2QD4A

Wild type human ferrochelatase crystallized with mncl2
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
molecule tags Lyase
source organism Homo sapiens
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
total genus 144
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd4A01
3AQIA 2Q3JA 1DOZA 2XWSA 1TJNA 2PO5A 2XWPA 3M4ZA 2QD4A 2QD2A 2XWQA 2PNJA 4KMMA 2HREA 2Q2OA 2QD5A 3HCRA 2JH3A 2Q2NA 3HCOA 2DJ5A 3GOQA 4F4DA 3W1WA 3LYHA 2PO7A 2HK6A 2HRCA 2H1VA 2QD3A 1AK1A 1N0IA 4KLAA 2AC2A 1HRKA 3HCPA 1LBQA 1C1HA 4KLRA 4MK4A 1LD3A 4KLCA 2XVZA 1C9EA 2XVXA 2C8JA 2H1WA 2QD1A 2XVYA 1QGOA 4CCSA 1L8XA 2AC4A 3HCNA
chains in the Genus database with same CATH superfamily
1X14A 4LDJA 4F6LA 3ER9A 2B25A 1BYIA 4PVCA 4LHZA 1DKLA 1YBMA 2IPXA 5D87A 4NCKA 2LKCA 5JW6A 2OB1A 2Z3WA 4EABA 1PS9A 2V7TA 3BWEA 1FLAA 4MUBA 1EWYA 1BEEA 4JU9A 2QYOA 1C81A 4ZVNA 1YB2A 3ICPA 3SZ3A 3NBMA 3CTMA 2NXCA 4HJXA 3GA7A 3L8CA 3EXHA 2O2SA 3L92A 3BD7A 5DMXA 1XRLA 3NANA 2YJZA 1TEZA 3A3PA 3PQDA 1T9BA 1DDIA 3F9RA 3KYCA 1PNRA 4S1VA 2VT7A 2Y4OA 2HK8A 4WNCA 3V1UA 821PA 4JI6B 1NBEA 3CH5A 4TLLB 2EYQA 2B3TA 1WIWA 1GTSA 4NPHA 1I3KA 2WB4A 5ELLA 2OC4A 3VYSB 1Y8QA 4HHEA 1S2OA 4RYLA 5EIWA 4LGVA 1T2AA 4MQMA 3BHNA 4OQEA 4CKXA 4DLTA 1I4DD 5LP6A 1Y80A 1OA0A 4OMDA 5BWCA 5K99A 3BIOA 3BB4A 2WD9A 3GXOA 2R00C 3LDAA 4U5QA 4B43A 4G4IA 4NV3A 4D9BA 3D31A 1BC5A 4MINA 4DZZA 2QPTA 1O9HA 3HBMA 4XD2A 3K70B 3AW8A 3DB1A 1VJCA 1BROA 4W5OA 1FZTA 3V4OA 4HC4A 4A16A 2YNMC 1XLTC 2J6BA 2WHXA 1OGIA 3AM1A 4LMAA 1TOAA 4CUKA 2VAPA 4O4JF 2HWKA 3AHCA 3K09C 1QGOA 3X1ZA 2RIRA 1ZKDA 1AZLA 1P1CA 2FQYA 1SVNA 1PL6A 2A4MA 4ETWA 3RRZA 3TBFA 2OCPA 4H7EA 4ZU3A 4J0GA 5A04A 1ADYA 3C39A 1J49A 4PQRA 1XCJA 1QIKA 1QF9A 2PBLA 3DFZA 4JKIA 1MNAA 1MLDA 1F2UA 3JD4A 5AI8A 5FL7D 4QO7A 5EPUA 4I08A 1CP3A 5AXCA 4EA9A 3B1FA 5GVSA 1J5EB 4HNRA 1SXHA 3HKCA 4YALA 3M9WA 1C5KA 2Q7DA 3B6IA 1N6RA 4UVDA 1PWXA 1QQ6A 4X63A 4F2GA 4Z1OA 3T7KA 4ALLA 2QG4A 3ZS8A 4LV8B 3SWWA 2JI6A 4QDKA 1M2EA 1ADFA 2DP4E 2ECQA 2NNWB 1BDMA 4EPYA 2BZ1A 4KE6A 3GB9A 4H4EA 1UODA 4FKZA 4P54A 2J4FA 2Q45A 3QLTA 4PX9A 3ZGVA 3UMYA 1YZ3A 4IINA 4PFQA 4NJEB 1R0WA 4RPJA 1GSAA 3W5CA 1V0JA 3MWKA 2A92A 1J1UA 3L9XA 3R3VA 4EUNA 2GXAA 1PUXA 2WI8A 2OAEA 4E30A 5DNEA 5SY6A 1YUMA 4KUGA 4GO1A 4B2PA 5M04A 2IQIA 3O92A 5F33A 3N0VA 5A2GA 2GWHA 2FSSA 2NXWA 3H11B 3OZRA 4RGQA 2BDTA 1JR2A 3ZIAD 4DY4A 2P68A 3IPYA 4GU5A 5CGZA 2DQSA 2AVNA 3G8DA 5FCDA 4YJ3F 4EQZA 4GRIA 3RK1A 5B2FA 3B1VA 5CK4A 2GTIA 4B79A 2AUTA 2SNIE 4D97A 1WV1A 2OGSA 2FWAA 2HJSA 3A1TA 1ZEJA 5AWFC 3BSFA 5FWXA 2H1CA 3SX2A 3H65A 3V7UA 2OK7A 5K0JA 5FD8A 4B5KA 2EL9A 3ECAA 2ODWA 4JS0A 4YRFA 1JB1A 3R0QA 3TM4A 2EZUA 3F5FA 1NQTA 2ZR7A 1IZ8A 3WGGA 4I55B 2LRHA 3UOGA 3SEAA 2XUGA 3O6VA 4JVLA 4DG8A 1BXRA 1B6SA 