2QD4A

Wild type human ferrochelatase crystallized with mncl2
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 144
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A01
4CCSA 2H1VA 2XWPA 3AQIA 3M4ZA 3HCRA 2DJ5A 3GOQA 1DOZA 2QD3A 2AC4A 2XVZA 4KLCA 2XVXA 2XVYA 1TJNA 3HCPA 3W1WA 1C1HA 1L8XA 1QGOA 2C8JA 4KMMA 1N0IA 2PO5A 3HCOA 2H1WA 2Q3JA 2PNJA 1LBQA 2PO7A 2QD1A 1HRKA 2QD4A 2HREA 2HRCA 2JH3A 2QD5A 4MK4A 4KLRA 2Q2OA 2XWSA 2QD2A 4F4DA 1C9EA 2HK6A 3HCNA 2Q2NA 1AK1A 2AC2A 4KLAA 3LYHA 1LD3A 2XWQA
chains in the Genus database with same CATH superfamily
1TT5B 4HH3C 5FH9A 4FHGA 2FUG6 3NGMA 1B8PA 1S01A 4C78A 3VTAA 2X2PA 1ZP6A 1U3VA 5KNCD 5JYBA 1K6JA 1VLVA 2ZAGA 3FPCA 1KMQA 4NF2A 3RFCA 4J4BA 3GBPA 3FAZA 5CVDA 4Z9XA 1PWEA 1AGYA 1RPAA 1EWTA 4EY8A 2FG7C 4TSKA 2VC2B 4RH3A 2R2AA 3AH8A 4V1CA 2RHOA 5ES3A 5HK9A 4HAYA 3ZDBA 1T0UA 4OXXA 5JMOA 4IDOA 5E38A 2I22A 1G3QA 1TM4E 4XASA 4B4OA 4BB9A 4HMOA 5TQ2B 4LBYA 1ZW1A 4UATA 3SC6A 3DMHA 4D80A 4ZI7F 2B5OA 2ODNA 2QPAA 5CT6A 2QRPA 1OBOA 3H8WA 2IU0A 4AWAA 5HEKA 4W8GA 5JZSA 4RY2A 1VFNA 5LZ9A 4Y2YA 5DM2A 4ZT6A 3MILA 4EKNB 4F71A 5DYTA 2GCOB 5CCDA 1NY6A 1P2GA 4J0IA 1WBBA 5K8TA 5BMVF 2EKLA 5TT0A 3VYUB 4LGCA 5AJZA 4YNBA 3TRFA 2CHGA 2AL7A 1SRRA 1D2RA 2I6FA 2PCJA 3KHSA 4UOZA 4WCFC 3AERB 4KO8A 4B87A 1PNVA 1YZQA 5IBQA 1LK7A 1Y1TA 2D06A 4MEBA 4MWSA 5EWLA 1RHQA 3GLUA 1DRVA 2I4TA 1XO1A 4HN4B 4XCQA 1NYTA 1N3IA 1KDVA 1JJVA 1SVLA 3HRIA 3KNZA 3W3AH 3A1CA 4A6PA 1G20B 1Y7HA 2BKAA 3FLMA 1DAGA 2JVIA 4JVOA 2IIVA 5JNLA 1P7PA 5DEOA 1O95D 3EDCA 4YCMA 3ZOKA 5G02A 2FW9A 3H8JA 4FBGA 2HU8A 1QWSA 4GM0A 3RS5A 2W6JD 1PKXA 4R9NA 1UKCA 3PD0A 3DGEC 1A4RA 1GNVA 4ZKDA 2FKNA 3I01A 2CJWA 2H5EA 3UXEA 1PS9A 4KREA 3TINA 5IASA 3LSTA 4OXQA 4DWJA 1BH6A 2I71A 2G04A 4BLWA 4JLUA 4XVQA 1PZEA 2NXWA 5G4KB 1YE3A 2QP9X 1WDWB 2IDZA 3DM9B 3E8XA 4JJEA 2P5TB 1O6FA 4JS0A 4YIKA 3OJFA 5EKTA 2R1TA 4KUEA 4ZC8A 3EZ2A 3V7YA 3ZHQA 4PQGA 2QA5A 2VEDA 4RWEA 1AMUA 1KHTA 3N2ZB 1QQ5A 4ITUA 3JYLA 4PCLA 4HAVA 4XWOA 3S68A 1XPUA 1XZPA 1P60A 1MKYA 1KBQA 1MAWA 4M9CA 3KOMA 3L7YA 3M1IA 4AQYB 1X2EA 2ZZMA 3BL5A 1CE8B 3E9NA 4U3JB 4IXWA 3G1TA 1GTJ1 5AW7A 3LH5A 8ATCA 1EGAA 3ZC3A 2GCGA 3ABZA 3I4CA 1R15A 3E8MA 3DKPA 4LXUA 2ZIUB 4CKYA 1C29B 3FMGA 3SHWA 3TSZA 3MJHA 5JQGA 1HM5A 3SP1A 3HACA 2GK7A 2VL7A 5KSZA 4P53A 1P18A 4M89A 2F9LA 2AK2A 5AVYA 2RGRA 4FZVA 2ZS9A 1ZIXA 5DHRA 4KR9A 3SI7A 2G3YA 4AZ0A 4DJ5X 1SA0B 3I6IA 3QKUA 4M55A 1GNTA 5EUMA 1MEOA 3E7XA 4JP3A 4L4XA 1X7ZA 1Y9AA 4ZCLA 5JMPA 3RRFA 4BB5A 4GVXA 1GPYA 4IJ5A 1EUDA 1B74A 2UZ4A 2CXUA 3HJAA 4ZT4A 3L7KA 4BO8A 4FVTA 2DQSA 3GZNB 4JODA 4LIPD 2AFVA 1M33A 1WW3A 1EPUA 1OYYA 2WFZA 1N4DA 3R6GA 4FCCA 2WAAA 3AZPA 1W1UA 4NYIR 3TDKA 4LJKA 4G85A 4UU1A 2XCUA 1MH1A 1N2OA 1PBNA 1M1NB 2NZ8A 3I9V6 3CXUA 1X1AA 1NRIA 4JOSA 1FXSA 1PL0A 5T4EA 2ACWA 2ZIVB 3THYB 1CUSA 2J5KA 2I76A 1JECA 2O2YA 2RB4A 3OE5A 1AN0A 4ZO9A 5AUPB 4NMXB 3NHUA 3E9QA 13PKA 3ZCSA 3OJXA 3WX0A 4QTZA 3IPAA 2BSQA 2NZVG 4FIZA 5DNVA 3VVMA 5HS6A 3WP0A 1J9EA 2R8PA 5EMKA 3UOWA 4BYGA 4RXMA 1HNXB 2Z6AA 3AEYA 3PSAA 3TIXB 4CTJA 2R751 3KC2A 4URWR 4UVIA 3DEKA 4B8ZA 3S2FA 5DW3A 1A9RA 1CDDA 2P9QA 4XYBA 4BO1A 2WTUA 1PFVA 4RX1A 3RSOA 1MQ8B 3EB9A 3MJ4A 5FXMA 1Z08A 2O1SA 3PEVA 1SXPA 1M83A 3VC3A 1YQQA 1EE1A 2XNJA 3FB4A 4O08A 2ZTUA 2EFEB 3B3AA 4BFLA 2ZUCA 4FM9A 4R5HA 3ISTA 4EKIA 1BH2A 4MQ4A 4UM8B 2PO7A 1FRVA 1EFRA 2D54A 3IIIA 2NMVA 3AVQA 3W04A 2Q27A 2GKOA 2IZOA 4LZPA 4PSUA 4WL0A 3TB6A 4W1QA 3MWEA 3UO8B 2B4YA 5KU7A 4R3WA 1DPGA 1EA5A 1K1EA 2OT3B 4FLMA 4PTYA 1NBHA 4PO3X 2RHCA 2ZSBA 4RETA 5D8DA 5E0OA 3IUPA 3NONA 3KR2A 4JLJA 3QUCA 1WV0A 2P91A 4FDUA 4CTKA 1CUGA 1G0OA 2APJA 3RG2A 3J80A 4A03A 2MWMA 1FDRA 4J1NA 3DR5A 1EVIA 4WFJA 1R1DA 1CUZA 1E6CA 2C7VA 2XTNA 4KC0A 5CPFA 3KKQA 5EGSA 5FPYA 3PQEA 1JPUA 2J67A 2JS7A 3NBMA 1RAIA 2R87A 2C8JA 4OQDA 3WIOA 4A8PA 1U99A 2XYHA 2J3JA 2XWBF 3QE2A 3B1VA 2Q2QA 5TPWB 3GJ8A 4F56A 4XVCA 3TQOA 1QC5B 3E3OA 1ISRA 2QTAA 1L1RA 1B6GA 1XVUA 1FSGA 1S2MA 3RYHA 3TBKA 4BBPA 2PBRA 2ZYTX 1A98A 1M6NA 3BGOS 1BGXT 2P9HA 2ZAMA 3P19A 4BP1A 3U44B 2DPLA 4OK5A 1YRYE 2F8MA 1TZMA 2WWWA 2Q0XA 4DM3A 3QFHA 2V7TA 3L4BA 3AL2A 3NH6A 3ZIDA 1KIFA 3ZHRA 4LEIA 2P5YA 2Y8EA 3WY9A 1SNYA 3DVAB 1JB9A 3GEHA 2P90A 5GV7A 1NQ5A 4B09A 3M4XA 4FQ7A 3M7IA 2GJKA 2W48A 3U9LA 1YRLA 3C6BA 2H1WA 4NZPA 4H1WA 2PVCA 3LY9A 5K0LA 4CLHA 1G66A 1T4CA 4ZU1X 1D2GA 1XF9A 5AOAA 2WSYB 3SICE 5LPNA 4JXKA 3ZJYA 1TFUA 3TYXA 1XNHA 5A5EA 4ENQA 5E6UA 4N7JA 1GZ3A 2C03A 2J87A 4R7GA 2ASVA 4LMAA 4PBRA 2C4VA 3I8XA 3WGMA 2CHEA 3TQIA 3WWCA 4JY7A 3JZIA 2P9JA 4IQFA 4Y0VA 5E7IA 3F7OA 3I2IA 4P8RA 1E66A 5EJIA 4PM4A 4LRWA 5IBRA 3ZCXA 3MM4A 2Z1NA 4ZIRA 4Z53A 2O5EA 1MLDA 2F3SA 4A0GA 1RZRD 1YR3A 2GUGA 1DO0A 1FBTA 2Q9BA 3LP6A 3EJ6A 2WD9A 1WXHA 4DEYA 2JJ1A 2KJQA 2QUHA 2SKEA 3H19A 4L0QA 4RHCA 4KW7A 1QGYA 4RE6A 4FZ5A 9GPBA 1N2IA 3EVBA 1SC1A 1WZ2A 1AZSC 1T1RA 2C7GA 2ERXA 3IT1A 1Y7LA 1EFKA 3T7EA 1UKZA 1E9BA 1ULAA 4QEZA 1OLUB 2LIVA 4TKUA 3BGWA 4DA8A 3TS1A 2IL1A 1G20A 1EUDB 3DTVB 3GJSA 2P6PA 3AUYA 1QKJA 2DM6A 3S2ZA 1VL6A 1CZOA 3BQ9A 3HP4A 