRC 4ICNA 4LRTA 1FWWA 4JOMA 2GOKA 3EA2A 4NXKA 5FJPA 5GPRA 3T78A 1D9EA 4H00A 5JUVA 4S38A 4UMBA 4LB4A 3I4KA 3VGFA 3HMCA 4QNEA 2IPFA 2XN1A 4E2VA 1TMHA 4HZ6A 3OOQA 2C91A 4B5SA 2ZXBA 2DV0A 2X41A 1TWSA 1EJVC 2ZXQA 1H7PA 1GKPA 1W1IE 2C15A 4AVOA 4NZ5A 3A3XA 2XSXA 1U2YA 3QZEA 4W8AA 4XD5A 3VPLA 1DKWA 4JFSA 4WGHA 3KP1A 4CQ8A 4JTDA 4P61A 3QOKA 1C92A 5IFPA 2ACSA 3KZSA 3TOYA 3I6RA 3W0KA 3MWAA 1EEXA 1TCMA 3TH6A 1E9IA 1QBBA 2A7RA 1I2NA 3AOFA 3H2NA 2A2IA 4HK5A 2YCIX 3H70A 4HA3A 4L61A 1UR0A 5BXSA 5HNRA 4CD7A 1CW2A 2JKAA 4L4MA 7ENLA 3W70A 1VENA 3TDFA 4B90A 5EY5A 3CTTA 5CJ5A 2YIHA 2DT0A 4FNSA 1VBRA 3ES8A 1KM6A 2RUSA 2CXGA 4RDVA 3WJSA 1FTXA 4X3ZA 3KLLA 1VHCA 2QDDA 1JCTA 1GG0A 1TV3A 4MIMA 3B40A 2HBXA 4RXGA 3C2YA 1GJUA 2I1OA 2OWXA 4K3ZA 1F61A 3LY0A 1ODZA 2YCKX 1SUXA 3Q58A 1P6BA 2NLYA 3BWWA 3NZGA 3GYCA 1R38A 1F6KA 4AWTA 5DBTA 1CPUA 2V5CA 4HHHA 4KGJA 3IGSA 1ENUA 1HO1A 2NV2A 3KCJA 1GOWA 1JPHA 3GZAA 1WXYA 1A4LA 3WEZA 3SJNA 5CPNA 1BRLA 1UR3M 4PBEA 3ID7A 5E6ZA 4LV9A 2OEJA 4IMEA 1E4NA 3REQA 3KDOA 4P8WA 3WD2A 4J1OA 2Z27A 4NRRA 2XVLA 3E0IA 2CITA 3BV7A 1G67A 1P6CA 5F7UA 4CN1A 5FESA 2F61A 2OO0A 4AXNA 4EWND 2D0GA 4O17A 1QNVA 4AD4A 2Y6ZA 3PPGA 5BOFA 2QT3A 1A5CA 4PMRA 4NHVA 5E0KA 4CN4A 1FDZA 3R5EA 3FVMA 2WV8A 8XIMA 1QPOA 1QATA 1OIFA 4RDYA 1IEWA 4QLJA 2CBJA 5A6LA 4XVEA 3RUBL 5C9WA 3D0CA 4M3PA 4UOQA 4MB5A 2ZC1A 1WOBA 3NEHA 2YBUA 4PTVA 2WSYA 3UA3A 4WX2A 1SFLA 3ZFHA 5G2WA 3PBUA 1PAMA 4ZEPA 2QMKA 5E70A 4US5A 1YDOA 4I9JA 4I7UA 4IMFA 3WY1A 4DZ5A 2Z1BA 4JNZA 3SUVA 4TVDA 4MZ8A 4XBKA 4M81A 4BJHA 4UNIA 2Q09A 1XLAA 2DJXA 3LGDA 4IOTA 4MY8A 4D8ZA 2HTMA 5KITA 2X1TA 4J3SA 3RHGA 4PSRA 5EPDA 3OLEA 5I3KA 3N1AA 3SN4A 2RGMA 