2QD4A

Wild type human ferrochelatase crystallized with mncl2
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 144
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A01
3W1WA 2JH3A 2DJ5A 3AQIA 1DOZA 1AK1A 3HCNA 1HRKA 1L8XA 4KLAA 1TJNA 2C8JA 3LYHA 2QD4A 2AC2A 4MK4A 2PNJA 2XVXA 2PO7A 2Q2OA 3GOQA 3HCRA 2QD5A 1N0IA 2QD1A 2QD3A 3M4ZA 4CCSA 2HRCA 1LBQA 3HCPA 2QD2A 4KLRA 2XWPA 1LD3A 1QGOA 2Q2NA 2H1WA 2PO5A 4KMMA 2XVZA 2HK6A 2XVYA 2AC4A 4F4DA 1C9EA 3HCOA 2H1VA 4KLCA 2XWQA 2HREA 1C1HA 2Q3JA 2XWSA
chains in the Genus database with same CATH superfamily
2EW1A 1EG2A 5DHSA 5EESA 5IFKA 1JH8A 1NJ2A 2QK4A 1UXJA 1YB5A 3SEZA 4UHEA 1R3DA 3ZJ5A 3RHFA 3SF8B 3ABZA 4KBYA 5IK2A 4DYHA 3IDOA 2AOTA 1AKEA 2JLRA 3NWBA 1B6TA 3S7TA 1QWSA 2CXRA 4LC1A 4UBMA 1JKJB 1H0HA 4ATNA 4YT4A 1QIGA 3CUUA 5J4YA 1Y8QA 2P0YA 1K6XA 1YZGA 3C8ZA 4URHA 2ZRKA 4DVGA 4RZUA 4FC6A 3GHYA 5EI5A 4XOIA 4F12A 1WMBA 4CUZA 3INTA 4L1KA 4DCJA 4MSUA 2CLLB 2ERXA 2X5JO 2VATA 1TKCA 3AW8A 1Z4QA 4PQYA 4TV8F 5KHAA 4ZVPA 5F3WB 2GSDA 1I3KA 3MRXA 1JR3E 4E11A 4ED9A 5HNKA 4UQLA 1WXIA 5LIPA 5DNEA 1WF6A 1XLTC 2BFFB 4ZYWA 3HEBA 5AW2A 2O5CA 1JDPA 1EM6A 2R8XA 1WBDA 2QZJA 1YTUA 5F4BA 4RY9A 4D0SA 1YSCA 4Y1RB 1EUCA 1KOLA 3ROMA 3LX8A 2YJGA 5JR3A 1I4TD 1W96A 3SC2B 1TFRA 4BNFA 3C3DA 3G49A 1P7PA 2XQGA 1F8FA 4CM8B 3ZIUA 4V1CA 4EG0A 3F8WA 3PGA1 3BWDD 5E38A 1KMQA 1C3EA 2V65A 3E9YA 4XCXA 1WW2A 1T5BA 4JLNA 2ZJAA 3WK8A 4B3MB 3EXIA 2QP3A 3KZKA 2QMOA 1ZIDA 1PL6A 1A9YA 4PG6A 4XRRA 4XAQA 5IBQA 3BXEA 5EJ6A 1BRTA 2VH5R 4Y6PA 1VJGA 4UAVA 4ZYXA 2BAGA 4EPYA 4JL5A 1QP4A 1WUYA 4J90A 4WERA 5K0BA 1EU1A 1Z6TA 2RGCA 4KWIA 3PWZA 2EKBA 4L4XA 3LQFA 1HUQA 4PX3A 1R0WA 2FSHA 3B20A 3GEIA 5FV4A 2ZIAA 4NNJA 4MQBA 3TX2A 3LLCA 3M3DA 4BKPA 3CIFA 3G17A 3Q7PA 5AXAA 3QEKA 3UZUA 3PLAE 1LWNA 3K92A 2OAP1 2O2YA 1GD1O 2IYRA 2WYWA 4XIJA 2Y71A 3SBXA 5J2UA 1OWOA 3HC7A 4MHOA 4PX2A 4OG2A 5GOZA 3RAGA 3ZWWA 2QMEA 3R5SA 1OZFA 9GPBA 1YD7A 2EJCA 3S8YA 1QKJA 3INNA 2I8LA 3B89A 1RMQA 1XIVA 1U2PA 3LPDA 4ETNA 1N6KA 1UC9A 1QTQA 3R2JA 1T3SA 1L4KA 1LJLA 1JPJA 4HUQA 1CZHA 2ZWMA 4RVUA 2XAAA 3HUFA 3KAPA 4DB2A 3DVAB 3TQFA 4S0ZA 2WWXA 3KD3A 1KSJA 1QB7A 4RS3A 3L0BA 1MB9A 4QUIA 1IL0A 2NVWA 4CMKA 3MF4A 5DI3B 5L45A 1UBSB 1KVRA 1M8JA 4OHUA 3AUAA 3Q8WA 3GN1A 4UU7A 5ARDA 2H17A 1H22A 5CB4B 5HKOA 2IZ6A 2LKCA 1R5BA 4EYGA 4NHEA 5ILOA 4K6KA 4NX2A 3AINA 3TRHA 4E08A 5LQNA 1ECGA 1YZHA 3EOZA 3MN1A 3JVEA 3SLGA 2ILTA 4J29A 3CMMA 2VH1A 2BLNA 1FYXA 5B1DA 2HBYA 4A26A 1R3UA 4JXJA 3VR6D 3EPJA 2VRWA 1FXWA 1U0RA 2DT5A 3IC5A 4COOA 1BD3A 2JFGA 3LVRE 4ER0A 2I7DA 3RIGA 2VOJA 1EVQA 5B7GA 3GOQA 3OF3A 3ISTA 1SUDA 2VF7A 4ZVKA 1SG6A 3WGUA 4W9NC 2PT5A 5IDVA 3PTAA 1L9KA 2BH2A 1O9GA 2X0IA 5TB5A 4KR7A 1DDIA 2NV6A 4QXPA 1CIJA 3TZLA 4K7JA 1R5OA 3H87A 1S3FA 1EUDB 3EZFA 4TMKA 3VMMA 4DCTA 4DRXB 5HM8A 1G8HA 4B80A 4Q1FA 2PZBA 1G1AA 4FOSA 1YBHA 2G1UA 5T64A 1F8XA 1A9TA 2RIRA 4QGGA 3AESB 5BWLA 2HUNA 1I7PA 4MIKA 2OKGA 2EGUA 1U0GA 4A5SA 3TPCA 4EKIA 1UFRA 1B3RA 3ESZA 3P2EA 3VC2A 2OD9A 4GI5A 4DIEA 1B2LA 1HX7A 1OLOA 1PYOA 1VZ2A 4C3ZA 4B2LA 2AG0A 1AHIA 1DHTA 1L3BA 1T3TA 2X2FA 1KDPA 3D3QA 1JDBC 1W73A 3LG2A 1F2TA 1HOTA 4Q4AA 4YDSA 4WE3A 3ZBPA 1M3SA 3N86A 1N78A 5DGTA 2KBEA 3F9IA 1DP4A 5FTNA 4H1UA 2BI7A 4PQRA 2HD4A 1DIAA 1F0YA 5FOXA 1RDFA 2PS3A 5DBOA 3WV5A 2FKNA 3LRPA 5DT9A 1DDGA 3TTTA 4CIXA 5JY1A 4F60A 1WS6A 4PFQA 5H3CA 4DNPA 3B9QA 2QPLA 2O2ZA 4ZEMA 4JI4B 4REQB 1NXTA 4AIRA 4RY0A 1YFLA 3J80A 3QUSA 3AI7A 1GNTA 1C0IA 5BSWA 5AVWA 2DHDA 4BV3A 2H1HA 1NBAA 4RA6B 4M1TA 1Z62A 3MINA 4M38A 1BVHA 3WADA 3RKSA 3HP1A 4XYMA 5E9QA 5FO0A 2BLLA 2NAPA 3ZDXB 2P67A 2H0RA 3KQWA 1K97A 4JD5A 4LK2A 1SC3A 3P71T 1KQGA 3U6KA 4KRFA 2F3TA 4KP7A 4R7ZA 3BMOB 2UUCB 4C0SA 1DLJA 4QWMA 4TTSA 1VGVA 2WU4A 2QY9A 5KJ6A 4Q3DA 4FB5A 1C8BA 2W6IA 1FDIA 1JHZA 2I1QA 3AZPA 1P1HA 3MMPA 3QWAA 3EIWA 1I2DA 4CETA 4RV4A 3ER8A 4DDKA 1TRKA 4OU5A 2QSYA 4FZ3A 2Q45A 3FTCA 5BXQC 5HRAA 4CLOA 2ENUA 2ZK7A 3IOCA 3OOYA 3ROGA 2DQ4A 3GP3A 3ONWA 2ZRJA 5FOSA 2I4MA 5CG2A 1IC6A 4TKZA 1IZ8A 1B41A 1WNTA 4DBLC 2C3MA 2PU7A 5T4EA 1QK4A 5I47A 1JL3A 1G8PA 2V3WA 4GI7A 2HXSA 2HA3A 5J2TA 3ZPXA 2MYUA 4CQMB 5BYAA 1NG9A 2COEA 1T2VA 1IM5A 3DBHB 3MELA 4O4LB 2IW1A 3QEMA 4BQEA 3SFVA 4ZOAA 1Q57A 5CEJA 2F3PA 1A4XA 4X3PA 1DIOB 3QWBA 1U0OC 1E1DA 1N9GB 3OLXA 3ESAA 4II2A 5ECYA 5AW4A 1FLNA 3LUJA 3D6FA 4DBZA 3T54A 3UC9A 1S4QA 4CMGA 3EGXA 2RG1A 5KYVA 1ISHA 3E5RA 1ICIA 2CWDA 2LZ0A 2ZSAA 4DS3A 1Z5GA 5JAOA 4MWCA 4YDQA 1MF7A 1QSGA 2FSIA 2VDQB 3R7WB 4CEHA 1K7XB 5EN4A 4BMCA 2AN4A 2RHRA 1CV2A 1ORDA 2VTBA 1M34B 3EEFA 5ENZA 4CLEA 1QJ4A 4IH9A 3WGKA 2CJFA 2IXFA 1DCFA 4CKXA 3H2KA 1T36A 4W63A 4PZEA 3WYCA 1OAOC 1T13A 1NZJA 3PE3A 3BGWA 4HADA 2Q5LA 1XEWX 4EK9A 8AT1A 1A1SA 4CMBA 1TLLA 1M2OB 1VHLA 4TV8B 3GCDA 2J48A 4YMWA 2EJTA 1GV1A 2F3RA 2Y1GA 5CA0A 5AI0A 4NENB 1C3XA 4HEHA 4AWAA 2I55A 4LY0A 5K8TA 1E6LA 1PT7A 3HWRA 5CDSA 2J59A 1W9HA 1H6CA 3B5JA 2X3FA 3WK9A 1B4DA 2O8DB 1LB1B 1PWXA 1TU0A 1DE0A 3BXFA 3D6JA 1P7WA 5F1YA 3O8NA 1VYHA 2ZBUA 3FOCA 4GE0A 2LW7A 3BUSA 4UUNA 1OZAA 4GFDA 4PU0A 4DJEC 2JLWA 