4B0PA 3NHSA 2P2NA 4DABA 3N87A 3PJDA 3IQXA 4JUIA 5FUYA 2IPLA 5ALVA 1EKXA 3G1UA 2JLUA 4CG0A 1J9GA 1OGYA 2LDXA 3M6WA 3QW4B 3CNHA 2R66A 3HU2A 4ZT7A 1DOAA 4GLLA 3WGYA 3AERA 4QYSA 1XVAA 4YN3A 4B81A 1D03A 3H83A 2CB9A 4L85A 5CNIA 2H31A 4ZJUA 3EQ9A 4IFEA 2VS1A 4U7DA 4M1ZA 1EQ2A 4YDHB 1L5YA 1GRRA 2YWGA 3UATA 2EEPA 5C8YA 3ROEA 1RVDA 3E03A 5LMUB 4QPCA 3UMBA 1HRDA 3U4HA 1E2KA 4ZVOA 3PJGA 4MI9A 3TLYA 3LTNC 3O03A 4LI0A 4OYRA 5ECGC 2WWVD 4E3ZA 4LQDA 4F4CA 4R0MA 3OX2A 4R2WA 1CB7A 3S1AA 1I4OA 4PX3A 3H6GA 1O77A 3AQ4A 3EG9B 3G9ZA 3I45A 2AHRA 4LVUA 1PJSA 1CVLA 2B4TO 3GLHE 3O4JA 4NATA 2NO6A 2YY5A 4UUPA 1KE2A 4CUZA 4DBZA 5JY6A 4X1YA 3VPFA 1BOOA 3CJRA 2X3UA 2IS6A 2R7KA 3DMDA 3DOEA 3RIHA 1AQLA 1T9CA 2IW3A 3A0RB 1T2FA 5F78A 1AKMA 1RWVA 1V3TA 3WLSA 2H8KA 1U6JA 2IWHA 3CLUD 1TYDE 1OWOA 2DP4E 1S2GA 2ZT7A 4RF4A 5ILGA 3W4JA 1HR0B 2BFEB 3IQGX 4Z4IA 5BV8A 4UOEA 4MX8A 3U1VA 5AOCA 1JXQA 4UULA 1DQZA 3R23A 3ZQUA 4E22A 3V80A 1KRHA 4EPVA 1RLIA 3AR7A 1ZU5A 4CIXA 3ZHXA 4Y30A 3GQBB 3ZXUB 2WVAA 4K9KA 1KMMA 3Q87B 4RLSA 1G59A 2ZR8A 4KAXA 1XFDA 5A4JA 4JYCA 4UU0A 4DLTA 1ACJA 1KEZA 1I33A 3GUZA 4DF3A 1WXFA 4PRLA 2IQIA 5E6RB 4ZT3A 3IP6A 5JRDS 1MC1A 3KVYA 1RMYA 4QAJA 3VC7A 1T1EA 2YXLA 4KFSA 1V41E 5M2QA 4F84A 3PXCX 1TTPB 3VZDA 2Q2OA 2RK4A 4UTOA 5BVGA 2PH7A 1WV1A 1YT5A 4OI0A 2ZU6A 3AJDA 5E7QA 4NMLA 1ZM3A 2CMGA 2OFXA 3OCYA 3W5IA 4OSPA 2OG1A 4KPUA 2HAEA 4DHWA 5BW8A 1WZIA 3GPCA 3RARA 3WLLA 4DXHA 2FOIA 4F6LA 4O1IA 4RZ3A 2O50A 5AJHA 4IJ6A 2GNAA 1FRFS 4WGFA 1DAEA 2FQXA 2OSVA 3UJHA 3SQDA 3X1JA 2X4DA 4F6RA 4B74A 5KOYA 1JPNA 4EF6A 4QJ3A 4O4JB 1DU4A 3TBFA 3DHYA 1PJ2A 1QCCA 1RQNA 3JZDA 4J9VA 3ORSA 1VKRA 4ITRC 4MB0A 4WNAA 3OQPA 3RRBA 3TIIA 3CMCO 4X64B 1LS1A 3H9UA 4QARA 4EKDA 4YJ2A 5KYUA 3DF9A 1C7IA 2V1XA 4F60A 1ZH2A 1OSNA 1Q83A 1R0CA 3C7TA 4P54A 2X0FA 4O4IB 4KFUA 5I4CA 4DV7B 3H04A 2J46A 3OAAD 1P1JA 4WN9B 1UBTS 3RS9A 4YRBA 1KFCB 1UDCA 2DSTA 3BFKA 3C6XA 4QUBA 5EJMA 4JI4B 4O2AB 1OI7A 5DE3A 2A14A 3OQNA 5F7ZA 3LTEA 2I3AA 4NNPA 4U7WA 1M2NA 1QCYA 1W76A 2WVGA 4IJKA 3L8CA 5JAUA 2HQOA 1WSDA 2NUTB 4WXEA 2XNDD 3EUAA 5DN6D 5JISA 2XZOA 1IEQA 3HCBA 2DF8A 4JI7B 3A1WA 4JJIA 4A9AA 3SYKA 1P33A 1QYRA 4HDAA 2FSVA 2NTYC 1VLZA 4X6UA 3WA7A 1E2JA 1XVIA 2VG8A 2FUNB 2VHZA 4LRSB 4OMFG 4LSMA 1TEHA 1Z83A 2DBVO 1U7XA 5KBYA 1LDMA 3FHCB 3IBSA 1UOEA 4J3JA 2AC2A 1Y7TA 3AUSA 3SYTA 3WNQA 3YASA 4M1TA 4Y3UA 2DBYA 5AJVB 2YWRA 1T5LA 3EHDA 4MS1A 2V9CA 1ENZA 1W1WA 2H0RA 3DD5A 3OI7A 3P1JA 2BFCA 3MMZA 4DR5B 3ZKWB 2VP6A 3JD0A 4RY9A 2C82A 3RFVA 5BUSA 1UUFA 3LSYA 3OG9A 2JEYA 2ONYA 1LWNA 3G2PA 2FK8A 2XCSB 2C7BA 2XYPA 4NE2A 4NYJQ 4XCVA 1VHDA 5A7GA 1IZ0A 1P5RA 3LNCA 4E07A 5CIWA 4PGGA 5TQ0B 4X85A 4AG6A 3AEKB 1LPNA 2IXFA 4P3OA 3UGJA 1GDTA 2W2LD 4EPTA 3T9EA 4EMBA 1UFKA 2IWRA 1WTAA 4MV1A 3IOMA 3E9CA 2WWTA 3VTKA 1Z5NA 4QRIA 5IVIA 3B9BA 4WNCA 5TEVA 3WYAA 3B20A 3CR7A 4NQZA 3L05A 2R8EA 5A9TA 2GCIA 3STVA 4N3NA 4F11A 1INLA 4RTKA 4OY3A 3ZVKA 3A4TA 4S04A 1E3TA 1TADA 2ILTA 3VAYA 2WJGA 4WOJA 5J58A 1E61A 3MRTA 3KSBC 2CXRA 3DWIA 4G1CA 3FWKA 1J7JA 3GP5A 1T6NA 3LQRA 1ZHHA 5F1KA 1WNFA 3G49A 4KYVA 1U0EA 3GD7A 3D0RA 1K3UB 1LSSA 3C7KA 3IP7A 3JAWA 4KFRA 4V0MA 4IZIA 3P4XA 1YO6A 4XSVA 2VYQA 3AJ9A 4M0PA 1V35A 2AFHB 3C4JA 4XJSA 4Z9YA 2XH8A 4F93B 3OQMA 2XNKA 2IUTA 4RHTA 3RWOA 3AVXA 1FF9A 5BWLA 9ATCA 2BE7A 2FPRA 1G8FA 2ZIEA 3A2NA 3DTYA 3E9EA 3DVQX 3H9GA 3E58A 3ICOA 3R5FA 4ZOLB 3E18A 5H9VA 3P0RA 2E4AA 3PEWA 5DKFA 5IHXA 4AAYA 3MERA 3AUFA 4RJJA 3EZGA 3G0OA 4J0GA 4B85A 1GZDA 1LSUA 3BN3A 1MR3F 1HURA 3QUQA 1K7EB 4MA4A 3TW8B 4R1NA 1ZD2P 3SQLA 4V3BA 4JGIA 1EGMB 1V96A 4G4GA 4MTLA 5CNKA 4C4OA 3GFTA 1IAQA 4N3CA 1C3JA 1D2CA 1HSOA 2OMEA 2PKCA 4JWKA 1G5TA 2JLQA 1TO2E 2WUGA 1JLRA 1GDHA 2A7QA 3DZJA 4N18A 5EXEA 1YTUA 4LA4A 3GUCA 1YS1X 1YS6A 2GBGA 1E7SA 2VKTA 3A4IA 4W63A 5FF9A 5BW5A 1WXIA 2H4WA 2FSPA 4NS1A 1PWHA 3U3KA 5LSAA 1H2ZA 3NETA 4ZO8A 3IIMA 4UEJA 1K8XB 1KPHA 4ABTA 4ARSA 3GGPA 2QUZA 3SEZA 4F72A 3DEHA 1HF3A 3SZLA 1KK3A 3KQNA 2Y4NA 3UWDA 2X6RA 4M49A 4NCKA 2A92A 2X9QA 2XJ4A 2EZTA 4PSCA 1TYZA 3PQ5A 3UJPA 4GZ3A 1DX9A 1L8AA 3KZKA 3SPXA 2CLOB 3AXTA 2Z5FA 1JLKA 4DCGA 3PJRA 3J7AC 3V1LA 1KC3A 1M2VA 1Z88A 4HDOB 3B9PA 3W2IA 2I2BA 3DOOA 1VCNA 1G1MA 4E2XA 2V59A 5HJ2A 2IYWA 3REQA 3S2IA 2XRZA 2I4MA 3TF5A 1PK8A 4HX9A 1F7UA 4UHHA 1OXXK 1RW4A 3U1BA 4Q03A 2QN9A 2J3EA 3PVCA 4B3BA 1G3IA 4NV0A 5JUWA 3E15A 4L7VA 2JIBA 4C0WA 3UT6A 4X00A 4E4RA 1ZGAA 4OUDA 2IZZA 3KAQA 4H18A 3RVNA 2AJBA 5HYVA 4IEFB 4KR3A 4CXMA 4R51A 1SVMA 1BDBA 1DRKA 1YCFA 2IXBA 3LA6A 4ZOQI 4LOJA 4FFSA 1Z74A 3E7FA 4OEHA 4OQXA 1IL0A 2FPSA 4AX4A 4AY6A 3A9CA 3T3OA 2FE1A 3QV1A 3PNSA 5JNWA 3KEMA 3MGCA 5CDYA 1HRKA 2O8VA 3EGXB 3OM9A 1O4WA 3NWEA 4WUTA 4Z5XA 5G1NA 1EK6A 5CDFA 2J6CA 2PS0A 1H3NA 3E9MA 3O8BA 4JP8A 1WMAA 4KE7A 1K0UA 2O4CA 1DBWA 3OIGA 1NW6A 2X8JB 4K5QA 4MAAA 1E6WA 3VXKA 1CPYA 4AJIA 1IH8A 4JB0A 5TGZA 1XPRA 2H08A 2O8CA 1Q7CA 2EP8A 5H83A 1SKYB 4N9QA 1D1SA 3WLFA 4UPEA 2P2SA 2DFTA 1WL8A 4BL5A 3A70A 3PEYA 1IN5A 2V45A 1P8AA 1RLOA 2A78A 2L19A 2PSFA 2R5NA 2WHRA 2WU1A 4R3UC 3SHQA 4CQJA 1D1PA 1XQ1A 