3SIRA 1IQUA 4RM2A 5HFNA 5AIBA 4MO2A 4RKFA 4TKVB 1LX7A 2QZPA 4RLFA 4IR7A 3RIXA 2ZRCA 4IJWA 1C8BA 1P1JA 3FTDA 3H83A 3NDPA 5DIFA 3WO0A 2QX4A 2Z57A 3H5LA 2H1WA 3ZGOA 2FETA 2PVCA 1WO8A 3EFEA 2CLMB 1DKPA 5ETJA 4DQVA 4JLPA 1SBHA 1Z88A 1OXTA 2R60A 4PM4A 2F1RA 4NV0A 5DASA 4PZ9A 4FC6A 4ZDKA 1L7BA 3DEZA 3VTZA 3TLCA 1W36D 4JROA 4NVRA 2R65A 3IQXA 2MYPA 1J7JA 1OFVA 4WIAA 4HQ0A 5KWJA 6NULA 1AH2A 4WY2A 2CLSA 1AKTA 4OK6A 4BNNA 2OV1A 4MEAA 4C0XA 3GRZA 3WBKA 4ECAA 1VHLA 1KMHB 3KV3O 3ZZ1A 3S3TA 4EUKA 1TCVA 3RSGA 1ZUHA 3AILA 1CNFA 2FTKE 1JEOA 1V41E 4UOQA 3U7QA 2NVBA 1ZZEA 2R4UA 3LBHA 2PV0A 3VI3B 1AK2A 1DAGA 4WVLA 3FJYA 3EVTA 3O31A 2A9QA 1O8BA 1YZTA 2Q6IA 3FPBA 1RYDA 1L3BA 2CVQA 5DBFA 4D8WA 3CNEA 1IN6A 4CV0A 1YJCA 1T1JA 2QD5A 5EZ6B 1DBQA 1Z33A 1IZZA 3ELYA 3KJGA 2NYVA 1WNFA 2HGSA 3QOXA 4DAEA 4CM9A 3CR8A 4GPZA 2JCBA 1JIXA 3L07A 3HMQA 5LA6F 4DLZA 2JA2A 2HBYA 3PSAA 2WYUA 4ID9A 4ERXA 2B83A 3HABA 1Y6FA 4PLTA 4GGOA 2YOFA 5THKA 3TTXA 2X22A 4URXR 1AXGA 5JI3E 4GM1A 2FGJA 3SC3A 2C2WA 1OVGA 1XQVA 4FDTA 2X2OA 3V8MA 3T5BA 1F2VA 3TLJA 3OH8A 3NW9A 1GV1A 4WCVA 3K6SB 5CFPA 2BW0A 4WXEA 5SY4A 2NV6A 3SVZA 4ZO8A 1G63A 3EPRA 3FWHA 1V3VA 1MJFA 3WAGA 3U9LA 5JALA 4IBOA 4XYMA 5F52A 1FUUA 3ABZA 1ORTA 4XFKA 3AFOA 4ZVPA 5A05A 4Z4IA 2RE8A 1OIWA 1R0BA 4J1SA 4O4JA 1CY1A 2OHOA 2O8EB 4DSZA 2FZLA 1YB4A 1M1YE 5IJZA 4M37A 4D0NA 3THRA 1I1OA 1CBUA 2I2WA 4R1UA 1GAJA 5B7PA 4CIAA 2QRZA 4B2YA 2HN9A 1LLFA 1YDGA 1NNUA 1QDLB 5BORA 1VCIA 2PRSA 1UBMS 5C2JB 4F92B 1OB2A 3T5AA 1EK0A 1G8YA 2A0YA 1EXVA 2IXTA 1SOUA 3KOMA 3VR5D 3W5IA 1UAGA 3A4IA 3OEYA 5GIOE 2EHDA 4NBNA 4QIHA 2GVNA 5K51A 5CB4A 3HJTA 4GC5A 4CMEC 2OLEA 1WR8A 4FIDA 4OUDB 2R1ZA 3IAM6 4QSMA 4LZLA 3BT7A 3BAZA 4BGEA 2TECE 1AQ6A 3OURA 2PGIA 2VOEA 1YBFA 3AI3A 3WOVA 5CA0F 3N8GA 3PPYA 3QVTA 5HE9A 2NOAA 5BUZA 1Z4IA 2J09A 2CDNA 3ESYA 5FRDA 2QTMA 1ZY2A 5B12A 4AKIA 1HYEA 4HLUC 2H4ZA 3OQPA 4RQAA 2HLDA 1D8AA 2VDVE 2PSEA 3E4DA 3EVGA 3LCUA 1PRYA 3NTVA 1IK6A 1A9YA 4EHBA 4BNHA 1R00A 2A4KA 4FLMA 3I28A 2ON6A 2PX6A 1ZQ1A 3F5QA 3QOWA 4LHWA 5EP4A 1N2OA 2I6QA 2X5KO 1L5KA 3BZBA 1Q0RA 1SC3A 3EXEA 3RV3A 1HYQA 1RW4A 2WZDA 3WA7A 3DO6A 2ZRJA 4KI7A 1G42A 3JWEA 3GPLA 1Q0SA 4OOEA 3DZHA 4M1SA 3JD3A 3M6FA 2BEVA 3MJEA 1A76A 3TCXB 1PYGA 3RS9A 4EL5A 1SQ0A 1AG9A 3FX2A 3M1YA 5DXFA 2XUHA 1T10A 2X86A 5ENZA 1H69A 5TS3A 1H0HA 3LUCA 5GM1A 5ALZA 1D8TA 2EKDA 5I7UA 4MO9A 3VHLB 1YMVA 4F7WA 3O26A 1CDOA 1MA0A 3FHJA 4TQ9A 1SH7A 2EFHB 3LY8A 1AHIA 2XOKD 4ZREA 2JGKA 4JKYA 1BWRA 1RZUA 1G0NA 1JFLA 4RHCA 4HLQB 1R15A 2WFLB 1KYVA 4KHPB 2MR6A 5TXGA 2GPWA 3I32A 2XUKA 1OSNA 4OAOA 1GPBA 4A0QA 2O07A 4NECA 4MYCA 5JO9A 3VX3A 1TPYA 2QTGA 1COWD 2WNIA 2XSZA 2O52A 3KB1A 4UHEA 1A7AA 2ZXEA 4UVGA 3UANA 3X1MA 2JL1A 3Q8XB 1K1EA 3RBZA 1BS1A 1K2VN 3KQMA 5DYGA 3ZZUA 3WKCA 