1QK2A 2Z6JA 5ECUA 4O10A 4ZB2A 2GJNA 1XRSA 5KINA 3TE9A 3RU8X 3DN5A 4N7QA 3W6LA 3N2MA 3ARVA 5JIPA 5CBJA 1B30A 1UKSA 3MW7A 3WNOA 5ABHA 3GXDA 3WELA 1HL8A 1GQLA 4V2XA 2C1GA 1ZJIA 4XK2A 1NU5A 2WZEA 2XHYA 2PFHA 4IPPA 4DI8A 2QKFA 5LGXA 3T0BA 4K6AA 4D8AA 3VNMA 1NWTA 2J79A 3D3AA 3LTPA 2J7HA 3N73A 3CQIA 3NTYA 4DJEA 1HUVA 4AWSA 4HCDA 3NG3A 1UP0A 3EKGA 2XVKA 3K13A 4OBSA 3ZVHB 4DM1A 4GOAA 2ZRVA 3G3MA 1OYBA 2Q6ZA 5DMMA 3KCLA 3TNOA 3M0MA 2VVSA 1Z89A 3QLDA 1NJJA 2FKPA 5D2XA 3QC0A 4O8RA 1TIWA 5IOBA 4AB4A 3RK8A 1PZ0A 2BVTA 7PTDA 4Q4SA 3W1UA 3ITVA 2FTWA 2OEMA 1UG6A 2AQWA 1XDJA 3B0VC 4UQBA 2Y7GA 4U3AA 1F3EA 5A95A 2ZUMA 4H3DA 3VIFA 4FNRA 4OUIA 1PL9A 4TX6A 4XZWA 2DY3A 3UJFA 1CBGA 4AXKA 3CZEA 2ASHA 1KGWA 4L65A 3V0SA 2XINA 1K4GA 4TX8A 5D9NA 1E1FA 1Q7MA 1RALA 1ICPA 1B4KA 4HNUA 4PB4A 2PMQA 2QGHA 2ABBA 1IT7A 2ZA1A 1GVRA 1FA2A 1HO4A 3WH9A 3VE7A 1KWKA 3ZJ6A 3OYZA 2BOFX 3EXSA 1EDGA 3ALFA 2ZX5A 4LUJA 5TQLA 2OSYA 1D8CA 4QQUA 1V5XA 2GGJA 2IKIA 1PTGA 4GVGA 4HPJA 3UQNA 3RM9A 5FF2A 4XAGA 3PS7A 2OGJA 1REQA 3W71A 2DT1A 1FWJC 3WD4A 2KZHA 4QDWA 3CUHA 3IJ8A 1K02A 5CKSA 2WVSA 4RE2A 1ZB5A 3IGXA 4YVPA 1SJBA 3L66A 2PLJA 1E5NA 4Y2WA 2NUYA 5I07A 2EKGA 2JGYA 4I9TA 2A6LA 1JZ6A 3WUFA 4EXQA 4IFRA 2PWUA 1H7XA 1LLOA 1CGVA 2PDNA 5K2ZA 1XD1A 3TSMA 3AYVA 1IXQA 8TIMA 3QBUA 4L9ZA 3CIWA 3BQ5A 3GTIA 2XZ7A 3W38A 4P8UA 3LM7A 2VRKA 2BG5A 3KVKA 4KPLA 4AZCB 1DBTA 4IGHA 3T2QA 1IIHA 3TYAA 3UZ5A 4WRHA 7TAAA 1PIGA 1SQ7A 3HB9A 1UHVA 3DHPA 2IQ0A 3P84A 1QI5A 3Q67A 1YTEA 4QR6A 3THQA 1J93A 1EYWA 4UFMA 3G0SA 3ABRA 2JFEX 3APTA 4H8UA 4X61A 2QPUA 2C1IA 3AS0A 1HP4A 4WJ8A 1XLBA 4MPKA 4O18A 2I17A 1ONRA 3VGGA 3WQDA 3W26A 1GEQA 4YTQA 1GPWA 4OUEA 2PWVA 