2NSJA 1N5MA 4Y1RB 3T1VA 5KJEA 5A6SB 3SHVA 4BZQA 2VOEA 3P4UA 2CFOA 3B1JA 3ZK7A 4DPLA 3EWIA 5I7HA 3PNVA 4L16A 3MWDB 4FYIA 3ZWDA 3H2BA 4ZEVA 4KXNA 1EFTA 4XGQA 4ZQCB 5ED0A 3FPKA 1GAXA 1ZNXA 5EPEA 4JUAA 1P4HA 4RANA 4KLAA 1GQYA 3AOEC 3RJMA 2FLWA 2DB3A 2DY0A 2HDHA 1XXHE 3RF6A 4E03A 5AUNB 3E2IA 1GEGA 3KPWA 1LB1B 3L1IA 3OCVA 1HG0A 3SQNA 2VHTA 1UEJA 1FQKA 3LOUA 2J08A 2OCLA 2ACEA 1H85A 1EX7A 2HXGA 2Z2IA 3Q10A 2R3SA 3ABSB 2P41A 4IIHA 2PPVA 3PT9A 1L1QA 4E2FA 2QU8A 3JSAA 4HWGA 2IDKA 2Y92A 3SJAA 4URHA 3G82C 5K4GA 2NADA 2POQX 1T2NA 2IYZA 5HSGA 5C34B 1C14A 2BFFA 2W93A 2Q7OE 5CIYA 5J47A 1JJFA 3A6GA 3OLCX 1WD5A 3FMVA 1G63A 2Z57A 5AM3A 5FWYA 1QU3A 3NHLA 4V0SA 2NU7B 3KSZO 3TW6A 3C24A 4BVGA 4D9KA 1NC1A 4M1YA 2GOYA 1JBQA 2OV1A 3LYHA 4D4MA 2NO7A 2D2IA 2VH1A 4IO0A 4LY6A 1DS6A 3V4LA 3ZGXA 1BYUA 3RYHB 1U1EA 3AM5A 3N9IA 2QT9A 2HEGA 1O9HA 4QUAA 3UXYA 3OPMA 1EUZA 2QAIA 1RR6A 4M0EA 4CVNA 1NPTO 1MJGA 2V7UA 2CV1A 2D5BA 3SBEA 3VHLB 3F3YA 3MYRA 4Q5IA 2WM8A 1YCDA 2H4HA 4D8WA 4L5IA 2QUKA 5KHLB 3TOXA 3U7EB 5EERA 2QD1A 5D6OA 2BM9A 3KD3A 1H4TA 4HQKA 3ELWA 2ZROA 3AJEA 3VNRA 5GJBA 1ZGZA 1B8OA 1ONNA 3PDIA 1ZN7A 3UMSA 5K0FA 2WJAA 1UINA 5P21A 3FPFA 1VM6A 3K1ZA 3LC7O 4R01A 3ZJ4A 5LQMA 4B79A 2ZYVX 4MMXB 1IY8A 3T7IA 2PZFA 1NMYA 1ZM9A 2LGJA 4CMIA 1KFJB 2PGIA 3L6CA 3B2QA 1PD1A 1DTWA 2ERYA 1YRHA 4HX2A 1MJ5A 5AYVA 1R6BX 4JDUA 2BI7A 4ZYWA 4NZOA 1Z82A 5I7EA 1TEZA 3K8ZA 2WU8A 3A9RA 1HXHA 1R4MA 3OT5A 4N8SA 2BMJA 4XA8A 4WZAE 2FPMA 3EXG2 3BJZA 1SQGA 4TXMA 4X7PA 3CNEA 2P6OA 2H48A 1YDGA 4OFWA 4WK4B 4Z8YA 5JDCC 4FYYA 4IDHA 2A5GA 2FQ1A 4YRRA 3UBMA 1UK7A 4REQB 3KKPA 2IPMA 4Q3NA 2YNMD 3CZ5A 4NI5A 1WMFA 4RO0A 1OLXB 2OLEA 4DUGD 3GA5A 3KYDA 4R2IA 5FWXA 1P0MA 2OCAA 3ZZMA 4B3XA 4B8YA 5I51A 4LUCA 4JHLA 4DMMA 4AO8A 1G60A 1DXHA 1ZEMA 2AN5A 4O2RA 1P7YA 1HFKA 4YJGA 3GJZA 1V25A 5FTKA 2OBYA 4REOA 5CX4A 4NZYA 4O6VA 1YC2A 4HGPA 3VDMA 1OT3A 1ZUNB 1PD0A 2HF2A 2WK1A 3O4HA 4R98A 4WKCA 5C1PA 1CDOA 1NXWA 2G5PA 4V0NA 1K63A 4NY1A 3ENKA 5JBIA 2AJCA 1CXZA 3GRZA 1JVSA 4YRDA 5GJWC 4GS5A 1V37A 2PHZA 4DE5A 2X41A 2YRWA 1GNSA 4Q9JA 5AI4A 2YXBA 4DJTA 2AH5A 2CJFA 3EA0A 1Z5UA 2IHTA 2IT1A 2XZPA 1KI4A 4XGNA 3PTAA 5A3QA 4MR9A 1RWQA 1Q1ZA 3LP5A 5EP2A 2OV6A 4HRYA 1Z6GA 1C7EA 2P7HA 2UYCA 2SKDA 2HXYA 5CHYA 4Z7NB 1FUKA 4AMZA 3VO2A 5DI3B 2N0SA 1L8LA 2WD8A 1LSOA 1IPEA 2Q5FA 3FLAA 3S2SA 1QPGA 1EM8A 3ZDZB 1V39A 1PS0A 4RMGA 5BMOA 4I50B 4FB5A 1MXHA 4ETMA 1YI0A 4Z0TA 4Q9LA 1NAIA 3AI1A 3COZA 5JROA 4BFSA 2I4OA 3CUTA 1CJKC 2XUJA 1P4SA 4G65A 4M76B 2A1UB 1FOEB 2DUMA 2WABA 5TQ2A 2FEWB 3NPAA 3QYFA 4JH0A 2Q2NA 4I3GA 1MX1A 1J0DA 2EKDA 1WQ3A 4M9SA 4TYWA 1CEQA 1WRBA 4MQMA 1UDXA 2XKAA 4NYMR 5D3ZA 1U3GA 2AVDA 3KB8A 2NO5A 1QOPB 4X94A 4LFCB 3V1YA 1EUCA 2DQYA 3PICA 4K6FA 2I7TA 2REXB 4M9XA 4TTVA 2ZCVA 3U5TA 3H3XA 3ZZTA 1P1RA 3B89A 1PWZA 2IYPA 2Q8PA 4FMCF 4KPGA 4N49A 3QELB 1QZTA 3H5AA 5E9AA 3F78A 4MUJA 4CEIA 2PYDA 3H8SA 2JLYA 4JIMA 2JH3A 4NEQA 4DRXA 1WCYA 4DV4B 1A9QA 1LPBB 4Y2PA 5GZ6A 2ODWA 3ZR4B 2PJDA 4NOKA 5EP4A 1H23A 2WOOA 1GQSA 4ZTBA 1G6Q1 1YKFA 3COYA 1R0ZA 1X70A 2ZG6A 4AUNA 3Q5GA 2XDWA 1HZJA 1I7LA 3KSRA 1RLUA 4NRDA 5C1DA 4OUKX 4EY6A 1FFEA 5HKBA 3LOPA 5TRTA 3GC6A 1N7HA 2SHKA 2X8WA 2OQRA 3BSYA 1UAAA 3F7MA 5DWVA 1U4NA 2OFOA 3ESXA 4Q3CA 1XZ8A 4Q3EA 3ET4A 1K8YB 4PFJA 4RS3A 4S1NA 3X43A 4CEJA 1ZCJA 4NR0A 3R7DA 4F8JA 1NNI1 5KYXA 2IBTA 5I4BA 2R60A 4ENUA 5BSTA 4ARZA 1X1DA 2ODBA 4IDQA 1RHMA 1QFJA 2O2XA 5COBA 1YZTA 5KUTA 2GCOA 5JAMA 1ZBDA 3QPAA 1Q3HA 1JEQA 1ZA2A 1CZLA 1FLAA 1WQ4A 5AKYA 2PGJA 1W85A 4DSZA 4NP6A 5L7WA 3WB2A 5MFPA 4MRMA 2PUAA 4CG2A 3HO8A 3PUZA 3U3DA 4BS9A 3O9ZA 2YZNA 4D9JA 2Q3LA 3RABA 1YVUA 2HZBA 4UASA 4AN1A 3PE6A 1N5RA 3PHCA 4DL9A 3DAHA 2IYFA 2HT6A 4UC0A 5JNUA 3AY0A 3IX7A 4IF4A 2BEWB 5KI6A 3W9BA 1E5VA 3M3HA 1J8QA 4G01B 1G21B 1QAOA 2HJWA 3LPCA 4G0OA 3WTBA 3KCNA 4PNHA 3MCAA 2XPCA 3IHLA 4PANA 4XIGS 3NOQA 4RZHA 3NTOA 1Z6QA 4WJZA 5FWNA 4P22A 1FU8A 1KOGA 2FETA 3R4VA 4B3FX 4H3VA 5COQA 1PW7A 4I4TB 1JEEA 3QW2A 2P2YA 3E22B 4FDLA 3ONFA 1Y7IA 3UBTA 1EQAA 5ALXA 2YV2A 2XW6A 3ZWXA 1GRVA 2FEXA 5FIUA 1U8UA 1R3DA 5ERGB 1JSZA 3C6KA 3PLNA 2IX9A 1T3ZA 2HUNA 4UMFA 3KJEA 1VPWA 1F8GA 1DEHA 2VJNA 1U2DA 5DM60 3PQDA 1P9LA 3F6SA 1ISFA 1RM0A 2XODA 3EGDB 1U9JA 3I1YA 5LP6F 3THYA 1OXBB 4S3MA 4XYGA 1TTTA 3PLAE 5K8VA 1D4AA 5J4LA 2JJYA 3HO1A 3SJZA 5MHTA 1P7WA 3J7TA 5B4UA 1X7HA 3IIEA 1ARZA 1OR8A 3Q7EA 5ICFA 5TPZD 1EWQA 3OKCA 1F0KA 3BMNA 2Q5CA 4B9EA 4UAVA 3GRAA 1XZBA 3M9XA 1UJ2A 1QG0A 3A3NA 3DTVD 2VXYA 1RHUA 4ER0A 1ZUHA 3DO5A 4R1UA 3FCSB 4BWGA 4FGJA 1DC4A 1F8UA 1E32A 1M7HA 1Q7BA 3AHJA 2O57A 1FMJA 3AGQA 3NIWA 4LZAA 4TLEA 1SXJD 2Z2KA 3G17A 1YQWA 4OB7A 4NS4A 1E2NA 1F60A 4Y9RA 1B6SA 4D46A 2DU8A 2FQYA 2Z8ZA 3QLEA 3EIOA 4FGWA 3VR0A 1J0BA 1M7GA 2I3BA 3OPYB 3BDIA 3PWKA 1JSLA 1A8SA 2XVMA 3N5CA 1MC8A 1TAGA 1ZGJA 2VPZA 1ZVVA 3OF3A 1Y3FE 3K1AB 1V2GA 5JD5A 5K0GA 1Z0JA 2CD7A 2LV8A 3UMGA 4RMNA 1H9CA 4AQDA 3ZK9A 4AULA 3Q3JB 3C5CA 1KY4A 4IUBS 1ZVMA 1MAAA 1RI1A 2UZAA 2ZSUA 1XLTA 1U63A 1DQYA 4G3XA 1G8HA 5TNXA 1HNNA 2QR3A 4OQYA 5JADA 4FYPA 4XVUA 4XW2A 2PD3A 