2F4NA 4FEGA 2J7PD 3LFTA 1NBMD 3J80A 3RFVA 3AEUA 4DJDC 4G1VA 5GONF 4L08A 1CQIB 1E32A 1ORVA 2B2XA 2AW3A 2V4MA 2J1LA 5EJIA 3IJRA 4Q9NA 3QEMB 1RPNA 3K9QO 4FSHA 1H2EA 1WSBA 3B6ZA 3E1GA 4GECA 2BWJA 4MA5A 4EJ6A 1AQJA 5BV7A 4DSOA 1SG9A 1B0UA 1PEAA 1DOAA 1WWKA 3LPCA 1NXPA 2CHEA 2ESRA 2WJ3A 3AF4A 1ONSA 4CYMA 2JATA 4URVR 3DYVA 1WSDA 1T43A 2FPGB 1Q7RA 4MRNA 5LBIA 1HQKA 5KZMB 4LXUA 4DV1B 4BZXA 3ULKA 5I8ZA 3I61A 1L4YA 1N5JA 2QNBA 2QZSA 4Q9AA 3THOA 4URHA 4WMLA 1RU3A 3CN7A 2HRCA 3PHCA 1E6LA 2NSDA 3ILHA 4ZCRA 4KBFA 4G1CA 4TTTS 4Y2PA 1F7VA 1XXLA 5AW4A 1HDXA 4IM7A 2P5UA 4EKGA 1M9NA 2W2KB 1P4AA 3PFHA 1XKLA 3N2EA 3ZD9A 1OF1A 4LE2A 3WSVA 4G84A 4Q3NA 1GZHB 1UMKA 2EWVA 3LX6A 4ARSA 5BSKA 1J0AA 1QMPA 3F4BA 5D3QA 1W2HA 3PTAA 1BVHA 1W4ZA 3U7GA 1D2NA 2BPOA 4QJIA 4HBGA 3DQPA 4TLAA 3LLCA 4MMZB 3OZCA 1KSJA 2JH8A 2P9ZA 2EGUA 2H5IA 5CVEA 1V26A 3F49S 2C1EA 1TKRA 1S4QA 5DDIP 5C7YA 5E1DA 2V9CA 2QLJA 4HEHA 3T0GA 3HXPA 4BNWA 5J3JA 2QPOA 4NBKA 3ZNPA 3DMPA 4PNZA 1OXXK 3NP7A 4Q9HA 5LNK6 2FAXA 721PA 3EQ8A 2ORYA 3ROKA 4E14A 1G3UA 3BRWA 2M1ZA 4ASUD 1ESZA 3HN6A 1W9MA 4BBAA 2YDXA 1M1NA 4LJAA 4OQNA 3WADA 1U5BA 2MWMA 4D4JA 1EJ0A 4LI0A 3YASA 2VJKA 3E0XA 5LYJF 2FN4A 3FSEA 4DUPA 1ESNA 1AUVA 5JHGB 4KREA 1DKRA 4KJZA 4YP6A 2GNOA 3SVTA 4DJTA 3DCYA 7MDHA 1J00A 2HK7A 4QLOA 1SXQA 1FQWA 2W2XA 3GT7A 3TD2A 1S8AA 3OOHA 3WL5A 3NDRA 1HFJA 3GFQA 3HCEA 1HQCA 3F97A 4INZA 5DW0A 4C0AC 2XBUA 3BMNB 4B3IA 5C52B 4XLZA 2N9UA 2P77A 3FI9A 4JNCA 1XX6A 3I4FA 4QTXA 5DYNA 2HNAA 2Y1XA 1P4RA 2WHYA 4LSZA 2HA6A 1P9WA 5KO2A 3G59A 3OZSA 4MWGA 5C3UA 2ZSIA 2IU3A 1SXGA 3D64A 3LUJA 2FNAA 3M4NA 3NNNA 4IIGA 4RZIA 1T6YA 3L06A 4R2LA 4XGQA 2H4YA 4E5KA 1P2VA 4EPWA 2ZROA 1GNVA 3D6TB 3TIFA 1ESCA 1T2CA 1JA9A 1KYXA 1T8WA 4FIZA 3BWYA 3KSRA 4N0DA 4NZMA 3E7WA 4PLPA 3SOPA 4E5MA 4ABTA 1EUYA 2FJUA 4P2GA 1SK9A 5ICEA 4B87A 2O8DA 3X1KA 1UC5B 1X8LA 2PWBA 1OLUB 3C8UA 1QCDA 3IOMA 4WZBA 4F06A 3U17A 4OGFA 1YQXA 1JEYA 2H00A 1PI3A 4XEUA 3TBHA 5JVDA 3IEVA 5EPOA 3T4XA 5L3SA 1YS2X 1TEVA 4R2XA 5F7JA 4WINA 5TNXA 2NTNA 4Q1CA 4YWJA 1R3UA 1NT2A 3P97A 3S7ZA 1RPTA 4GSYA 3IBGA 4J1TC 1XZ8A 1E2LA 1N5RA 2GVZC 3G89A 3PDIA 4Q4HA 3I6BA 4RH0A 1OWPA 1RRFA 2W0MA 1E2BA 1A71A 3M4ZA 4U7GA 4YIHA 2WIFA 4IWNA 2CNNA 1ZU5A 2JF0A 2PUTA 1MD9A 4DCNA 4EEXA 1O08A 2GBPA 4R8MA 3ZI4A 2VP9A 2ORED 1W96A 1HYGA 2H08A 3LGSA 3UHOA 1PQ4A 1PFYA 5HF8A 5JDCC 5IT5A 5KNLA 3UATA 5KYUB 1G5QA 1U0BB 1IN8A 1KO5A 3L4BA 1M34B 1LI5A 5DCUA 4F6CA 3EY4A 1EE1A 4Q47A 3AUUA 1RM3A 1K8XB 2CWDA 4CM9D 3L7DA 1BGWA 4QAJA 3IAS1 4DUZB 4XJTA 2HA0A 3HM2A 3H17A 2YMMA 4R1PA 2JJ2D 1HG0A 3G2IA 4ADSG 4GDMA 2R6HA 2QG9A 3C7KA 3CLUC 3B7WA 3OKPA 4HX5A 1RZRA 1DBSA 1MW8X 6REQA 4ZVRA 4GP9A 1G64A 2VHTA 3VC1A 4HP8A 2D0OB 4Y9DA 3JAWA 2Z2ZA 2G4LA 1QAOA 1ZBQA 4I9GA 5L40A 3UOWA 3QBJA 