4N3GA 4E51A 5DXAA 4H7KA 4ZPJA 4XUCA 2QRVB 1BX0A 3ELUA 1EFHA 4LXGA 4R05A 4BYMA 2NVUB 1D1QA 2XF8A 2NPIA 4Z7OB 5ICCA 5J58A 1M0EA 3G23A 4R2LA 5BWCA 1YVDA 3BF8A 1VRVA 3VNRA 1T3LA 1U11A 2Q9CA 2ZG6A 3B13B 1KZ7B 1Q74A 3H18A 4QECA 3TX6A 4RTRA 3RRMA 1NW9B 3N2KB 3O94A 2UV8A 3S99A 3SR3A 1W36B 4GL2A 2OCXA 1Q0RA 4Q4JB 2B3TA 3OPQA 2Z8XA 1PJRA 1DRJA 3PWSA 1QANA 1UDWA 4FYVA 1AKTA 4YVFA 1ZD3A 2EG9A 3Q9SA 3SJBA 5D3QA 2O1WA 3MAAC 3NKFA 2C9DA 4JQOA 4PPQA 4YCNA 2UU9B 5EWLA 2R8BA 1GPUA 2JD0A 3LUBA 1QIKA 1R6UA 4IHJA 4FJ2A 1G7CA 1KVUA 1DTWA 1VFPA 2WUFA 1ZOOA 2Q5EA 2XWSA 3LYUA 2V6FA 2HA7A 3QKUA 5LDDC 1Y8ZA 3WB1A 4AKIA 3MEQA 4WADA 1AIPA 1R4NA 2V7PA 2CNBA 2XADA 4KGZA 2HA2A 4MITA 3LW7A 1QVAA 2JIBA 4BRSA 1W9MA 3I9KA 4A0SA 3KKZA 3CNEA 2J46A 3KKQA 4OHFA 2ROQA 3U3OA 1Z6GA 1G5RA 1JKMA 3UV6A 4F72A 1U7WA 1T8SA 3LD9A 5B64A 1ZI9A 3HRKA 4LRYA 1HSOA 4H31A 3BSWA 1K06A 2E89A 3GJ8A 2C94A 4GOKA 3HUDA 4X94A 4LQCA 5DLPA 3SQLA 3VR4D 4M7RA 3DULA 5FD8A 5JNWA 2FJ0A 1YACA 2GZMA 1MC1A 2GPJA 4M21A 2OV6A 2VF5X 1XQ1A 2OZLB 3RU7A 1QO0A 1HMPA 2QPTA 4EQZA 5D5PA 3LHSA 4KKVA 1ZICA 3QZUA 4YRQA 2XH8A 3H0EA 5EUMA 3KJXA 5JCJA 1IE3A 4JLUA 1EM8B 4YUZA 3PUZA 3H17A 1NIPA 2GJSA 1FB5A 2Q0SA 5I3CA 1MAAA 2C0PA 2NTJA 4OXIA 4NQZA 3V6MA 5C80A 2YFHA 1D0VA 2YV4A 5HIIA 3RARA 4MR9B 2CT8A 3RODA 3IPYA 4D92A 2XCIA 1PFVA 2OLKA 3GFRA 1RAHA 3SZ3A 2BKXA 1PAUA 2C3UA 3CRVA 4W5JA 1VE3A 2PYIA 2XUPA 4OJNA 5JD3A 5LBUA 1K75A 1FFSA 1NFRA 3V6LA 4CF3A 3ABSB 5LZ9A 1ILEA 3TFQA 4U2GA 2JCYA 3GFGA 4HDKA 1FX0B 4RGQA 1KPIA 2DZDA 3RABA 1V48A 2QQFA 1F12A 1FFDA 1QAMA 1EDDA 2XY4A 1PK7A 1I3MA 2ES4A 2MTBA 4BP3A 2QNIA 3KWFA 5HKKA 3HA5A 3SYNA 1IOZA 1V35A 5AJWA 5TPWA 2NP6A 2IUTA 1YONA 4YJFA 4LTMA 4MWEA 3T7RA 1XBTA 3LECA 4GRAA 4CIAA 2O7SA 3VDQA 5A1TA 1YI1A 1PBTA 2P9GA 2QXTA 4WGGA 3QYJA 2CC2A 3JYPA 5FUYA 4ZAWA 5KYYA 3U7IA 3BH7A 1DUSA 3TXAA 4G4SP 2I6GA 1U0HC 2WM8A 2VJNA 4I2NA 3A6ZA 1WHSB 3AKCA 3NT5A 4ZCPA 3GEBA 3H8JA 1J33A 1CQIB 2YFKA 3ZGYA 3ASYA 4YBRA 4HYEA 4XR9A 4WXPA 5AP9A 2BEKA 1QQBA 4I1YA 5ETJA 2VFAA 1FUEA 4HNQA 1WCXA 1GL9B 1L4BA 5FL3A 3FHOA 1N8KA 2W2KA 1IPHA 3CA8A 3OQVA 3WLJA 4EX7A 1IB0A 4MRAA 1ZR2A 5JPIA 1TW3A 2G7ZA 1N6HA 3TLJA 4NU8X 3OCVA 2XNDA 3KD2A 5IHXA 1T2FA 3CUSA 1L3CA 2B8JA 5A1JA 1QYVA 4JC5A 1P4SA 3CLUD 3PJDA 1XCJA 3WHIA 4IS3A 5EXTA 5B4VA 4YRDA 5E4FA 2CSXA 3A6KA 2I54A 3H8SA 3O82A 4CYMA 2YMPA 2Q5CA 4QAQA 3N53A 1PS0A 1L5NA 3W2FA 2LP4Y 4I55A 5LP6A 1T0JB 1BHJA 1XTJA 1SCIA 3VOTA 1E61A 3DAHA 4ZD6A 4BU1A 3AO0B 3OTOB 2HV9A 2LRHA 2DB3A 4Z1MD 4ZI3A 2HRZA 1RM0A 2YTZA 2WHPB 4M7OA 4XQ9A 3SNKA 3UAGA 1MUUA 3UWOA 3DDSA 3VTFA 3FD8A 3TM5A 5SYAA 4DDVA 3OQBA 5LA6F 2QLLA 3CJTA 5DTQA 2W8BB 5KC9A 1PJ8A 1Z4JA 3LQ1A 1FRNA 3R41A 1RI4A 1CEYA 1AD2A 3OEWA 4GRDA 4PO9A 3AVTA 1T9AA 4LDRA 3JQGB 2WYHA 3ORFA 3LV8A 3ORYA 4YRRA 1RLJA 2D3WA 4OKIA 1JVNA 3OA2A 1H6DA 2OZVA 5A62A 3T38A 4G24A 1OGIA 2BCJQ 1RLOA 3SC3A 3BH6A 1GFZA 1G60A 2HBZA 4BEWA 3THWB 4EO4A 3E82A 3HCAA 1YL7A 5IZCC 1VMEA 1UEXC 2OILA 3ZVLA 1G19A 2BEUB 4EI2A 2YVQA 2D13A 3OC0A 4NKRA 2JIDA 2O4UX 5T8KC 3VXKA 3TVTA 1RQLA 3E8SA 2XYHA 3COVA 1QTNA 3N7UA 4S3MA 3FFXA 2VNKA 3LLSA 1ATZA 2MYPA 4M0KA 2GM4A 3DMGA 1DAOA 2VDWB 1REQA 3OIGA 1W4ZA 4Y9RA 1XZGA 2G76A 4I3HA 3GN2A 4S1WA 1DPFA 1QHHA 1SB8A 3RG8A 3AF5A 1GEEA 1YUMA 3GFQA 4B47A 2Q7XA 3E9RA 4F7WA 5TVKA 1U3GA 2JH3A 5KX5A 2IDJA 1KWGA 2IPLA 2GK7A 2A5YB 2Q99A 1EX9A 3A4YA 3O0TA 3R40A 2A0UA 4Y2RA 1L5VA 1TVMA 4QJIA 3VU0A 4E4YA 3UV3A 1AV6A 4U7WA 1T5OA 3DJYA 3TAUA 4KK4A 4C7BA 1WKVA 3KT6A 2ACKA 5F7XA 1EVLA 3LFHA 3LHDA 2OHXA 3N2GA 1MO5A 3OQIA 3D2BA 2Y1CA 4HNHA 1P3DA 1ULHA 2VC2B 5J4KA 3OEED 3KUUA 4JU8A 3HBMA 1INLA 1MT3A 4A82A 4BLRA 1E94E 4BNZA 1FXUA 1GNQA 2C82A 4S2EA 5DBHX 4BC1A 2E6UX 1UPXA 3JD4A 5EUCA 1US8A 4WKNA 3URKA 5MN5A 1R4MB 5IJXA 5JJCA 1N6OA 2X8LA 5ENDA 3TW0A 3NC0C 3IDZA 4MB2A 3ZLJA 1GDHA 2YYSA 5JC1A 1EGMB 3K09C 1OA1A 3IAS1 1J0EA 2XD4A 4MAAA 1I33A 1NX9A 1U8ZA 1Y1QA 2BUBA 4E5SA 3RDPA 1V5EA 2VQDA 1STOA 1W88B 3AXSA 5DK6A 4DWJA 2JASA 1H1TA 2QTLA 1AQ6A 3KXIA 1K08A 1LGYA 4FEYA 1L3IA 3GT0A 3MOIA 4OMDA 4R69A 3TDKA 4ZGWA 4C87A 1G5QA 3PWKA 3SQMA 3BGDA 1VZ3A 3T3GA 3MQ4A 2HNBA 1TQ8A 3V4SA 3ICEA 1PJZA 3R3ZA 3BREA 2C00A 2FFHA 4XB6B 5CMLA 1ZVKA 3AJ9A 3FHLA 3WP1B 4EELA 1ZOLA 3TF5A 8ADHA 5KREA 3D8UA 4UNSA 1GZDA 3HYSA 5ADUS 1RAEA 2SKCA 2XUFA 1YU9A 4U7TB 4DZTA 1J1IA 4ZJPA 1ISSA 3H0CA 1EDOA 1FK8A 2H11A 1CJTC 1U3DA 2APJA 4EAQA 4HDRA 5CR9A 4ME6A 3VNSA 1BMQA 4YN3A 4JL8A 1FSFA 3LP8A 1ILWA 5I9SA 3AKDA 3H65A 4FR2A 5E9WA 3L41A 3TJRA 3S1AA 3VBEA 4MGKR 1N2EA 1IZ0A 4JT4A 3T5TA 1MAWA 3CEHA 1I4WA 1WQ1R 3PDJA 2QL5A 1SOVA 1VJ1A 3RFXA 3OOJA 4FYMA 2SKEA 3DLAA 2F3UA 1ZK0A 3OPNA 1Z34A 1YRBA 4N5IX 3AEUB 3HCDA 4LNHA 4EWLA 2QM7A 3GJYA 4KHZA 4RPKA 3PGKA 1T9KA 1K7YA 2OHGA 4R7TA 3UXMA 5KYXB 3OEHD 2NT3A 2YJ6A 3IUBA 3PNSA 3Q8MA 4IJMA 2G09A 3JZMA 1LA2A 4YUXA 1KYVA 1HH4A 3HUUA 1XTZA 2R3SA 3PNMA 4XX1A 4CJXA 4DPMA 3CZCA 4NYJQ 3NETA 5BN1A 4R51A 1Q1EA 3HWSA 1MO6A 2X5XA 4B3RB 3SJZA 1RJ9A 2SECE 4AJEA 3M6FA 1LH0A 1OTYA 3L0SA 2DCMA 1NJ8A 2L42A 1SAYA 3KB6A 4OKNA 1YCDA 4KH0A 