1O12A 1DWAM 3MT1A 4DB7A 1A0EA 1OX4A 2JIEA 3H2MA 4RE4A 3ITCA 4UUIA 4LWWA 3TN5A 4DNHA 4HU8A 3BW2A 1EDQA 1NY1A 1Q6GA 2WLZA 3LEPA 2CESA 1R30A 4JIRA 3VGBA 2CHRA 1AZ1A 1NTHA 1LYXA 4MZYA 4HSOA 2C16A 1NQ6A 2NXIA 4NAEB 1UKTA 1OYAA 2NUXA 4LUSB 1Q6OA 2GJPA 1MEIA 3M9YA 1KKOA 3QV7A 1QOPA 3QHNA 3QM3A 3PVFA 3OA3A 1ONXA 1M3UA 3RX4A 3CAQA 3CL7A 2HZGA 2B7NA 1O5RA 1IEQA 3A64A 5FJRA 4XBSA 3ZVHA 2E3ZA 7ODCA 2WJZA 3PN8A 1RA5A 4AZ6A 4A3RA 1OG6A 2Z1WA 1XDMA 1UJQA 5A6AA 1QI3A 2H8XA 2ZTJA 3E0FA 3I7QA 5TBOA 3CV1A 2PDXA 1FWFC 2CYGA 1EH9A 5G1MA 4ES4A 1LOLA 3LM3A 1PKLA 2OSWA 3S47A 1ISXA 5T26A 4X63A 1V3LA 1K6AA 2AKMA 3PNZA 4JTTA 3W7GA 2QCHA 1EHNA 4E8DA 4PGLA 4MB1A 2Q3OA 3CO4A 4Y8FA 1DXEA 1ML1A 3QV6A 1OC6A 4C1LA 2BY0A 1FKXA 3CNYA 4BI6A 4XAZA 1BD0A 1YADA 1OFOA 2ZC8A 3FIGA 3AZRA 5T8GA 4NASA 3DKJA 5CZTA 5I7GA 3VUSA 1TTQA 1PEZA 4DUWA 1VLWA 3ABZA 3E2RA 4Q8QA 5HJYA 2FHFA 3ZJ8A 4JCMA 2GZXA 4YL2A 4JTRA 2OYKA 1UD4A 3CT2A 1MQQA 1YBQA 3BE7A 4HPXA 4U2YA 1NDZA 3GHSA 3IVUA 1WKDA 3NPUA 2WAGA 2NX9A 5EB8A 3PNUA 2ZRWA 1JGMA 1WOAA 4MUZA 1YHTA 5C5YA 4ZOCA 3WLMA 3CBWA 1OD8A 2OZ3A 5FEXA 1UD3A 1LL4A 3CQ0A 4Q33A 1P7TA 4S2BA 2CBVA 1CI1A 1XYLA 1UP3A 2HWGA 1IZKA 4M29A 4H9ZA 5CSYA 2E7FA 3ITOA 1HN1A 1XG3A 3ELFA 4QRNA 3WQ5A 3UCCA 4CNSA 5LA2A 2Q3RA 1AH4A 2CERA 4Q4MA 1CWYA 4L1XA 4IGSA 3GNNA 2WKLA 4HSNA 4HQVA 4XO6A 2Z1VA 4BZYA 1J0HA 1I2OA 4WXZA 1TB3A 5GJNA 2PTDA 4S3FA 4UR7A 3RPTA 3FKRA 1I45A 1DXFA 3PUEA 3JR2A 2WW5A 2GWNA 1EUNA 1HGWA 1YIXA 2E6FA 1S1RA 1C90A 4H7VA 1G69A 4F0RA 3N25A 4EE9A 3EA3A 2PS2A 1FCUA 1LT8A 5FI8A 2XVNA 2YXGA 4BF9A 2NSXA 1XR2A 4V27A 4B3KA 4YXGA 4HA4A 3VVGA 1P6WA 4FXRA 3AI0A 5I77A 2BXYA 1UD5A 2DVUA 4JTUA 2Z7KA 1ME9A 