2QD4A

Wild type human ferrochelatase crystallized with mncl2
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 144
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A01
2QD5A 3LYHA 2XWSA 2PNJA 3HCOA 4MK4A 1C1HA 3HCNA 2H1VA 2PO5A 1QGOA 2H1WA 1AK1A 2XVXA 2AC4A 3M4ZA 2QD1A 2XWQA 2XVZA 2AC2A 1LBQA 4KLAA 2XVYA 4KMMA 2QD2A 3HCRA 4KLRA 1TJNA 1C9EA 2JH3A 2Q3JA 2DJ5A 4KLCA 4F4DA 2Q2NA 3AQIA 1DOZA 2Q2OA 2QD4A 3HCPA 2C8JA 1N0IA 2HRCA 4CCSA 1L8XA 3GOQA 2XWPA 2PO7A 1HRKA 3W1WA 1LD3A 2HK6A 2HREA 2QD3A
chains in the Genus database with same CATH superfamily
1R4MB 4FBGA 4OFZA 1DTSA 3D4OA 4BWGA 1NYLA 2A33A 1IG0A 1QZXA 3VC2A 3CZPA 3KE8A 1P81A 3NT2A 4PBRA 3ZWQA 4BJ3A 4Z7NB 2QY9A 2ZWAA 4TYNA 2WFLA 4MS1B 2B4YA 4JLNA 3T7IA 1VXOA 1CUZA 3FB4A 1NJ8A 5ALXA 5AI4A 3VSAA 4EITA 4V1CI 3C14C 5F2NA 1EM8B 4HDMA 4RMIA 4AKTA 2FDRA 3RTBA 1UKVY 2FK8A 3FPJA 5JH7F 1OV6A 1C1XA 5FIUA 1BCSA 3R5FA 4WZAA 4D4KA 4DLWA 2ZYUX 3GLTA 1ICEA 3QVGA 3LSTA 2QBYA 2Q45A 3A58B 4FU0A 3FYDA 4BB9A 5AW7A 1DO8A 3OJFA 3GJRA 1C3LA 4FCCA 5AOBA 2ZCJA 3N3AC 2GPTA 4N0QA 3JQ9A 3STYA 4A26A 3BFXA 2WSSD 2W93A 1W5FA 5TSDA 3GUCA 1I3CA 4FD3A 1E6EA 2OPBA 5BOSA 1DKRA 1XV5A 4B6RA 1M74A 3NRJA 4JFAA 4WERA 2WUFA 1P7ZA 3DFIA 3H5NA 3N8HA 4LVNA 4B6PA 3BCUA 1GPYA 3EW7A 4UUQA 2QPOA 1A97A 1CQZA 2V03A 4UCXA 3WKCA 1W2WB 4FP9A 3BORA 4XB6B 4L2IB 1F06A 4JYCA 1EM6A 3OOSA 5CYOA 1GG9A 1NL3A 1RR6A 1JE0A 4HDCA 1M2FA 1OREA 1R4NA 4JP5A 1IMJA 4M8SA 3QUSA 4NZPA 3ZBQA 5HUHA 4UUMA 1SQ0A 4KXUA 2BKEA 1RLJA 4BFLA 1SCIA 4FHCA 3X43A 4WACA 2HREA 3P2KA 4OHZA 3SR3A 2QJTA 2JFZA 1YRAA 4KMSA 1AKNA 3MD9A 4NS4A 3WBFA 4TXNA 5M2QA 2F8LA 2XB8A 4K9RA 1W85A 3ET5A 2N0SA 3W9UA 1CDOA 3D2LA 2CLFB 2OY0A 4C3UA 3CUSA 1Z34A 4UM9D 2JF0A 4MR7B 2PYIA 2R3SA 3JY6A 3C5CA 3H75A 4FEEA 4ISBA 5TMBA 5DHTA 2AEFA 5K8CA 2V3CC 4BZWA 1SUCA 3EGXB 2Z3ZA 2GZMA 1OAOA 2A1IA 3KYCA 1VYVA 2A4KA 2XAAA 3WK4A 4UE3S 4HP8A 5BYAA 3TLGB 1EZ1A 1NLUA 2XH8A 1VQ1A 3DZ8A 4NJMB 5BWCA 4HOYA 1A69A 3D3QA 1Q15A 4KR9A 6GPBA 1H0SA 2CF6A 1GGMA 2EP8A 3LCJA 421PA 3WWDA 2FFAA 2ERYA 3FYSA 4IRXA 3OOEA 4MIOA 2DTEA 3Q7EA 3F3MA 1NVDA 3AIOA 5HR5A 3U1BA 1QR2A 3AP2A 2OV3A 3AJ8A 5HFAA 4HEHA 4TYMA 4RJLA 1B16A 2DRIA 4EF4A 5EKUA 4IV0A 4YR7A 3WLJA 3FVRA 3P9YA 1Z2CA 4BN4A 1RC0A 1A8PA 2PSJA 3NETA 3D6MA 2R1TA 4QJ5A 4AECA 4NP6A 4CIWA 3E35A 4MB6A 3UPDA 5IM4F 4INZA 2PRYA 5FL7A 3BICA 4LYGA 4MAFA 4Q9HA 1O6GA 4Q4CA 1MXHA 3HDYA 3PWKA 3O8CA 1AHHA 4MICA 1J7KA 2F48A 3WGTA 4XIJA 4XOUA 3JQFA 1EWVA 3A6JA 1E1NA 5JZSA 2G1AA 1MIOA 3HJHA 3LVFO 3BGOS 1Z4PX 3PQ2A 3DMHA 1KI6A 3P27A 3W77A 3O38A 4HDAA 1OZGA 2VP5A 1EBFA 2ZRJA 4J4BA 5K1ZA 5TQ0B 5JW6A 4I5EA 4BVBA 3SYLA 3TOZA 1DX4A 2I4OA 4NKRA 4E15A 1W36D 3RLIA 2BSQA 4H0FA 4IDQA 3D7MA 1Q7RA 1N2SA 1NLYA 4KBYA 5D86A 4FK8A 2I76A 4M1YA 4NMMA 3DDOA 5LUAA 1SIUA 5J2UB 2R6GA 4AP5A 1V16B 4BNWA 3MTDA 4G0QA 1RI2A 2WWGA 3M4YA 1NQTA 4XB2A 1WCIB 2ZIAA 4XOIA 3W78A 3TE6A 4OHYA 6NULA 3PZBA 1UAYA 3OT1B 1ENOA 4UNRA 5G0SA 1E3WB 3ZV7A 3VR6D 5A4KA 2WF5A 3G8AA 5HW0A 5AJXA 4DG8A 3UCEA 4JBLA 1YGPA 3PXEA 1ZD4A 4LSWA 4PWZA 4OATA 5TDHA 5I7FA 1FTWA 4PGAA 3EEBA 4BASA 4MV0A 3SX2A 1AGXA 3O4HA 2X4IA 4AKEA 5MGBA 2G1PA 5ULLA 2GPNA 1KO5A 2W0SA 3EGDA 5CA0A 1P6UA 4IQFA 2C88A 4KFSA 3FYUB 3AFOA 3TAUA 3KSDO 1KO1A 4AG6A 4LRTB 3I9MA 3ZHTA 2X4DA 4LDJA 1EFVA 1ODSA 1N2CB 2W22A 3OZWA 4L8VA 4PPQA 4U3JB 3WJAA 4CMAA 5TQVA 4PPGA 5CIWA 3QW4B 4D96A 1N33B 2HXYA 2GA9A 4C4XA 1HE1C 4MK4A 2WT8A 3CONA 3BWDD 5EIBD 5L45A 5LYYA 1BA2A 5TMPA 3AVUA 3KAPA 1K3FA 1K7XB 3EFEA 2I2CA 1T1IA 4L4RA 3ILHA 3VU8A 4DLLA 5BVHB 5LCXA 1CQJA 2VTBA 2DETA 2IGBA 4EHHA 4E3ZA 3W4IA 3PIRA 1EBBA 1UKAA 1BJTA 1NAIA 4XIGS 2RCNA 2P3QA 2QUBA 3TLXA 4CMBA 5CB4F 2JAPA 5JVDB 2FPOA 4R2HA 4YJ2B 3EVCA 3RVPA 3NC1C 5ALWA 3ESXA 4AZ3A 2FJPA 2GBIA 1S9HA 1N3IA 4BZQA 4KV7A 5AOAA 1ZC3A 3Q1KA 4CWAA 2HHHB 1YONA 4G4JA 3WTCA 2CXUA 4GYJA 1SBQA 2X77A 4Q9AA 1YA4A 5P8WA 1SOVA 2O0JA 2X9QA 4JASB 1EFUA 1P0PA 2NZ8A 3DZIA 4Q24A 1JWBB 3IXLA 1PW5A 2TMGA 4Z99A 4EGCB 1QGUB 1P61B 1V3VA 2AA3A 3ZK7A 1JJFA 3IHLA 4O3FA 1AKWA 1KJZA 3PR3A 8ABPA 1IJKA 5JNTA 3VZSA 3SK0A 1V7QA 1H3EA 2CXTA 1SK8A 1XEWY 3T3MB 5AVZA 1T8WA 4QVIA 4HPXB 3RYFB 4QUEA 4DCJA 3WIOA 4XDGA 3ZIDA 3O75A 3EZYA 3FUVA 1E2FA 5CG1A 3ZBUA 1PR6A 3NJ4A 4NPAA 4CGYA 2E4YA 2TS1A 3EW9A 5CAEB 3C41J 2H3EA 4RZQA 1HA3A 3CLUD 3H5LA 4BNMA 4HMOA 3VGPA 3EDRA 3PL1A 3VYTB 5F76A 2OD9A 4DARA 5ENVA 4MA4A 2ROQA 2GK6A 3L8GA 4FZ3A 2CDCA 4EI7A 2PT7A 4BP9A 1K4KA 3L41A 4GO1A 1TYDE 3MXTA 4TMWA 5JJCA 1L6IA 5T8KC 4LTMA 5D85A 3Q9UA 3K94A 1UBHS 4FEAA 4Z0HO 3ZWDA 1A9OA 4HX9A 4AD8A 3WLFA 1WDLA 4V0OA 3DPUA 2ZXUA 5AVJA 4OHOA 1GFWA 1C0KA 2CXXA 1Q20A 3GD5A 4RHCA 3MS4A 2NXEA 4BJ5A 1YRLA 2YY5A 2XCUA 3BH6A 3UKDA 1IHOA 1C30A 3BYZA 4O4IF 5DLEA 4FFVA 4ESEA 2AUMA 2Z4SA 1I51A 3B89A 2UZ0A 1Y1PA 1EDOA 3NEJA 2HPZA 5A7FA 5LYJF 4RTRA 2VBGA 4LW8A 1WZCA 5TR9A 4P84A 5CUQA 1NXWA 1XEXB 2NV0A 2DKNA 4L4SA 4WSOA 1DRJA 4OQXA 2WPDA 1JU9A 2F90A 3HXTA 2FVXA 3H2SA 1J8YF 1P9LA 2CXOA 1ZRSA 2N1BA 3OZAA 4FFLA 4LK2A 1MXFA 2O7SA 1NZJA 2QAGB 3O2SB 2D7CA 3NHMA 1N3YA 3TRKA 4NS1A 