3WFIA 1PTJA 3FPAA 4BDTA 1DX4A 2W83A 1N7HA 2VDJA 3H87A 4R1OA 5FEUA 4DC9A 1JLKA 1NQUA 5TMDA 2ONZA 3WLSA 2A7XA 3E7DA 3KKPA 1TA9A 2B78A 3LX4A 3I6IA 1F2DA 2GXSA 3L4EA 2FPWA 1RI5A 2HU2A 3FYDA 4XASA 3HJNA 4CIWA 3SNHA 4EKEA 1YR3A 5ELXA 4FR0A 3MRXA 3LPAA 4PIMA 4RKYA 1ISMA 3EYWA 4LCEA 5HIKA 2ZJAA 3I5YA 1G7TA 1I4EB 5JEEA 2J46A 2PKEA 3IQEA 4L07A 1FP4B 2YS7A 1Y6ZA 4B6PA 3AHDA 1GRQA 5JZMA 4PANA 1OHHD 4QSHA 3ZLVA 2HSGA 2VYND 2VL7A 1EVLA 2VNSA 3BE8A 3PJDA 2W6PA 1UR5A 2P6UA 3KL2A 4YN3A 4U9HS 3B7PA 1EHCA 4BNGA 5BRNA 3OLWA 3N2YA 1PLLA 5GADl 1ATIA 3AO0B 5HIJA 4WPGA 1L7NA 1U98A 1RS0A 2VF2A 1JZSA 1GG2A 3VDQA 1PK9A 3UMJA 5H82A 1RHKA 4P53A 4DV7B 2IIBA 2CHFA 3DFKA 4IZOA 1NVDA 3EA0A 4U2GA 2OYCA 3UT6A 2NP7A 1K9SA 4ZCTA 3NO4A 4QUDA 1QNFA 2MMGA 4GR9A 2VNJA 1QRRA 4DSTA 1QZUA 5ALGA 4HZUB 2W6JD 3HY4A 2FSVA 4QEDA 2XE6A 3GJSA 4LEIA 3HG7A 1U1GA 4GX2A 3TB4A 2C00A 2WR8A 3OX4A 3PUHA 4WERA 3ZWQA 1HNNA 2OILA 2W58A 4KDEA 1Z26A 4E51A 1HDIA 5E3JA 3B1KA 4V0ME 4DSAA 3P2JA 3WWCA 2O8FB 1YHYA 4TKUB 3EASA 1QGDA 4J9VA 3G17A 1SHTX 4TRJA 5K3AA 3W8DA 2EP7A 5CIYA 2PL1A 2H9YA 2AH5A 3OE5A 3JARA 3HN2A 3PQ3A 2HA5A 4DAOA 2YQ4A 4U0KA 1AURA 2ZUCA 3KKNA 3LS2A 3I76A 1QXSA 1SRQA 2D0IA 4EMBA 1PVVA 4ND8A 2Z9CA 4F9TA 4YLYA 3KSDO 4TWJA 3ACCA 4C06A 4E2ZA 4CDGA 2HPZA 2O3SA 2C98A 3D6AA 2AK3A 5FWYA 1XTPA 5TMBA 1FU8A 1EFVB 1PR6A 3IDSA 5K6AC 1H4VB 5CX1B 2A58A 4DUGD 2AFHE 2OFPA 1V3UA 2OXEA 1VE6A 2QBYB 2QB5A 2X58A 3ZWMA 1FXSA 1KNQA 3ZY6A 3DTVD 4L6AA 1V25A 3MINA 4Z99A 5T41A 4ZO7A 3RVBA 3HU2A 3GCWA 2HT6A 2AF3C 2JAPA 4Y7CA 2VYVA 4WK2B 3V1LA 3X1XA 5TIIA 3B53X 2FMIA 1NUAA 3D7MA 1X1QA 4YLEA 4AJ9A 2VBGA 2XX3A 2R25B 3FNQA 3PRHA 1DJNA 1PJQA 3OX1A 1U2SA 5EIBC 4AB1A 1R18A 1ZAKA 3PIRA 4OFXA 1OPXA 3ORQA 3BWXA 2BC9A 3AB8A 5E8RA 4WESA 1RWVA 1V3TA 1NLFA 1SVKA 3UCFA 1JEAA 1NVBA 1Q74A 4J1NA 4N1AA 1BMQA 2XNJA 4GFDA 4D81A 4YMHA 2FF7A 3AKDA 3N70A 2QGFA 1U7WA 5JZ9A 4KZKA 4DNPA 4AKSA 5LM3A 3PD0A 5K05A 2I22A 5IUNC 4LJ6A 3MB8A 4B84A 1M1YA 2X6RA 4X84A 1CD5A 2GEJA 2GT1A 2DLCX 2DFKB 4MR7B 5A0TA 3E3MA 2XY4A 3CLTD 4ACBA 2A59A 2RHJA 2G28A 2XQJA 2HJWA 3JQFA 4KNWA 5CVDA 2C59A 5U9CA 2F59A 3HRHA 1J0DA 2FUKA 2H1HA 5AVJA 1AMUA 1A27A 3UHPA 4BRZA 4YLGA 1PE0A 4Q66C 1Z6PA 1UDWA 4B81A 2VZ9A 8ADHA 1CRPA 3VO8A 2O48X 2V03A 4B6GA 4ZV7A 2XKKA 5HGJA 1SBIA 4M86A 5IVHA 1X3LA 4Y6GB 4LSMA 1ZRNA 1DEOA 4B7CA 3UBTA 3T0FA 4PAOA 1V1MA 1I3NA 2QJTA 2GM5A 3AY6A 3BF7A 1M0SA 3LUDA 4K6FA 1W76A 2G1JA 2IEIA 5HHTA 5A9TA 3OPYI 2FSFA 3Q7TA 3ZTTA 4WK0B 3LX8A 1U3WA 4CLDA 5M3BA 2WZCA 3ZDYB 5C8YB 2UYCA 5I4BA 2UXCB 2BUCA 1NI3A 4LY0A 3HB9A 1C9KA 5I51A 3PUIA 2BL4A 2FSIA 3OE7D 4Q16A 4D8XA 3NHPA 2O1SA 4P22A 5FEMA 3RC9A 3TVDA 4D5EA 4TL7A 1ZCZA 4MVJA 4DIOA 3QMWA 1H1TA 1XD9A 4H0CA 4JDPA 1TCAA 1N2IA 2V7BA 4GXNA 1VHJA 4REOA 3WLAA 2VH5R 3AYXB 