1NVGA 2Z4RA 5E3JA 2CUTA 3L8ZA 2QUJA 3INGA 4BZQA 4LOJA 5CU7A 3SE7A 5DLQC 5ALWA 5DM1A 1Y3IA 1D3AA 4GYWA 4QGHA 3QIVA 1ENOA 3FOBA 3JXEA 3V1KA 4U7JA 4UFPA 3AUFA 3QBTA 4IIHA 4LXHA 3KQHA 3RVMA 4MQUA 2G4CA 1PNVA 3V4FA 2W58A 4HAZA 1UK8A 3N8NA 4XDYA 2E48A 4I8DA 1N1EA 4W1SA 3S40A 3GFFA 3Q3GE 3H04A 1WTCA 1EVYA 1RPJA 1JMYA 1TDJA 1ZAKA 2IF2A 2HRBA 2VA8A 3OAAA 2P3LA 4RTPA 2QYHA 1SVSA 3CW8X 2CLEB 1W35A 2YZNA 1IK4A 1U7PA 2QMHA 2GYVA 4MWTA 5FTKA 6PFKA 3PGXA 1GN9A 3K20A 3LYAA 3OIWA 4V0LA 3NTLA 1L5YA 4HXEB 3T5PA 2P75A 4HAUA 4ZDWA 4L73A 1WCIB 3I45A 3KVVA 5KSYA 3VKWA 3ESBA 4U02A 4LJ9A 3ZQ6A 4ZEWA 1SBNE 2JDID 4RZXA 3GLIB 1YOVB 3ZWPA 2WB4A 1H2HA 5JANA 2CL0X 5FYQA 5EIAA 3A04A 2OXRA 2GFIA 3R7DA 1UOPA 4W4TA 3Q2KA 3JALA 5JY6A 4FWTA 3IXQA 4L5BA 4ZA2A 4XFJA 1RYMA 1JHUA 3P9PA 2ALJA 2YX1A 4LFCB 5K4HA 3WGMA 1H05A 5B57C 5CAEB 1GRNA 4YT2A 4IEEA 1OZ0A 1ZBDA 3D2LA 3EGVA 4YDHB 2HJRA 2PYDA 2I2WA 1ZSNA 3GWZA 1BCRB 2XE4A 2CVPA 3KEGA 1QAQA 1C2YA 3GVXA 4UNQA 4A03A 1OBCA 3UQZA 5K8JB 3DZHA 4B44A 2K87A 1U2QA 1ZH0A 1R0LA 4M4SA 3V1TC 3ZG6A 1FMCA 1E4EB 1KWKA 1DC7A 3DGEC 4Q00A 1KKLA 1E7YA 1ZEMA 5IEJA 3J7AC 3M7IA 4N12A 4YECA 1AK9A 1T25A 5HZGA 2AE1A 2ZFUA 2GKGA 1Z08A 3U5TA 4AZWA 4C14A 3RGWS 1JHXA 4YJ3B 5A06A 3RQSA 2HFJA 2HPHA 3EB9A 4PGHA 4ND7A 5LA6B 4AK9A 3RS7A 2ZYGA 3AM4A 5HCNA 2PBZA 1VYTA 1Q20A 3K8QA 4WBNA 1MVLA 3P9NA 4Z9BA 3B6MA 4B31A 2P1ZA 2GXSA 4PZYA 2O4CA 3I5YA 1GZ5A 1L5LA 2DAPA 3NOOA 3GLHB 5AI9A 4FQ8A 8ABPA 1GV0A 1Y63A 4ARZB 3RV4A 4FFDA 3QOWA 3MRTA 4AN1A 4DUGD 4EP1A 3OZDA 3UB3A 3MWGA 4JLDA 3T9DA 2WTUA 3LJKA 3RRJA 4RQAA 4F4UA 4N65A 1GADO 1KORA 3KNZA 2D2VA 4J9VA 3QA9A 2I4LA 2VEDA 2OBXA 2XCOA 4PZUA 4EEXA 4X8HA 3KOXA 2PFSA 3TCXB 3DZJA 1RCFA 2ZUCA 1KMHB 1FQKA 1K3FA 2FWPA 1TM2A 2ETXA 2IHJA 2IEAA 2OQRA 2XHZA 4NBUA 2O6HA 1DNPA 4JHXA 4UTNA 5FH9A 2VQFB 2X13A 3N05A 2QTVA 4RVHA 1UT8A 4ER7A 5C8YF 3KK0A 1PVVA 1OKKA 3D3JA 1XTBA 5A3SA 1KZHA 2ZTHA 3IAS6 2K4MA 4TSFD 3KKPA 3CF2A 4FFOA 2DWCA 5TC4A 1IY9A 1NM5A 2W0SA 4MYRA 4K1XA 2HNKA 1U98A 1GL6A 3H5LA 3CX4A 2MSDB 2FPPB 2YR0A 3NFRA 4WT7A 4ZVQA 4BLPA 2HHLA 2HT6A 2OHHA 1T1IA 2G3YA 3E8MA 3O74A 2NO5A 3ZCRA 2Y1KA 2PUJA 4GOXA 4OK3A 2WJGA 4I50A 2V1UA 3GPCA 2JI7A 4FLFA 1U7HA 1RAAA 2DUNA 4MKXA 1U3UA 4QODA 5C1IA 2NO4A 3P2KA 2PQ2A 2HZ7A 2ZE6A 3U4QA 1YA6A 2Q0XA 5F5LA 4BIMA 4CMIB 4D0NA 2WVJA 3PLNA 2XSZD 3OHMA 1PFWA 1WXWA 1T10A 4ZRMA 2FW1A 4GPIB 4IDBA 2WPDA 3FDZB 4D6PA 1EWQA 3LX4A 2AXNA 2WTBA 1MTOA 4DMMA 5BWMA 5JAMA 3D6AA 3Q3CA 3H2SA 3FJOA 5G3YA 2GBPA 2X7JA 5DNYB 3ADPA 2QUHA 1H85A 2RHMA 3D8SA 2FUNB 3JQ7A 3L79A 4K6HA 4TUYA 4WOJA 2G88A 4C0WA 4I1VA 1P2GA 3ZK8A 2NM0A 3GYBA 2MSEB 3N75A 1XF1A 4NCNA 1YJQA 1I30A 1OI2A 3TAXA 2QIOA 4M87A 5SY6A 5A6VA 3ZZ1A 2GXQA 3TJZA 2GJ9A 5LU9A 1Y3HA 2P7IA 3NWOA 3SX0A 4Z8YA 2OYCA 1M2FA 3KR0A 1ZCAA 3MWEB 1ECBA 1L7PA 1YZ3A 2REQB 3I32A 3AF4A 2V3CC 2ZCVA 3D6HA 3NS7A 4L7VA 3IVGA 4E5VA 4DR1B 2EV9A 1USWA 4PINA 3JAWB 4HLQB 1D2NA 3LF1A 4UTOA 5TDHA 4MRPA 4K1LA 4BDTA 5JFGA 3L0ZA 4NEHB 5HJEA 5EINA 4F9TA 1XRSB 1KI7A 1OHHD 2VK1A 3QQ5A 4O3FA 4OYLA 3M70A 4JKYA 3F3KA 4WJZA 4ZOEA 3VVCA 2WPNA 4C2AA 5B58T 5KTRA 2DPXA 4DV6B 4LW8A 1M0TA 1XTIA 2BHTA 3CN7A 3NDPA 3PZBA 4BCCA 5IUJC 9ABPA 1TUIA 2NSJA 3HJHA 3LGAA 3PPYA 3Q87B 3EDMA 3NH6A 5ADWA 4OA5A 2KYRA 2P79A 1I2BA 4GPBA 4OXXA 2WJYA 2WHXA 4HT3B 1K5DA 3QELB 2PMCA 4J1NA 2YJ4A 4IBOA 1P75A 1NVBA 4NJEA 4BQQA 2AYYA 1M0SA 2BZ0A 2E1RA 5GMOA 2CV0A 5IKPA 3D7KA 1J25A 1Y3AA 1LDYA 3LKVA 2W0MA 1KGDA 4IZOA 1IJKA 3QVMA 4JUIA 1EE2A 4J75A 4TSKA 4CKBB 2AOVA 1OV6A 3LA6A 1DO2A 2A92A 4MRMB 4ZO8A 1P3JA 1QIFA 5LB4A 2GH1A 1N36B 2HW8A 1CX9B 1KU0A 3AUSA 2RHOA 2BHLA 2ZYDA 3E7XA 3WAJA 3TB4A 4D46A 2I29A 1S3GA 2GS9A 4GKJB 4Z0TA 3ENZA 4EGSA 5EPUA 2BKEA 4D81A 2DQSA 4HGNA 1YS2X 4G84A 1RHUA 3L04A 4GSLA 3VPBA 4NU5A 2HMUA 2IOFK 1NUAA 3QG1A 2IIQA 3IT0A 1HFEL 2IKSA 5DK4A 5ALIA 3VO2A 3OWHA 4O1HA 4M1WA 2PTHA 3E7WA 1UZUA 4IH4A 4Z53A 1ZJ6A 2EEPA 3GDOA 3DMDA 4XEUA 3U49A 3VR5A 2GZ1A 1FLAA 5C81A 1PN3A 3FUUA 1ZM7A 3ZNPA 4HVLA 3REOA 1I5EA 3HBFA 4KOAA 5CH5A 2QENA 2H7XA 4MP8A 5DIZA 3VA7A 2F55A 1BA2A 2O1EA 2Z08A 1MPXA 5EKUA 4HFMA 2Z56A 4DV0B 4G5QA 4WXMA 5J63A 1Y82A 3LL7A 5J4LA 2UUAB 1OWLA 1ADFA 1RI1A 3OM9A 4IM7A 5DNVA 2QSJA 1G0NA 3KXKA 4JELA 1NY5A 2I2BA 2QS9A 3G89A 4QNMA 1EIWA 4R9UC 2IHVA 2JGLA 1ESZA 2PGOA 4ZV9A 4YB8A 1UPTA 2CJWA 4JB3A 4LXTA 2R87A 4ZI7F 5EVJA 4HH3C 1IQPA 3A27A 3CLTC 3KFVA 5F7ZA 2JCSA 2VHYA 1WHTB 4OLHA 4U3JB 1H6AA 4RO0A 5IDYA 5G2OA 2BBSA 3VH2A 4I8IA 3ZU2A 2A1UB 3FHCB 3P9QA 4B4KA 2XTAA 1X2BA 2EKLA 4F04A 1D5CA 1B43A 4M1ZA 1V8OA 2X23A 1PUIA 3OM0A 4GX5A 2CMKA 3PE4A 3RANA 4B3BA 4CDNA 2WSIA 2GGSA 3CLSC 2ZOSA 2BMDA 5I9BA 1LBSA 4NE2A 4NATA 3FWPA 4HHEA 5G41A 2O2GA 3CZ5A 5CVEA 3VYUB 3QXSA 4QUDA 4EG6A 4PLWA 4IGKA 3IP5A 2FZLA 1X77A 2P4HX 4C4RA 3FKSD 1TOAA 1YQ9A 2OAQ1 1HQKA 3A06A 3TQQA 1CUGA 2Z09A 2BGRA 3OPYA 2NU6A 4LN1A 1KSFX 1E2HA 2I7TA 4GPTA 5KYUA 1XLVA 3KJQA 3A32A 1JWBB 2LCIA 2VHQA 3HN7A 4WY8A 1II0A 5C3MA 3SXUA 1OYYA 3GH1A 1P9NA 3AM5A 4XD7A 3TLGA 4DG9A 4QJ5A 3DF7A 3FFWA 3E53A 1NAHA 3HKCB 2OOKA 2PPLA 5C3UA 