1CB7A 2AC2A 1BSVA 3IULA 5SZIA 1VGQA 2YV4A 1UINA 1R5OA 2V7QD 4M46A 5IBPA 1YZKA 1ZITA 3BDAA 4N5MA 5IFLA 1ZMOA 2BN4A 3G7SA 1HRDA 4FLFA 4K28A 5JO0A 3VOSA 2FMXA 1INLA 2GZ1A 3LRPA 2FP4A 4FXPA 4IDBA 5H83A 3G6WA 5L40A 1MUUA 1SZPA 1KP3A 1L8XA 1GRNA 2P9HA 3I1IA 5DTIA 3PDCA 2J9ZB 1P9WA 2YASA 4IJMA 4OAQA 3AVXA 2C4HA 4M83A 5DX8A 3EAFA 2GOYA 2HHCA 1M73E 2H5IA 4ZYZA 3DZDA 4PFJA 1ADCA 2XA2A 3IV6A 1Y5MA 4WUTA 1SMKA 2YINC 2ZJ1A 4G3XA 1X77A 4WKNA 3ZU3A 3H6GA 5L3SA 1APBA 5CD1A 4D25A 1L1FA 4LXGA 2HBYA 5FOUA 2OVFA 7MDHA 3U19A 1UXGA 4H7PA 1ZJWA 1NUSA 4D8WA 4FWIB 2XQIA 4DXAA 2ECQA 3PXAA 3JARB 4LJ6A 3T12A 3C3BA 1YMVA 3QOWA 3KZNA 3R0VA 4FHGA 4MAAA 5TC4A 5TGZA 2DLDA 3EQ2A 2UYGA 1SKUA 1IK4A 4MCJA 4ND8A 5FTNA 4BU1A 3ZDBA 2IFTA 2DWPA 4JWKA 4RVNA 1KMQA 2C7VA 1J25A 1HETA 3Q88A 5BNTA 1EP9A 3GDGA 5CM9C 1TT7A 5JY1A 1LCIA 2FX3A 2P0AA 3TZHA 4AJLA 4E46A 1BC5A 3OOJA 2I8LA 3H97A 5T41A 3A0UA 2C2BA 3GU3A 1DQSA 2IX3A 3QEKA 3H8JA 1X9HA 2V6FA 4DUPA 1F8FA 4MWEA 5B1DA 3CUWA 3S1LA 4N9QA 2CBXA 2AJDA 2XBUA 1OXMA 1C80A 3WIVA 4DLTA 2PDAA 1X0VA 1X1AA 1VLZA 5LDGA 4JH0A 2R6ZA 2WF8A 4G9EA 3COZA 5EMKA 3ZWYA 5JD6A 4B6GA 4BJHB 2BDUA 3OI7A 3FNQA 4TTIA 1UEJA 2XCOA 1R8XA 4ZQBA 3D7KA 1BVRA 1SCBA 3T54A 1J8DA 1LDEA 3LRXA 1MMFB 1QR6A 3QOFA 4F9FA 1JB9A 4AG5A 4WOJA 2OCXA 4MVJP 3E9YA 4CTMA 2FB9A 1J00A 5F4ZA 4L72A 4PVDA 3Q87B 3SZ3A 2Q21A 4HZIA 4YJKA 4BVJA 4YUVA 3GR6A 3ABOB 2F1OA 3BE6A 3KJIA 4OGFA 5T7BA 4NCJA 5IJ0A 2HF2A 3HKEB 5CT9A 4WHMA 2NUAB 4C0KA 3HCBA 1GG5A 3I72A 5EQFA 3TDNA 3SU8A 2Z6UA 1U9CA 3V8PA 5JZOA 4H4CA 5KTTA 1P39A 4YS6A 3GEMA 3OZTA 4YJFB 3NM6B 3ZE6A 2QI9F 1V5GA 1GPNA 2PX3A 3H1BA 4K9LA 3WMRA 2JLUA 1J2JA 2O5RA 2C20A 1R4MA 4U8HA 4RYLA 3R76A 2NZ2A 4HH3C 2RGCA 2PCLA 1ZH0A 2N75A 2Y8EA 3NHUA 5GJWC 5P21A 2WSMA 4C4ZA 4EB6A 2WJPA 4PBSA 1HYBA 1I9GA 4R68A 5KYXB 4MS1A 2PVCA 1ZMBA 2WK1A 4P08A 3EF1A 4ZKEA 1JFLA 3IA2A 3OA2A 3F3SA 2GZSA 4FX2A 5IM5A 3RR2A 2WSBA 5EQTA 1QH8A 1M54A 2BAGA 1ZUD1 3RUFA 3D59A 3ZXXA 1KK1A 3MPOA 3CH5A 5ALDA 3VNQA 1U80A 2VQFB 4LHSA 4QXMA 2C7OA 1UEXC 5JRZA 2W6OA 3MOSA 2E89A 4PYNA 5F1PA 3X2FA 4CF3A 1PZNA 1T4GA 1GRRA 1XDDA 2GSWA 2X13A 4LNAA 3SR0A 4BFTA 5K0FA 5KYGA 5A3JA 1VKRA 4HNSA 1D4FA 1P29A 2B6HA 1NT4A 3FVTA 3OPMA 4MP6A 4OD0A 1DDIA 2IXDA 1KXZA 3D0KA 4ER7A 2JHCA 4ZFNA 4MRMA 1OTYA 4YJ3F 1A8HA 3LUFA 3AMVA 4ITVA 4X95A 3TKAA 1DCFA 3WRWA 2Q6VA 4A2WA 5LQSA 3SCZA 1LLDA 3I01M 4F4DA 5JCJD 1ZNXA 3DGFC 3D1LA 3KOWA 4U2DA 1DEHA 2HRZA 3TRFA 1UJNA 2F62A 3MGAA 4OB8A 4L2IA 3SC6A 1NKTA 4W5OA 2FLKA 5FLXA 1RZVA 1JU3A 2WZBA 4ZU3A 3RVRA 1M0WA 3EFBA 2GCOB 4B79A 4G0YA 2YMQA 4YMTA 1JXQA 4YMIA 4GHWA 3ZDQA 3ZWNA 1DUSA 2I1VB 4RKRA 4RJKA 1BNCA 1XALA 2R7KA 2SHKA 4K9DA 1OA0A 2WG2A 2JJYA 3IPYA 4HEJA 1L4YA 4N49A 4KODA 3KOZA 3CB2A 5IXYA 2W4QA 3LHIA 1GKYA 1WPRA 1NRJB 3D6UA 3GAAA 3HN2A 4TPKA 2NYAA 4ARAA 5IVKA 1U7HA 4MQMA 3KSUA 2Z58A 1G7CA 4RADA 3A6DA 3AKDA 2GLXA 3EQ6A 3G2OA 2RHGB 3SJZA 3LVQE 4XPZA 4WAUA 3SDZA 3LPLA 2EW2A 4BTLA 5I45A 4MR7A 5I9BA 3PUKA 3N3BC 4JI4B 1T2UA 1Y1SA 4QGFA 1J0BA 3H3FA 2WD8A 3D4BA 1OU0A 1PLKA 2IDKA 1JKIA 2Y0CA 3EGXA 4M9RA 3RSQA 3QE0A 2YN4A 4B3TB 3LDGA 4CLRB 3IUPA 1FDSA 3IB6A 3QXCA 3VYUB 3M2TA 1HORA 3TLGA 3WICA 3FR8A 4NJMA 4QGBA 1GEEA 2P9BA 5JWHA 3W1EA 7REQA 1BJRE 3A6ZA 1BHQ1 1RWNA 2QNBA 3T8YA 3IKTA 1PGJA 1LLFA 2F1HA 1NKVA 3JATB 3LUHA 2WJAA 3P4UA 3EARA 2QTCA 2VJNA 3OHSX 4G0PA 2WRZA 1CEYA 1OFUX 4RSRA 4RIEA 3DSRA 2E5WA 2JCVA 3FSEA 4PQYA 4URUR 4QECA 3MT9A 2BC9A 3HBNA 5U1PA 2GVNA 1WXFA 3PRJA 1SM4A 2V4ZA 2VNSA 3HJGA 4OIFA 3P9SA 4Y7DA 2YICA 1FRFS 3ZU4A 3FHJA 5EZYB 3TSCA 5LMCA 3GLFB 2ACKA 3E3OA 1GPH1 4BWVA 4TMVA 3AZPA 4JQSA 4OQEA 4O2BB 2PLWA 3L8HA 5CXQA 3ACBA 3T1OA 3DF7A 2PAAA 2OCKA 4EENA 3ZU5A 1COZA 1PJCA 4U7WA 2E1RA 4Q93A 2VK1A 4WNAB 1TK2A 2WTBA 3A3NA 3NHLA 2YBEA 2ZWIA 1QYIA 1L5FA 4E6PA 4EKNB 1UDWA 2SKDA 3PPVA 4E94A 1BWQA 1FSSA 4F5WA 1RRPA 1FQWA 2F3SA 2EL9A 4W1QA 5IMSA 5TQ0A 1WHSB 4IYJA 2XOEA 4Y6OA 5B3KA 3NHYA 1E7QA 2DHCA 1E5QA 2J3KA 4CL3A 5IARA 1VC2A 4IV5A 4RPLA 4DY4A 1H0KA 1DPGA 2VP6A 3R7SA 3AP3A 3WL3A 1NKSA 4KIWA 2QZZA 2XHZA 2YQZA 3K70C 4LYYA 2G8LA 1E2PA 2EC5A 4OQZA 1U2ZA 5J2UA 2JA2A 1M2HA 1V16A 5CPFA 1SG0A 4PSCA 4MIYA 4DEXA 3VKUA 4K7JA 3R41A 1RCUA 1WCIA 3R20A 4DCUA 2P9QA 3HXPA 3SMVA 3JD4A 3OT1A 1WXXA 3WJ1A 1E3WA 1Z6YA 3A4VA 1EFTA 4FKMA 4K03A 3RU7A 4RZHA 5SICE 2ZB4A 1L4NA 1IXKA 3NRBA 4IIJB 5K0NA 1PT7A 1A72A 1PR9A 4GGMX 1ADFA 5J4HA 2QLMA 2FSVC 4E5KA 3RJTA 2OL4A 3RKUA 3UWSA 5IABA 3QTBA 1Q1NA 3FYUA 1WUJS 3LFTA 1HDRA 4IXNA 1Y6QA 4G26A 1C4OA 1JLHA 1N2CA 3A9UA 3F7NA 1M66A 2Q7XA 3RC9A 2H2HA 5LQNA 1DJMA 4FVTA 1F17A 2I2FA 1ZCZA 3BIWA 3R1IA 5B6PA 1G38A 1JV2B 2VP3A 2FWBA 1DRUA 3RYCB 1PDWA 4HAOA 3CN7A 5LFAA 5JDIA 3FJ1A 4WN9B 3KLOA 4LJAA 2W6JD 3GCDA 1KQOA 3DBHB 5BVHA 3FPHA 1R50A 4Q9DA 1IAQA 3AB7A 1YR9A 4QODA 4TMYA 5HEKA 5EMNA 1KHTA 3F73A 1TTPB 1U1GA 3NZEA 3LD9A 3WOHA 4C89A 1P0QA 1KEZA 2NU7B 4Q7KA 3VR2D 5JVDA 4HQNA 3RIMA 4YJ2A 2QN1A 4DMCA 3RKSA 4DTIA 3PEVA 3B1JA 4I55F 3FWZA 3BRQA 5F78A 1M76A 3HBAA 4G5RA 5D87A 3A32A 2CEAA 2NXCA 3KKQA 3NTOA 3QKRB 5T6BA 2F8SA 