4L27A 3R74A 1WB5A 1THMA 3WL3A 3UYLA 4EDHA 4KVAA 5EHGA 3GMSA 5DKFA 2FVXA 4PZ0A 3ST7A 2J9FA 5JNTA 3ROGA 3L40A 1TUBB 3GGPA 4AJHA 2GAOA 4H0FA 5KWSA 1KI1A 5ESXA 2RH8A 4RZ2A 4G0YA 4RIEA 3REFA 4X3CA 3KJHA 1SULA 3QVGB 2FB9A 1J7KA 5EHXA 2YJTD 1AKEA 2VDPB 3LCMA 4BO8A 3KVOA 4B7AA 4BLWA 3OG9A 4Q93A 5LQRA 2Q5IA 1U2RA 3KR2A 2VDMB 3HFJA 1A69A 1IDOA 1EFKA 1ZD1A 2OAGA 4DPLA 7REQA 5JBQA 1MN6A 3HSKA 5BQXA 2JFVA 5EMMA 1GOTA 1XKQA 3EMVA 4Q82A 3GRAA 4A0HA 4MS3B 5ALPA 3HK2A 3R76A 1CDEA 1X7DA 3I45A 4CTMA 1ISHA 4FYXA 1KBOA 2APJA 4OXXA 4FYIA 1H0KA 4KWIA 4V0QA 1OILA 4FOSA 4IOLA 5E2AA 3H6GA 1Z2DA 4MQEA 3D7KA 5D00A 1UADA 2FZWA 3NALA 3SHQA 2C4UA 1IEQA 1GPYA 1DQYA 2CUTA 3Q8LA 3HS3A 4OFZA 1BDBA 4GI3A 2AOTA 4LQ4A 5EMHA 3WGHA 4HB2A 5A03A 2WWIA 2XWSA 2XQFA 1L1FA 4JT2A 3UV6A 2CXUA 2XTMA 3MLBA 1JKJA 5BYKA 4ID3A 1IB0A 3NHAA 2XNDD 2GN1A 1VGRA 4RVOA 2E5LB 2FDCA 4P0PB 3RH0A 3DOCA 2ZJOA 4D6YA 1L4KA 1N0VC 2VK2A 2YY5A 3GPIA 4G4SP 4RV9A 2LIVA 4DDKA 1JG1A 2XOKA 1JI3A 5ABPA 1ZO8A 1V6AA 4YP7A 1R8SA 1DFHA 3SYTA 3WISA 4MULA 3SIXA 1TVKA 2QN1A 4TS4A 5DLPA 5ED0A 2EJWA 2GCEA 4NONA 3FVTA 1SPXA 2I91A 3U3MA 4HZGA 1XPJA 1QHHB 2X5XA 2ZVPX 3AIMA 2Z1MA 4JVMA 4QL3A 4A26A 4ZT5A 3R7SA 4AD8A 4QOSA 3INGA 1I3CA 1NLZA 1X1TA 5JCJD 5JFGA 3OHSX 1F0YA 4TYQA 5F64A 3I4LA 2VHZA 3GDGA 4JEUA 4M8LA 1VLZA 1YCDA 2FY8A 2ZJ8A 5FL7A 4C21A 4FFRA 3A9VA 2QM7A 1YK0A 3OKAA 2B37A 1QR6A 2FWPA 1JJBA 2X23A 1MQ8B 3A6JA 1TF7A 3GLHE 4KSCA 2OQ2A 3FDJA 5FQNA 1A3CA 2C42A 3A26A 1EJBA 4LDAA 3ZCXA 2DBYA 2ADOA 1Y3AA 3BB1A 3ILYA 4AY3A 5JDIA 5KTOA 1Y5RA 4BQFA 1ZJWA 4XUCA 3GW8A 5BMVA 2GF2A 4G26A 2G9NA 1N92A 1CQXA 3DMHA 3F6CA 3ZV4A 2ZE7A 3LXRA 3QHPA 2D1TA 3GLHB 4MW9A 3IKJA 5EUCA 4OYHA 2W2NA 3OJOA 3OY7A 1J99A 1YBAA 4OXRA 1JHAA 3KFXA 4Q3CA 2Z43A 1NF9A 3U19A 4Z53A 1AUQA 1XHEA 2A1TR 4YCLA 2HBRA 4RGVA 1RE0A 2QQFA 2BR5A 3WRVA 3GFPA 3ZJYA 2BE9A 2F1KA 1A2KC 2H92A 4BQEA 4URWR 3BF8A 2QNRA 3CNNA 2C0PA 2XMGA 2O8NA 3KZNA 1NN1A 3PPXA 1MZPA 4HEA1 2WVHA 4K9RA 2QENA 3DLIA 1YZQA 1CF2O 2XRYA 1BVRA 1JWLA 1OI4A 3ZCRA 3QH4A 1CFJA 1U8ZA 2E87A 1KY2A 2HT1A 2DAPA 3ZHVA 4YJGA 2R66A 5KB3A 2ZS7A 2HREA 2NQ8A 1M5TA 1XU4A 1A50B 2E0IA 4IKOA 1XIVA 5GJCA 4WZBE 4ZOLF 1CIPA 2W2MA 3H11A 1E0KA 5F78A 3WB9A 1L5ZA 2ZUSA 3GNLA 3HKEA 4RJIA 2M6LA 2FUNB 4BTEA 2R9VA 3AB3A 2VJBA 4BMNA 4NOJA 5I9MA 1BKDR 1G66A 3PD7A 2VSFA 4MRPA 1RYHA 3N2GB 5L4LA 4XSVA 5DOZA 2VDOB 2ID9A 4UAGA 3GV0A 2CVPA 2ZAMA 2QJRA 2OHXA 1U11A 4RXMA 4XQCA 1E61A 2ZQ5A 1CVIA 2ZJ1A 2OBXA 2VPTA 2DFTA 3N0WA 2HIAA 3VKFA 4OKIA 1T3SA 1W59A 1Z07A 1DARA 3ZK8A 4ZAVA 4DY6A 4KPYA 3KDAA 1ZGZA 1ZMRA 2GEVA 3IO3A 3HVIA 3IVXA 3ZR4B 4DSUA 5FBZA 2A0UA 3W77A 2ECOA 3KQKA 1G2IA 2QTWB 3R20A 2WFMA 4TUYA 3I2GA 1U02A 3L0IB 3R0IA 5A4MS 5JZBA 4WAUA 1HZJA 1X74A 2FSPA 1Z4JA 3A05A 3NI2A 4TKZA 4UQOA 