1A9QA 1JE0A 3Q10A 4BJ5A 1IWOA 1DEXA 3HB0A 1ZK4A 5FWDA 4CLRB 2O2JA 1QHIA 4CLXA 2QN3A 4HGRA 4QLBA 3A6EA 5F21A 1RYHA 3UMYA 3WLIA 1PVOA 1ZMTA 2CVZA 4O2BA 2I3DA 3HO6A 1TQDA 2WIDA 5REQB 1CG6A 5JECA 3EG5A 4TKVA 5A4IS 3I1JA 4DF3A 1JHMA 2N0SA 4MW6A 1C3VA 1WIWA 2DR3A 1L5OA 4KXQA 4DVJA 5B36A 5K0EA 3GAZA 1EYZA 4KFUA 4P83A 4X97A 4GNKA 16PKA 1CY4A 5D1NA 1QG0A 4P36A 4QRIA 1M2WA 4HAVA 4ERXA 2M32A 3LNTA 1BKSB 3I9OA 4MWOA 4Q39A 1G3MA 3TH5A 4OB7A 3WLLA 4F6LA 3K9GA 1ZJJA 1ZK3A 1E2IA 2EZ9A 2P9HA 3HZZA 2DRIA 1XEAA 2GESA 4RD4A 3AYZB 4ARAA 3AERA 5C52B 2O6LA 3RWMB 3B6KA 3GARA 5C8YB 3BQNB 2ONYA 4L8YA 2I03A 1QC5B 4KQIA 5JHHB 5LXTF 1PR9A 8ATCA 1IOWA 2WINI 5IMSA 5LBTA 2XCLA 2VHUA 4JMPA 1XEXB 2XHEA 1OUMA 1TF7A 3KDSE 5CLFA 4EG7A 5G1NA 2FR1A 2KLHA 2Z5FA 3W9BA 4X44A 3ECCA 4QYIA 5B37A 3JWHA 4ZHSA 4EYOA 1MR3F 2IQIA 2FB9A 2NXCA 1II8B 3AQ4A 2M1XA 1EG7A 1FBNA 2DBZA 2HRRA 2NSDA 3NGLA 3MW8A 4PAGA 4PHFA 4ZCTA 5I48A 3AEKA 3VM6A 4KUGA 1MFPA 4TYWA 4B6PA 3AR5A 4I5GA 1BMFA 3B12A 4KN6A 5ALQA 3GRYA 2OM6A 4GMDA 4BGUA 1HSZA 3OA0A 3K73O 3ER9A 2BI4A 4D45A 2YXBA 3GJRA 4UDYX 4H9GA 3WRVA 4H15A 3M5DA 4XWTA 4TS9A 3M4ZA 3RYIA 5ALYA 4Z54A 5K0FA 1U3VA 1E2BA 1WB4A 4KPFC 2ZIXB 2EX1A 2X4LA 1EXVA 4V1CI 1QMPA 3B2NA 3COYA 5HIKA 2OGTA 3L6UA 5KZMB 3V3TA 3C1TA 3GVPA 2OGUA 2OKCA 2W48A 3OECA 4JUAA 4LIPD 3RBAA 3RFTA 1NMXA 1KJIA 4FCTA 2WEKA 4HKTA 4QIHA 2WP8J 2E85A 4MYHA 1NDQA 1BD4A 4LDPA 4PQFA 3G8BA 3ZE9A 4XDZA 4Y2JA 4EYQA 3DE5X 2ZSIA 3PENA 4IXWA 2H8KA 1Q50A 4HQKA 1P5ZB 4K81B 3G9ZA 4N76A 4J4HA 4MB0A 1RYFA 2DBQA 2EERA 1RYZA 4KFSA 4UVIA 3W8RA 1N57A 1OLSB 3KQSA 2V6GA 1H4TA 1GAQA 1RD4A 2ZBGA 1KY3A 3GFVA 2FSUA 3NDIA 4FGJA 4Q7KA 3B1JA 4N6GA 4ZCRA 1YHNA 3UAOA 1BDMA 1T3GA 3ZKWB 1NWHA 2GOYA 2ZVQX 4QPPA 4CEIA 4B3CA 4HRXA 1U9JA 2VXCA 4M0UA 4I4NA 5BN5A 1PR4A 4RETA 1YB2A 5J5VA 2ZZNA 4QARA 3FUXA 4ZU1X 2X76A 5LP6C 3WXBA 5JD6A 3K9FC 2WWYA 3UMJA 2I2CA 4M88A 1OFGA 1R16A 2C5AA 2RHBA 4G8CA 5ARBA 3AVXA 4OB8A 4HWTA 4OIMA 1PFKA 3VH3A 2IS2A 1TLFA 2QVGA 4G9GA 1RXWA 5JQWA 3DKKA 1Q0PA 4RU1A 1HM5A 5G1PA 3JQRA 3MTJA 3RT9A 3WSVA 1YR6A 3L5OA 3MTGA 4HEJA 3WWEA 3GCGA 1X1RA 2CXUA 4JBHA 1JEQA 1Q17A 1H66A 1LLQA 4JLMA 3ZVRA 1GPNA 4JXKA 3UOWA 1TFUA 2ZRLA 2GD0A 3TGLA 4Q9DA 2YXNA 4IDQA 4ZVVA 2BGLA 5ICFA 3EVBA 2YWHA 4MYUA 1NSFA 1P1RA 3PK0A 1YFKA 1WCWA 4KN9S 1DRWA 1LC3A 3HNOA 4LMPA 2FRDA 5AHKA 4DSUA 3W2GA 1X8LA 4XEHA 2XKJE 1ZD1A 2V7UA 1A27A 1WZIA 4JP5A 3C6YA 4M9CA 3G3EA 2XOEA 2DH5A 2O8NA 4L2IB 1RADA 4W1RA 2IHKA 4EUKA 1GPYA 2XVZA 2PKQO 1A8HA 1MAHA 1MP0A 2VSYA 4QOFA 2VSQA 3TIGA 2CXOA 1SBQA 1MDFA 1W4AA 1KDYA 4D74A 4DTIA 5B7QA 4NU6A 4N0DA 1UKCA 2HREA 2OV8A 2ZB3A 3UK1A 4G36A 5AH0A 3LCVB 1KQNA 3CEJA 3O91A 5LVAA 1BJRE 1Z82A 4HY3A 5KYGA 4AXXA 3KCQA 5L7YA 4G37A 4CQMD 3MMZA 2HEGA 3OE7A 3HPRA 4RTOA 3KE8A 3EGDA 1G8GA 4AG6A 2IP1A 4CFYA 4N3AA 4KV7A 3IAUA 2P41A 3C6ZA 3LZCA 3O92A 2NT4A 5ALDA 5AJUA 2XWJI 1TB4A 3OFJA 3TQHA 2UVPA 2FSGA 2NU7B 1J8MF 2PGJA 4ZI7B 4TRNA 4DPLA 5L3VA 4NICA 1J5EB 2CHFA 4RIGA 1HLFA 1BGXT 1BKYA 2BGIA 4O33A 4WCFA 2G8LA 4OK6A 3TZHA 1G3IA 5DBGA 2C3YA 3RHTA 1V7ZA 3K71B 1X7GA 1Y3BE 4YRSA 1G5IA 2WJ6A 3PEUA 3FUTA 4NABA 2K2QB 5CNIA 2KHZA 3QKSB 1Q0SA 4WBSA 1C1XA 2HNAA 2WHYA 1UBUS 1JB1A 5D3ZA 3FPJA 4GVLA 3GCWA 2JGDA 2AOUA 2W7TA 2JLBA 4FCCA 1QQ7A 2IC5A 3GEPA 4G8DA 3SK0A 3Q7IA 4HMQA 3CCBA 3WGHA 4AURA 3EZ9A 2DGDA 2RH9B 1V7QA 3OEYA 5C7LO 2AQ8A 3Q6NA 3AEQA 4JOQA 2R1TB 4J6FA 2W6NA 5FTJA 1ZVJA 3K7EA 2JGJA 5AM0A 1BAPA 2XECA 3QHAA 4EKNB 3EULA 3KKMA 4TXHA 2ZIUB 1J22A 1UFVA 2PV7A 3L0YA 4AY5A 1P29A 3JWPA 4TQUS 3EIOA 1VLJA 2GK4A 1A98A 1RE0A 2QAIA 4OF4A 3VQTA 1WUJS 2ZPTX 3CZRA 4KE8A 4MWDA 1BA3A 4XARA 4DB4A 4O4JA 1LLDA 4BAUA 4NEGA 4E12A 1Z38A 2VHTA 2IK8A 5DW0A 1KJZA 4MO9A 1SKMA 4FGUA 1RI5A 5E6RA 4JC8A 1YIDA 5C53B 4ZYVA 1Z06A 1IUKA 2NU9A 3K0HA 1U3CA 1TU4A 2ECFA 2LVBA 1XPJA 3AEZA 4XZ3A 3BD9A 3E70C 3EEOA 4LNUA 4KSYA 1XFDA 2A57A 3LPCA 4PE5B 4D8TA 1DXHA 3V55A 2N42A 5KYTA 3GPIA 4BVLA 4QELA 4BO1A 1A04A 3O9MA 4CEIB 3D6TB 4GLLA 1P1JA 4TRMA 4FJ0A 2Y6UA 3DMRA 1F2UA 1QPBA 4FDVA 2NMVA 2QTWB 4UFNA 1AGYA 3KPVA 5KAPA 3S8EA 1GRRA 2C20A 1W36D 1HOXA 2OQIA 4QBTA 4Y9SA 3V4LA 5DSXA 5MFZA 3WJ2A 2AFIA 5SICE 3PHJA 1WRBA 1NNSA 3EUWA 5LXTB 2WABA 1U28A 1EJ2A 2MMGA 3QLVA 3GHHA 3DV0B 3M3PA 3OLCX 3TGWA 4P84A 2QUBA 3KELA 1RR6A 1I80A 1BE0A 3LXMA 2MU1A 1LBHA 1TMYA 2YMQA 3K1AB 5JPCA 2C88A 3VU9B 1Y98A 3GUUA 3LUDA 1XPOA 1F0PA 2P6RA 3PTLA 4OHYA 5PNTA 1WUKS 1VDZA 4B3IA 2WMNB 2YH2A 4TMTA 4MUHA 3WFZA 3BWYA 3C6MA 1E9RA 4NQRA 3EWAA 4PBTA 3ETHA 1DG9A 3DOJA 1CR0A 2B6NA 4GGPA 1NXOA 2AXPA 4BFCA 3AT1A 1GSIA 4Y6LA 5JJIA 2X0EA 1XA4A 3SSOA 2Q28A 5AW8A 1ZINA 3HV0A 4MR8B 2WM3A 2G83A 1WOMA 2PWYA 5IJAA 2EG5A 2ZB2A 2D0PB 3R7LA 2BFWA 4EG3A 1G66A 1KH1A 1Q3HA 1Y1LA 3M6AA 5EJ4A 1D0IA 5UKDA 4IXNA 4R1QA 1H69A 1SGWA 1XU4A 4X00A 5FUBA 2GD2A 5TQ0A 4JP3A 4UUPA 4BNNA 3LCUA 4JYPA 2YHIB 3EXAA 3PUJA 3RSGA 5A2QA 1A76A 3TOCA 1YS9A 2OB1A 4YS6A 2NGRA 4HLUA 1ZSVA 3RTEA 3T94A 4YRBA 4K40A 5LOVB 5J59A 4BXOB 3HK2A 3R9XB 4E1VA 3U4CA 1SKYE 4J0HA 1NHGA 1TM5E 3SZGA 5BNIA 4DARA 3MC1A 3BSSA 