2PMFA 2J3DA 5T3UA 4MMXB 4OFBA 3UMRA 1QGUA 1PWXA 1Z5VA 1XAGA 2FUG1 3EIOA 3KWLA 4K9OA 4U2KA 1XZKA 4ZK2A 2P40A 3UZUA 2VSFA 3K71B 1YXMA 1JNXX 1JHUA 2ZR0A 3BJMA 2WHQA 1OASA 4HYQA 4LZOA 3RYFA 5BSFA 3GLRA 3BN3A 3THOA 3BD9A 1K0FA 2P2DA 4S24A 5CAEA 1Z0IA 3RV3A 5BPFA 1G2IA 1LWNA 4W5QA 3D8UA 4GPTA 3IESA 3KTAA 5CR9A 2Y1XA 3CZ4A 4D9IA 2ATVA 1G9XA 1JP7A 1M83A 2EIXA 3KUUA 4DCCA 5KWJA 1W5SA 2D5BA 1UL1X 4RSMA 3ZDZB 1WW3A 1Z2OX 2OO5A 4AJKA 3RYIB 4BGEA 1A50B 1TMKA 2YWEA 3I5AA 4Y6QA 3VMMA 4NMHA 5BMVF 4UNSA 5C35A 3STHA 5HQ3B 3AKCA 1KTVA 1E0SA 2JEZA 4CIDA 1UAAA 3H86A 1JA0A 2VK8A 3PC4A 3NORA 1KORA 1GOTA 4LI0A 3BWYA 4B7CA 1HFKA 2O5EA 2V6GA 1PSWA 3TR5A 4ZJUA 2EJCA 2FZKA 4GW3A 3AUFA 2YZ7A 2W4IA 4YRPA 1CUBA 3H13A 4JOSA 4PG8A 3QEOA 4BBZA 2GH1A 1RADA 1XMIA 4CVNA 4G0XA 2A2ZA 3NHZA 3Q9NA 1XEXA 4CGZA 1GDTA 3LF1A 4OBWA 3THYA 5B3JC 1RMQA 2ZZNA 1QV9A 3HVRA 1H3NA 4WKCA 1PL8A 1AZSC 1C3JA 1FNCA 2GNPA 2QAGA 4LZNA 3SG0A 4DCVA 4G5XA 3H18A 5IYZB 1TK9A 3MC1A 5GV7A 2ZWPA 3H87A 4GI5A 1MB3A 1G59A 3P9QA 4OBEA 2CHQA 1O5OA 4IGKA 5AKIA 3TZLA 2R00A 1FRZA 5LQUA 3E3LA 3IRUA 1JI0A 2ZP1A 3FI0A 1W6UA 3WISA 1BOOA 1FK8A 3PNMA 3JVIA 4C7KA 4E30A 1D07A 4RQBA 3DBRB 4F60A 1VA5A 1MO5A 1RC1A 2MSDB 3A3KA 3GQBB 4FDVA 5BUZA 4KK3A 1CRPA 3PQ3A 2O52A 2DR3A 3IP6A 4NMLA 5EE9A 1AIPA 1QPZA 3Q2OA 2M1XA 2MSNA 3SHWA 2XWQA 1GSOA 3QU5A 1EK5A 1XMSA 2YZKA 2HJVA 2W6ZA 1QLJA 2CGEA 3IMCA 1V7ZA 1QAQA 2NT4A 3LQYA 1HT1E 4MJ7A 4NZOA 5KHAA 3NT5A 2ZZKA 4R83A 3VUEA 5TV2A 4CF6A 4C4YA 2VTVA 3I9FA 3JYPA 4PSKA 1KWGA 4C78A 3ZW7A 4BAUA 1SU4A 3U3MA 1K68A 2F8TA 1VE3A 2MJLA 3Q12A 1I2BA 3F96A 4A73A 1Y3BE 3LFUA 1D9ZA 5AW5A 2P2ZA 1PR2A 3JARA 3AJRA 4FGUA 3UGTA 5EJMA 5B7GA 4JYAB 2DECA 1SR8A 1H2WA 1TAQA 2X9LA 3OJWA 1KBQA 1PK7A 4N7BA 4PZ9A 4RK4A 3IRVA 4TQUS 2C59A 3TINA 4HSGA 2Q4EA 3VU0A 2HNAA 1TX4B 4ZAWA 2ZRDA 4O8CA 3HK2A 1JHDA 4KIGA 1VP9A 1PL6A 4QE3A 4OYHA 1HE4A 4IKPA 4TM7A 4BQNA 2OSBA 1D9XA 1EWYA 1P5HA 3QVLA 4WWHA 3ADOA 4HGNA 2AGVA 3UMYA 2ODAA 1NW5A 4H35A 1QFSA 3NNDA 3R0QA 1KYWA 1FFXB 4LXYA 5EKXA 2FYTA 4U6SA 4CIYA 4BO1A 5IFKA 4QM7A 1SKMA 1LJ8A 2FR1A 4G1CA 4GH5A 4HSEA 5EC8A 2V9PA 3EQZA 1Z0FA 3L7OA 3Q6NA 3GT3A 5AMXA 3FCAA 2PBZA 4JUBA 3OE1A 1PT6A 2JVIA 3CNLA 3JQGA 1Y3CE 4HBZA 2EERA 4P1ZA 2B35A 3VZDA 4C3OB 4E7PA 1JR6A 1HM5A 4XH9B 1A04A 5K8JB 4DV6B 1X7DA 4R0NA 5KNCH 2X0DA 1V6AA 3R75A 3LC2O 1JDBC 3CSDA 1YZ3A 1F0YA 3CC8A 4YAWA 3MCWA 4M1WA 1QP8A 2ARKA 3HVKA 2ZRMA 2ZWMA 3R40A 3ZWAA 4NE9A 4YALA 1DCKA 4F91B 3DTNA 4UEKA 2XEXA 3RASA 3VZRA 2IYRA 1V1RA 2W6JA 1GKIA 4WFQA 3ITKA 4DIMA 5K8VA 2HCJB 3RHZA 1DS6A 2WV9A 3GDWA 3KVYA 4I9GA 3WK7A 5DF1A 1ZMXA 1KAEA 4HWPA 4RPKA 4ZYXA 4G1VA 3KD2A 3VTAA 5JSUA 2RMKA 3PGXA 3VR2A 3HKEA 2JATA 3QVXA 2NUAA 1E3DA 1UKBA 1UDAA 2N46A 4OSOA 3BA6A 3BZWA 4PC6A 4WRRA 3U40A 4A91A 1QUFA 1ESDA 5E4YA 1FXSA 3GZ4A 3KBBA 2PKYX 1O1YA 1P2BA 2R8RA 1XCPA 2ODQA 1MW9X 4YJFA 3EVTA 5BYKA 5JLJA 1C14A 3U7GA 3AUSA 3ZHXA 1Z6ZA 2GFHA 4XRRA 4AU1A 4IY1A 4K6HA 4B76A 1PWYE 2YY7A 4DJDC 3H5RA 5ESDA 3EG5A 3EH1A 3TX2A 3UJPA 1U8AA 2K7ZA 4R69A 1OLUB 1R6AA 2X4GA 2HRRA 4HLDA 4K9SA 1R6BX 4MWDA 4C0HA 2SNIE 3N6VA 1ODTC 1SVKA 2MYPA 1F6BA 2NU6B 1R9MA 2WDPA 3DJYA 4RD4A 1M1YE 2CK3D 3OLZA 4MVJF 3PP8A 1X9GA 2KBFA 4L3WA 1N6IA 2YNMD 4TYYA 1HC7A 4HXEB 4Y2YA 3B1KA 4DV0B 4E11A 4GM4A 3MBKA 3AO0B 2WYVA 4AF8A 1EYZA 1NBWB 3ENQA 3K1YA 4YJHB 4YI5A 1FRVA 2BUAA 2XBLA 3I0ZA 2R6CA 3DKVA 3JVVA 1MJ5A 5IK2D 4J0KA 3UB3A 4I4IA 4IJWA 2E5FA 3RLFA 2BMAA 1ECFA 2AXNA 2GEKA 5SV2A 5SYAA 3DQPA 2L82A 5J5AA 4EY8A 3UV6A 1FE8A 2IDZA 1V3QE 2CC2A 5AVKA 4GM0A 1O3YA 1AXRA 2G09A 3C24A 4G85A 3WXBA 4C29A 5A4JA 1RZRD 1T9BA 1CJKC 1NJFA 3JQAA 3OWOA 5DDIP 4QPDA 3RQIA 3WL4A 2RGUA 4B8ZA 2Z43A 1YOVB 3L7JA 4PQGA 4F38A 4KGVA 3A1WA 4TUYF 4MX8A 2GCOA 3ROZA 2IDJA 2QVCA 4TLLB 1U7UA 4ZTBA 1XCJA 4RK5A 3T7EA 1YJ8A 2VL7A 1KJ8A 3ASUA 1JIUA 1Y3DE 3R9KA 1XVTA 2OV8A 1EINA 3U4DA 4JXXA 1F7UA 4B85A 3LBHA 4YCDA 1CCWA 5D3ZA 1V11B 1Z8FA 1Z06A 4H15A 3FTQA 1I7LA 3LZCA 2X86A 5JQGB 2CV0A 3LP8A 3TSZA 4RA9B 2BR5A 2C1XA 4BQFA 4KJXA 2WE8A 3CG4A 1SVSA 4O08A 3L1HA 2WWHA 2PS9A 3DDSA 4MRNA 2FUKA 2H2DA 2Y9MB 3FPEA 3I30X 5EFZA 4PSVA 1OB2A 3B9PA 4KAAA 3NXSA 3OLQA 3AR2A 1HDOA 2FSIA 1GUYA 4HR7A 4HWGA 4B33A 4DMGA 4EJFA 4CLRA 2G17A 4CKYA 1G6OA 5BNIA 4GPAA 4Y2UA 1MEOA 1XKTA 2H1VA 2O3TA 4YV0A 3G2MA 2AMFA 3DBIA 3ETGA 2JAHA 3G2NA 4FC7A 4I50F 2GJKA 3I58A 1IM5A 2R6R1 3JATA 3JYOA 4DR1B 2WNHA 1GL6A 2HHLA 1PFGA 2W9XA 3IQWA 1MO3A 1NX9A 4EPTA 1PZFA 4C22A 1PJRA 2QXUA 5CLFA 2O2GA 1A2KC 4QPJC 2H5EA 4LHEA 3X1XA 4OCZA 2NUPB 1L3CA 4ZT3A 1IOVA 2QG4A 4UPVA 4RJTA 5CMLA 2Q3HA 1HDGO 2EG5A 2WVHA 2LE0A 3DDUA 2WFAA 1O87A 2H63A 1NVMB 3AUXA 1CZNA 5EZYA 5HDQA 4N40A 5JXHA 3GLFA 4YC7A 1SBZA 1L9XA 2XX3A 1QH9A 3LXMA 4FMCF 4OYYA 4O2BA 5AJTA 5IDVA 1IEWA 5BWLA 2BZGA 4NECA 2A9JA 2EJBA 4LV5B 3U4CA 4DKJA 2KHZA 3U60B 3HCWA 3MT8A 4IJUA 3EVAA 1XPOA 2XQJA 4NWIA 3GVHA 4G5GA 5IHXA 1PTJA 1P7PA 2ZI4A 4RVGA 2YMLA 4WNAA 3ILSA 1AZTA 1SUEA 3RWBA 1JALA 1VL0A 3JQFC 3PXBA 1HURA 1U7OA 4U7FA 4F2GA 3QWBA 3VVBA 4RMJA 2PX8A 2HU5A 1LY1A 1R0CA 3KHUA 2DH6A 4QSHA 