4Q7KA 4BFZA 1EE9A 4PW0A 5BUSA 1IQRA 4BECA 3RUIA 4CG0A 4OLAA 5JCZA 5HMLA 2QSUA 3G5LA 2WWVD 2ZDGA 3WLOA 1WCIA 3P4YA 2F9MA 3SAJA 4L5JA 1CR6A 4TV9F 2HHLA 3FTEA 3KJFA 4MPJA 2WHEA 4OL0A 4RAOA 4YV7A 4W8OA 1LX6A 2WT8A 4FGLA 5SZHB 5E9WA 1F8XA 5ALEA 3TK1A 2RK6A 3TUJC 4Y1GA 1VIMA 3HDYA 1KO1A 3FTPA 2P27A 3H16A 3IB3A 4UHDA 5C0OE 4Q37A 3IR7A 4MDEA 5DTRA 1Y6RA 4BLTA 2AA3A 2BV3A 3EYAA 1ZNQO 5DSXA 3PXXA 1PR4A 2GN6A 3EPPA 3P9SA 4QTYA 2CL5A 4ZVLA 3ZW9A 4ZQHA 5FJIA 2Y1WA 4S1PA 5HKKA 4F11A 3STXA 1VKHA 4QGGA 4D26A 4JIGA 1VBNA 1JHQA 1XALA 1QQ5A 1ADGA 3DAOA 3HEBA 4KN9S 3X2SA 1QG6A 4QOJA 2CB9A 2P4SA 3T12A 2JLRA 1JWBB 3IKMB 3OIGA 1R2QA 4C04A 4ZOLA 2GBGA 5BMOA 1G38A 3KYJB 3GNSA 3VH4A 3L1IA 5F2EA 1JR6A 3TTSA 1JPJA 2PU5A 2QQGA 4M0EA 4BJ3A 2EZTA 5JMWA 1FFYA 1BO6A 2VT6A 4HRVA 2ET6A 1Z0KA 1BU8A 2QL7A 1O58A 3VHRA 3O73A 2VYFA 3TOZA 3N74A 3SC2A 1GTL1 1IY2A 1HDOA 4CG1A 1GLVA 1KYTA 5JSKA 3KNZA 3VZBA 2R84A 1YZLA 4F3CA 4DXHA 2BFPA 1BE8A 1SC4A 2PCLA 3IEUA 4YI5A 2DU8A 3GLTA 1CUWA 4G5SA 4Y98A 5CX4A 1YZHA 3DOHA 1H9CA 1ZMTA 2P5YA 3HI4A 3K05A 2QWXA 5DTJA 1UFKA 1RADA 1JAXA 2OT3B 1N7GA 1CUHA 4MVJE 3GLRA 3P26A 4FZVA 4PC3A 4GM0A 3CKKA 4PSDA 4RSHA 4X3OA 4J0JA 1Q1AA 2BGGA 1Y63A 2AIRA 3FMIA 2Q41A 1EIWA 4EVSA 2BFDB 4Q9LA 3G8AA 4F2WA 4JV5B 3CB4A 2AUNA 2ZWAA 4KRGA 2AQKA 2XI4A 5EESA 3DL4A 3I8SA 4NXMB 4A8JA 2FPLA 5DHAA 4HV4A 5EVCA 3LJKA 5IUJC 3HXOA 2WRZA 3EQZA 3OCWA 1M73E 2N46A 5EJGA 4E7OA 2AG0A 3EZNA 2WYIA 3V46A 4DS3A 3BWVA 4LF8B 4E03A 1SD5A 1MT0A 3SX0A 2D1FA 3L8ZA 4TV8B 2BZGA 2UZ1B 2WSLA 1QDEA 4GYYA 2A35A 4QOIA 4YI3A 4O2BA 4HD8A 4RELA 2Q3EA 1Q3TA 2XXAA 1ZIPA 4B9AA 4AZTA 1N77A 4W8HA 1CY6A 3SHOA 2OOSA 3GZ4A 4MVJM 4KYTA 3T7AA 3ZDZB 1JU9A 2GBLC 1X1RA 1FSSA 1Z5UA 2YY6A 3SIPA 3WB2A 3AH8A 4JQOA 3AUAA 1DWPA 2GZ1A 2O0LA 4R1SA 3A6DA 2WTEA 3EXAA 1D9XA 4OBWA 4PG8A 4CM4A 2OFXA 1WD7A 1AN0A 4O4HA 4PZPA 4YYEA 4DEYA 5AW3A 2IYZA 1NP3A 1MHTA 1SXJB 5JSYA 5IW8A 3AXSA 3L0CA 4JP1A 4UU8A 5KYGA 5M29A 2ZQZA 3I1JA 1VRVA 4FNGA 4BTLA 3AFNA 3HCPA 1UP4A 2GPNA 3BE4A 3AIKA 3Q5GA 4MPPA 3RFXA 2O5EA 1QH8A 5A4IS 5FI5A 3CLHA 2WC1A 3Q11A 3RYHB 2O2XA 4PINA 3RAPR 2QNIA 5G1PA 5KYNA 3R7FA 3W6UA 3R3YA 3LAWA 3G2PA 2BSQA 4JX9A 1P1BA 1XL1A 1C1DA 3CUEF 3HP7A 4EW1A 4G5OA 3ND5A 3E84A 4RS3A 2NV2B 2R6ZA 2ZIEA 3ZJ4A 2ZETA 3NRJA 1RRMA 2NXJA 1NUUA 4TTIA 1ZYUA 3AZQA 2ZULA 2CHUA 1F8FA 2XNDA 3PIDA 1Y3DE 4Y2XA 5LCXA 3T7SA 4BX0A 3K8ZA 4CMIA 2CV1A 2ZUEA 5K8VA 1LZKA 3M6UA 2G63A 3AUTA 4INOA 2R68A 1ICIA 2I6TA 1WF3A 3KQLA 2F8LA 1GUAA 4KRXA 5F1YA 1C30A 1S9DA 4BGIA 1IVYA 2FFRA 1JILA 2AG5A 3DTYA 4M89A 5JNWA 4JUAA 1CXZA 2PYDA 4PZZA 2NVUB 1I7DA 2X3UA 2BCJQ 3ND7A 3OUTA 4XTCS 3ZU4A 1GDTA 3CBGA 3SQMA 3K5PA 5FF9A 3SF8A 4C7JA 3R5XA 4TYPA 1H4QA 3HLTA 5KAMA 1AXRA 1MABA 4FZRA 5KYWB 2FFAA 3T1YB 4NCIA 3FVQA 1FDOA 