3ZHVA 4Y2RA 5KJ6A 1W44A 4WLFA 2B98A 4EQZA 1XKQA 2M2IA 1FA9A 2Y1LA 3NGLA 4Q9AA 1IHUA 1SC3A 2HYDA 3R0JA 3RT7A 5JFTA 3VPCA 2UZ0A 1H42A 1SXJB 2WIDA 3BXEA 3FZNA 3QXXA 1TTHA 5B1IA 4EY5A 3VZBA 5IXYA 2VQFB 1REQA 5H3CA 1DC3A 1KR5A 1UPAA 4X9XA 3T06B 4Y2QA 4DNPA 2O3QA 3H75A 3IMGA 3I9JA 1P0FA 3INYA 4JI6B 4CM6A 4KLRA 3GLTA 4WBSA 4G86A 2O8CB 4AX8A 1FFCA 2Q5HA 1JHVA 1VL5A 3GT7A 4HCJA 3UGTA 4EG0A 4S0ZA 4MMYB 3QV2A 4YS6A 5DISB 5AM2A 5EPUA 1LI7A 3P8ZA 2H18A 2CLEB 4ZVTA 5B58C 5KCZA 5DGTA 3U9TA 3N0TA 3A3OA 4IXNA 3D2LA 4JMPA 4M1QA 2EBHX 1N8TA 2JCXA 1CQIA 2ZRKA 2FWAA 2O2SA 3HCDA 2ZTLA 2Y0PA 1QYWA 4LN1A 5HDQA 2J0SA 5GM2A 1XF1A 5ALNA 5K2MA 1P2VA 1DKUA 2NV0A 2ZJ5A 3IC5A 4LRQA 3RLFA 4YV2A 1H69A 1ULSA 3MCZA 2Q5LA 4RABA 4X8MA 3IQFA 1G5FA 1QRDA 1T25A 1C9DB 1JI3A 3PF8A 3TQFA 1SQ0A 4AF6A 4B33A 4DJAA 2BR5A 5E1OA 3L41A 5EJGA 3MJDA 1XA4A 2OBLA 4W8OA 4NBKA 2EBWA 1YDMA 2YHAA 2WZCA 4QFBA 5AM5A 4AKGA 2H3EA 4LXTA 4M1WA 1IIRA 1OXKB 3FCCA 1JU4A 2ZUTA 2J5BA 2EJUA 2VNSA 4FMDB 4B80A 1FVFA 2ZSDA 4CGZA 1P9WA 4X1KA 2XVXA 2CWWA 2P68A 2TYSB 1E3QA 3N74A 3K32A 1NRXA 2X23A 2N3ZA 3OQVA 5TMPA 1L1FA 5KVSA 3CZQA 4BOYA 4MRAA 1QP4A 1ECBA 3AG5A 3PR1A 4UQOA 1IBLB 3JASA 2Y1XA 2H9YA 1IHXA 4KWEA 1QVAA 3DQQA 5T6BA 1NP6A 2PMBA 4OD0A 2ZR7A 2ZTSA 3EZ9A 5E6SA 1G9XA 3EZXA 2EX4A 3RKRA 1MB2A 4DA9A 1ZUD1 2AI2A 2AQIA 3C3CA 3GFSA 3DP9A 3K9GA 4MLDA 7ABPA 1P1IA 2WHPB 3HKBA 3IKJA 3R9KA 4FSDA 3I73A 3RYFA 1R7RA 4B6EA 1X7XA 5AO9A 2A8YA 4F2WA 2CMKA 4OP2A 3EMBA 1TLLA 2B3TA 3F5QA 1Z5OA 3MUNA 4DVGA 5A06A 2RJNA 3PG5A 1N3YA 5B7QA 5HUJA 3NM4A 2R11A 3BA1A 3FFXA 4NE9A 3RVLA 3K0AB 1XCLA 2QLNA 5KNDA 4I1IA 3ZWYA 1V11A 3CISA 1N1EA 1I3OA 3PNQA 4BMPB 3F97A 2P4UA 1OLSA 4P4NA 1E1CA 3HJCA 5LP6A 3K09A 2WNHA 4F4IA 5LWQA 4IJMA 4ZQEA 4BEVA 2B94A 2WILA 2EJCA 5AW5A 1IBRA 2PQMA 1ICEA 4C4PA 3DZKA 4EYEA 4GOJA 1W96A 4D9HA 4QHSA 3A4NA 5BVHA 3NYIA 1R8SA 4P7JA 1M0SA 1QAQA 4O8ZA 1QIFA 3QNWA 3A9UA 4H7KA 2TMGA 3BMNB 3K0EA 4MUYA 1Z8FA 1QQAA 3B36A 1NQOA 1P3JA 4MARA 3ITKA 4BX2A 2AUNA 4JLBA 4UBOA 4P36A 4YI5A 3R76A 3WJAA 3AVPA 2QTNA 4EJSC 1K3FA 1BQ4A 4KTTE 2EKPA 1S9HA 4UM9B 1KL7A 2OXFA 2X76A 4JVMA 4Q24A 3WLJA 5DBFA 4V2IA 5C5EA 1BX0A 3M5CA 3GARA 4Q3OA 3W5BA 2PCLA 2IYUA 3AJRA 4HB0A 3PDUA 5IH3A 3VRHA 3UM9A 3RC8A 2O2GA 3ZDRA 1MFPA 3ICVA 1R2QA 2A1TR 2AYXA 4IIFA 4BECA 4DWWA 1P29A 2VDOB 4AG5A 1NASA 3EF1A 3DBHB 5F2NA 4EG7A 2L17A 1JQ5A 4K0RA 1DCTA 4AF7A 2F90A 3S2UA 1ZOOA 2A7XA 1YFKA 2C5HA 4LSZA 4PC2A 5A3JA 2C4TA 4AKTA 4W82A 1GGNA 3IHKA 2YOHA 3DFKA 1ZS9A 1JS1X 2AV6A 4V0LA 5DNWA 5DULA 1QVWA 1JPJA 3W1WA 3BZWA 3FTQA 3I5AA 3QNMA 3CM0A 4HR7A 4OFBA 4ZO7A 1ONBA 1UM9A 2GFIA 3B38A 1VKZA 3I6MA 2VPIA 4IEEA 5AKEA 1SCIA 4XH9B 1WHTA 2C99A 2VA8A 1OPRA 2QRZA 2XSZD 1GSAA 4C30A 4EY3A 1Z7BA 2WHEA 3ESYA 2YFKA 4MK4A 2G5TA 3CLRD 3FRIA 5K05A 3RTBA 2NM0A 3UB4A 1CY4A 5AM0A 4HDNA 4B3JA 1EH5A 1RJWA 2ZJ1A 1Z2OX 1ZPDA 1L5FA 3JQ7B 4QU5A 3AYXB 4NCBA 1MW9X 1U80A 2NZJA 3I0NA 2HRQA 1IHOA 1EXMA 3EULA 3LQ1A 2R6FA 4B4KA 4MCHA 5GINE 2ZJAA 5D84A 3MHTA 1E2UA 1RKXA 4I50A 3IXLA 3PUWA 3N0RA 4FUTA 1X7YB 2GR9A 3D54D 5K8UA 4NYJR 1TF5A 2BI8A 3K0AA 1WUYA 3RE1A 4EO4A 1VHTA 4AF8A 4A16A 3HI4A 3LV8A 1LDGA 5FBHA 3DAOA 1Z5VA 1CR4A 4N4AA 3IBCA 4RVCA 3PFKA 1U0BB 4HZUB 5DBIA 3W5SA 5I7RA 3BMQB 1NW9B 1QVRA 3JS5A 3KQPA 3OQJA 3GDOA 2PL3A 1LKZA 3IPCA 4ND2A 1KJNA 2GZRA 5EIWA 3RTGA 3FKQA 2GYUA 1VSQA 1Z7GA 2YDXA 3CPHA 1PSWA 3H4IA 4L76A 4MWOA 4WCFB 2OO5A 3WHIA 3T9DA 1N8KA 3B6ZA 4HAOA 5A03A 1E2EA 3FNQA 1W4LA 1MQSA 1Q3TA 3ORRA 1XTQA 5HUHA 3GHYA 5GQSA 2C2MA 3A9WA 2WG1A 4MRPA 2FJPA 1GLNA 3H99A 4N47A 4D4GA 5F3WB 3Q7RA 4ARBA 4RGYA 4L5YA 5CA0F 4YJGB 2NP6A 1ZH8A 1ZOIA 4FI3C 3AR6A 3I0MA 4AECA 5IFLA 1X13A 2N1BA 2RHLA 4B46A 2QGNA 1N6RA 3KLBA 1W87A 3IA7A 4DC0A 7REQB 2BH2A 5I9MA 2QTZA 2BKLA 3LX8A 2CKDA 1C7JA 2XOXA 4KI7A 1UKBA 1VI2A 5LC1A 3SS8A 2AMVA 2YN0A 1V4BA 4NBSA 1GTVA 2DWPA 3KHKA 1JAXA 1ZESA 2CYBA 3QGMA 5EZ5A 3ZCTA 4LWOA 3FVQA 4M4SA 1ZN9A 4BO9A 1E58A 5B30A 1XC7A 4IJVA 3ZK8A 3Q85A 1EZ4A 2X14A 3C5HA 3INNA 4OM7A 3S4YA 1CR0A 1SCNE 1QQ6A 2H6EA 4R9RA 4YRTA 3ERCA 1SEPA 3IELA 2LD4A 4RZIA 1VTKA 5FHRA 2DHDA 1L4GA 2ES4A 3CEHA 1KNQA 1YVDA 3DE1X 4E1VA 6REQB 1CQPA 3KO8A 4A23A 5CA1B 1OT5A 1NUQA 1G4UR 1BNCA 2D1TA 3N7TA 5CBPA 3KQVA 4LDAA 3IILA 4WCVA 1SBCA 3HZHA 3URMA 3BXOA 5KNBH 2OP1A 2YC2C 4EB8A 4P4UA 2P79A 5FJIA 1YR7A 2E3JA 2IEDA 3ZXXA 4ESOA 1A72A 5KTMA 4MVJI 1D0IA 1SUFA 2IFTA 1Y48E 4J3FA 3BJMA 1R4NB 2EL7A 4YJ2B 3P9RA 3H2GA 1LLFA 1H93A 1EI9A 5K3BA 1T0BA 2E2WA 5C5IA 4MP6A 1OZ0A 2QRNA 3OPQA 4LTMA 3NUZA 3TUZC 3CRNA 4B6GA 3I2HA 4QM6A 3D3KA 3NHBA 3GRFA 4UTNA 4NH0A 3P9PA 2VAXA 1Z6YA 1EUCB 1JDPA 4GXRA 4C1BA 1GIAA 2O5VA 3ACBA 1E77A 1U5CA 3LCCA 2R6HA 2E4UA 3DBLB 3PUVA 3I8OA 1Z7WA 1U90A 3U31A 1XL1A 2YY7A 4KN6A 5L3RA 4BX0A 5BRNA 4INAA 2WE7A 1W5FA 4Z3DA 3IA2A 2GEJA 4HGQA 4I3FA 5BSEA 1E6MA 4DDUA 3L8FA 4NAUA 4C6TA 2DULA 1UPXA 4DR4B 4DLVA 2VHQA 3LGAA 4RNCA 4RESA 2C84A 2XD4A 4RF5A 1U2TA 1EFDN 2GBFA 4QLAA 5EIFA 4WOCA 3F9IA 3WOHA 1M34A 3CKKA 3DUFA 3OEEA 4L9SA 4MUBA 3ANTA 2HPHA 5JWHA 1II8A 1NTOA 1C30A 2R00A 