1PDVA 4OOFA 3TPZA 1WHSA 3KYJB 4WOBA 1LV8A 2EYUA 1Y33E 1QB7A 4HLUA 2ERCA 2GAIA 4RL6A 2O2XA 3JWHA 4LZPA 2G08A 3ZH2A 3ZXUB 1ZSVA 4BP8A 1TM3E 5GONF 2OSVA 3R5XA 2J5BA 1MQAA 2WQ7A 3LE8A 1DAGA 4EUKA 2IUTA 2Y1KA 3W6ZA 3CT6A 3A3PA 1SCAA 3DFUA 1E3SA 2NZWA 3NEYA 4IHJF 2GD2A 2VJMA 4INAA 4L02A 3VV3A 4EB8A 5BVGB 4LF7B 3V7FA 5KNBH 2Q4BA 1I7QB 2Z6VA 2Z8YM 3NHRA 1XDBA 1Y9JA 1CUSA 5E7IA 4MW0A 1A8IA 4JI7B 3WG9A 4RWZA 1GZ3A 2NNWB 3ZVMA 1Q0LA 2QTWB 3MCTA 2J0EA 4AI6A 3OQJA 2YH2A 4YRRA 3ABZA 3NBMA 3WMWA 4IDFA 1N2XA 3LUGA 4IIJA 4RFLA 4E21A 3W5SA 4E5NA 1GZUA 2IYZA 3C43A 2J4DA 3EAGA 4LY3A 1WB9A 4YREA 1JJIA 2LBPA 4PRLA 1PVOA 3VPXA 5FV7A 1J7JA 3PFKA 5ADVA 5AQ1A 5KOHB 4KX3A 3T3OA 1I5EA 3E4DA 3UJDA 1NA5A 2ZJ4A 3U7FB 1JZSA 3EC2A 3RUDA 1JQJC 3VH3A 2BKVA 2DU8A 3C15C 3KQUA 4EFNA 3CEMA 3NIBA 2D1FA 3M5DA 3O4JA 3KB8A 4FQ5A 4JVOA 2H92A 1PBNA 2XUDA 2FG7C 5AIBA 5EMMA 3TQOA 2XGJA 3STVA 1VHQA 1D03A 4WN9A 3IVXA 1DOAA 1K6JA 3DBHA 3FZNA 2ZREA 1TJ4A 2PU5A 2X9GA 1N1EA 3P9ZA 1IUKA 1PJ3A 3GEDA 4D9EA 3BGDA 5AVRA 3KQLA 1A7AA 1NPYA 1UJCA 1X7XA 4X60A 2V0CA 3RBXA 1SUBA 4GOMD 3WDLA 2NU7A 1KOLA 2XV1A 3DP7A 5J2TB 4H17A 5HKLA 2IZOA 4A0QA 1EA7A 3GFSA 3SSAA 5BXYA 1SRRA 1AMOA 3R2JA 4EVRA 4D80A 2CK3A 4I2VA 4MR8B 3DE4X 2YNMA 1LZKA 1QYWA 1WPXA 1C81A 2IVZA 3QKRA 2BD0A 3K73O 3LNCA 3KJGA 3VSBA 3FAZA 1MHPA 4FIDA 2DWUA 4DM7A 1LI5A 2GBPA 1U1DA 3I8OA 3L05A 1S2DA 1N7IA 2IV7A 4IGAA 3FDFA 3Q8XB 1MDBA 3D1VA 2I4MA 3DYIA 1U2DA 5IK2A 4KZKA 1ZEJA 3QPWA 2JIBA 2ZJ2A 1Q0ZA 1SC9A 2MINB 4X54A 4B74A 4CLDA 3TL3A 3E5HA 4X3PA 4COKA 3CVVA 1UFOA 3WK5A 4L0DA 3JRWA 2J08A 4PRZA 3IUSA 4KYVA 1YCFA 5EUQB 1RZRA 3UPUA 4GI2A 1NW6A 2HCRA 2VAPA 1KKMA 2HK8A 4ZAVA 3WRVA 1Y6RA 3H05A 2VQDA 4KL8S 4LHZA 1ZSYA 4INOA 5A03A 1CEXA 1PEKE 2VPXA 1YZUA 4JHLA 1U63A 3IPAA 1HG1A 3M4ZA 4OQMA 4DWWA 5C80A 2CVPA 2H00A 5EXDA 2HYIC 3RYIA 1R8QA 2PX0A 4EW2A 1KFEB 1Z29A 4G67A 1XQ1A 1MJHA 2Z08A 2OO7A 1ZK3A 3PE4A 3S81A 3V4VB 1H4VB 4RACA 4ZI7B 3HWRA 4IVRA 4H59A 1Z38A 3QZUA 4KMOA 4U8GA 4UU7A 4BBPA 5I9IA 1ULUA 2OBFA 3G8CA 1WF3A 3MLEA 2BT4A 2GPSA 3O3MB 3QX9A 4I6EA 5TS3A 5K5EA 3MWDB 2F67A 3H99A 4KKVA 1KR5A 4PZLA 2J9FA 1XZJA 3EPRA 2CZGA 3QLUA 4FD2A 1EFRD 3WYNA 3GRUA 1Z4JA 3LUDA 4Q1FA 4UVDA 5CU7A 2YQ5A 4MPTA 2OYSA 3EDOA 2BE7A 3GJ7A 2I3ZA 3T7JA 2QLTA 4QRIA 3O4FA 1ZCAA 4F85A 2WUEA 2QQGA 3B12A 3NH9A 4BMVA 2YFQA 4JXJA 3JQ7B 3RUHA 2W11A 2D2VA 3JZDA 3J81k 5DWVA 1SXQA 3P0IA 5IYZA 3NP7A 1P0IA 4V3CA 4DY6A 2P65A 2IYOA 3TCXB 1VRCA 1KYQA 2PRZA 2W37A 3AHGA 5F3DA 3UOGA 2FOLA 4ZU6X 3HCFA 4UD6A 3W5JA 3GFQA 4EFLA 3MHTA 1LDMA 4FYIA 2O48X 2IVFA 3S40A 4RV9A 3MQ4A 1E98A 2PL9A 3EHDA 3GV0A 3DBOB 4IAOA 2RD2A 1X80A 3RAFC 5EHIA 1XTZA 1LTQA 4XX1A 3WGGA 2PG3A 4H31A 4D0RA 2I0FA 3J81A 4H6XA 3PFCA 4YP9A 1JHXA 2EX1A 1WZUA 1I2AA 2ZBRA 3GQBA 1HLGA 3BHIA 2B21A 3QWAA 1HMYA 2W48A 2QX8A 1RQNA 3TLZA 2DY1A 1WVIA 2PJDA 2RI6A 3ZZMA 4N0MA 2FRVA 3CF4A 1ISIA 3C6BA 1JFFB 4OGKA 4S3MA 4Y30A 3WHKA 5AW0A 2C4UA 4W9MC 4HCJA 5FTLA 3GRPA 1O0SA 4C3VA 2ADMA 4PHFA 4JEHA 3B6EA 1M5TA 5AXBA 3K1JA 4KREA 4RF3A 2XMBA 1Q0PA 4KKXB 4XDZA 3VNAA 3OETA 3MXOA 5ALFA 3RYTC 1R8SA 3ZWMA 4ATNA 2FN7A 5HCUA 4EFKA 2YOGA 4MO2A 4RV4A 2DTXA 1G3UA 1QBKC 2HDOA 2B92A 2P2YA 5IW8A 2ZQZA 4WKBA 3SYTA 2OHHA 3WWCA 2QVXX 1B3BA 3LQRA 1CYEA 5JAZA 3N2NA 3MJDA 4BO4A 3ZGNA 1LPMA 5IS2A 4ENVA 4QREA 3G88A 3T9AA 2NTEA 1QORA 1W36C 3GLKA 2B2XA 2EOAA 4PZEA 5KDLA 4CQNA 2W71A 1EBUA 2VYCA 5G1OA 3ZIUA 3GLVA 5IASA 3AKEA 2Q8PA 1RHQA 4PZ0A 4OI1A 4N7JA 1DXQA 1FFXA 3BH7A 4FYXA 4IQGA 1Y6ZA 3TZ6A 1TCAA 1UMDB 1S2MA 5DHRA 1F0NA 3LP5A 3DZJA 4IJVA 4UBOA 4FJ2A 4FT4A 2E49A 3E7XA 4OXRA 1GUAA 5BQXA 1K27A 2XDAA 2WSIA 3WHPA 3TLAA 4RZ3A 1KMCA 2AMYA 2AVDA 2JIOA 1OR8A 1O96B 3LVBA 3PUYA 4MLCA 4MVJH 2OXTA 1ODLA 2VYVD 3OCUA 3IR6A 4MIEA 5IXJA 3ESDA 3EXAA 4H3VA 1M34E 5BRJA 4WVLA 1IBSA 2VT2A 3AR6A 4OQNA 1WV1A 2XMPA 3LLMA 1X8LA 3V2UA 4IKOA 1DB3A 2ZKLA 1X3SA 4YRFA 1QF7A 4NBVA 3AI1A 2WNIA 4MKRA 2QN3A 2SCUA 1XYGA 2NPIA 3C3WA 3DR5A 1CIPA 3MRSA 4D8TA 3OFND 4C06A 3W5CA 1HX7A 2HZ7A 4NJEB 1AVTA 1ZX1A 1M8PA 2DFTA 3K2QA 2GEUA 5EIBC 4UATA 1D8TA 1X1QA 1YZVA 4V38A 4IH9A 2LRHA 5FPKA 1Q11A 2ECPA 3BGWA 2GFIA 2VZ0A 4JS0A 2GPBA 5J43A 5BSMA 4L15A 1OYYA 3B6MA 4ZVTA 2OBXA 3GROA 5G4KB 2BKAA 4OXYA 4WA7A 2NSHA 3AEKB 2BCEA 4NBUA 1P19A 1KI2A 1LRLA 2AG6A 3VKHA 1O6BA 2HCTA 2JFPA 3ROKA 3O3OB 3TDKA 4A8JA 5D2CA 1I7PA 3L7MA 4BQEA 4KXQA 4CU2A 3R3VA 3EWAA 1FSGA 1UK6A 2EBFX 2IY9A 2FWNA 4KI0A 5A3QA 5JC8A 2FPXA 3MHPA 1SURA 1ZVQA 3P9KA 1E2HA 3Q15C 1W8IA 4YBRA 1GTRA 1IL0A 1MU0A 5B55A 1F1JA 3QNUA 1T6XA 4PG4A 2JLRA 3O2NA 1C2TA 2H57A 4I14A 1NG9A 4QYIB 1LEHA 2B9EA 4ZEVA 2X0KA 2CUNA 4U0JA 5KNLA 3RFCA 4UPEA 1WW8A 1D7OA 2JFBA 2NXJA 2ZE5A 1OLUA 3AJAA 4MRRA 4ARIA 5FPSA 1T35A 3FI9A 4MRVA 3FZYA 2VDMB 4Q39A 2NU6A 2NSLA 2O8DB 2P2GA 2IT1A 3E1GA 4ZC8A 3AB8A 4PWYA 4A27A 4KB5A 1NE7A 3CLUC 3K0AB 3QF4B 3FY4A 4I1OA 4DQ0A 3QEMB 5ALYA 3V3TA 1MAWA 3L7LA 3COVA 2F3RA 3MM4A 1GQRA 4G25A 1UDXA 1HEIA 2EBHX 5AXDA 2HIGA 2JCGA 3CR8A 4G8BA 4ZEMA 2VZ8A 1ABFA 1ZJYA 4R8MA 5JNVA 1O95A 1V71A 4PLFA 1FX0B 3QRWA 3BMOA 