2P91A 1NW8A 4ZZ3A 5IDWA 5AVZA 4Z9AA 4ZYTA 3L6UA 4XA8A 2W8BA 5AHOA 2XYPA 5AJHA 1PR2A 2JFPA 2DFPA 4HFJA 4MV0A 3H8WA 4CL8A 4AIRA 4FDLA 1M33A 2WOJA 1GSHA 2C77A 5B3JA 3VKVA 5JPDA 1TK9A 4RACA 1UM9B 2OBFA 6ABPA 3PSHA 3KV1A 3TR5A 4B0PA 2ICAA 2ZB3A 4JBGA 4UNSA 4ZC8A 1TO6A 4GGMX 4DIEA 4YRMA 5FORA 3CX7A 4QBFA 4EHNA 3LQ1A 3LHIA 2QJFA 2W6JA 2I4RA 1U2EA 5D6NA 5B55A 3GBPA 3Q3JB 4OX9B 3AVXA 3VTFA 1GPJA 3KEMA 3DL7A 5KYXB 4DA7A 4AMYA 4QJ3A 4M76B 1O4WA 3HXMA 3UPUA 1EFVA 1EX1A 1JYEA 4PLCA 4FDVA 1HSZA 3BKWA 1PFUA 2YFQA 1JIUA 3NFYA 3PB3A 4K8OA 4Z4QA 2MSEB 4F45A 3A1EA 3QXSA 4J7AA 4HNVA 1QO7A 1SBNE 2X5OA 3RJ5A 4IMPA 3S70A 1X2BA 8OHMA 4OX9Y 1Y8ZA 2B69A 1SY7A 3TXYA 3CW9A 1RQ2A 3ORYA 3PNKA 2C5EA 1AKWA 2PRJA 3I12A 1UFRA 4KMRA 4R2WA 1MX5A 2R8BA 3S68A 3TZEA 4D4MA 3A58B 5JSUA 5IT9A 1C14A 5CD9A 1IOWA 2GK7A 2IJGX 3CIFA 4LY3A 5E6RB 4BCDA 1ZAYA 1XJ0A 2ZB7A 3GL9A 3GY0A 1HT2E 1M8PA 3EVDA 1H6CA 4NCBA 5IAAA 2CVZA 3KD3A 2XPCA 2IY9A 1SXJA 4OM7A 1UMDB 1EUZA 4OH7A 4RY8A 3N5KA 2QTLA 5T8KC 4X1OA 1SC9A 3AUYA 4RD2A 5DTMA 2WTXA 4H3HB 2GK3A 4R2JA 1PEDA 1N6NA 1TRHA 3VU9B 2GM4A 1G5FA 3BSSA 3JWHA 3P4XA 1USVA 5HKKD 4LHSA 3TOVA 1M2WA 2V65A 3SBDA 3DBHA 4EB3A 4YMIA 4POOA 1XTUA 4OHCA 2IYWA 2WUWE 1U7DA 4EA7A 4NAHA 1GQQA 3RVNA 2FOIA 4ISCA 4P3KA 1RYEA 4DMLA 4EY7A 2ZJ3A 3PC8C 3TI9A 5COAA 2PCJA 1NYLA 4LJLA 3QSYA 1LBEA 2CJWA 1YZUA 2PIAA 3L7NA 1A8HA 2W2LD 3VGPA 3VUEA 4NFLA 5BT8A 1YFJA 5EGNA 1FDRA 3JYOA 3N75A 2J3QA 2VBIA 3JAKB 3JD0A 5GOZA 5JWHA 5I7WA 1AOXA 2VRWA 4Q1EA 1EVZA 1R9MA 3KCNA 4ZK2A 3K2IA 2XDYA 4CKWB 1UDBA 2EOAA 3ZLTA 4X7PA 2CNLA 3DE5X 3KAPA 4RV4A 2BMWA 2F2TA 3FDXA 2NO1A 3T06B 3BRWD 4IDEA 1UQRA 5JNSA 1TI7A 4XD7A 5C51B 1NKSA 1R5NA 3JQ6A 3HKDB 4BTVA 3K4QA 1R9GA 3INYA 5HFJA 3RJMA 4XDYA 3WS7A 2FPIB 1JIIA 4L2IB 1H2RS 3Q7RA 2BEUA 1ODIA 3T5CA 4FZ5A 3P9CA 3KX2A 3P8ZA 4H6WA 5A71A 4YAEA 3EAGA 4TWAA 4ZI7B 1R50A 3R5FA 5REQB 1ISRA 1N2XA 3CSDA 4W1RA 1DSSG 1FPQA 1VFPA 3PWZA 5G41A 4D9FA 4HUTA 1GZ3A 3U26A 3UAYA 2IKSA 2JAQA 1GNSA 1GL6A 1IOLA 2ZB2A 3L77A 3KQUA 3CJTA 3Q4GA 3PXGA 5TR9A 1GZ5A 4DA9A 2VHQA 3Q2IA 1L5GB 4BZZA 2INGX 3ZLUA 2QXUA 4IRUB 4H7HA 5LLDA 2Q5JA 1R64A 4MYDA 1UP6A 4WXRA 1XTRA 2NU9B 1MVLA 2UUBB 1DT5A 4P36A 3ONWA 3SQWA 3KQYA 2ZWVA 3A4VA 1Y1TA 1QGUB 3INTA 2VUSA 1HSOA 1J0CA 1C8KA 2HADA 3MCZA 3KYIB 3NHSA 2WAMA 5KHLB 1NMYA 1LWNA 2O1WA 4MQ5A 4O1IA 1T8PA 4A2WA 1YOVA 2D74A 1YCHA 2Y6VA 2RGDA 1NVXQ 2JFHA 3CQ9A 1ENPA 1US8B 4ISBA 3RK4A 3OJEA 1G6KA 2PAAA 1IRIA 3TUIC 5IJ9B 4RF2A 1T2EA 1T5TA 4BNLA 4Q7QA 3SHTA 4CM7A 2RI1A 4MV8A 3RAGA 4HDKB 2ZBRA 2ZDQA 5A4AA 1P39A 5HQ3A 1SIUA 1QUFA 3IXQA 2JH9A 2HIMA 4LZWA 4EPVA 4KE9A 5I5EA 4UM9B 1OAAA 2DBZA 2G6BA 1QKKA 2WKRA 5AKKA 1M0WA 4G81A 1SOAA 4YTEA 2B6NA 2X9VA 4BN5A 1AS2A 2GI4A 2G8LA 3T9FA 3LY7A 3DHEA 5CTJA 4D45A 2ZW9A 2R11A 