3UF0A 3H65A 1KJ9A 2QW0X 2Z95A 3KUDA 1Y81A 1NBWB 3ES9A 5ALPA 1Z2DA 3BH7A 4ONEA 1C3LA 2BPOA 4OP1A 4PZCA 4ZXFA 1WDMA 3SC3A 2VAMA 1ADBA 4AWBA 5E2IA 4P3YA 4B3GA 4ZTUB 1T35A 2FZVA 2P75A 2PWZA 1J06A 1HDIA 3AHDA 3LF2A 1G7SA 1XJ5A 5C8YB 2QV0A 1W0CA 4IH9A 3L40A 2D1QA 3HXLA 5WRFA 1D2HA 2XVYA 1X1SA 2P0EA 2WUWE 1Z5GA 3F8SA 1F1JA 1ZOSA 4KTVE 1CUHA 2HN9A 3GF4A 3BTUA 1UBSB 1XEAA 2XZTA 2YV3A 4IX1A 4Q1CA 3I39X 1UDAA 3KL4A 3O95A 1PR6A 2RC5A 1LGYA 3R0VA 1XI2A 3HEMA 4PZLA 3VC2A 1XX6A 3DHEA 5LN1A 4EX7A 2V5UA 2R6AA 3U48A 3K6SB 1KBOA 3GK3A 4KWTA 1OIXA 4FOOA 3LM8A 4L8LA 4RA6A 5BNIA 1A9YA 4EVSA 2ZI6A 5JPCA 1YB6A 1NXVA 2G8NA 3DTVA 3T7AA 1W93A 1XMSA 4YLYA 5AKZA 5IN4A 4L8GA 2I34A 4X8HA 3T3EA 3DBRB 3SX0A 4BGIA 4YWJA 1RKQA 1AKWA 3K16A 1U0LA 1XDDA 2AC4A 2PFKA 3IP9A 4LNUB 5IJAA 4F0JA 4CM8B 3I6QA 5BPHA 1KEEA 2DECA 4LDZA 5DLEA 2EZ8A 1LZLA 2BDTA 3IT0A 1GADO 1R6UA 3OC0A 4RZXA 4Q05A 1VE7A 2JANA 1XU7A 2R85A 3M4JA 1KSJA 1U28C 1A2KC 2P9GA 2OKGA 1DKLA 1FMCA 3OX4A 3MMPA 4YHBA 5C31A 2QBYB 1MV8A 3OM1A 4DSOA 3F3KA 3VH2A 2B37A 3DCJA 2FN9A 1CWUA 1CT9A 3SBDA 3LQQA 3GLVA 3EUFA 5J2TB 2PQ6A 1WR8A 1QGZA 1UAYA 4I1VA 1H1LB 1RI2A 3D7RA 3ODPA 1O5TA 3K6KA 5K8JB 2XKJE 2XB4A 3V8BA 3O4FA 3IB6A 1KEWA 4MQFB 2QT1A 1D6MA 3OZXA 2YBEA 5FV7A 5MFZA 3PHHA 3QM1A 1LPMA 4TZ0A 3M6MD 1H9AA 4TWIA 3WL6A 1I6LA 4RK1A 1U9IC 1W59A 4ZCSA 3KQOA 3B9QA 3ROXA 1PTJC 1ZVJA 2G0NA 3R7WB 1XEXA 4UHDA 1Z62A 4RTJA 1WUHS 1L8QA 4GMFA 2WKWA 3ASUA 2OCYC 2PZJA 4MRVA 3P71T 1E3IA 3KU1A 3KYIB 2GYWA 3JQGB 4QTTB 4Y6SA 1E2FA 3TNYA 4KE9A 1N3LA 2RHJA 3VSAA 1W49A 1ABFA 1NU6A 3M5DA 4DTCA 4JDPA 1YF3A 3LKVA 4GBGA 2X13A 3MWYW 1KYWA 3VZPA 1H3FA 4X65B 1CUUA 2BONA 3CRZA 2D2XA 1OX5A 1EGVB 3FA2A 4UMDA 4CI0B 4QOJA 4XQCA 3II6X 4DT1B 3DFMA 3WYDA 3L6RA 3HB0A 2AZ4A 5D1NA 3I04M 3L0IB 4J16A 4RV9A 4DCSA 3S3TA 5JZOA 5KU1A 2BWJA 5JQGF 2DH5A 3P5BA 1VE6A 4D9NA 3K9LA 4GHWA 4DHEA 1H0RA 1D3AA 3ST7A 3U7QA 1ECFA 3TBHA 4CQLB 3U9SA 4Q1VA 4RZUA 1BFKA 1K5GA 3K7EA 4RA6B 4PF1A 1I01A 3WBFA 5KWVA 1N1GA 3D6AA 3DBLA 1LJ8A 2ZSIA 2VT7A 1ZK2A 1CP3A 4FYVA 1VPLA 4Z9FA 4YUVA 4CCYA 2VDKB 3MBOA 5CEJA 2ZUEA 1OLOA 3OEWA 2E4VA 5HCNA 3EOZA 3NEYA 3QFFA 1ISIA 1FY2A 1Q15A 2ETXA 2Q3DA 3KOUA 3LG2A 5FI3A 1H9BA 1TMYA 3WLMA 3OLYA 5F7XA 1U0GA 4ZZ2A 4DYHA 2LCFA 9ABPA 5CVUA 1HE2A 2H2FA 1EB8A 1DAHA 3R8CA 4EHJA 1FZQA 4F5EA 4XR4A 2BRUA 1P6QA 4R2XA 4FYMA 2XV1A 2AMLA 2VPYA 2WWIA 4H7FA 4QTXA 2B78A 2UZIR 1NJSA 3UJ9A 3UWKA 1T5HX 2D7CA 3FKJA 1PGPA 3EPPA 3EVZA 3HVKA 4OO3A 4YT8A 5C52B 1XZCA 5DTEA 4YH1A 3BH0A 2R6DA 4JENA 2RI0A 4TUYB 1V8PA 1YAJA 4KSCA 4HQ0A 4PLCA 1F7VA 1HA3A 2O3UA 4AZSA 3B2EA 3A31A 1EFAA 3K6SA 2D00A 3EEYA 1UAGA 1K7YA 3FN4A 3RQIA 5EQJB 3UANA 4TN1A 4DSUA 4Y9SA 2CE2X 3UQZA 1UFRA 3LLVA 4BP3A 4QO8A 4N3BA 4YI3A 2HHCA 4BFTA 4CT0A 3UJ8A 1ZZGA 3PFBA 1ZGBA 3EWAA 4E1BA 4EELA 2WUEA 1DEXA 3FJYA 1HEUA 2YYZA 2QW8A 1FS5A 3N0WA 1YR8A 1J24A 4JOQA 3UENA 3GI1A 4EHHA 5A1TA 4IGIA 2OA0A 1C5KA 1VMIA 4ZI7A 2GSDA 3OTHA 1CQJB 2FGKA 2Z2JA 5CYFA 4NV3A 3OIYA 4RM2A 1PFWA 4RORA 2DYKA 4E32A 3RT1A 1KY5A 3ROQA 2ZJ0A 2PG3A 3F6CA 4PQYA 4ZV9A 1AHPA 4Q02A 3W6NA 1CYDA 1X7ZB 1GN9A 2VQ6A 4IOJA 2CXHA 1ZMOA 4KLNA 5BQOA 3RWMB 4CFYA 2QPLA 1SU6A 4L4RA 4LYHA 1XNRB 3CLRC 3GZTB 4QOFA 3WB9A 4GX1A 4BNXA 4CN9A 4KR7A 4LXHA 1NBOA 4JZYA 1RC1A 2FAXA 2QRUA 1HYGA 3Q9LA 4PLTA 1EBUA 3T1QA 4E15A 4EABA 5CA1F 2ZI9A 5LDDC 2C7QA 2VBCA 3TQTA 1NM5A 1YDEA 5JIBA 1A5BB 1EVYA 1MDBA 4KO4S 4MIEA 5THXA 5JLJA 2QTMA 4CN8A 2ADOA 1BS2A 3HS3A 3KZNA 4TS3A 4RK6A 4RCZA 3HJRA 3HNOA 4G6ZA 4QXOA 1II9A 3HA2A 4ZQBA 3NP7A 1S1MA 3MIIA 3VR1A 1G18A 2CV2A 2O4UX 5JDIA 1O1YA 3SCZA 2WVHA 3FTFA 5EY5B 5AJTA 1Z5ZA 1EJ0A 3HRKA 3RK1A 3UJCA 2Z1DA 1HQCA 2DG2A 4JU9A 3SSAA 3R9XB 4O4HB 3BMOB 3HXKA 4KLCA 1RFLA 4TTQA 5JAPA 1TM3E 4QEDA 3ZW7A 4Q7QA 1GGVA 1HFJA 2QPOA 4D45A 2GEVA 4ZK2A 1P2SA 4RD2A 1XRRA 3RU9A 4HMQA 1WVGA 2W4IA 4X8LA 4NBUA 4OHFA 4W1SA 1EP1B 2WU0A 4LXGA 3RC3A 3ZHOA 1B43A 2OENG 3UAVA 3OY2A 3F9CA 1R5BA 3BAFA 1N2CA 2NZWA 2FUKA 4KPFC 4B7XA 1U7ZA 2PZKA 4R83A 3TTVA 1KFKB 3FDZB 3KV1A 2XQIA 5H1YA 5BV0A 1WU7A 1JFSA 3SLRA 1HDYA 4RFLA 3DDNA 1KK2A 3VVCA 4X6YA 3ADOA 3AKEA 4INOA 4UBNA 1QTRA 4UBIA 2CDAA 3QXSA 2DCMA 2J3MA 5DCLA 3RG8A 3T5AA 1KSHA 1GKIA 4LS3A 5LCXA 1TVEA 3D4PA 3QELA 4FFVA 4R1PA 4RM3A 1RWNA 4CEIB 2PMEA 2O3RA 3HYRA 5H0IA 3HDGA 3N58A 3JQFA 1ECGA 2ZIXB 3MS2A 2QVZX 5HS4A 2BBSA 1NI4A 3BC1A 2MIIA 5EI5A 2O7SA 3BX1A 3B9RA 1DMSA 1VE1A 2OO5C 3UXHA 4W8HA 4ZRNA 4HZUA 4BNJA 1VHQA 4CE6A 4KG7A 4YMGA 4XB2A 5BRAA 4GL2A 4UTZA 1WS6A 4BNVA 3ADKA 1S3SA 2A9KA 2ZWPA 4FBMA 3HCAA 1JDBC 4IR7A 1KDTA 4U0JA 5CFLA 5ITVA 3REGA 4YJ3F 3UW3A 1AKNA 1H1TA 4G37A 4RVSA 5CA1A 3HU1A 3GL9A 2OD9A 1UDBA 3WMFA 1GYPA 1L7VC 3FUUA 1Z5WA 2VOJA 5AVTA 1R6TA 5CAEA 5HF5A 1KAQA 1W73A 1FTNA 4ZO6A 5THQA 3RVPA 4AMBA 3ZLUA 4IGEA 3R3ZA 3WKEA 1F0PA 3SBOA 4BX9A 4P9NA 1FYVA 1QDLB 2QYOA 4MLCA 2UV8A 5CFOA 4UUAA 4M7PA 4ZYVA 2BEUA 4DQKA 1NULA 1IUNA 1W5TA 3O47A 3ROMA 4P82A 5JCZA 1QKIA 4GXNA 3MTAA 1A4IA 4G25A 1VLHA 2M32A 5KQLA 4BJ1A 4KWHA 4DMRA 1JU3A 3D6VA 4R31A 4G1VA 2AEMA 1Y98A 3LQ4A 4N8DA 3ZDXB 4FMBB 