4HNGA 3N5KA 3HJRA 4A1OA 1I2AA 2POQX 5EP3A 1NJ5A 2ZE7A 2CXXA 2O2EA 1TVEA 1Z74A 1XDUA 2R85A 3LQQA 4H4DA 4R2WA 5I7SA 3F49S 2MT9A 4KI0A 3FI0A 2QAGB 4BOYA 4DT1A 4RZ3A 3PUVA 4K9OA 5AOBA 3ZHUA 2A14A 4ZQBA 2QD2A 4ZMBA 1YR7A 4RH1A 2IUYA 3ECAA 4GMFA 5LUBA 3N8IA 1CUSA 5FNVA 1Z45A 1P2UA 4HMPA 1IN6A 1IXYA 4JR1A 5HP4A 1FU4A 4GLJA 2R8ZA 4L8WB 4BX8A 5K6TA 3C8UA 1PHPA 2QRQA 5HXAA 2DUMA 1ADJA 4DAOA 5CDFA 1BNCA 2LBPA 1GZ3A 2AG8A 2AI3A 1H0KA 1NI4A 2ID8A 3AR9A 3R44A 1U8EA 2IZ0A 3T3DA 3UWPA 4PTLA 1XI2A 1XNRB 1NURA 1YKGA 3S0JA 1E0DA 1EXMA 3BWEA 4UJ3A 1OB5A 1OXTA 1Z25A 1E4VA 2PS9A 3NVAA 5K5EA 2FWIA 5JTTA 3GG2A 3M8KA 2Y76A 4H0CA 3H1EA 3UK7A 4F21A 4P3YA 1T2DA 3R3SA 2JLVA 2P2DA 3SYKA 1QXSA 4FFPA 5KVQA 5KTSA 4ZI5A 4LRUA 1ODCA 3THXA 1E9CA 3RR2A 2F1HA 3T12A 1IBRA 3X0DA 4OCZA 1PG2A 4OIFA 3JYLA 5BRAA 1R64A 3GQBA 1PNTA 4INJA 2W6CX 4ZZ1A 2Q4TA 2GPAA 3MSXA 5DLDA 1N5LA 3D0KA 2FEWB 2JBHA 1JFFB 1JLLB 1CUHA 4R9RA 2WJAA 3WNQA 2Z8ZA 1J8YF 2KE5A 4I1SA 4R2MA 1QRSA 2HYIC 4JP2A 3WQHA 1PKEA 4UOEA 1X7ZA 1AKWA 1T8UA 4G5OA 2PGDA 4PQEA 3LP6A 3H1AA 4HTAA 2QRHA 1NR1A 3AF6A 4DMKA 5KNBD 1CIPA 2YNMD 2Q2VA 2D74A 5HILA 3HYNA 4OHKA 4UAUA 1RC1A 5D86A 5IC5A 3LT2A 3N8GA 5IJ9B 5HKLA 3SYLA 5JO0A 1W7AA 4Q34A 4P5PA 4CF6A 5LMUB 3QHQA 4U7FA 1L5HB 2Z8YA 4YRFA 1NQAO 1ZJ5A 3MJEA 1D2MA 1KOFA 4FLMA 5ICEA 4DNOA 1X38A 1CDEA 4G4IA 3A58B 4F3NA 3A70A 3BIJA 4QDTA 1K98A 5CFQA 4R9SA 1CLEA 5ESXA 3RRNA 3ZCUA 3WNZA 3NLLA 3UJBA 3J81k 4PX5A 3UXHA 3H5IA 1NLZA 4TMWA 2ADMA 4TWZA 3FTQA 1E3SA 2AJCA 2AIRA 4ZARA 1Z5NA 3GDGA 3ZY2A 4MYCA 3L0IB 3VDNB 3EBPA 1UANA 2OPHA 4G1UC 2X0KA 1U1IA 4IV8A 1SBZA 2D54A 2MMCA 3BCHA 2J41A 1XR3A 1L4GA 3K6KA 1BS2A 1UBJS 2I6SA 1SVKA 3FWZA 3NAMA 4D3ZA 1U0EA 5B4UA 5FPHA 2FEKA 5TQ2A 4A16A 4YAWA 4MWSA 4BO2A 5FFNA 4W99A 1Y5NA 4WQMA 3N2ZB 4A15A 5C4IA 2JVKA 3AEYA 1JIKA 1QH1B 1JU4A 3O3CA 3DHNA 1KTVA 2E3JA 4HRVA 2DPYA 5DWVA 1EUQA 2NP7A 4XJVA 3I4CA 1X7XA 1FFYA 2CBGA 5BO5A 1CF4A 2EYUA 1X8KA 1SPXA 1XMOB 2WUGA 4RPGA 3UICA 1ZA1A 1BVRA 2W4QA 3H2GA 1ZM2A 1Q6YA 4GP6A 2Z1DA 1VG1A 4M1MA 3IP8A 2AFIE 3Q3IA 1Z33A 1P2SA 2Q6OA 3AMVA 4C9BA 3E1SA 4DZZA 2PX3A 1S3IA 1C1HA 2VP2A 3I5AA 3GDWA 4PNEA 4O4HF 4JC4A 2ZSHA 1U0FA 3B1ZA 3KQNA 1R9NA 3ZC3A 1F5SA 4CFSA 5D7NA 1ESDA 1VPWA 3U4HA 1N2IA 2ZCUA 2A59A 4JH0A 4M22A 5AJZA 1CVLA 1T1EA 3ZU6A 3AF3A 1RWXA 3S2ZA 5EMLA 5JROA 1T5TA 1P80A 3CUEF 2CW5A 2J45A 3GZNA 2C2XA 2PGXA 2VT7A 4GI1A 3IAAA 4HNVA 3U9TA 1CK4A 1S2DA 2FR8C 1MH1A 3DKIA 4L8FA 1D1SA 1LD3A 1NDHA 3TNYA 4UVDA 1KZ4A 1WDMA 3IDSA 5GGYA 3FNFA 2QLFA 4F4JA 1B16A 2I78A 5EA2A 5F5NA 3EPKA 4IWNA 3ZE1B 3U7FB 3M0EA 2J30A 3R5XA 2RAUA 1GU1A 4N18A 5KYKA 5A5DA 2NZ2A 2XGSA 3QVOA 2P2SA 5CLJA 2I2DA 1P3Y1 3U7QA 2JA1A 2FN7A 1WDKA 4BE7B 4D4IA 4DMHA 3AVWA 4N3NA 3SXJA 4MV5A 3KEQA 5E1BA 1XHFA 1T5HX 2O23A 3VOAA 3DAFA 3E0QA 3I9NA 4YT8A 4I19A 1RJFA 1GNPA 3BWMA 4N9QA 2PE5A 1G291 3STTA 2C4TA 1M2VA 4ZODA 3Q8LA 3CVXA 3AVYA 4GUDA 3O8QA 2OP0A 1D7OA 1ZO8A 3OLVA 2I3GA 2L18A 3U80A 3D6MA 4X1YB 1PJCA 3I2HA 4KQEA 1LPNA 3M2PA 3P52A 3NANA 4HK4A 1T9HA 4C05A 4B85A 5K0CA 1E32A 2B8WA 4DR4B 3H1TA 2J3DA 4TTAA 5G1OA 1U99A 1DZ3A 1JHRA 2NYRA 1F4LA 3HLKA 1O97C 2N46A 1DC4A 3N1UA 4B81A 4HPWA 1ACJA 4WOBA 1RKBA 4OJKA 4EHJA 3I5XA 4UBNA 3L05A 1XXHB 4TMFA 3AV3A 3EQ2A 1BCSA 2QTAA 1IUPA 4WVFA 1GPLA 3VPSA 1EZ1A 4Z5XA 3CB4A 1SZCA 5CDFE 3FSJX 2VP0A 1Z7EA 2Y4NA 3H9CA 3NHBA 4HDAA 5THXA 3PCTA 3QPWA 4UEJA 5JCOA 3VR6A 3LY5A 4EB3A 3ANSA 3QHPA 4ZRNA 5CGQB 5A2GA 3H9EO 1P6QA 1WXHA 5JAHA 3QSGA 4G0QA 4ZOLF 4CL3A 3PEWA 1Y7IA 1N2BA 3WJ1A 4CPDA 4B2YA 5JYDA 1R8SA 5JLAA 1SUAA 1VSQA 1Y3FE 1RCTE 3MAGA 5G0UA 1LSOA 1DCKA 2ZS8A 5DVZA 1ZU5A 3R5TA 3UK0A 5KPDA 1QQAA 2OBLA 4JFRA 2NQTA 4PG4A 5AVTA 4AMZA 3ZW7A 5BSUA 1COWD 3G8YA 1ESCA 1RJGA 2MINA 4G0XA 4H0FA 4G5SA 5HK8A 2FPIB 4RVOA 1G20A 2QRNA 5H02A 4F11A 5I7RA 4R84A 5CEEA 5HSGA 2B30A 3I34X 2IS4A 3FG9A 4UBOA 3RTBA 4PG8A 2GR9A 3WLMA 3K4HA 4AQYB 2QN6A 1NUTA 4MV1A 2QUIA 1EFPA 3ZWNA 2FA9A 4WY2A 5IUKC 4B35A 3NPAA 3DT8A 1NT2A 4LI0A 5LN1A 2NPOA 4LRWA 4OGFA 1IM2A 1KY2A 3AKYA 3K1JA 4QRHA 1LLCA 3ZY6A 3AFHA 3HR4A 1Q2XA 3C5HA 1ZCBA 2HJHA 3HWWA 3SJAA 4W6QA 4RX1A 1NMYA 3LO8A 1V2HE 2WT8A 3BMQA 1F48A 1YBVA 3NHMA 3NWEA 2VSOA 3BMCB 4IMJB 4G56A 1CE8A 3CZQA 4JQZA 3DLHA 3L8DA 3I64A 1NN0A 3HBAA 5LLDA 3X44A 1GQOA 1LPOA 3KQQA 1BX3A 3EIUA 1UFQA 2H63A 1NW3A 5JNLA 1E2PA 4S1PA 1NW8A 4QICA 2GQ0A 2JB9A 5FBHA 5IVHA 1JHOA 4PYNA 2GF2A 4UCQA 1KETA 1USUA 3S7ZA 4A6EA 3L8FA 3WDKA 4BLQA 1QVZA 4B71A 1JAZA 1ISMA 1S6YA 2B36A 4U4AA 1TTHA 3R9KA 3O8LA 1XKLA 2X0JA 4L16A 3AM1A 4BB6A 2GKOA 2POCA 1QGUB 4I46A 1IQUA 2VXYA 1ISIA 1NGSA 1FRQA 4RA9A 3FVWA 4FHDA 4N5DA 1BXGB 1MA3A 3CGGA 3VPGA 4UQPA 4WOKA 4UNRA 4JDUA 4H27A 1YB6A 5FJIA 4A2QA 1JR6A 3JYHA 4U9HS 4H3VA 1FEZA 3QM1A 1P2VA 4B7ZA 1VE7A 1V45E 4S35A 4C7XA 2H1WA 1KZGB 3BDIA 4DADA 3S1LA 2OVFA 2Z8YM 1IK6A 1K2VN 3LCJA 2O50A 5CYFA 2YDXA 3HXLA 3N6XA 1UC4B 2CF6A 1NF9A 3HWX1 2CNKA 3RE1A 4CL8A 5C8VA 5AKKA 4XJTA 1N1GA 1JIIA 2QZSA 3NKLA 4V2IA 3X1ZA 5AUPB 5JS7A 2Q9UA 3TG8A 1UOOA 3A6PC 1G16A 3LT0A 2GBCA 1GRCA 4X6XA 4C03A 1A4IA 4AO7A 