2WUVA 1EUCA 1MVOA 2OK8A 1RYNA 4WBXC 2CJWB 2DUNA 3K9QO 2G0TA 3VHQA 3CMMA 3VKFA 1YUBA 2V0GA 1SOWA 2ZSFA 4MCAA 4BCCA 1TVEA 4MV8A 4YK7A 5FUXA 5EE3A 3VVCA 3RG2A 2A5GA 1RRCA 2PQ6A 3ICCA 3KT3A 1YOVA 1L9KA 4FI3C 1G41A 2CVOA 1EFRA 1MQ9A 1SCDA 2AR9A 2Y77A 4JI5B 4YWHA 4ON9A 4MV4A 1T8TA 2BZSA 1U3FA 4TTQA 4P6VF 2NU9B 1T3LA 2LW7A 4CR8A 1XD2A 3TLBA 1U0OC 3Q6MA 3JVUA 3ETLA 5CW1A 1SUWA 4MUBA 5FBLB 3RBVA 1QP0A 1YB6A 4RFVA 4NBWA 4ZRNA 3AY0A 4Z9XA 3CPJB 3SXPA 1XG5A 3UAXA 3WP0A 1V11A 3S5JA 4MA5A 5IWAB 2VTEA 3CEAA 1DRVA 3MQ2A 4MWCA 1G21B 4TWZA 2Y6UA 3L6OO 2F64A 5JATA 5JQGA 3R3ZA 2BGMA 4RA9A 1IM2A 1S6YA 2R87A 3KOUA 5IVPA 1KDRA 1DIOB 1VMIA 1G17A 1OYVA 3N2KA 5FBHA 5F7OA 1VI6A 3QX8A 1TUBB 5IZ4A 4BMCA 3EA5A 3FWKA 4F12A 4HFMA 4N6OA 1MDFA 4XWTA 4BCDA 1I4WA 4JC5A 4P38A 1UPTA 2WWRA 2XGMA 1KY4A 2P11A 3AERB 2FSGA 4MRAA 5EZQA 5JMTA 2NX2A 4MHSA 1F2DA 4CG3A 5F2OA 2Q6OA 1XRSB 1H2YA 3NGMA 2XXAB 2D54A 2QRHA 1WWKA 3DV9A 3HCRA 4NBTA 4P8RA 4ZVOA 4F4UA 7GPBA 3NO4A 1MB0A 5HKKD 4LF5B 1Z7EA 4NENB 4DMHA 4KN9S 4TL9A 1UH5A 3U4IA 3U4QB 3JZIA 4QYWA 1FU7A 4CEHB 5GGXA 2OK7A 1X7YB 2VHZA 3JASB 4PFKA 3W4KA 2C5LA 3KUKA 1TC2A 2NUPA 3ADKA 1NBAA 1EWTA 3QOYA 4LOHA 4HN2A 4OQDA 5AM2A 3ZWCA 3PFNA 5J4YA 1DMRA 1FS4A 1VL5A 1W0CA 2IIVA 2QXYA 3EC7A 2EJVA 2ZRLA 3PKZA 3ES9A 4O6VA 4FGKA 3T15A 3BK2A 1UK8A 2UU9B 1YB2A 4OX9Y 1NSTA 2G83A 2MSEB 4BNYA 1RQLA 1HI9A 2F3TA 5FA5A 4EMTA 2VJBA 5IEJA 1EWQA 5JD4A 2HSWA 3TVDA 1WMAA 3ZWKA 3BSSA 3TGLA 3FOCA 1FJGB 2I4LA 3VAZA 2FMFA 2M2IA 1DKLA 4OP3A 2Q2QA 3MJ4A 1M0SA 1XHEA 2RK3A 5D7NA 4AYTA 1AK9A 1I6LA 1Z0UA 2AZDA 1ZY2A 3GUUA 2NO5A 4RABA 1CPYA 4MKZA 2QD4A 2VT7A 4ZI3A 1HFWA 5KMGA 2V7PA 4MTCA 2P7IA 4H3SA 5HJ2A 4JJEA 2H7YA 1UPCA 2QPTA 4JLDA 1VCHA 2GEVA 4EAQA 4ZYTA 1MAHA 4LXHA 1RBYA 4L85A 1TM1E 4HNGA 1F4VA 4ZHQB 1DI0A 3ZTTA 2XUGA 3EVGA 1PJQA 2CBZA 2VYVA 3DULA 1QIJA 3FVQA 3MWEB 1RWBA 1M7HA 3DO5A 3IEIA 5BVGA 3IOCA 1FL9A 3OMWA 1GILA 5JISA 1RQGA 3RBAA 2VHYA 1QDUA 3N8NA 1OBOA 2HU7A 3P9IA 4C04A 4ENPA 4N5DA 3RYHA 4YMGA 1ZU5A 3ITEA 4L9RA 1W4LA 4YT8A 3ZTYA 5HKBA 3OHPA 3LOPA 1OLXB 3OFNA 2X23A 2R7LA 3D3KA 1TE2A 3PJDA 4HJRA 1UK9A 3NALA 1XF9A 1G16A 4TWJA 1RLOA 2O2EA 4TROA 3VHLB 5AKLA 1E1YA 4KIFA 4WPGA 4Z9BA 1Z7YA 5EP3A 1E6WA 1JWAB 2HC9A 2NWQA 2XTNA 3L46A 1ABBA 4I5DA 4PX3A 2O2JA 4EKDA 5KOHA 3T1HB 1CXZA 3GIDA 4BMXA 1R0YA 2H2FA 5D5QA 3EXEB 2M1ZA 1XF1A 4LECA 5ALNA 3L93A 2BHSA 5E8JA 5KSOA 3HABA 4LWOA 5H9VA 1JFSA 3L7YA 1KEUA 4LMPA 1FYXA 1R2QA 1JFTA 1SHLA 4XLZA 1VHDA 4GWGA 2IYSA 5ITSA 1T25A 4ZAZA 5J63A 1Z17A 1NYRA 3DYBA 5GZ3A 5JDIC 4BVAA 2BFAA 3IXQA 4YNBA 1EXWA 2VCEA 3IMGA 1PNVA 1RCFA 3W7AA 1GAXA 3HSKA 4URVR 2HRQA 1E2IA 4PTLA 4BKQA 4P7FA 5J2TA 1YHZA 3C1UA 1G8PA 3DMNA 3SYNA 4EI2A 4GRAA 1CLEA 2EZTA 2O2CA 2D7JA 2WFMA 4LVUA 3QWIA 1TD9A 2MYTA 2PX2A 4J0JA 1HNNA 2AFHB 2RCYA 3ZQKA 1X7WB 3UOAB 2IOFA 4QOSA 4AZTA 2JLSA 3G2KA 4JIGA 2YXBA 1OB5A 2V4UA 4LOIA 5JYBA 1Y9AA 1U3GA 3N9IA 2PUGA 4U5XA 4IVQA 4LBVA 3KD3A 2OZLB 3D3JA 1Y48E 4EPXA 4L7VA 5HIAA 1N7HA 2C3YA 3OEHA 4BEBA 4GQBA 1CWUA 4B3RB 1E63A 3D4PA 4L3VA 5BSRA 3AY7A 2CNDA 2MINA 2XLBA 1E2JA 3WYEA 3ZQUA 1IN4A 4D5GA 3QLTA 3CUUA 4NI5A 4LQCA 2DPMA 4CMGA 1QIGA 4J6EA 5GM2A 3LX4A 1JSCA 2O57A 1JMKC 1X8JA 1IHYA 1QDLB 1YZQA 5DBIA 2O8FB 2P6UA 1XTUA 1QX4A 3HE3A 2VHQA 1BMDA 1LH0A 3BDIA 2J8ZA 5J59A 4ACBA 1YRHA 3NPAA 1U1EA 4HQKA 4UFOA 7ABPA 4G23A 2I78A 1PR0A 1VCIA 2ZE7A 3D3WB 4GDMA 2HHAA 3IAAA 1LS1A 4Q7LA 3I09A 4CT5A 5F23A 3GP5A 1GV0A 2RHTA 3INNA 1ZIDA 5AM3A 4BFVA 4B3SB 4I81A 3H6KA 4ZOCA 2J59A 5IC4A 5FBZA 3W0LB 4B3JA 1GN8A 2IUFA 4M2LA 2NO4A 1PHPA 4KLZA 4QYTA 4BUCA 1E4YA 1NDQA 2I2DA 2OO5C 3FSJX 4GBED 1ORVA 3AW8A 1RMTA 1Y7HA 4ZI7A 3IL2A 1N6RA 2B82A 1PFYA 2P90A 1HDEA 2F1JA 3FZGA 1QOPB 2AXEA 2V3VA 1RBZA 1C7IA 1P5JA 2VDKB 2VOEA 3GT4A 1L4MA 2MT9A 4DBZA 3RD5A 2HBRA 2P30A 5CHYA 3WL8A 4EO9A 4YV2A 4OBBA 2O7VA 1UKCA 5E9WA 3X1JA 5JSZB 1NRWA 4CW7A 2GS9A 3N8KA 3T06B 3OCJA 4X85A 3E70C 5ECGC 2QJFA 2YHAA 1N1GA 2YHUA 1KYXA 1JTFA 4LJ4A 1PK8A 1VB5A 2JFXA 3L3BA 3RM3A 4B17A 1ZW6A 1F60A 3U4GA 3JQEA 5DZSA 1EHYA 3JAWB 2JFVA 5L53A 3KR2A 4NNPA 1KO4A 4Q47A 1JJ7A 5D1HA 3RUIA 3CKKA 4A92A 5HKKA 2I80A 1DDOA 1YS6A 3PGVA 1V7CA 1K4YA 2QAGC 3I0NA 2ASEA 2OOSA 2R8EA 1OV4A 3L0PA 3P9RA 3SAJA 3DM5A 2VJOA 5EHXA 4O4LF 3LKDA 4J94A 1RWQA 2VAXA 2C0PA 2RJOA 2AI3A 1M6WA 2ZT6A 3CZ9A 3WB1A 1UKYA 1UXKA 4O4HB 3J80A 1UADA 3ELDA 1L1RA 3T3DA 1W96A 2GAJA 4PIPA 4UHDA 4NHEA 4MH0R 4EGQA 4Q6WA 4G01B 3N2GB 4HQFA 4QD3A 5AD1A 1MRSA 1NM5A 4DNQA 3T9BA 1JL3A 4B4KA 3GHYA 4L8GA 1FY2A 4WNYA 3ROTA 3VVLA 1CUXA 4IUBS 1CE8B 4NCXA 2AD5A 4K6FA 3HJCA 4QO7A 3RSZA 4PS1A 1JFFA 1JDZA 1WP9A 4KGDA 5H7XA 2RGAA 1RWVA 3NP9A 1KJQA 5EEGA 1GPMA 4Z1MA 1LNZA 1DE0A 2Z0MA 3Q3EA 3WAKA 4HI0E 3A26A 4F2WA 1K6IA 3WGIA 1AU9A 1QG6A 4LRYA 5JXIA 5L6LB 4B0OA 2ZG6A 4GLOA 4TSKA 3U3DA 4Z6KA 1K9VF 4KK4A 4MI1A 2JHAA 4X90A 2PSEA 3KJEA 5HF5A 2Y1DA 2IYYA 1GEGA 3M6AA 4LNHA 2QL5A 4PGFA 1N4DA 1L8OA 2MR6A 3MMSA 1NF2A 3S29A 2R1ZA 3FX2A 5CEJA 1A88A 2BEUB 1D6JA 2V1UA 2I87A 3IDZA 4MO9A 1FLAA 5CYPA 5JCPA 1XEFA 3R7NA 3VU9B 5I9TA 1J8QA 4FIZA 