3KBSA 1EP3A 4NG3A 1W91A 3MP4A 2OMAA 1C93A 1N2VA 3STFA 4BY3A 4HK7A 3PAJA 2FHBA 1V0KA 4WDXA 1BXNA 1P7TB 3L4YA 4S3CA 3AIVA 4O4WA 3IRSA 3URNA 4Y8EA 3T55A 1G7UA 1WCGA 1EGMA 1W9VA 2GOUA 1AH3A 3EPOA 4XAPA 1ZENA 3CAWA 2PRLA 3LCLA 2DFAA 3U7BA 1JDDA 2CZ5A 1BYBA 3UT0A 1S3HA 5JBDA 1M7JA 1UIPA 3MP5A 5AHEA 3WH8A 4B3LA 4DF1A 3KS5A 1F8MA 5KMYA 3SJ3A 2XVPA 3QTGA 3SUUA 3UG4A 1DHPA 4LTSA 4UTWA 1I75A 4C6MA 1KGXA 4DUOA 2ZZ2A 3MJMA 3UCQA 1V8EA 4H01A 1XLJA 5G2IA 3ZLHA 4HYVA 1R8LA 4LY8A 3VO0A 4WOQA 3O3RA 2QV4A 2FPYA 1WDSA 5A8MA 3HQOA 4PTXA 3W86A 4QSFA 2A21A 1Q7ZA 4PB5A 3BG9A 4MFDA 1M03A 3ALGA 2ISWA 1QCWA 2J7FA 3QMSA 4URIA 2A3BA 4LAZA 3V5FA 4DZAA 2INZA 1H7NA 1TTPA 1WDRA 2BS9A 4JHOA 1ZPTA 4L1GA 3DEQA 3HMJG 4BEUA 2WSQA 4X9SA 4AVFA 4QFUA 5IFTA 1Q8AA 3A3WA 2ZUNA 5CAHA 2P0IA 1J6PA 1ME7A 1D7FA 1H61A 3LSCA 3GNRA 1SR9A 1JCYA 1E70M 1IEXA 3F2CA 3N9SA 2I5IA 4PFMA 2C19A 2PLMA 1VYSX 1TV7A 2Z2AA 4WKFA 2CHNA 2WMFA 3T08A 4X2RA 4JQAA 3LB0A 3PZUA 1JRCA 3I3EA 1VB9A 2XH2A 1RK6A 1VJZA 3HG2A 4W9TA 5DMLA 3LN3A 3W53A 3SRFA 3PBYA 1GK8A 1KGUA 1OC7A 3IGHX 1PKNA 4CQDA 2VC7A 1EC7A 1AJ0A 2RAGA 1FWNA 1TPH1 8XIAA 2YDAA 5CJNA 3P5YA 4JN6A 3SSZA 1MVYA 1L8NA 1CTNA 4NX0A 5C2GA 2FZDA 4J3WA 1JDCA 2DIEA 3R25A 3L9CA 4S3KA 1FWBC 3SW6A 4ZB0A 1L6GA 2WB5A 1ZY9A 4IX2A 1P43A 3FAWA 4MTVA 3MUXA 5EMJA 4XTIA 3GW0A 2EKCA 3O06A 4JTHA 3B9AA 6REQB 1UWRA 4ML4A 3APYA 2X2YA 1FWSA 5F2LA 1H62A 2INEA 1BF2A 1XSJA 4PMUA 3R89A 5HQMA 2ESCA 5A2CA 4OVXA 2VFFA 4MJMA 3V0UA 4FAMA 4DQWA 4KIRA 3W3OA 3PTQA 5F4XA 3AXKA 4JTFA 4JX6A 1EB3A 2DZXA 1PKYA 4NY2A 3SQLA 5BXRA 4DBDA 1X96A 3KX6A 3EDKA 2R6OA 3G1RA 1V6XA 3GY1A 1W3KA 1H1NA 4HJWA 1UQYA 3DGBA 3QQ1A 5JXQA 2H6RA 3W7PA 