4BNGA 4XTCS 1Q7RA 1JIJA 2ORYA 5IDWA 1Q2UA 2JI4A 2NSHA 3QEMB 3QWAA 4A0FA 2JIMA 4GKKB 2JDID 2Q6IA 1S2NA 4HUQA 3OTGA 3TLCA 4HEA1 4R8LA 2I67A 3ZVRA 3R6TA 3QLUA 2MSLA 3O8DA 2CHUA 1AKYA 4ALMA 1G20E 4JL5A 4XD7D 4DY4A 3QUTA 4HNVA 1JG1A 2A0KA 3H2KA 1IOWA 4XR9A 4LTNA 1E2LA 3TCNA 1CS0A 2PFSA 3LPAA 3WGUA 1X94A 1PHRA 2RIRA 2QX8A 2BW0A 2GZHA 3NAMA 4R8RA 1HE8B 3FKSA 1A9XA 4EZEA 2N42A 4CV1A 2VJLA 3BMQA 4YO7A 5FFNA 5HJ5A 2AXEA 4L5JA 1OAAA 4OHYA 3L7BA 2VTVA 3KSDO 3ZLBA 4CODB 2GO1A 5CGZA 1K6IA 3PXAA 5TQVA 5JWRA 3L06A 2CMHA 3WDKA 1P1KA 2HJRA 4G5FA 2ENUA 2PRYA 3ZGVA 5LQNA 2EV9A 2HLDD 2Q3MA 1K66A 4RSHA 3Q9UA 3UJAA 4DDVA 2DHQA 3JWJA 4FE4A 4ND8A 1P7ZA 3FOEC 3GG9A 4CMHA 1R18A 3CRMA 2BFAA 1Q74A 1WWKA 2CLHB 4IHAA 4G4IA 4IDGA 1PNQA 1JEOA 3WGIA 4V0ME 4BWYA 3W7BA 2RGUA 1ZIPA 1YS2X 1SG9A 2VZ9A 2AKEA 1DXOA 4WBNF 3KR0A 3CG0A 3VX4A 1FB5A 4LRTB 2OCGA 1JA1A 4BQSA 4ZDJA 3GFRA 1GP2A 2ZREA 1YMQA 2L82A 1F2UB 5AXAA 5DX8A 5HKKA 1QRUA 4JOCA 4BIMA 2AE2A 4UBKA 1IOLA 4I46A 4DLXA 3FCOA 4F9EA 4JLNA 4QVKA 2WF9A 3ZD7A 2ONKA 3QNUA 5JCOA 4O4HA 4KGXA 4UCQA 2PUDA 2JBWA 5A3RA 3ZGNA 1EB9A 1I10A 1FPMA 5HRCA 1LK5A 1FUUA 4A1FA 4L3OA 2EKBA 2H54A 3KJHA 1HUQA 4Q4DA 2E18A 4N39A 1O57A 5CJJA 4F8EA 4CQNA 4IS3A 2W37A 2YC4C 4CDRA 3LBYA 4ATNA 3JZAA 4D02A 1HDRA 2A4MA 3H2IA 4R1QA 5B3JC 3JX9A 4J1TA 4LHSA 3DNPA 1XOIA 1ZFNA 2KLBA 4IDPA 2XDYA 4L73A 4V0QA 4PHTA 3GLIE 2J9FB 3CSUA 5AK0A 1O5OA 4AS2A 4B73A 1FJXA 4LVOA 2JFBA 1N5JA 4QUIA 1Y6ZA 3AR4A 4WACA 4K6OA 1C4WA 3RC2A 1JHPA 4KO1S 4HSEA 3HU3A 2QVCA 1YBHA 1XU9A 5TF4A 5BSHA 3DG9A 4HWKA 2YS7A 3A9VA 4MRRA 1MC5A 2YVUA 3GJ3A 2QNBA 2ZPUA 5BRJA 4LF5B 3ETJA 4EMTA 4PZPA 3R3XA 2IYVA 2GLTA 2VHXA 4HEJA 4WY2A 4Z51A 1P5ZB 4BGEA 5LQRA 1KS2A 1F4PA 5KTOA 2WJYA 4UW9A 1B41A 1Q7EA 1T0IA 3CUSA 1JP7A 1I1OA 1RSZA 2RC6A 1S0UA 4LF7B 3RVDA 4UEWA 3OOJA 3WJ1A 2DTEA 4UXHA 4EY7A 4F97A 2PRSA 2QY6A 1JPVA 4Y2UA 4AZVA 2F3PA 3DE3X 5CVCA 1ZL2A 4JI3B 1Q1GA 2FCRA 1T3SA 3K6JA 5CRIA 5K20A 4E7OA 3H5VA 3WZLA 4JEUA 3H2ZA 5KC8A 5EWMB 4JYZA 4NOMA 1IM2A 1ENPA 4KOAA 3NORA 4FFLA 3GMIA 2GX6A 4I6EA 3RRJA 2P7IA 1SUDA 1VCHA 3IDSA 4GBMA 4TLLB 1CRZA 5EIBD 5JJKA 1LU9A 1XLWA 1HDCA 3RK0A 4RQUA 3ZVMA 3ICEA 1SB9A 4AW9A 1UOPA 2QRKA 4UEQA 2ZBUA 4D92A 4MVJD 3NWOA 1NYQA 3OT1B 2GWHA 3EE6A 1Q14A 2JVJA 2ZRHA 2PWAA 3OQIB 3R0ZA 3R5HA 4IVNA 4LDNA 4NG4A 4A6EA 3TWOA 1YZNA 1Q1NA 1FK8A 1ABBA 3RFUA 3INGA 2JAQA 3MAGA 4B2LA 1E1QD 3WBBA 4FWIB 1V43A 1G291 5ESWA 3ZDQA 5IJ9B 3KT0A 2AK3A 1CJCA 2RDMA 2GXSA 4JEIA 1R16A 2B1JA 2YFYA 3N8IA 3WBKA 1HK7A 4RJKA 3WYEA 1XDGA 4TRJA 3OZUA 4BV3A 4CMEA 1OB5A 3C3KA 2XRYA 4GLJA 5K3DA 2GRUA 1AKEA 2Z2YA 3OTIA 4WFKA 5BYJA 3VHRA 4DNQA 1FXWA 5JJLA 4X1OA 2CKMA 2BP7A 2PL1A 4YAIA 2Q07A 5SY9A 3T1NA 4HXYA 3O3CA 1C7FA 3AGPA 121PA 3FRJA 5IKXA 1U8AA 1E2HA 3KEFA 4G4SP 4UVHA 2DERA 1Q0LA 2RBKA 1ADJA 4O2BF 1OFUX 5IVDA 2I7CA 2QQ0A 1M2GA 1B1AA 2ZWIA 3MNFA 1MNQA 1TCAA 2RONA 1S89A 1KJWA 2PZGA 3AEUA 1VIAA 2X1HA 4X24A 5EHNA 1B1CA 1UOQA 2WQ7A 1Y9ZA 1PUIA 2J9GA 2QU7A 3ZTYA 1F3OA 4S0XA 3ZOZA 1H2XA 2WJVA 1KJIA 2DQZA 5LOVF 2FH5B 3PLRA 2IEYA 2ISSD 1BROA 1XZJA 2ZYAA 3JR7A 1T9ZA 1LDEA 3IUYA 3SEQA 1M1XB 5DNCA 1F6WA 1U3UA 3L0DA 1JKXA 4M53A 1I6KA 5L4LA 1O8BA 3IT2A 4FDAA 2R9VA 2Q2WA 4YPVA 1TK3A 3MW8A 2CD9A 2XGGA 2PSDA 2XE8A 1I5RA 4J75A 1O03A 4OGKA 2VRNA 1RYEA 3HN7A 1GA6A 1QONA 2D3WA 2QD2A 1EWYA 3EFBA 1JFVA 4ZN6A 5LR6A 3USCS 2DBZA 3G8CA 3ISJA 1MAVA 3TOVA 2VK8A 2DPGA 5KYWB 2IEAA 2FR8A 3FNBA 1EK1A 1PZFA 5KJCA 3WQQA 2W2KA 3UHPA 1QHYA 5IC6A 3IULA 5T4BA 1KGDA 3ZEAA 4CETA 4ENPA 3CF4A 5G53C 2FP4B 3WWEA 4MMZB 2R5WA 5IYZA 1U6IA 4M0FA 5EMNA 2JARA 2VQ3A 3L49A 4RD6A 4L4SA 1OCEA 3TLAA 3AI2A 3BE4A 4BN5A 3K92A 5L4NA 3IRUA 1PDOA 1QOQB 4U2FA 4B31A 2ATCA 1MVNA 1E94E 1W46A 3NJ4A 1GT6A 4PS1A 2FE4A 1H1LA 1NW7A 5TPZA 3F5FA 4GD3Q 4MUIA 1PGJA 4E2YA 4Y8VA 3PXXA 3R0QA 4TQ9A 3CVXA 1E3JA 5KS2A 3F73A 1NJ5A 4RXTA 3ML1A 4JI5B 1WX1A 4DR6B 5DNDA 3KX2A 1L5NA 3UWSA 1O9GA 3M2PA 4MVXA 1RJGA 2I7VA 4F85A 5LL6P 2X4GA 3RSCA 4CCWA 2JLXA 3N7UA 2P30A 5HW0A 2FN7A 4L6IA 3CLUC 1QGOA 2QVLA 4IM7A 4C5CA 4D43A 2G1KA 5LYJF 1EYZA 2HSDA 2E4XA 2VIIA 3LFUA 3IQHX 1IBMB 2ALJA 3G9TA 3MF4A 4YP5A 4CLRA 3I83A 1E0DA 3AK4A 4FOPA 4WRRA 3PWTA 1OW3B 3MWJA 1T3HA 4HRVA 1GZ4A 2QAGB 3DL2A 4L1KA 4N54A 1E7YA 1JF8A 4XVHA 3SS9X 1VQ1A 2QP4A 4OQNA 5EGNA 1GLGA 1JG7A 1EVKA 3M34A 4U7PB 4TV8F 1A9XB 2BH9A 1X3LA 1J0XO 3OX3A 4U2GA 1GUYA 2HA6A 1NY5A 1MO5A 1LBHA 4QUJA 2NPFA 3HZOA 3EWNA 3TRKA 3FROA 3ZNOA 5BUZA 4UPVA 3HCRA 1CVIA 1SIOA 3D64A 3I05A 3NC0C 3OQIA 1KO1A 1PZXA 2JAHA 2ZI5A 3H2HA 1IBKB 4Y6OA 1I4WA 1YB5A 3CZMA 4N5IX 3BB3A 5CYGA 3AX6A 4BKPA 4AMYA 1YZLA 1Z2CA 2CXSA 1OWMA 3P2MA 4BO3A 3EIXA 3AY6A 4E3WA 1JI0A 1D7AA 1NHGA 2BFMA 3KUKA 3UOGA 4HVTA 4LY0A 4PNPA 4EKGA 5E1BA 4B2YA 1QDUA 4HATA 5A5FA 1KQ3A 2GEBA 3SZGA 4K26A 3UMVA 1WPRA 3WGKA 2ZU0C 3F4KA 4G9EA 3GJ5A 3IAHA 2FZLA 1I30A 1DV1A 1XAIA 4IICA 4TL9A 5KNDD 3QKWA 4JYBA 4UHCA 4WLNA 4WKGA 4BMOB 4L0CA 4D8VA 1RZ3A 3PC7A 5NLLA 4CM1A 2LP4Y 2V7EA 2A35A 2BF4A 3DYIA 4RK7A 2MJLA 3RS4A 1FFAA 4HNSA 2FVXA 2XT6A 1XZAA 4QOGA 3QF4A 3Q8WA 5ELXA 