2RAVA 2WU0A 3KFVA 2AJTA 4LBZA 2DHDA 4JVSB 4L5AA 1T8UA 1TCVA 1U7WA 3QLJA 1T1GA 4KVFA 4X1OA 4XASA 2XB2A 4KNYA 4WXPA 2G07A 4XTRA 1BU5A 1CDDA 2VBFA 2XWPA 4Q6BA 2UYHA 1UMDA 5I7SA 1Z88A 2I2BA 3UK2A 1OXSC 4DB2A 4N3CA 3RHTA 2HSGA 1O96A 4X5OA 3EUWA 4OHCA 4W99A 3RJ9A 4UNPA 3LK7A 1AC5A 3OLCX 4DCPA 3FCXA 2NZXA 3GRVA 1PO7A 4S05A 4KXLA 3T7KA 4MV5A 2EKBA 3A25A 1EB8A 4MINA 1RHKA 1W1WA 3ADPA 3DCYA 3UJ7A 5JAPA 3PTAA 1QNLA 4J07A 2HWXA 2RBEA 1XTBA 2AMVA 4JDPA 5HIKA 3VJKA 2QX6A 5E6RB 4RXUA 4UCFA 2G4CA 2PVSA 4NJEA 3ZX5A 5M7EA 1YR7A 3GCXA 4DMRA 5A04A 1M2OB 1AA9A 1M8KA 3M81A 4DPKA 4Z3DA 4C7JA 3ZD7A 3RRNA 3K2BA 2I4NA 3CCFA 4WNCA 4MMZB 5CGZA 4F1KA 5FI1B 2Q5IA 2VYQA 2FRDA 2ZRPA 4JI0B 3FUCA 3W2EA 2PUDA 5G4KA 2C3UA 2O19A 1FNMA 3LCRA 3TW8A 4OHRA 1R4AA 1U7ZA 2VK2A 3AEKA 1Q74A 2DG2A 2GZHA 4K6GA 3QE3A 2CHEA 2QQEA 2VA8A 3G5LA 3MK31 3OQPA 4KP7A 4C0AC 1NYQA 4Y0VA 3W34A 5I7OA 2CFCA 3PGJA 4FTWA 2I91A 1ZIOA 1N5MA 1CUAA 4HN9A 4HUQB 4IJ5A 2ZOSA 4JBHA 1GIAA 3OF3A 4L4YA 1ZDMA 2YV5A 5DSTA 1KQGA 2W83A 3MTQA 1CULC 1RPZA 2REOA 1R4ZA 2W7TA 4FN4A 4QYIA 1PZXA 5I8WA 2E21A 3B6JA 3R3UA 5J9FA 3TTVA 3NHWA 1VRWA 2Y0EA 2YIJA 4ITUA 5EXTA 2OQ2A 4DHEA 2BV3A 5A5GA 1MV8A 1GQOA 4EUFA 4S35A 3CW2A 3WXMA 2C5EA 4DR7B 1YQQA 2O8DA 1K5PA 2Q5EA 3WDKA 1KIAA 2JBHA 3LY8A 3K0AA 1T5LA 2WWIA 3MBIA 3QF4A 3LY5A 2E7ZA 3QEMA 1LGYA 2B37A 5KOJB 1L5KA 2B5WA 3LIIA 5DYWA 1BRTA 3TJZA 3COJA 1N36B 1XZQA 1G5IA 1DAFA 2IIBA 5IKEA 4FBLA 1BQ4A 1DIRA 1K2VN 2JBWA 3HR8A 1XKLA 4YMVA 4D3SA 4ZJYA 4MWTA 1FX0A 1Y63A 1Y4DE 2HJWA 3JYHA 4HB2A 4IJKA 4P4UA 3ACDA 2CJWA 2JAXA 1I6MA 3RTCA 4RTOA 1FFHA 4D6PA 1C5KA 2DUWA 3A04A 3HKDB 3QELB 1OA1A 5FWAA 3CF6R 1WMEA 2AG1A 3THWB 2OAGA 1PG0A 1Q7GA 1ORHA 4MV6A 1R37A 3UCFA 2D1QA 3VR3D 3OZVA 1H5QA 2UUPA 4G1EB 1DV2A 1MC1A 2P1DA 3B13B 3GFBA 5JCJA 1FP2A 1Z13A 2IODA 2NU9A 4PC2A 4EA8A 1AX9A 5C1BA 4B3DA 4Z4IA 1JQ3A 2HMSA 2R7NA 2GXSA 1R6DA 3WNDA 2VAMA 1RAEA 3GGOA 4V39A 5K3OA 3WLTA 4EKEA 1P5FA 4DLXA 3FE2A 2LD4A 5A02A 1Y6JA 2FUG6 5L9AA 3WA6A 4JBWA 2P9CA 4AUKA 1IYZA 2C9CA 1J1IA 3DOCA 1K7YA 1ZHOA 1G21A 3GFPA 1GRVA 1RPTA 5KWEA 2CUTA 1I1HA 4GI7A 5H81A 1KDYA 2R60A 4LTNA 2QLFA 1C9JA 1HEYA 1M72A 2P3SA 3M6LA 3QVOA 4MKXA 5D84A 3R23A 3ROFA 5I3CA 2XHEA 2PH3A 2PPVA 3LZDA 3D54D 4MWBA 3L8MA 3AERA 4C05A 2Q5QA 3H2GA 2G82A 3CRVA 4E31A 3MBOA 5CM8B 1HLDA 1DINA 1JYFA 3O82A 1ID8A 3CVOA 1WW2A 4XWYA 4FDAA 3UGJA 3K9CA 3W6UA 2XXAA 3VYRB 2ZIGA 4QOGA 4BP3A 3T3GA 1OKKD 2FV8A 5TF0A 1TIPA 4ETNA 1I4LD 1OFGA 1RKXA 5LSAA 5ELMA 4NENA 5FUVA 3PK0A 4JU9A 4EJ2A 1E2EA 2I03A 3U4QA 1Y81A 4I5FA 3G5TA 1U81A 1ULAA 1E8NA 3CVYA 1C4WA 1X7YA 3JASA 4CEHA 1LPNA 2IUSA 5LB4A 2VNAA 4YXFA 1I2MA 1TKBA 3FUXA 2VJLA 1XQVA 3ED1A 3P0EA 4R3UC 3PUWA 1W94A 2BGKA 2DYKA 4QUDA 5BSHA 3M34A 4PG7A 2ZQYA 3TIFA 4AX8A 4ZZ0A 1Z7BA 1LPOA 3PBKA 5AVXA 1KOGA 1EX7A 3L6BA 2W8ZA 3K8YA 4QPCA 3FPKA 1CR1A 2QX7A 3UWPA 2WILA 3CNOA 4D74A 3L07A 5K4GA 2OGSA 4JQOA 1NRXA 2IXBA 4EKYA 4A0HA 3NDPA 4ZCRA 5G2OA 2FQ1A 1VCMA 4Y6GB 3AU8A 5HBGA 1AH2A 4EEXA 1XN1A 5DX1A 1WSDA 1YS4A 5HF8A 2AFRA 2WJ3A 1ABEA 4L0QA 2HADA 2JLWA 1YRWA 1EQAA 1E5XA 2FMKA 2QTZA 3BM5A 3N2EA 5LB2A 4EGJA 4BO8A 1SXJD 1XEWX 3AR5A 1KQ3A 4HLUC 2PBRA 3IE2A 2Q3FA 3NC0C 3CJQA 4E88A 4ZHQA 1ETHA 4FS3A 3QXHA 1NVKA 1AKUA 1OI7A 2AZMA 2P35A 2HKIA 3MWEA 2H85A 3CQ9A 1OLOA 1HZZA 2G0AA 2ZUWA 4P3KA 1CVLA 1NVAA 1JIJA 1BCRB 5A0VA 2F17A 2CLHB 3I6ZA 2AN1A 4RK1A 3T1TA 3U61B 2WZCA 4GNRA 5KCMA 2C9YA 3BAZA 3GEGA 3ZCVA 4Y9DA 4GDFA 4IUCS 4FWBA 1MOZA 1FW6A 3EIWA 1MVNA 1U11A 2JGEA 1BTOA 3EGVA 1JHMA 4JLUA 3WSWA 1FP7A 2OBYA 4JYMA 2PMCA 3KKNA 3STXA 3DNMA 2GT1A 4IIHA 4KQ2A 4TMFA 4U9IS 4DXHA 3O3NB 5CCXA 3BQNB 4H1VA 2YBDA 4EHLA 1T5HX 3BRWA 4AJNA 4I9FA 2AEEA 3TB4A 1PWZA 1I0LA 1XNJA 2QJOA 2A94A 1ARZA 3HB0A 3I9KA 4MUEA 2JEOA 3LQFA 3R24A 4URHA 2WWXA 3IPXA 3KP1A 5LD2B 5KMGB 1HE5A 1Q7EA 2PFKA 2F9MA 4QFMA 4WJKB 2VF5X 2AKAB 2XTAA 3IILA 2HTEA 4L6AA 1VGRA 4P22A 3WLEA 1RZ3A 4YONB 1XUOA 3LHDA 1SELA 3C3EA 1ST2A 2JAWA 1D6MA 2BP7B 1P1CA 2WAMA 4E7OA 2Q9CA 1E9SA 3DE3X 2EJTA 3U26A 3VTKA 2G3YA 2XZPA 3IV7A 4YHHB 4MP8A 4KXMA 3V2GA 2P75A 1NOIA 3BVPA 4G2TA 3SJ7A 3F9CA 3GJZA 4N01A 2B4KA 2RB4A 2QPAA 5T4BA 4BV8A 1GZ4A 1ISMA 1RI1A 5F1OA 1QLHA 3V7YA 3W3ZB 4AUNA 1QFJA 4EJSB 3DKIA 4J0CA 1IRIA 5B57C 2O3QA 3QHPA 1GFSA 1U94A 3QVMA 3ZD6A 2AFHA 1CRQA 1T1SA 2ZU6A 1X7WA 4U7PB 1J9GA 4JBIA 3L43A 5T5QA 1GAJA 2SICE 3B3QA 2CYAA 2X1MA 3HXLA 4BMOB 1XEAA 3E58A 1Y7PA 4BUZA 3T1QA 2GVDC 2YNMC 3N7TA 4QJ3A 2H1SA 4RY0A 2OZLA 3Q41A 2V7UA 3AVOA 4YLEA 3I2IA 1YB1A 5CT5A 1D0VA 5FKJA 1WNFA 1ODKA 2F43B 5EHGA 1DAKA 1WCXA 1E9CA 1GZVA 1XTSA 2Q4DA 2H7VA 2RKWA 2WG0A 5ER9A 1U2DC 3K0HA 3OIDA 5CX1B 4R2KA 4UEWA 1KAHA 1QE0A 1ZXXA 1YAJA 3FNEA 4NYMR 4DJAA 2O8FA 1PGQA 1K7EB 1RYBA 1ORDA 3EQ8A 2C2HA 1NI5A 1S1MA 1YFZA 2BM8A 2CFOA 2KJQA 2P69A 1MBZA 3LY9A 4D45A 1QZ3A 5A4AA 1IBKB 2WWFA 4NOLA 1ZD9A 3ZJVA 1N2GA 3B1VA 3VR3A 4D2IA 3NAMA 4NYMQ 1WY7A 2FN9A 2H4XA 3RUEA 2H08A 1M1XB 2NZJA 3NDJA 1GAQA 3OEWA 3ROGA 1MNAA 5EIXA 1D8AA 3GQVA 4Y18A 2JI7A 2HOQA 2DBRA 1BDIA 1T1RA 3KT0A 1F3OA 1N2CE 3KJQA 3DPIA 4CJXA 