5JVLA 4IQEA 1YKWA 3KFTA 3A9IA 3A22A 5HPOA 4J3VA 2BZNA 1XRFA 2E6YA 4BF7A 2VMFA 1VEPA 1QVBA 2W4XA 1W32A 3KCOA 2VEFA 3FJ6A 3HO8A 1U33A 4Z2HA 5FF0A 5A8PA 1E9ZB 2FYMA 1O60A 1VFHA 3KAOA 2ZRUA 2GYIA 3JU2A 3A21A 2OFJA 1FOBA 4FHAA 2NV1A 5EL1A 1ZFJA 1B3VA 4CLMA 3CYJA 2GQ3A 3M0VA 3UXKA 2ZE0A 3H4GA 1RQEA 3FJLA 1E4LA 1XDLA 2YX0A 3PULA 4QS5A 1PHQA 2PTWA 3M6DA 2PRMA 1RPKA 4ZO9A 1UMYA 4IPLA 3BH4A 5LXEA 4DLMA 3SCPA 3VKDA 4LOCA 1TPFA 1EGVA 3N29A 1IWPA 4LYPA 2B31A 3M46A 5I6SA 3ARSA 3GRIA 4H2CA 1J10A 1CLXA 3VKJA 2VZSA 2JE8A 4JYEA 2FQIA 3B9OA 4GXMA 3PG9A 3VABA 3NYZA 3VDHA 4LBUA 1TVPA 1NARA 2CBIA 4BI5A 1IQ8A 2D20A 4EPBC 3VMNA 2DGAA 2PDQA 3BANA 4KBXA 3W00A 1F9CA 1XBVA 2E67A 5BOOA 1KKRA 1QOQA 1AW1A 1PXGA 2CLPA 1TYGA 5H8MA 4GVHA 2PD5A 3FDGA 3JZUA 1VBJA 4LS1A 4RNIA 4R85A 4U2ZA 3M0XA 3KBWA 4ALDA 3UY8A 3H54A 3RR1A 2V2HA 1S5TA 2VGBA 4POCA 4Q7BA 1E56A 2CC0A 3EWYA 4ATLA 1E72M 1V6WA 3UERA 3SRKA 1NIUA 3VGEA 1OX6A 4E2DA 3CUXA 3GDLA 4I3GA 3KEHA 4JICA 3SB0A 3VU2A 1LRQA 1M65A 3WBXA 2DH2A 1E4IA 1U1JA 2O7QA 5LHEA 5DCBA 4E3TA 2ZUUA 3PZOA 4PCFA 3UPBA 4XBJA 2TMDA 3LBMA 3FKKA 1KR0A 1V77A 1UOZA 2YCLA 3EKZA 4MVAA 5BRBA 5I00A 2DT3A 3ZT5A 1A49A 1MQPA 4H6EA 1JZ3A 3Q65A 3EXRA 4CD4A 1BPLB 1Z69A 1YDNA 1ICSA 1S39A 4W84A 1CXHA 1NDWA 4K8GA 4AFYA 1XSIA 1ZU8A 3ARTA 3WQPA 2GGIA 3RU6A 1NP2A 1JVNA 3GWQA 3BLDA 3GK0A 3FOKA 4JIIX 5DLCA 3O0FA 2DZTA 3QW4B 2PWEA 1XFBA 2MANA 2WNZA 2QR6A 4GUFA 1CLVA 3N6QA 2Q8LA 1DHKA 2XYLA 2IKGA 2Y63A 4OKDA 2WHKA 5I24A 3W75A 3IJ9A 4OJYA 3CWOX 2AL2B 3ARWA 1V03A 3FLUA 4U31A 5C9UA 3EMQA 5A6BA 3B3DA 4FX6M 4YN5A 3M43A 3QYQA 3S83A 4DJED 3LYEA 4UTIA 3AO0A 4O0ZA 3WQ6A 3BZGA 1EOKA 4GZJA 2J24A 4GC4A 4EKJA 3RPMA 