4J91A 1G21A 1AUVA 4B44A 3SDZA 4QG3A 4MCAA 2DFPA 5F2EA 1JKJA 2Q0QA 1NE2A 3IVRA 5DF1A 3I9OA 5BSMA 2J45A 3D43A 3OX1A 5JALA 3M81A 1UKAA 1J2YA 2G06A 2IU3A 4IEIA 5T6MA 4BMNA 1R9NA 4LBWA 1QCDA 3P0EA 4AZ3B 2ZSJA 3A36A 2EF0A 2PZAA 4MRMB 1YS7A 3LPLA 4CGYA 4HGOA 1XMPA 2QYHA 1I1HA 3AFGA 3M33A 1JJBA 1JEQB 4WZAA 3EGCA 3V7WA 4ENSA 3KLMX 4XIIA 4K2HA 4B43A 3JD3A 5CK5A 4EI7A 2I33A 4U1RA 1OREA 1BWRA 2LPMA 2V3WA 2ZJ2A 3B12A 5IJZA 1KMNA 3FRHA 3EW9A 4HYQA 4KQ2A 3OOEA 3NTXA 3K1AA 2IBMA 1QQBA 1N2EA 3THXB 1B2RA 1OI4A 5KWEA 2ZRCA 3HDVA 1KI2A 3D2BA 4IGFA 1YZYA 4NONA 3WBJA 3G79A 4KBGA 4RKFA 3R7NA 3DLHA 1H6CA 1L9XA 1VG0B 4BWVA 1IXRC 2FJUA 2C58A 3GJTA 4B4UA 1V7PC 1KJ8A 5G3YA 4B0OA 4EA6A 2E82A 3JWEA 3LC0A 3EH1A 4Q3LA 5EIHA 1UXGA 2QT0A 3KQSA 4EM6A 5LQUA 3A2LA 3GLGA 5DHTA 4B83A 3HBLA 5C2JB 1C9YA 1TIBA 1U0OC 2B21A 2DUUA 1R6XA 1YBMA 1ISJA 3FDZA 4CEHA 3MN1A 1TYBE 2V0NA 4BAUA 2DLCX 5KYYB 2EYUA 1N2CB 4HVAA 3TZKA 1ILWA 2GBIA 4U9IS 2W2LA 3B51X 3LQ2A 1PU2A 4O02B 1W48A 1GPKA 3AR5A 4P5PA 4ND4A 2CLKB 3AV3A 4J7CA 1QH8B 1E1RA 4F38A 1G2OA 2EARA 4X1IA 5IUJC 1S2LA 4TWAA 2REQB 1O95C 4P3XA 2OPBA 4A5OA 4TM7A 5KYWA 1F51E 1E5LA 2VJOA 4RD4A 3QBTA 4ZHSA 2FFQA 3DSRA 4ZCQA 3RHSA 1VLLA 1UMBB 1BKYA 3FPGA 2HUPA 1CKEA 1NNLA 3M6XA 3WIDA 5EMHA 3C87A 3Q40A 1BVHA 2BZ1A 1Q5PA 1DC7A 4N9WA 4BTVA 4Z1MD 2BM1A 2YRFA 4PAQA 2CVZA 4M1MA 4UPDA 5FBQB 5MN5A 1DG1G 4V1CB 2XUOA 3OE4A 8AT1A 3TAXA 1CR6A 2AOWA 3K2IA 1EEHA 1GV0A 3K1YA 4C0AC 5FUMA 5EQDA 1ZD3A 3AU9A 3G6WA 3CNBA 4IIJB 5EYPB 5CDUA 4BQQA 2XGOA 3S55A 5L6LB 2IHZA 1Z2EA 1XIVA 3D31A 2PNJA 4IQ8A 1IU9A 1L5RA 2I8LA 2O2DA 3O0DA 4GW3A 2OBBA 5IMBA 3PD7A 3RHFA 1BJKA 3U7GA 1KU0A 1EK5A 1G4HA 1E20A 4RTOA 4L9WA 2X19A 4C4SA 3G8YA 1L4EA 3L79A 5KVQA 3OHPA 4PYJA 1Q0TA 1QGUA 3OWXA 4OLHA 1RACA 4L78A 1IM8A 3MXOA 4JC0A 1M6YA 1NVVQ 3WG9A 2O2EA 3PQ6A 4EPYA 3B52X 1IWPB 2V58A 1S3FA 3C3AA 5BN4B 2D8AA 5TT1A 3D4OA 2X9NA 3D81A 4M98A 3DFZA 3O1IC 2OP0A 1KOLA 3RSSA 4OOEA 1C7RA 2YUIA 4C9BA 1CRPA 3GNSA 3HFRA 2W0SA 2EAUA 5BYBA 1SOUA 4UXJA 1OKKD 4GDMA 4X7RA 3HO6A 3WQHA 3FHTA 2JZCA 1UBLS 3GVHA 3FZEA 5YASA 3Q8MA 2B8TA 4AI6A 3L0CA 3GN1A 3CVYA 3A6PC 1QFZA 2EW8A 3LKDA 4C21A 4KDCA 4PYKA 4CMIB 2H2HA 2OECA 3GJ6A 4GI7A 5G0WA 1D5WA 1XCMA 2YIMA 1FW6A 4NBVA 5JCJA 2GN0A 4HHEA 5FWYB 3EODA 4NCAA 5DLPA 1VI5A 1JDVA 3EFOA 1WCIB 5A04A 3JQAA 1RCFA 2WIFA 4G8CA 1N5KA 3BHMA 4F1WA 4CQMA 1G8AA 1Y4DE 1RNLA 5ARCA 3BB1A 3E5RA 4DMFA 3D0QA 1P5JA 5A4AA 2UYYA 2G6BA 4LWPA 3ZU5A 2PUFA 4G9GA 3L7CA 4QPDA 1RM3A 2FFBA 4KQ1A 5CFRA 4MO2A 2GPSA 4AJLA 3GPBA 3PFIA 5TIIA 2XLBA 1T26A 5AKXA 3U3JA 2IYEA 1VE5A 5C3MA 1O7JA 3MCTA 1QHHB 1W5AA 5ES4B 3WMXA 1VLQA 3ZGLA 4B7ZA 1U31A 2HI0A 4BNMA 3UJNA 1DV2A 2I7XA 3AV0B 1QRTA 1DUVG 2ZGVA 4D5GA 1XTJA 2GCNA 2FMKA 3HXPA 4QJ4A 4ZOCA 1K98A 4GECA 4RVNA 4B7UA 2R2GA 4A6DA 1UBUS 5CTJA 4B3IA 1EXDA 3QSYA 1C2TA 1E79D 1JTEA 1UMCB 4D56A 4IDAA 4B4DA 2QZ4A 4QPNA 5FNVB 4DMKA 4P3NA 1N3BA 3WL7A 4JBHA 1UANA 1FFHA 2NQTA 4GXQA 1LS6A 3EXEA 4EJMA 3TJZA 4BX8A 3FUXA 1FP6A 1YRBA 3X1KA 3GLIA 5IT0A 3VU0A 3ZIUA 4QASA 2WHXA 3CHYA 2GFHA 3T5PA 1W34A 1VRWA 3H1GA 2AOTB 2XGMA 3N39C 1G21E 2HPZA 2W8ZA 4LNAA 2Y27A 1IY9A 3QEBZ 1B3RA 3G5TA 5A9SB 1XQVA 3IKVA 1ZEJA 4D9EA 4Z9BA 3FYUA 3TOZA 4E08A 4HDMB 3VJRA 3QU5A 1P44A 4H7IA 4LK3A 1P77A 3A6JA 3I8SA 5IW8A 4G9BA 3UW1A 3GELA 1UKVY 3IAAA 3CLSD 2BP7B 3R40A 4N76A 4EW3A 1MIHA 1SKAA 4M9UA 1BJRE 1A5SB 3DDSA 3ZG6A 1E9EA 1TUBB 1YR1A 1N7JA 3JQPA 4C04A 5JRZA 1ML3A 2RGAA 5FJJA 3SYMA 3D3EA 2I1LA 1A0OA 4GOXA 4H0CA 4K1LA 1N9GB 3V1UA 1XNQB 1EVLA 2H4FA 4Z6KA 1VXOA 2JLCA 5LVAA 5L3SA 1PVDA 3L01A 5FBRB 2IYOA 2ZBGA 2RSLA 4PRKA 2WAXA 4B71A 4CKCB 1O0SA 3OU2A 2JD1A 5FFFA 4D0SA 1N1DA 4LECA 5TE9A 5CEEA 4ESEA 1YZUA 4HTAA 5A02A 2QJTA 3U26A 4C7KA 3OT1A 1NOIA 4DEVA 1KO5A 1OLXA 1RYFA 4UD2A 3UJ6A 2G76A 1PYGA 5CGQB 2J5RA 2WWYA 1NSTA 3G0CA 1KDZA 1EXWA 1HX7A 4X6LA 5B6JA 2IHUA 1ZM7A 2XCLA 2HQBA 1BMFD 2NSLA 2D74A 3K30A 4KRGA 5FWDA 1T91A 1Y7PA 3PQ2A 3T3MB 3V9AA 2MINA 4N6OA 3SM3A 3WSTA 1NFRA 3GFOA 4ZGWA 2P4QA 4G8DA 5KOIA 1I0ZA 4GL4A 1CUDA 1XSEA 1PE0A 3CW8X 5LKAA 4ZAVA 4JV5B 3U60B 1M1YA 2P9CA 3WQRA 1M8KA 1YV9A 3RUPA 1CUJA 2WEKA 4KH1A 4PNZA 3KVOA 1C0KA 5BV1A 3VYWA 4TZTA 5FQNA 2AG6A 2F8TA 1HORA 1IJEA 4WCDA 5CUQA 5JNTA 3AVTA 3JYPA 3OCJA 2RAUA 2ZZKA 4P3PA 4QBFA 1PWYE 5FLYA 4JUBA 2CVFA 2Z4RA 4E11A 4YRGA 2Q9CA 1CW2B 3AESA 2IXDA 1PQUA 1ZJJA 2HSZA 2ZIFA 3B8EA 4D6YA 2FWMX 1ESNA 4IZOA 4GE0A 1PRYA 2JEOA 1DHTA 1DIGA 4OHMA 2AHOA 4ZEOA 3N2IA 3T0GA 1V45E 2RI1A 2PX3A 1RWPA 2XKBA 5JLAA 3R6LA 4H7PA 1FMFA 3BAZA 5JHGB 3KAKA 5DU2A 3MHPA 3KXPA 2UZ1B 3OBBA 3RU3A 1ZUWA 1QPBA 2CHFA 3PGMA 1V3QE 2BR3A 4J94A 4ZVQA 4BKQA 3FMFA 4C7OA 3NBFA 2FMXA 1BXZA 2HFKA 2ZQYA 2HF9A 4UARA 1EK0A 4RJIA 4NDNE 3I30X 4IQ0A 4U00A 1RBYA 2XWQA 2I55A 5DYYA 3ZYCA 3HZZA 4O4LB 1KQGA 3I62A 1X9GA 3VSCA 5CLHA 4LDQA 2CL6X 4MQLA 1FFBA 3CEMA 2EJVA 4JSYA 4A2PA 1WSWA 3ZXIA 4L8VA 3V3TA 1R6AA 4YRCA 3RTCA 4XEUA 1K6EA 2PUWA 3TVYA 4BB6A 1O0BA 1Z7EA 5EHGA 3RHTA 1Z12A 1PNRA 2C7PA 3HCEA 3QWBA 2JGJA 5B3JA 3QVVA 3WICA 3NRBA 5IG2A 3NTUA 3DOHA 2NVUA 