5JAPA 1ZGHA 2HLPA 4RK5A 1UM9A 2G72A 2XRYA 3OOSA 4NCIA 2O0MA 5FYDA 1UF9A 3ZEIA 1YZQA 1RZVA 1GA4A 2VJLA 2P2CA 1RRKA 1C81A 2OZKA 3AH8A 5FKJA 1G4UR 3E2MA 4RIIA 3G9TA 5A9RA 5CA1F 2FEPA 2KWIA 3SJ7A 3UK6A 2DJIA 3SBOA 3OM1A 1RQRA 2YWXA 4B4WA 2L2QA 3EFEA 3RS3A 1KAQA 4KN8A 3TL2A 1QYDA 2WSLA 1CF9A 5KNDD 2IZ1A 4XOUA 3OD1A 1QS0A 2W6QA 2B7LA 2CHQA 4XYEA 2PA0A 1VSVA 2SCUA 2AKYA 2FPWA 4LRQA 1KMCA 4KRXA 2XUOA 4Z8XA 2OV3A 4FQ5A 4DNQA 2OORA 2YWCA 3A4LA 4M9QA 1VCHA 1O94C 4BV2A 4FDMA 2G8NA 4DLPA 4MJ3A 3T3MB 1TM4E 2YUIA 3LL4A 2IX3A 3KQTA 4AMGA 2IXDA 3WQBA 4M8SA 4OQYA 1ODKA 3RUCA 4QUEA 4ZREA 2WKWA 1AU9A 2PJDA 2WC1A 3MPUA 1VGRA 3ENVA 3KWJA 3ZY5A 3ABOB 3L43A 1LEHA 3W5AA 1NQVA 3QNMA 4RY2A 3IEMA 5FWXB 2B4KA 2R5WA 3WGLA 2EC5A 1ZNQO 1TGYA 1C4XA 1E2QA 2WIAA 4KFRA 1P2TA 1ZGAA 3AHIA 1JDBB 1TJPB 2B98A 3MIZA 1T6YA 3PXAA 1XJCA 3QLTA 1Z4OA 2P8JA 3SICE 2NUTB 3BE8A 1O95C 3BGVA 4RAOA 3UYLA 4HB0A 4ROTA 2XYGA 1HNNA 5CT4A 3R5JA 3IXMA 1VHJA 5ALKA 2NO7A 3O0DA 4O4HB 5ERYA 4AJHA 1U0BB 3NEPX 2NXEA 4UUAA 5EOVA 3NCHA 1BWSA 1CB0A 3LUHA 2V96A 4FFWA 4MMXB 1EQUA 5G3ZA 3UH0A 4X7MA 4D9CA 3GLGB 4H1HA 3SEQA 3VR3D 1UKYA 4NWIA 4KOEC 4Q21A 3KOYA 3EARA 4U7PB 4B40A 4S1TA 1QR6A 4BB0A 3QJYA 5GVRA 4GU5A 2ZIGA 3U7EB 3H6HA 2V5VA 3W9UA 5LM3A 1N6RA 5FL7D 2BM1A 2D5CA 2IRWA 3R09A 4H6VA 3I0ZA 4ER5A 2QG4A 2QM0A 3BMNB 2IXEA 5BWNA 1BOOA 1FVOA 2GLUA 3ZTYA 2G5GX 2OSBA 3KQKA 1FJGB 3O8OA 4NEQA 4P34A 2D2EA 2HBQA 1C14A 3JQBC 3QXJA 4OU4A 3SHVA 4QQ8A 4D4JA 4PZZA 5BY2A 1H65A 1DI0A 4O2AA 5BSRA 2BN4A 4C04A 3SDZA 1D8AA 4F2GA 1KRHA 1QP8A 1NU8A 5FO1A 1VLZA 1W48A 1SIBE 2CWWA 1WY5A 2MYTA 3FX2A 4U5XA 5FI5A 5B30A 1O8CA 2CNDA 1HQDA 3IUQA 4B7AA 5BNZA 4HC4A 1VQ1A 1U5BB 3QX8A 3W9SA 3ZBQA 2FU5C 4FGLA 4MUYA 4KB5A 3GJ4A 1BGVA 2J9FB 4H7IA 1M1ZA 4HWGA 4NRDA 4EATA 5C1DA 3B5EA 3AP2A 3MUOA 3V4OA 5KWIA 2NWQA 3HVRA 3A14A 3KOZA 1ZVVA 1G20E 4IQ0A 2GN6A 5HE9A 3RF6A 5LU8A 5FWYB 4P9NA 1C8VB 4AX4A 1C7QA 1I8TA 1XCBA 2WD9A 1IQ0A 2OTCA 3BA1A 1VPEA 3TZQA 5ITVA 1XP5A 1VJDA 1NQ5A 3MNFA 1X39A 2FDRA 5LQDA 4IIXA 3KR9A 2I4RA 4RULA 4EY7A 4UPEA 2C3PA 4X60A 5FWAA 3ZCPA 3VR4A 2PAAA 1IZ9A 3I53A 4KO3S 1RTTA 5KOJB 5KSOA 2FX2A 3OMXA 2ICAA 2YCLA 2R00A 3FIJA 1SBCA 2DYKA 1P7CA 3E9DA 3EMDA 4M55A 4QDXA 1RXEA 4ZTBA 3UJNA 4QOSA 5H7XA 5DHRA 1PJSA 1QHXA 2RGBA 2PJRA 3V4RA 1KO8A 1MHPA 4CLOB 4LSWA 4P0PB 5GGXA 4KYTA 5GV8A 1HZZC 3EOBI 1EQAA 1ESNA 3UENA 3MGBA 4OLFA 4I14A 4GVPA 3E58A 3MB5A 4ZOLB 3RK0A 2R9VA 2TSYB 3IIIA 3K16A 2CHVA 3IR6A 4G1EB 1U0JA 4N82A 2COKA 1LFAA 4KYIB 4XUDA 3UGKA 3NAGA 1D2AA 4BFUA 3L6DA 1IHOA 3HVHA 2I80A 3NG1A 3OIYA 5BW5A 5CDYA 4M6WB 1NNUA 2HSJA 3NUQA 5E6SB 3T3EA 3NYIA 3A9UA 4PSVA 3ZXIA 1KRXA 2CFTA 3T35A 3KLPX 3RC9A 4R2XA 3IH5A 3RG2A 5DHPA 2F1JA 5A04A 1K5HA 3K9LA 2VUTA 3EUEA 4LDQA 3A2KA 2KJQA 3L6EA 1J9EA 2RK3A 3MWDB 3ZJ4A 2P3OA 2YFYA 3EG9B 4F2PA 3QYAA 3UPUA 3FZYA 2F59A 4RQUA 4UNPA 4UHFA 5KTKA 3VVMA 1ORVA 3B2EA 4TX1A 3UAXA 5GZ3A 3EXEB 4I6EA 2RBGA 1MG0A 3ZK9A 2HSDA 4BQSA 4DJAA 1FMFA 2NUPA 2A4MA 1DRKA 3AUUA 3RJTA 1FFHA 4KPUA 4RK0A 3LBHA 1PCXA 2XA2A 5L40A 1X7YA 2V97A 3DP7A 1FJ2A 1YBAA 2XJ9A 3HL0A 3OBIA 4PO1A 1L4UA 4MZXA 4LWPA 1PS9A 1GL7A 4M53A 1AE1A 5HS4A 5JOQA 1Y6GA 1TQ2A 1J21A 1JDZA 3W06A 1N5KA 3PUXA 2ZR8A 3VR0A 1G8SA 4DLLA 2ZRMA 4CHTA 4HQ0A 2VN8A 4DSTA 4EEKA 1ECJA 4JLPA 3T15A 1FTNA 3FB4A 1WXDA 3FYDA 1DXOA 3FYHA 5BQ3A 1K7FB 1FDSA 4FGKA 1Y89A 4ZVTA 1RBQA 4KE9A 4ZC1A 4EUHA 4FWIB 4W5OA 3CEMA 3FPEA 2V58A 3IJ5A 4D8UA 4GPAA 2F43B 4F8YA 5BVGA 1HQYE 3GRPA 1GAWA 2IEZA 4DCSA 2IY9A 4D6YA 1EPUA 1P0FA 1UODA 4OQ4A 1D9XA 2RHJA 2ZT6A 1PFQA 1FDOA 1SQSA 1WD7A 4OQNA 2ZZKA 4PQGA 4U0KA 4UE3S 2JI9A 3SG0A 3GMTA 4YBZA 1E2FA 3TTYA 2OO5A 4QO7A 4XX0A 3IGFA 4IUYA 3ONEA 1Y42X 3MHTA 1E6CA 1V6AA 4NP6A 2LR0A 4NCXA 1TQ6A 5EHQA 3U0BA 4Y2HA 1GZVA 2LV8A 2Z57A 3ZDZB 4FZRA 2FP3A 4MTLA 3UAWA 4MYSA 4Z1MA 1BZYA 1FVXA 3U3RA 2HHCA 4XGRA 2QYTA 2VT2A 4ZQCB 4CFZA 5K8UA 1DARA 3NHKA 4P08A 1NI3A 1SURA 3OLZA 1U8FO 4KIJA 1UMBB 2E21A 5AIBA 3DYBA 1MG5A 3MJFA 5J5CA 1QV7A 1Z13A 2BD0A 1JLMA 4Q9LA 4HZGA 4PYIA 5HKAA 4YRTA 3I9JA 3KP1A 4OQMA 1CUYA 1GUDA 2H5IA 2X15A 1U0LA 1HDRA 3AUJB 2PRYA 3BVPA 3L93A 3ZU3A 2CKDA 3ZZTA 2ZUBA 3QFCA 3D2CA 2BGUA 3C8HA 4CCWA 2HSWA 1XNGA 4YHBA 3HO1A 1PQYA 3BSFA 4Q3EA 2A5FA 4EL0A 5DYTA 3FYTA 4YT5A 3KB8A 1K68A 1MIOA 3ZX4A 1FFAA 1L7QA 1PWEA 2P4SA 3CW9A 3EF1A 5AJHA 4KRYA 5B3KA 1SXIA 1B1CA 1U28C 3O7MA 4NR0A 4EMTA 4QT0A 1AUQA 1GTL1 3L4BA 4S0XA 1D03A 4E46A 3PT5A 2BR4A 2F7SA 2GJKA 5ELLA 4AJPA 2FFRA 4EYSA 4UOZA 1A95A 3CPHA 3QYFA 1N3IA 4FHEA 1CR2A 1QP0A 3SFZA 3EEQA 1ZL2A 2FQYA 5KINB 3OZBA 3AL3A 2Q27A 2Z5LA 1YDWA 4L0QA 3IEIA 3IIJA 3VNAA 4GXTA 4NDZA 1H4SA 1B6SA 2PL9A 3WZ2A 5IN5A 1IRXA 1OX4A 2IHUA 3C8MA 3I1YA 4IUCS 4PLCA 1Q1QA 2PGNA 5IARA 1QIJA 4B7XA 3DL4A 2WK1A 1ULBA 3KG2A 4CHGA 2FUG1 4YV2A 1I7LA 1U7UA 1ZMBA 3EC2A 2YRFA 4G65A 4IDGA 1Z6QA 4TRJA 1U9IC 3SOPA 3NHUA 5CH3A 3Q7RA 2ZTUA 4ZO4A 1ODFA 4GBMA 3GJTA 4IR7A 2X8JB 5CT5A 5FOTA 1UMKA 4C6HA 5L9AA 4PTZA 5DX8A 1MQ8B 4KXLA 3TLMA 2B82A 1P17A 4ZVRA 3G5AA 1ONOA 4BY9E 3OEEA 1KRWA 2Q1SA 1XYGA 4J1TC 2ONZA 1USKA 