1BFUA 4QXAA 1IVYA 2WAOA 2Y27A 4JI1B 1YR2A 3QKWA 4RE6A 2A5DA 4M0DA 3TMYA 3VJMA 2Z6AA 4RQAA 3HU5A 4CL2A 3KOMA 3WQBA 4L07A 4GICA 2HEIA 5I9SA 4Q21A 4K9PA 4P93A 3H2JA 5HRUA 2G8NA 3UMGA 5JSZA 4EG5A 1VHWA 1HMPA 3WLOA 1DNPA 3I0MA 1BX1A 4TTJA 4XARA 3X1WA 4F4CA 4WK4B 5EIFA 5KIAA 3HFSA 4H0NA 1W30A 2BM9A 2XUHA 3CJTA 4QEKA 2I4RA 1DP4A 4E2FA 1A8SA 1UOQA 4FQ7A 2HIMA 3JAWA 4IIYA 3PEYA 3KYDA 3TCKA 1FBTA 3DO6A 3LDFA 3S2EA 3PCXA 1ZNZA 1JEEA 4DTCA 2ZJYA 5DP1A 3S2YA 3WB0A 1SPXA 1ORWA 2JANA 3ZI7A 1E8DA 2AI1A 3SR4A 1FF9A 3IX7A 2JKZA 4MUJA 4ZV7A 1JH8A 1R6VA 1WKBA 3L0IB 4XGNA 5B36A 4N18A 3SHFA 4Q03A 1SBNE 1AB5A 1Z5GA 1G2QA 2AD1A 2RH4A 2TMYA 3NKLA 3ORHA 4O4JB 3WLNA 3VAAA 4CV1A 4D8YA 4F06A 1MB4A 4AXBA 4ZVKA 4YDSA 1BDBA 3PEFA 3UNXA 1UBNA 1LSSA 3TW4A 3CS3A 3VZBA 6CHYA 3I4LA 3MELA 3N2GA 1N25A 4ND1A 1N0VC 1S8OA 3KELA 2FUEA 2XCQA 3PC2A 3PC8C 4ZYYA 3ASZA 3HI4A 4MLZA 2C77A 2CHGA 2DWCA 1GNTA 1ZRNA 1CE8A 3RS8A 4HDQB 4XB1A 5TQ2B 3UAOA 2H1FA 2J31A 4FYMA 4DC9A 5CP8A 5DM1A 4GPBA 1GPKA 4QGAA 4RQTA 2H4FA 1EP3B 4AMYA 1DV1A 2ZIXB 3ABQB 3BWBA 3PVZA 1JXOA 4AB1A 6ABPA 3GIWA 1RRGA 3CH7A 3RGWS 1II8B 2B78A 2XGSA 2YZNA 4M1QA 5E95A 3U7IA 3WWYA 3VR1A 2BM1A 2WIDA 4DNFA 2V59A 5ITVA 1MRNA 2GK4A 2Q7OE 3ERCA 1SHTX 4G8JA 1KS9A 4A4DA 1J49A 2VUUA 3C8MA 3I64A 3UMFA 3HVHA 1CLUA 2ZRAA 4LYHA 1EX6A 3EVBA 2JHPA 3WHIA 2ZB3A 4MUKA 1U7DA 1G6Q1 2BEUA 2IXGA 4EHDA 1HQYE 1IEXA 2JVJA 2NIPA 3PYLA 4R16A 4PYOA 5SY4A 1MT0A 5T64A 3SVZA 3UMCA 3VU9A 5JADA 2VSNA 2OE2A 2O8VA 1B1AA 2HTFA 1NPDA 4FGZA 1P1BA 4UDOA 1E7SA 4OQLA 1PJLA 2GSDA 2VUIB 4Q7QA 5B1YA 3DLAA 3VDRA 1UMCA 4EA9A 4WL0A 4M21A 2PGLA 2A6PA 3RW9A 3MAGA 3TLJA 3UUEA 3H4TA 3EYAA 4EYQA 3WMGA 5B2EA 3T7AA 3ZVKA 1DKUA 1GM5A 1R0LA 2NSDA 4Y0AA 2IPAB 2GYVA 4QOIA 4KUGA 4D8VA 1NLMA 4MVJM 1KAOA 4M86A 3NC4A 1XQXA 3CCCA 3QQPA 5EGNA 1V4BA 2WB2A 1YL7A 1FFAA 2R5NA 1XTRA 5AI8A 3SYRA 3UTDA 1SKYB 2HA3A 4HGQA 4M98A 3MA0A 5TGTA 5BR4A 3GEBA 5JJBA 1Z5ZA 2ZPTX 4X41A 5E6RA 1XPRA 1U5CA 1F4PA 2BDTA 1UZNA 3IBTA 4PG5A 4Q3CA 5CT6A 2WJ6A 5AW9A 4CDRA 5GZ1A 2XZTA 3QHAA 3U3OA 2OKCA 2UZ1B 1F3LA 4BKMA 4ESOA 4ZHSA 3GA5A 4ZZ3A 3ZVRA 3EOAI 4GOKA 4L9AA 3PGA1 3T41A 1Q1EA 2W42A 1QH1B 3LSYA 1JA1A 1I3NA 2Q1YA 1S2NA 5EY5B 2Q3BA 5DGTA 4BX2A 3I6IA 2H1RA 2WFZA 2XYHA 1SQGA 3AEQB 4YIHA 2PZGA 1VJTA 1Z35A 1T2CA 2FPSA 2YVQA 3CE9A 1LLUA 4FYPA 4QUGA 3TTXA 1YVUA 5ADHA 2FZVA 2Y4NA 4F9GA 5JT1A 4R1NA 1DG3A 5EE5B 3OWXA 1AO3A 4HUQA 1S3FA 4TGLA 1RTTA 2P1RA 3SF8B 4W82A 2ZM6B 1SBHA 1PUXA 1QHNA 3KCQA 2G9RA 4JXKA 3QX7A 1AS2A 4BEWA 3K0EA 2HJGA 1WIWA 3H1GA 4GGPA 4OHWA 5COAA 2BONA 4YP6A 5HTKA 1RKBA 2EKZA 2P4QA 5F64A 3WGQA 1TO2E 1A4XA 5A6VA 2W90A 1U3VA 4R5MA 3PHJA 3RSHA 3PJEA 4KHZA 1USIA 3K16A 2IDMA 4GPEA 2GARA 4K0KB 3LQ2A 4YRCA 5C7IO 1GN9A 2OT3B 3WO1A 3CY6A 1CRWG 3B1ZA 4DZRA 4EY5A 2YUTA 2WJ4A 2FPPA 5A06A 3G3EA 3PFHA 3U17A 1G7RA 5KOJA 2M98A 1G1AA 2G1KA 4E6EA 2XCTB 3A28A 1HSOA 3E9NA 3MFQA 4IICA 2GNOA 4BNVA 3QFTA 2F4NA 3WDSA 4D26A 1E58A 4HVTA 5HQTA 2C4TA 3MCVA 1LD3A 1UFQA 2J9XB 2QZ9A 3QJGA 5JSYA 4BB0A 2PXCA 1CUVA 1NW7A 1S2GA 5DSXA 3OUTA 4LRSB 1KH2A 4E32A 1EUYA 2IPLA 1W87A 1YQUA 2HQ1A 1LDNA 4CM7A 3HKDA 3QELA 4E22A 5BR8B 2UZAA 3PLNA 2XMQA 4E5MA 3H17A 1LDYA 4NZYA 2HHJA 3RVQA 4YMHA 3THWA 4YV7A 1RQXA 1V37A 1A3CA 1XO1A 1GQFA 2PTHA 2WAXA 4LYAA 4BLOA 4OXIA 3CPSA 3OE7D 5GPBA 5C37A 4YTEA 4OH1A 1K63A 1NE2A 1S5PA 4KPGA 1Z47A 3Q4GA 3T7TA 1VDMA 3VC1A 1E9BA 4BV2A 1A9RA 4D41A 4LHVA 2ZRCA 3WS7A 3TECE 5JSHA 4ARSA 1XL0A 2RHRA 2ZAYA 3KETA 2DZDA 2YTZA 1W4AA 2FW8A 3QYAA 3A6HA 2W2PA 2LKDA 4FNAA 2XOKD 4J2OA 4OKIA 4X8HA 4DQXA 1EIWA 3B48A 3IMEA 1DRWA 3JAKB 3FPSA 2MYNA 4ZOBA 3EISA 4GYYA 1G8JA 4S1TA 3GHHA 3ZEAA 4LJ7A 1P7YA 5CLHA 1IU9A 2ONZA 3LTEA 3M70A 5IG2A 4KQFA 3E82A 1NVTA 4NATA 4EB3A 2JJQA 2JNWA 1HH4A 2A3NA 2C7GA 3TH5A 1E4VA 4LY9A 5HP4A 3PGMA 4IR7A 3W79A 1PJTA 3HKBB 5A62A 2X9VA 4O25A 3VOAA 4PX5A 1PYOA 1RSZA 2DCMA 4UM5A 3ZWWA 4BBJA 1LC3A 4DNOA 3STWA 1HO3A 1TK3A 1Z25A 4JZYA 4G0ZA 4RHFA 3HYLA 4N3AA 5FJJA 3R6TA 2OHFA 1RLUA 2OTCA 2WYHA 3HB5X 3LKZA 4WX2B 5CH3A 2C99A 1MGOA 4UE2A 1TQ8A 4X1YB 3W4JA 1SZJG 1TYEB 2AOTB 1NN1A 2AXQA 1N0HA 1S4MA 2VP0A 2RDMA 1YJXA 4OXQA 5K3CA 2DQZA 1FQKA 4CMJA 1JT9A 3KKLA 2EWVA 4KGZA 3CRW1 1ZQ1A 4RK6A 5ES4B 1GRQA 3IDSA 2J9RA 2YN0A 4CM4B 1W4CA 4YRDA 5KDOA 1JEQB 3QLEA 2HSJA 2NU8A 3ON5A 1V4VA 2IBSA 3IJ5A 3RQSA 3OIUA 2QN7A 3AFGA 3GP8A 1KP9A 3F5FA 2CT8A 3ADDA 4LBWA 2R4TA 3OY2A 2GN8A 1IH8A 5DNAA 1KIFA 4FDUA 5K3BA 5HM8A 5FUQA 5HF9A 1P2SA 3ZH9B 3GI1A 2ZR8A 4GR4A 2EFEB 3HZZA 1L5OA 1E60A 1TJ3A 1WCV1 1XDSA 2IOHA 2MSLA 2P67A 3DB2A 1KY2A 4DAEA 4MXDA 4QZVA 3AUAA 1E1QA 3USZA 2PKWA 4BLPA 3ZQ4A 4MA0A 1I7SB 3C3KA 4KWEA 4DSTA 4FN5A 4TL6A 1Z6XA 5A9RA 3S2SA 4CI0B 5B6IA 2BMVA 1BS9A 4GR5A 4UCWA 4Y2HA 2RGRA 1WMBA 3JWGA 2JBAA 2PX5A 2RAFA 3QUTA 1J70A 1AF7A 3HPQA 5TMEA 2TMDA 3GFVA 2NYUA 3AW9A 2C58A 3EIQA 4AO6A 4DILA 3QPDA 4QJBA 3V4OA 3VM6A 3F67A 1BCRA 4WN3A 3IJPA 3QNWA 4FE4A 3ER6A 5A71A 2OCYC 4JBNA 4R1OA 3B20A 1VLQA 5ALHA 5TVKA 2J0UB 2XCIA 5NULA 3JVEA 3OZUA 4RIFA 3SSOA 3WQQA 2XXBA 5CFLA 2C2WA 2UVDA 3FIJA 