1XDWA 2BGLA 1TKCA 3BULA 3G23A 3VR4A 2C9CA 4OGGA 4PZZA 3LXUX 2F8LA 4AK9A 3O94A 4HADA 1RXEA 2IY8A 1FSZA 1RQPA 1DAIA 4GOND 5AM1A 1XMIA 2JBAB 2YMLA 2BUAA 1C0EA 1UFOA 2M6RA 4GP9A 2QRQA 4YP1A 1GQFA 1Y3AA 4WXPA 2J3DA 2ZRAA 3H5IA 3COSA 2ZRGA 2VYCA 4MPDA 3UJBA 4AUEA 3JXEA 2ZWOA 5A62A 3MEQA 2LE0A 3AR2A 3QVJA 2YWJA 3DMYA 1IJFA 1NPDA 1OFTA 2EFYA 3H8VA 3IXMA 3LX4A 4FT4A 4GGOA 4TXHA 4OFXA 4EJSA 4F04A 2NO0A 4IJWA 3E61A 1M1ZA 4LNHA 5CFMA 3LVQE 4RPGA 5IJ9A 5KVAA 4NULA 3MCWA 2E6KA 1NJFA 2AR7A 2JC3A 5MN6A 4G1EB 1RRGA 3VOSA 4CM7A 1M5RA 3UK7A 2JVKA 1W4CA 2CFSA 3K2QA 2C2OA 4J0QA 1FFWA 4XI9A 1G41A 1EP2B 4OTZA 1YBVA 2ZPAA 2FRDC 4BO5A 1EAYA 1FS4A 2WDPA 2VEOA 4FFNA 4HFJA 5D86A 3O8CA 1SCAA 1UJCA 1GL3A 3VOAA 4ODIA 2OHHA 2YVAA 3ZWWA 4EMUA 3H2YA 3EC1A 4D5EA 1MJHA 2PU7A 4TYYA 2JGDA 2AS0A 4NK4A 1JZTA 3H6HA 3A3KA 5KDDA 3R9XA 3ELYA 3GQBA 1V26A 1Z0AA 4B40A 3EGIA 1ZLXA 3PEEA 4JI8B 4CIDA 3LZCA 4CLEA 3C74A 1P3Y1 1D2MA 2JD2A 4L15A 4OJYA 2I91A 3IMCA 1XBTA 3CZRA 4R5MA 4QVGA 2IZ1A 5BW4A 4P0PB 3DAFA 4ECEA 4L8FA 4YP0A 1PJ8A 2C96A 5H3HA 3SEAA 2IVZA 2OAQ1 1RYBA 5FBLB 3RUAA 2IUYA 4EKYA 3S44A 2QZJA 1TU4A 3DBVO 3OJOA 3PSHA 1C0LA 4DV1B 4EG4A 5FUWA 4CL2A 3NATA 4HVLA 5ER9A 4GVLA 3ZE9A 3KCQA 4OQQA 1CF9A 1M2EA 2IIQA 4FZ3A 1G55A 1GNRA 2YINC 3DF7A 4G0NA 3DW1X 3KYJB 2PX8A 2MINB 1MTZA 1XK7A 3ABRB 3SOZA 2R4QA 4YMVA 1YC5A 3RGGA 3ZWKA 2D2FA 4R2HA 1G5RA 4KOEC 2GCPA 4EUNA 3B3QA 3TW8A 2FGJA 1UPTA 3U7IA 4I8DA 3QRWA 3C3WA 3MWKA 4ENRA 1AK1A 2XMBA 3FVWA 5L3ZA 2BIFA 3I72A 3HWX1 5J1SB 2REQA 4JXXA 1T9HA 4CKCA 2RHDA 3H7AA 1NUPA 3HRHA 5EWJA 3K53A 5C18A 2I6TA 1LQUA 4N6NA 1C30B 1P1FA 1N6KA 3DDZX 2VJKA 1VCOA 4BNKA 1AQIA 1J90A 2AJLI 2GKSA 4F6RB 4NNOA 1LPOA 4YPFA 3WMWA 5IVPA 2BGWA 1JWLA 3SZOA 3LDFA 4MUFA 3OCWA 4E51A 1GYRA 2DOKA 2EWVA 1PUJA 3ZXSA 4Q4LA 4WVFA 4A92A 2QTWB 3HH8A 4ZOAA 4QTUB 1M1YE 1K06A 3AWIA 1ZOLA 2FG6C 2FOLA 4HDMA 2OYCA 5IBCA 4EP1A 2P1RA 3MOIA 5K7SA 5KYUB 4KRFA 3B5EA 2CNKA 1RYNA 3UJ3X 5AKJA 1RKVA 3UMCA 4PGMA 4DYVA 2C9YA 2AE1A 2XDQA 4JBIA 1FQOA 2QENA 3H05A 3QOFA 3T54A 4ARVA 1QHIA 1EU1A 3IP8A 1I0LA 1WDLA 2NV2B 1S7CA 3U80A 3VAAA 4ZYLA 1N25A 4LJLA 1J99A 2IXEA 2FEKA 2PX0A 3PXBA 1HMYA 4PX9A 1JJIA 2P3LA 2P5SA 3R7FA 1HMPA 4R7TA 1L7BA 2GD0A 2JRLA 3X2SA 3COWA 3BF7A 2B61A 1XZNA 1IZ9A 2CNDA 1OXMA 2OAP1 2PMWB 4J0KA 2HW8A 3SHTA 5ILOA 3FDXA 5TX7A 3L4SO 3KBBA 4JT8A 4C05A 4N7MA 3GG2A 1EP9A 1LUAA 1NBMD 4TN5A 5JXIA 2VSNA 4OF4A 5C7YA 1FSFA 2J9YB 2NIPA 4PWZA 3WB0A 3WYFA 5B6PA 3LK6A 5KQPA 5E3IA 4RHEA 3KE8A 4HN9A 1TM1E 2OCXA 1JNYA 2ZYSA 6PFKA 5I3ZA 4KNYA 3FPHA 4DBLE 1NONA 2Y1DA 1AQJA 1ZNYA 3IQIX 1YK1A 4M8KA 1KJJA 4GMDA 1U2RA 3JARA 3S5UA 1NKVA 2CNNA 2NNWB 2R79A 3QEMA 1FVXA 4HY3A 1SVSA 2QXTA 2ZKIA 7AT1A 2J48A 4ZOLF 2FQQA 5D7BA 1O97D 2O2ZA 1X80B 4BLPA 1NVXQ 2CNBA 1O5IA 1Z0SA 3BICA 3PPXA 2EW1A 2WLTA 3C3MA 3DZGA 4ZA2A 3C5WP 5FPTA 3IGFA 5SV2A 1LI4A 1Z4OA 3H11B 3OTWA 3Q5DA 3L0ZA 3ROFA 3DLBA 3FF1A 3VJMA 2PV0A 4JXJA 4NFSA 3HLYA 2Z09A 2B69A 3STXA 2XLCA 1Z06A 4K6GA 3LT5A 3Q3EA 5K3AA 1V11B 3NX4A 2C77A 3KVVA 4D79A 2J5QA 5HFAA 2EOAA 2V7XA 1I51A 1OD6A 2WDZA 5ITZA 1MJFA 4PVCA 2ID7A 4ND6A 4CR7A 1I3KA 4RS4A 2BSAA 2GXQA 4OI1A 1MX5A 1EFCA 4AB1A 2FF7A 2WM2A 4WN9A 4HFNA 1P1CA 3GFGA 3MTGA 4E09A 2I65A 2IY9A 5C4MA 1EVEA 4WFQA 3DDHA 4PPQA 4EZBA 2QX4A 3LXMA 2C4MA 3F5SA 3DVAA 1GTSA 2GERA 1WU8A 3DOCA 3FPEA 5LYJB 4DWOA 1ATIA 1YCGA 3H2SA 3JV7A 4E88A 1JA9A 3L18A 5SZKB 4G5RA 5HQTA 2A5YB 2PX4A 3ZJTA 4D9GA 3U5ZB 1N33B 4RULA 1YI1A 4OJMX 1DJNA 4CL0A 4CNQA 5K9ZA 4Y2TA 4HXFB 1H6BA 2I0FA 3LC2O 3THWA 1EDDA 2W6MA 5CNJA 4Z0NA 5KINB 3NO4A 3NTLA 4RLFA 2DX7A 2MSWA 4LI3X 3H1EA 4P86A 5KVCA 5DI9A 1GPBA 1H1DA 4GIBA 4ETNA 2X4LA 4NMHA 2HLPA 4GVPA 3AJ8A 4KXQA 1XRLA 2VXOA 1DAPA 3GCZA 4EYQA 3N3BC 1HEYA 2CNOA 3FUTA 3ZU4A 1LPAB 3K9QO 3Q3VA 4L51A 1XQWA 1XA0A 1T0JB 4GNRA 3WGLA 3T3NA 1P8JA 3CIOA 4YMIA 3V48A 5KYTA 1SAYA 2QL5A 4Q21A 4WZ6A 4NCNA 3ROKA 2NPIA 1M0TA 3RBAA 3IAEA 4XQEA 1SKMA 4DQLA 1JE0A 2K2QB 3NHRA 5M29A 4D98A 1ACLA 1NL3A 1FDOA 4CNBA 2X5NA 2JFWA 2D1RA 4GU5A 1C1YA 1RXVA 3PNYA 1KAGA 1OC2A 4KAJA 3CT6A 3QKRB 4ZICA 5H8WA 2WD7A 1SPBS 4JCCA 1H4VB 3C15C 1JR6A 4FINA 1IATA 2NUBA 5I8WA 2PQ2A 4RK5A 3W3ZB 2QD3A 4B6OA 5AVQA 4L74A 4AJPA 1RTKA 5K99A 3WYBA 1HTWA 2QGZA 3ZH2A 3C7DB 4FFRA 4TKVA 1I3NA 3BZBA 4AXBA 5C8VA 1CQZA 2AFIE 2ZBDA 3C3DA 4OU5A 4FCVA 4RY0A 2ZW9A 4IH1A 1RI3A 3PIRA 3SYRA 5IYZF 3ZV6A 1RXCA 1X86B 3L7AA 3ORFA 3QVOA 3RBXA 1RAGA 2ZWVA 4X97A 1GPJA 4PR3A 4Q66C 4DUYB 4K9DA 1EWRA 3KP1A 5ALOA 2PWYA 1U5BA 2W6JA 1NDHA 2QVYX 3SWWA 2J41A 3GCXA 2QZSA 1Y3CE 3G68A 3GEPA 3WJ2A 3WRWA 2A58A 4G0YA 4TKZA 3GFPA 1K8RA 1XD2A 1Q1EA 4C6HA 3LY8A 3UHOA 2PUBA 1P39A 4BFZA 1XELA 4ZJPA 3P7MA 1JBEA 2BDEA 1Z4MA 1DFGA 4YC7A 1Q0PA 3AP3A 1LW7A 3WK4A 1SXGA 3HXOA 1LTQA 1H5UA 1WLSA 1OROA 2W6CX 1RIIA 3AOEA 1IAVA 3D1VA 3HA7A 4FOTA 2ECPA 4HLCA 2XJ9A 4QYMA 3E1KA 1V4NA 5HTKA 1B26A 2X0IA 3FYTA 3RS3A 4II2A 2ZRDA 1B0UA 2ZUWA 5HRAA 5L4SA 2Q3EA 5K4AA 2PX2A 1LJUA 1LBQA 2ZXUA 1QBGA 3FXAA 3SK0A 2SNIE 4W9NA 3GLGE 1NUSA 2ZB8A 2QLMA 3A9TA 5FULA 1HKUA 1WCIA 4H17A 4Y9DA 4ND3A