3LDUA 4H4CA 4HJXA 2QJOA 4KEAA 2CB9A 4JJAA 1EK2A 4NBTA 3WGOA 2B7BA 4Q7EA 1ULZA 4UPVA 3VZSA 4JXXA 1AUVA 1NVUQ 1MMFB 1NP6A 3V1LA 3WVNA 4YP5A 3DD1A 3D9QX 4MKRA 1MIHA 5GOTA 3LLMA 2JJ2A 5J43A 4FFLA 5A7HA 1HMYA 4FSHA 5ELMA 2WWVD 4BS9A 1A3CA 1DKNA 1GVHA 2VDUE 3RNLA 2HPZA 3OPYI 4RKEA 1ZCFA 3W3ZB 1HNZB 2LDBA 4NYIQ 4UASA 2C5FA 4R4JA 3Q6MA 3R3VA 2OXCA 1Z2NX 4OD0A 3H2ZA 4CM4A 1IG0A 1S2OA 2X1HA 3FCSB 4MQEA 2ZGVA 2ZRCA 3BQMB 3ZIDA 2CZQA 2PSHA 3FYCA 2CNOA 2I66A 2J6BA 1EK5A 1NRXA 5LQJA 4MHTA 1KEEB 5AKLA 3L8GA 4IMPA 1Y3CE 4ARUA 3HYLA 4NBLA 2HR1A 3M83A 3EASA 3FBWA 3N3AC 3ZBTA 3FLMA 2HF8A 4UZEA 3GGSA 4F9GA 1NBWB 1TTPB 2Y9PB 5CG1A 1OU0A 3DOIA 3EODA 4IDPA 5ED4A 2EWWA 3QXCA 2PWZA 2HT1A 2J4FA 1NBIA 1JR2A 2YV2A 3Q98A 2H3EA 4O2RA 3PHHA 4N4AA 4IILA 2VAWA 3I2JA 3GR6A 3W1WA 4RSRA 4BLUA 1SBTA 4CDGA 3GJ7A 1NXXA 4EGJA 2ZSKA 1E2GA 5MFPA 2PS0A 4QO8A 1NPTO 4K9NA 4NI5A 5AXDA 4I4LA 3ICQB 5I9TA 1YR1A 2H1CA 1LVGA 1Q7GA 2WAYA 1IVYA 1WCV1 3KPJA 5F12A 3KZOA 2VQ3A 4EGCB 5J2UF 2GEUA 4XSHA 3NM4A 4ZT6A 1JF8A 2F2TA 3OEHA 2H85A 4FX2A 4R71A 5FV7A 4BTVA 1SUPA 2VOEA 4DAEA 4KH1A 1ZOSA 3K1TA 3NOXA 2W70A 1FP4B 5CNKA 1TT7A 3DS8A 1GU0A 1QX4A 2HWKA 1Q21A 2OHFA 3BIOA 3HDYA 3K8YA 3HCFA 4M76B 4RANA 2ABWA 4G4JA 3OKFA 3DLIA 4MUKA 2EX0A 1D6MA 3D5EA 3BDVA 2D0OB 2R84A 2ZJOA 4CLHA 4KAFA 2PTGA 3H6KA 1JHYA 1T9GR 2CSUA 3B48A 4R5HA 1RWOA 3GLFB 5G0VA 1RYEA 4RS4A 1S2LA 1WY7A 2GLXA 2NIPA 4FSXA 5THKA 4DCVA 2FG6C 1KAHA 2R68A 4PFKA 1HDGO 1VSTA 4JBIA 2Z58A 3H86A 1L7NA 3S28A 2VQ6A 2Z4TA 3CZ4A 3ZOZA 2X22A 3MS4A 2D8MA 5BSMA 2UYCA 1U2RA 1R0SA 1GXSB 2W2LD 4Q9AA 4Z9FA 1U3WA 3A4IA 1H8ED 4B17A 1EINA 4I1UA 1GLGA 1MEOA 2PR7A 4WOCA 5CXUA 3RYHA 2O8FB 1D4FA 1KKMA 3WTCA 2ID7A 2OCIA 2R25B 1P9LA 3GA5A 4D3DA 1GGJA 5H68A 2JVJA 1UQUA 2FWBA 2Z98A 3C6XA 3I76A 4MUEA 4PHHA 3DEKA 4BHTA 2YQZA 1TW2A 2Y68A 4YPFA 1CRWG 3OJCA 5M34A 4CM1A 2Q5IA 4EHKA 2XXJA 1YR3A 2QORA 3EGCA 3SZUA 2QRUA 4A6DA 2Q8PA 1N3BA 4FBGA 2JDIA 3C7AA 4E2YA 2CEAA 3EQ9A 2FSVA 3TK1A 4F4CA 1DIGA 4NL4H 2Z2YA 1DQPA 1G3QA 2VZ9A 3P94A 3MCUA 1I2MA 4H7PA 4HB4A 3AX6A 4K87A 1LBEA 3W7AA 1WLSA 3L7KA 2Z6AA 2YDYA 1CR4A 3KQVA 1W25A 2GCOA 1A9RA 5IXJA 1XAHA 2IODA 4C4XA 3SAJA 1T9BA 2DECA 1CUFA 4ADSG 2Q41A 3IPAA 3PX2A 4HQNA 5LQUA 4NECA 2JCVA 4BLSA 4RTNA 3NBFA 1W0JD 4LFBB 2BFBA 1U3FA 1V1RB 3MT0A 4RKYA 3TW8B 3QA3E 4XVRA 3UG7A 3U5ZB 4BMXA 1FOEB 4TTRA 3CC8A 1G21A 2FWNA 3JW8A 1O6CA 3UMMA 1A9XB 1S1MA 5JFOA 4JB2A 4UPDA 4H17A 2HBRA 3OKCA 1MW8X 4ZZ2A 1WR8A 4FNGA 1SOMA 2QVZX 2WFMA 3RO7A 1C2TA 5DI9A 5KMGA 2ZDQA 1DAIA 1OC2A 4B3FX 1VRWA 2XIQA 4AC9A 1M7BA 4V02A 2J6CA 3VDXA 1JMVA 4RD2A 2I8AA 1QKIA 4HH1A 1DTEA 2OMKA 1E62A 4OM7A 4LTDA 2IEIA 3PICA 4CODB 4QFDA 3PXCX 3CUVA 1XZQA 2HB6A 3ORQA 2WOOA 2ZJFA 4RK7A 1XZHA 2WLTA 3R3HA 4C0AC 4EENA 4YRJA 4BRWA 4HWKA 4TXJA 2I9PA 1MQ9A 1VLQA 4MB6A 4OSEA 3REQB 2Z83A 1AKMA 1RM3A 2C98A 2QTBA 2ZIWB 3A2NA 4I6JA 1JTFA 3TAHA 5F9HA 1AKNA 2AVNA 5JMTA 2VBCA 1F3LA 2XWBF 3B6JA 4GKAA 1UKZA 5DX0A 721PA 1T0PA 4TWAA 3RB8A 3L8CA 2B3DA 1KYQA 2PIAA 1CNEA 4F5WA 4R98A 2GZDA 5DP2A 3ZIAD 4HDNA 2QSZA 4MLCA 4PANA 3DDUA 2FUG6 2XI4A 2YQ4A 3EXG2 3OLWA 4DUGA 4ARVA 4MARA 1C4WA 5J2TF 4EB6A 5EERA 3U2QA 3AOEC 1XYYA 4FJ1A 1E96A 3CNOA 4XSVA 1R8XA 1WCYA 5EYPB 4YRAA 3RKRA 4DKXA 1VL1A 3F47A 4IJVA 1EGQA 2C2BA 1Y5MA 4A8PA 5BOSB 4BQRA 4B4UA 1KBOA 4ESOA 2N3ZA 2G9NA 4BKOA 4R8VA 4G0NA 1O6BA 1BMDA 1JG6A 3NHZA 3UTCA 3C85A 2CE7A 4GQBA 2BHNA 2K5UA 5GAJA 1J0AA 1KJ8A 1KK3A 4EY5A 1N2OA 2CGEA 2CUNA 5BMVA 2H48A 3WOVA 2AFHE 3B7WA 1IYZA 3OIDA 4INPA 2QN2A 3PVZA 1NVWQ 4D82A 1T1SA 3UWSA 3WG9A 4EHAA 2AI1A 5ALHA 1F8UA 1VG8A 1GSAA 4TSFA 1J23A 4G5RA 2XUKA 1PJQA 3W2IA 5JASA 2Q21A 3MWFA 3NRJA 1FNBA 3SZRA 1FP1D 2NV0A 4IDOA 4KWEA 3WXMA 4B46A 1XJQA 3AIOA 4IDNA 4MVJD 1O5OA 1OZHA 2DBYA 5MN6A 1HC7A 1Y8QB 3D0RA 1LRKA 5G0WA 4B6GA 5DLYA 2WKPA 4ZAVA 1UR5A 2VNAA 3F6BX 3K9WA 1V9SA 4OGKA 2VPTA 4WXYB 3TSAA 1J2RA 3N0WA 5IT4A 1MFZA 1P0IA 1WWKA 3D3EA 4OAOA 4PZCA 2HMVA 3PD7A 2DWUA 4ABYA 3E7DA 1XMPA 2W6MA 1YBMA 2BR3A 2XSZA 4OYHA 1C0LA 3AHDA 3BFXA 4X1IB 1IHUA 5AM5A 1S96A 2WVHA 3BE4A 4XQ0A 5EHIA 4E88A 1OJLA 2WSYB 2W6ZA 2J0EA 1Z5WA 4C0KA 3UUFA 5AVRA 1ZI6A 1XMXA 1Y4SA 1FIUA 3KAJA 2QR3A 4LJSA 4KXFB 1DLIA 3K8ZA 4EJSA 2V45A 4RE5A 2WI8A 3LWZA 4M89A 3HS3A 3KTAA 4P4LA 4RDIA 5J4HA 1I3CA 2BGGA 4KVFA 3W05A 4V1CB 2B83A 1KOGA 3FUWA 3DMYA 2P5YA 2XXBA 1MAUA 2CFCA 5EG5A 3ZHOA 1KC1A 4HOYA 5BR7A 2X19A 2WICA 3QFFA 3EXHC 5ECGC 3ZR4B 3LC0A 4CCYB 4I2VA 3WAKA 4H18A 2R2AA 3DCIA 4HEQA 2ZDHA 3FYUA 7AT1A 2FW7A 3EXIB 3PNLA 1EWVA 1OWMA 3IQXA 3C5CA 4LHYA 2DY0A 2QQEA 3FF4A 4LMRA 5CX1A 1F14A 1ZK2A 2GB4A 3C3YA 4FWBA 4X24A 5CDUA 1CR6A 3EBOA 1L8QA 4DLKA 2CXHA 1WVGA 1WXXA 3D02A 3VV2A 1F8YA 3NDRA 4K9DA 1KO4A 4FS8A 5B1HA 3VU3A 4KAAA 4BL5A 2CZCA 1GT6A 1O5IA 4EUEA 5YASA 5AHOA 1FSGA 2A88A 3AR2A 1DIRA 5U1PA 3A1SA 3F7NA 3O3OB 4GBED 4DQXA 1OHHA 4A0FA 4YIHA 2PO7A 4BECA 3VC7A 4D56A 4BEJA 4CKCA 3EVDA 1PRYA 3FMVA 1CZNA 4IHJF 1J9ZA 1Z68A 4LXXA 4PRKA 4X84A 1CSEE 1O0SA 4AF7A 5J2UB 4MS1B 2X4DA 1NRWA 3KUCA 4FE7A 1T6BY 2WMYA 4HMOA 4KX5A 3WLNA 1ZH4A 