1OMOA 3KHSA 3O31A 2I6TA 2WAYA 4ZO6A 4KAXA 5BV8A 1U9IA 1DJQA 2OB1A 4LZWA 2F9LA 1CK4A 1TKCA 4MJLA 5FA6A 1ZN9A 1X7ZB 1SWWA 1S7CA 1UBRS 3UJAA 2DUMA 2WJZB 5CITA 3P97A 1ZIXA 1EVEA 3GA0A 1G60A 4FE3A 4TTPA 3KM0A 4P82A 4NPCA 1Q17A 4NH0A 4EH1A 4F96A 5DBFA 5I47A 1GV1A 4I6GA 2JA1A 3WGVA 2QB5A 4M0EA 2W6CX 2QIPA 3JZAA 3B3FA 3O47A 4KNVA 1DKMA 3ZXYA 3GLFE 4FINA 3KPYA 2DBYA 3MOGA 1P3Y1 2BP7A 2HV8A 2PEZA 1T91A 5GIPE 1Z0ZA 2EFGA 3RUPA 5DIZA 2FJUA 1BXRB 1BE1A 1I2CA 2PGJA 2R751 4LYEA 4QBKA 5EJ7A 1JF8A 5KYUB 4NBRA 2QSUA 1X1DA 4NEHB 2RHJA 3I83A 4BO0A 2O2DA 2CLEB 4R1MA 3OCXA 1L4EA 1E92A 3OIWA 2ZKIA 3OLVA 5ECWA 5ALIA 5LP6B 3VZPA 2JAOA 4DA9A 4EJSA 3G0GA 5LNK1 2QVYX 4HTAA 3ZE8A 2PLNA 4YFVA 3NX4A 1WZIA 1ZNYA 3GVIA 1FTNA 4N7MA 1P7CA 4F8YA 1NMXA 1V8DA 5DNDA 4EF6A 1OH7A 1VG1A 3O8QB 1G8YA 2JGMA 1JDPA 3PQ5A 4LSMA 3N0TA 4TLBA 3L4JA 1OPRA 3FUUA 2X6RA 3UJHA 2W43A 3OEYA 5C51B 1VLMA 2Y99A 3R7LA 1LUAA 1TLLA 2HA0A 3GPIA 3TL6A 4DUGD 4XKJA 4LQDA 4QSMA 5ANRB 2PUFA 2IS6A 5CX1A 4QUJA 4U00A 4XVQA 4LE2A 4QULA 3Q7PA 3IEPA 3TBKA 1UJ4A 1RT9A 5K51A 3UK0A 3ZCXA 1YB5A 4GG1A 4BKOA 4UQPA 1RHMA 2ZSKA 1VE1A 1WF6A 2LUOA 1QRAA 3LA6A 5C7OO 3OE7A 1L4BA 1W59A 3IKMB 1Z4IA 2QQ0A 4BU0A 1OTHA 2CB9A 3OX4A 1SY7A 1JVNA 5L3QB 1TD1A 3OTWA 1LTHR 4OI2A 4QNRA 4AJ1A 4E0BA 3SC2B 2XOKA 1J24A 3L01A 3OQIB 1BU8A 2OB2A 4JLWA 3FROA 1A5BB 3EPKA 3GNTA 5D3MB 4PZYA 1UMKA 1UBMS 2PKXA 4B3BA 4TTVA 3S2GA 1H2BA 1QHFA 5LMUB 3AXSA 2Y0DA 2CV1A 5DISB 3IE0A 1CHNA 4HAXA 4NV3A 1SAYA 3GL9A 4TTSA 3VV2A 1L5MA 3W6OA 1O4WA 4RO0A 4UVHA 1Z63A 1KHHA 5KNDH 3GYBA 3H9CA 2QYSA 4HDSB 3RUAA 1QJCA 3W5VA 5D5HA 4X20B 4RDXA 2VF7A 5DU2A 1GL3A 4RPJA 2Q1TA 1JLRA 1DBQA 4EB0A 3GRAA 5FAXA 3QFCA 1ZA2A 1ZI9A 4BATA 1RS0A 1LV7A 3PNYA 3PUXA 4HWSA 3CTPA 1CJCA 3LPCA 2Y1FA 5IZCA 4BLWA 4KITB 4OVKA 2ZW9A 5AT1A 4KTVE 3E61A 2ZI9A 4N47A 1NF8A 1A9YA 1FFBA 1Y5IA 2R8XA 2ZYIA 3LKBA 2ZYAA 1AY0A 1WEKA 3PDJA 3T3IA 5BPHA 2Q5JA 5D8DA 5JBQA 4EO7A 2FTKE 2M32A 3DOIA 5HNKA 3W8NA 3IQGX 4MPDA 2ORYA 4RXTA 5FT9A 5T57A 4DLNA 4ZVRA 5M5BA 5KQLA 3CRQA 3P0HA 1NM5C 4IIDA 4OBXA 4Q1DA 4RKWA 3S55A 5TQ2A 2FN3A 4ZQFA 2I7DA 1HTTA 1N2BA 2WVJA 3CO5A 1GTSA 5A4DA 2C2KA 2AQIA 1PQ4A 1LK5A 2ZIXA 3HUDA 1E62A 1QRDA 1LF5A 3LYLA 1FFWA 3Q98A 1II8A 5FR1A 3AR3A 3TDMA 2BMFA 2BH9A 4N8SA 4MRSA 4OQPA 5COBA 4F97A 1FIUA 4YRMA 1XK6A 3ENVA 1C1YA 4MUAA 4ITRC 1MH9A 5B7NA 4L28A 4LVCA 3HDVA 3FYTA 5AK6A 1GTVA 3KTFA 5T4HA 3QMVA 1Z8NA 4H08A 4HJXA 1CV2A 1BXZA 2DJ5A 4KO3S 3VI3B 5KI6A 1UCFA 3I2JA 1YIOA 1AQJA 2Q4TA 1DAPA 1YASA 4IIUA 3GN2A 5JYEA 1ZGCA 2I34A 2IC5A 3V4ZA 1FCJA 4AY4A 1FU8A 3BD6A 3V97A 2GXUA 1ZOSA 1H22A 3V1LA 4OHUA 2ZIWB 4FNMA 2DUUA 3DMGA 3VYVA 3H1EA 2YX1A 3H4VA 4LCBA 4PAWA 3UW3A 3E0XA 4D3DA 2PVPA 3KYBA 4IP0A 1T0UA 3R3YA 4IMJB 1QIHA 1M1ZA 4L8FA 4LWQA 4OJTA 4BEJA 5AFSA 4QT0A 2O8BB 3VO8A 2PLRA 4YMLA 1WB6A 4KYIB 2HGZA 3T5DA 2RBKA 4P54A 1YKGA 3KZMA 3FBTA 3FMIA 4L57A 2Z5VA 4ZAGA 4A36A 1DQNA 4AW9A 4BZZA 1OX6A 4HC4A 1KVRA 4F3RA 1QU3A 3M0EA 2VNIA 3UMSA 5DHFA 1KMNA 1ZHFA 1M8FA 2A9VA 3I12A 1ZLXA 1HYHA 2LIVA 2UZ1A 1VKZA 3ILYA 3PRHA 1L5HB 4UC0A 4YQYA 2GZ2A 3KQVA 4URFA 3TW0A 3U3JA 1EFKA 2D2EA 2OCBA 2QGNA 1ECCA 2QNIA 3A2NA 4ARBA 2BGGA 1QH1A 2PZLA 4G4SO 1I4OA 3U4MA 4GXRA 2FPUA 4ZVUA 1PD1A 3BWXA 4MS3B 4J8PA 2FRDC 2YJ5A 1A98A 3OFSA 1L3IA 2YZMA 4DANA 4W5NA 4I08A 4PU0A 3BIOA 2ODBA 2INGX 4TWBA 1P8JA 3KXIA 3BIJA 5INTA 4RE5A 2YHIB 4XQEA 3DNPA 5C4MA 2GKOA 3BEOA 3C3MA 4GX5A 4MGKR 3HNOA 4XR4A 2B8JA 4B75A 3SF8A 5CIQA 1QVZA 1M1YB 1EJ6A 5HZHA 1B2RA 3A31A 1E0AA 1J22A 5CH8A 1EUDA 1H2FA 4M38A 4NNJA 3RNOA 3LAWA 1EA5A 1IZ8A 3NWOA 4YQEA 5IDWA 1Q21A 2DSNA 4F46A 4BO3A 5LPNA 3CR7A 4DUGA 4ZO9A 3ZWXA 4ZCQA 4ZPJA 1DAIA 3AUKA 4GC5A 4RHTA 4B3GA 2ADOA 1P74A 3UHJA 4EYKA 5GTDA 3GJ4A 1Y80A 2VHXA 4GMXA 3EVEA 3TFQA 1G5FA 3DHVA 3PGKA 4DR3B 1SVMA 2C2MA 3O94A 4DW8A 1XP8A 1QO9A 2OHGA 4WMLA 3LPDA 3QU2A 4I2NA 2VOJA 5ALLA 1TAUA 2ADFA 2OBMA 1RZUA 3CUVA 1IDN1 2BCGY 4P2GA 1VL1A 1VHJA 4XQGA 2I2XB 2D1SA 4IOMA 2ZTSA 5FQOA 2X0FA 1JHVA 9LDTA 3WAJA 3R6GA 4XFJA 1YHNA 4DA4A 4C7OA 4CKCB 3MTEA 3OG9A 5I7HA 4MEAA 2WAAA 1P1JA 2XDQA 4V0LA 1KKLA 4KRFA 3GH1A 3FZEA 5FR2A 3I2YX 4RVUA 3TZCA 3WGHA 1UIMA 1H66A 1G5QA 3WGMA 1CY0A 1ECJA 5DE3A 1ZBQA 2FLWA 2PMWB 3GMDA 1XIVA 5D6OA 4XM1A 3PUZA 2XIQA 2QAIA 2Q1WA 3JQDA 1C0LA 5AHXA 4AYWA 2ENWA 3M7IA 2BPOA 2B1RA 1BN7A 1CJVC 1H1LB 2RGNC 5HYVA 4F9EA 1T10A 5K6AC 3Q0EA 1CJUC 3MGCA 4MJ3A 5D51S 3C85A 4OB7A 1RJ9B 4QPZA 5KQMA 3PXXA 3A2LA 3OFJA 4ND3A 5E0OA 3RS4A 2HWWA 1TVCA 3JAKA 2OQVA 4TZ0A 2FETA 1J42A 4C08A 2R1UA 1FTSA 3P9XA 4EJ0A 1KWKA 5KKCA 1B2LA 3GJQA 4CTNA 2UVPB 3V8BA 4FLMA 2E4VA 4BO9A 2XCSB 2ST1A 1T8RA 1S02A 2ZRQA 3N5CA 3VZQA 4RPGA 1KS2A 3UANA 4U2BA 4JJ6A 3CIOA 1JTEA 4R8LA 1EG7A 5EGSA 1G66A 1VBFA 5DK4A 5IKOA 2J5XA 4BVKA 1YDHA 4GKJB 3HS3A 2QN2A 1O6CA 4QU5A 3HKBA 3OFVA 3NBQA 4AQYB 4RIGA 2VI5A 3KKEA 2QM8A 3LKVA 1I94B 5B58T 4X7MA 1MT3A 2C83A 1B1CA 1IN6A 1FMTA 2H2IA 5IDQA 1CERA 1IY9A 4GE3A 3GPBA 1ZWLA 4G4GA 1D2AA 3BFVA 4BMDA 4X1YA 5AJWA 2AOTA 2LDXA 1RXWA 4GVPA 4DDKA 3PNKA 4BYGA 3FOEC 4TWAA 1JLMA 5EA2A 4DIKA