4MNLA 1X7IA 3MO4A 4WDUA 1B0IA 4LNYA 1XLKA 4L1WA 3AHYA 4J35A 4F0SA 1ITXA 3TW6A 3CASA 1AQFA 1YPFA 5AHFA 1OT2A 1EEPA 1UD8A 4L5ZA 3UZJA 3GDKA 3NM3A 4INFA 1W1PA 1WV2A 1IWBA 4NZ4A 3EEGA 1BKHA 1OFEA 4Z2JA 3T09A 5AC5A 3N11A 4R9XA 3PZNA 4LCQA 4XZIA 1KFJA 1WPCA 3GXFA 3N2BA 4ZMGA 3OVQA 3A24A 3EWZA 3TMQA 3MKVA 3M0ZA 3NYDA 4K38A 3GIYA 2VR2A 3GD6A 2A3EA 4UQ9A 3JVAA 2JGQA 3S2LA 1GYLA 3WJWA 5G1TA 4JTSA 3TSDA 1S3TC 1PYMA 1YW1A 2FH6A 4GJJA 1FRBA 5DCEA 1UC5A 4US6A 3N15A 3W6MA 5ABEA 1YTKA 2YA1A 2ZXAA 1KWGA 4NSBA 4UNLA 3I68A 4OIFA 4MWAE 1C8QA 2E6AA 1NH6A 1MUMA 1JPIA 2ZZ4A 3ZJKA 2C6QA 2QPSA 1HL9A 3N6HA 2ZRXA 4JHMA 3LHZA 3H8AA 3OIHA 5M03A 1KR1A 4UTUA 3WQOA 2O4MA 3GH4A 5AHLA 4MSSA 4QXIA 3USZA 3CAKA 4FR6A 7XIMA 3H12A 1BWVA 1KTBA 4Q8NA 4L64A 3DAQA 3L65A 3CC1A 1DWGM 4LNCA 4L4OA 3ZWTA 4RV8A 3DI1A 2PBGA 1FKWA 5E0FA 3U4FA 3T1GA 1U1UA 3GNPA 3GZ3A 4X0VA 2QIWA 4LUYA 3LCFA 4QE1A 4NF7A 2J9ZA 2OKOA 2YBTA 4UTJA 3CPUA 1HTIA 1K7EA 3OO2A 2OZ8A 4D6JA 1KXTA 3OU8A 3LPFA 3L4TA 3L5LA 4IJCA 4QG6A 2HS6A 3P80A 4KKXA 1W3LA 2P53A 3EX6A 3CUGA 4LB3A 4QJ1A 3TYZA 2QF8A 4J3ZA 1DIOA 4CVWA 3NL3A 2VENA 1B31A 2J6XA 4HT3A 1HF6A 4FF5A 4OZOA 4DBUA 3HJEA 1IR1A 1J79A 3J7HA 1V51A 2IKJA 3SURA 3TK7A 4EIVA 3TONA 4JTLA 2C13A 3S1UA 3NQ2A 1Y0EA 3T2PA 2B7PA 3IANA 3EMZA 4LS0A 4NVTA 1SYTA 4YHGA 4AQLA 1RQBA 1KNWA 1TJPA 2CLKA 3RAOA 2Y2WA 5D9PA 2JALA 4WCJA 1GOXA 4O8AA 2J62A 4QDMA 4RPQA 1UPPA 1EWDA 2YXOA 2X0SA 3W7LA 3OW1A 1EFZA 1QU4A 2ODOA 3TWBA 1W5QA 4GKLA 2DP3A 4F0MA 4MJZA 2P5NA 4XKYB 1GHSA 4S3AA 3TCSA 1IHIA 5F1VA 1JRBA 1XISA 3PB2A 3QF0A 5D2VA 3WQ4A 4AMCA 1QPKA 1K7XA 2GSHA 4ICMA 5CZSA 2XSBA 3F03K 1QFEA 2ZVRA 2EPLX 3FNDA 1MMFA 1NEYA 4XSLA 3W82A 