2WAMA 4J3JA 4R5MA 1TJ5A 3D3NA 1YIAA 3FTPA 4MIEA 1NP3A 4KQFA 3DYVA 4UMEA 3A4MA 3W7VA 5A6SA 1SVUA 1KK2A 3ICVA 3F3SA 4HTFA 4IVRA 4YP0A 4HUQB 4Y18A 1MU0A 2R79A 3L7JA 2OFFA 4EAAA 4F3CA 4H6XA 2ODPA 4CEJA 1ZJYA 2PUDA 2F4VB 1OASA 2HPVA 1DJLA 3KYDA 3SXPA 4CN8A 5FEMA 4Z4GA 4CV1A 3EQ6A 4B73A 2AC2A 3RUEA 3RIHA 2QRGA 2WQ7A 2FOLA 2G9RA 2PD4A 3BCSA 1SFRA 1KJYA 4LHSA 1G17A 4M1QA 1JJIA 3FVRA 4YI3A 4ZANA 4DEYA 2WM2A 2EZUA 4LA4A 3O47A 3EEYA 3NT4A 1W76A 3KC2A 2AN9A 2JHCA 2ZUVA 3NOQA 1X80A 1LZLA 3RRYA 3RSFA 5JT1A 1LQTA 1QF6A 1P31A 2N75A 1EHYA 4B83A 3A9TA 5IJ0A 1ADGA 1D1TA 2CXTA 1HYHA 3RYTC 4WHMA 2FX3A 1FMLA 5FPYA 3KZMA 4G9EA 4JJ7A 4OP1A 1AH2A 4ZC8A 5SV2A 3WNVA 2VIIA 3O95A 4OBWA 1AOXA 2HU5A 4AD8A 1L4LA 1VJRA 2C5HA 3DHVA 5E7JA 5JI2E 3KQLA 2ZXEA 3LVQE 2GXAA 4DFDA 3GPBA 3OIVA 5K6AA 3C0KA 4J6EA 2VS1A 3C15C 2QD3A 2TMYA 4IZHA 5TRTA 2EFDB 3V8RA 2O0HA 4P3KA 3HKEA 4NAVA 5K05A 2WF5A 1EEXB 4UULA 3ZE6A 3FNRA 3OZ7A 1YJCA 3EQZA 4G5YA 5A0TA 4JSYA 3MWYW 3O8DA 3N3BC 4G0OA 1HYBA 5E7QA 3WX0A 5D01A 1VYUA 2B0CA 4L78A 1SQ6A 1FDTA 1XZ8A 3O83A 2WG1A 3NONA 4NHOA 5U9CA 4EQ6B 4NPHA 3KCNA 3MLEA 4Q4AB 2RFLA 4C7VA 3W6ZA 5CB8A 4TT3A 3O2SB 2OGSA 3HB4X 1J56A 3L4SO 5EWJA 1QIHA 3I6YA 2BRUA 3C3BA 3T1HB 3B6ZA 3D64A 2PLWA 3B3FA 4LYEA 3FNHA 4NVRA 2WSSD 1E18A 3H2JA 4ZOCA 1GQFA 3ZDDA 3KJIA 1ZG3A 1KI9A 3CB2A 4BMSA 3KR1A 3P0EA 5FBRB 3OICA 3DUFA 3KWMA 2FAXA 2WTNA 3QI2A 1H5NA 3TR5A 1EWRA 3W3AD 2Z5GA 1ZXLA 4NDAA 3WRXC 2VLBA 4HFNA 1KI1A 1SG9A 3N0VA 3QW4B 1H2ZA 3FTNA 3IP1A 4NCJA 3TQSA 4DJFC 3LO5A 2ZXUA 4Z4EA 4WEQA 1J90A 1BXRA 2OGZA 2WVGA 4IDCA 1GQYA 4WDRA 4KQ9A 3G5UA 4MVXA 3FPLA 4U0JA 3T61A 3KOUA 3FKSA 3RH0A 3HY3A 1RXIA 3N07A 2VLIA 4O08A 4OUDB 1MZVA 5G53C 2NAFA 3NBMA 3M49A 3TTWA 1BMTA 1OY1A 2YIDA 1NLUA 1WXEA 3QMMA 3ZLBA 1HA3A 4UM8B 1FYFA 2HA4A 2LIVA 2R62A 3FRJA 1I2ZA 4I5FA 4I55F 4RV5A 5LP6F 2BFFA 2BEJA 4FIZA 1XZNA 4MH0R 5EKSA 3OZVA 3IE0A 5DTRA 5JCPA 1X3LA 2O2SA 4JYMA 4JIGA 3TSCA 3H2BA 4MMZB 1DCMA 5KNCD 1B42A 1H6BA 1JU9A 1JN0A 3IQDB 4OHXA 4CQLB 3PQCA 5BRJA 2CJXA 1R4ZA 4OQLA 2P9JA 4Z2AA 1FYVA 3IRUA 1UBFA 4TKLA 4X6UA 3UT0A 4F2HA 5J2TB 2JEOA 1U63A 2JJQA 3U19A 3DDWA 4Y67A 1VL2A 3DXYA 3PV0A 4RELA 1Q3KA 3QEMB 1FDVA 2AD1A 2BFPA 2EF1A 2E4ZA 2ZI7A 5BORA 2EAUA 1QAOA 5C46F 1H93A 1PR0A 1YQGA 4PSDA 4MA4A 2ZREA 1NN5A 2R6GA 3OTWA 4GPZA 2ODBA 2XT0A 4M0FA 4WCDA 2E55A 1QLWA 3KLBA 5DWQA 5HFNA 3GCZA 3EGXB 3UA4A 4O0LA 1FSPA 4FW9A 3BEOA 3MB8A 4HLNA 3O1HB 2PBLA 1ZH8A 4FTWA 4P2BA 3OPVA 4BJHB 1A4RA 3EC1A 3I2YX 5AO9A 4DM4A 1EFKA 1LY1A 4L5AA 2I6TA 3TOZA 2VTBB 4HGQA 3H1FA 3E18A 3QUAA 1NKVA 2RHWA 3FSGD 1LDBA 3E81A 3ZY3A 1RQXA 4KPYA 4ND8A 2AR9A 4IIYA 1CUCA 1KMIY 1SD1A 4YNBA 5CVTA 2Q7OE 5B1SA 4UTVA 5JSUA 4FHFA 2CCJA 2IKQA 1YC5A 3L9WA 3BPSA 5KX5F 4F1WA 1RBMA 4LKRA 2TS1A 1I3NA 4XJSA 1FP6A 3IQIX 3RS0A 4G23A 2H4WA 2RSLA 1KVTA 2O7RA 5DH9A 4FCWA 3RVNA 4DR7B 1ULTA 1SHUX 2O7NA 1EX7A 3B53X 1HGXA 3NOVA 2YIVX 4IOMA 4K05A 4ONEA 3VTZA 4EQ6A 2VHCA 2JS7A 2O20A 2EFGA 3OF5A 1MEEA 1NLYA 3JZDA 3MZ0A 5CB4A 2NLOA 3V7FA 3MGAA 5ALLA 1NXSA 5E2AA 3HGTA 3CS3A 3V7YA 1ID1A 3RI3A 1ZMOA 1ZRSA 4UU1A 3A3YA 3L7NA 4CM5A 1H4QA 3Q7TA 4S1OA 2PT7A 2HRQA 2P2NA 3AYXB 2RH8A 1A9OA 3K9HA 3SS7X 5ITZA 1YZLA 2YHUA 3QENA 5JZVA 2FQQA 4ES6A 2DTEA 4K03A 3COZA 3W4IA 1T4CA 5HBRA 5T5QA 4W9MC 2BR5A 4K9SA 3AZOA 1E92A 1KZYC 4POOA 3EJ6A 2J5BA 2WFLA 1T4BA 4JJIA 3OT1A 4L4ZA 4RPCA 3LA8A 1X13A 1SBHA 1I1OA 5I9IA 2JEZA 2C8JA 4QATA 4DOMA 4RLHA 3BJZA 3HN6A 5A5EA 5HZHA 3GRUA 1FRZA 2DHQA 1HE5A 3AESA 2FSFA 3R0JA 1KVQA 4RTKA 4XD2A 4IHJB 3QPCA 5IS2A 1D2CA 1DTWB 3NKVA 3UYKA 1WQ3A 4IMIB 1HDOA 1ZNWA 2K7FA 1F38A 2TMGA 1JFRA 4GOND 4HPXB 4ENVA 1WU7A 1XYVA 3EBLA 4L4SA 2W90A 3JQ9C 4RSGA 3GUHA 2QE7D 5K03A 1DEKA 4TM8A 2CDRA 2FVXA 5IEBA 1XVUA 1P91A 4AP9A 2REXB 1RMYA 3MS7A 1E5TA 4FONA 4BPBA 2EFJA 3L4EA 5IFLA 2R2GA 4OREX 5E1OA 2Q6TA 1ZC4A 1QB8A 2H6EA 3A9CA 4FFVA 2EZTA 2C9OA 1SVLA 2ZWVA 4RA6A 1M2HA 3CSSA 3GA0A 1BE1A 2F1IA 3E7PA 5IM5A 4C7KA 4Y2VA 4G2TA 2Z0MA 3GVHA 3RKUA 2HCBA 2N47A 4F46A 4EFDA 2XZPA 1GRVA 4PS1A 3SJCA 3QSYA 5EHGA 1T1JA 3BA6A 5TT0A 2FNAA 5KOIA 3CINA 1SZDA 2DX7A 4JNKA 3V00A 5KTNA 1VHQA 4JXZA 1J5XA 1VCMA 4EMBA 5I3ZA 5IVIA 1D4ZA 4COKA 3DTNA 3PQ6A 4G97A 5AM4A 4W8OA 1NQWA 2GM5A 5TNXA 1D4OA 1JQJC 4F06A 1E89A 1CETA 4GLBA 5FCDA 1TO6A 2PZJA 4OXNA 4RJJA 1I9GA 4PZPA 1JA9A 4C4AA 2XA9A 1XPRA 2ZRGA 4HB3A 4HDKB 3SU8A 3VBCA 5G40A 1A8PA 5EJ5A 4GYYA 4RF2A 1M54A 2EATA 3EMKA 3H9QA 1M2KA 1DJPA 1ULUA 4CQMA 3GGGA 4EI7A 4Q48A 5CCBA 1Q1ZA 2X4IA 4O4LA 4KUHA 3SSAA 3VH1A 1L8AA 3IFSA 3E4DA 1JAIA 3E5HA 5JALA 1GQRA 4YJFB 1Z0DA 3ASUA 3VAZA 5JDCA 4YLGA 2XE6A 1FRVA 5DU2A 3PC7A 2ZM5A 2A9PA 4CKYA 3QEAZ 1Z16A 4NYMR 3MJVA 4P81A 2D4HA 2JBAA 4C01A 4CMCA 3SBDA 4PC2A 3LPMA 5T3YA 1YHZA 5DHAA 1CHDA 5LYJB 1CEXA 3TRJA 1HO3A 1UKBA 1QVWA 1U2DC 2XOKA 3ITDA 1O3YA 2Q9AA 1W2GA 3ABQB 3OFKA 4BRZA 5IC6A 2VDJA 1JVSA 1LWOA 1Z0IA 4FMDF 2G40A 1M34A 5BV0A 2W2KB 4BBJA 2PSSA 1C1DA 1R8YA 1XGKA 1DAGA 1EFVA 1KK1A 2A84A 4YCDA 2OYRA 5CA1B 4FOLA 4DTCA 1DWUA 1NQTA 1XVIA 1QNLA 3U26A 3CWCA 5CFPA 2WNSA 3AI1A 3WAGA 3UKDA