4U3CA 3B9DA 4AF0B 5FOOA 2ZZ6A 1Q6LA 4DAFA 3GHTA 4RUBA 4LAMA 3N3MA 3NPXA 1Q4WA 4ML9A 3PANA 3O05A 1PIFA 4M1BA 4JX4A 2VZVA 3THAA 1H1ZA 1UIOA 3L4ZA 4UTLA 1V0MA 1XF0A 1DL3A 4JHZA 4BQ4A 3TJ4A 1XINA 1KFWA 2RGLA 3MCMA 2PAJA 2WBKA 4OHQA 3UY7A 1ADSA 4J5NA 4WIWA 4O1FA 3WJYA 3B8IA 2YLLA 3WNMA 2VP8A 3AMCA 5C54A 1WA3A 4YYFA 3FA3A 4H8HA 3BGJA 4JQ3A 4QAWA 3TUUA 5EMMA 1W3TA 1IXPA 2AMGA 3P62A 2VDHA 5HNTA 1GOQA 4IG2A 3W1QA 5CH9A 1Q45A 5D2YA 1UWAA 2ONEA 4KH2A 2W0UA 1GJPA 4I90A 5LSMA 1MRAA 3BW4A 3ZOAA 4UOZA 4UBPC 3FEQA 4GY0A 3ARRA 3W1AA 1YPIA 1DIEA 4O1BA 1XICA 2P1FA 1A5LC 1JUEA 4KQNA 1LWJA 3AYTA 2GJXA 4NYYA 2I5GA 1GVSA 3FN9A 4GD0A 3G0XA 3IEBA 3UR7A 2VQTA 4AG0A 4AWUA 3ISIX 3NNTA 1VD6A 3AISA 5A8OA 3MB9A 1W54A 4JTJA 3IV3A 3INPA 1H7WA 3WL0A 2EG7A 4R88A 3NQFA 2QAFA 1H0GA 2Z29A 3VGHA 2A85A 2E8ZA 4I9MA 3KBMA 3HPZA 3P67A 1T5AA 1XLGA 3KW3A 3BAJA 5M17A 3GKFA 3GG7A 4BK9A 4WK9A 3A4AA 1MQRA 3CK5A 5D33A 4ZZ9A 3FYYA 4DRSA 3BLOA 3N2OA 4XO7A 1WZAA 3AU2A 4LT9A 2VC5A 2J8GA 1E6XM 3NQCA 2ZICA 3WIJA 4JDBA 4AEFA 5EFDA 3CH9A 4CCDA 4E2BA 4GI9A 4DWSD 2NWSA 4IJRA 3CT7A 4ZE4A 3IIOA 4ZOEA 1AZ2A 3QJAA 1XGDA 2VFEA 3SQMA 3EDJA 3UWEA 4C7DA 4B2DD 1V3JA 3WNLA 1EJSC 3LRKA 3W1XA 2FIQA 3GHUA 4M56A 3WQEA 1KRCC 4JKMA 4LBRA 4IFOA 1YXYA 4GBDA 5ABTA 2PU0A 4KMQA 3ZZ1A 5I3HA 3T8LA 5GNXA 4B4HA 5FJJA 3OVGA 1DWJM 3WMSA 3VOGA 2XN0A 3W83A 3AWOA 3F2DA 1NWUA 3W25A 3WMLA 4HNOA 3AZTA 4UNKA 1TQXA 3WK2A 1GVOA 3CUZA 3K4DA 1GVEA 4N02A 2PDLA 3APGA 3OYXA 1DEDA 1WYIA 1GEHA 3ARYA 1XIEA 1QNOA 1V02E 2P10A 1BWLA 3CU2A 3BDKA 3S5NA 2W63A 1PWLA 4B16A 4WDTA 4A22A 5GNYA 2OX1A 2D2OA 3UWUA 3AJ7A 2WCGA 2POZA 3N12A 2XTKA 3WJXA 1ZGDA 3GB6A 1REQB 3P74A 2XSAA 2VUNA