3WMRA 1JRLA 1VKJA 4A6EA 1TZJA 2H1SA 4LZNA 3DEHA 4IG9A 3TRIA 1XMPA 2VH2A 1JLLA 1CZNA 1M7BA 2H3EA 4H7FA 2PX4A 1Z82A 4KDFA 4OP1A 1T4CB 2DSTA 5HOQA 3IE1A 3K2QA 4JWKA 2GPJA 4P7JA 4ZAZA 3SE7A 1Z08A 4TT8A 4IJVA 2PH1A 1QK5A 5HZGA 2BCEA 2ZSBA 2YICA 4MVJH 5DCLA 2QMHA 3U4MA 1K2WA 3LSYA 1BN6A 2CE7A 4Y0VA 1GZUA 4HH4A 4TS9A 5TGTA 4ME6A 4II2A 3SBXA 4Q0MA 1KNXA 3H97A 2VH1A 4RIFA 5CEFA 1F5NA 4PX3A 1OGJA 5ADVA 3QE3A 5ECGC 2DFLA 4GBMA 2I62A 1JH9A 4FGUA 3O8DA 3KXIA 4M1TA 2C4TA 2VF8A 1F9EA 5EKDA 4J3JA 3RYFB 2BFBA 2YIJA 5IK2D 1V3QE 5DISB 2Q5LA 1JLRA 2I7DA 5H81A 4BMOB 1DIAA 4AFNA 1PGPA 2JFBA 5FPPA 4CI0B 1OH6A 4ENPA 2BMDA 4U2DA 1F48A 4XUEA 4B6QA 1ES9A 4RFLA 4R40A 2P90A 4X1YB 2VHWA 1CCWA 4CPDA 3LL7A 5KMGB 1NJ5A 1U1EA 4RA6A 5JAQA 1X19A 3V8BA 4ESHA 5HTKA 1F14A 4BQPA 4ZDIA 3GX1A 1FK8A 1E2PA 1CNEA 3EH1A 2QLLA 1BTOA 3MBKA 4YRRA 1VHQA 1VKOA 1M6HA 1Z22A 3I6QA 4F5ZA 2PZFA 1DS6A 1RQPA 1VLVA 2BHTA 2BZSA 2JBAA 3D6VA 4Q7MB 5I9SA 2VSXA 3L9WA 4RORA 2GCIA 1LPNA 1ZK4A 2V6JA 3LQRA 4QTUB 3DEYX 3ILXA 4UEJA 4GF5A 3O94A 4YRDA 3H1BA 1NVMB 3I3SR 1ZUNB 3T3EA 3LDFA 4G4GA 4YFVA 2VTVA 5EXDA 4KR7A 1IEWA 1ZSYA 1SN7A 1P5ZB 1DEAA 1SWVA 2ZJFA 4MQLA 1WTAA 3EGXB 5BOSB 4DABA 3TG2A 4YCAA 2YNMA 3L04A 1PEKE 3A2KA 5IAGA 3DVAB 1U9ZA 1NKVA 3K20A 1QYIA 2CZCA 4FS3A 3EGIA 4EO7A 3Q1KA 1XEWY 5AFSA 1X1SA 1MAAA 3GFSA 3E9CA 4KFRA 2QXYA 1JKJB 1NMZA 1UFOA 1ZMBA 3I64A 3E8XA 1B4DA 2C2OA 1U0OC 4N0MA 4F91B 3UT5B 2P0EA 4LDNA 3ENZA 4II3A 2J3LA 3QUQA 5F2OA 3L8MA 3TBKA 1K0FA 5CD1A 2P6PA 3ZXXA 4MAAA 5KSZA 1ACLA 3TZQA 1VDZA 3OT5A 3QWFA 2F17A 2H3HA 2P2DA 1JAHA 3A6HA 4HDKA 5FNVA 2O8EA 3DWIA 3PQ4A 3TKAA 1OE0A 2P69A 1EXMA 2R8RA 4GWGA 5EJ5A 3KT6A 4A23A 4YJKA 2AFVA 1ZVQA 1KERA 1E6MA 4NFYA 4OD0A 2Y8EA 1DAHA 3C16C 1YHNA 3D3NA 4IH4A 2VI5A 5IKOA 3T9DA 2O20A 5ITWA 3ETGA 5I5GA 4LZZA 5LQSA 2J07A 2V1XA 2YR0A 2V7PA 3AEUB 5C9ZA 4K5QA 3RVKA 1WHSB 5DX1A 3WIOA 4HVLA 2R96A 1M0TA 1P0MA 2BUAA 3R44A 4O4HB 4QDXA 2IWRA 4PTZA 4FFMA 2R8PA 3WYFA 2VP0A 5CFQA 1FMJA 4JVNA 3ZWXA 2WQZA 2UV8A 1UWKA 3L5OA 1NI4A 5JASA 5IULC 4AM8A 1W4CA 4DG5A 1V11A 5LWHA 3RADC 1A5ZA 2ACEA 4KXVA 4C6RA 1FRFS 1U0JA 4DLAA 4BS9A 2JH3A 5C7LO 1MGOA 1TAUA 4DLSA 2WMNB 3ME5A 2ZZNA 4DRXA 3WVNA 2ZG6A 1ZISA 2OD9A 2HMYB 3KFLA 1Z4NA 2CMFA 1QIIA 3MG9A 4HNGA 3STWA 4A3SA 4ER6A 3GLHA 3N2KA 3A2NA 4TUYB 2VJDA 3NDBB 4RFSA 1KAGA 1KVUA 2F8TA 3GEPA 1DINA 1SXJE 3C98A 1D09A 4XXHA 4BMCA 2C7QA 3WKEA 3OLXA 2LP4Y 4LTMA 1F0NA 3IAFA 4YROA 4IIBA 5HIAA 1J21A 2EL7A 1N6PA 1YS6A 3KDPA 3HA5A 3X44A 5E3HA 5K03A 7MHTA 3RTBA 2A9PA 4K9OA 4BV8A 3HL0A 3LUAA 5E1BA 4RTQA 4AZSA 4N41A 1EFAA 4XJSA 1ECFA 1MAHA 2OCGA 4ZCIA 2GSWA 3JQ9C 3PVZA 4Y67A 4D99A 2XMZA 5C7IO 1E89A 2AN9A 1KMQA 4XOUA 1MB0A 2W6OA 1BJKA 1F2TB 2RKOA 3RARA 2I6SA 5C5EA 5HJ7A 3GJ8A 3QMPA 2LVBA 4FS8A 2PXHA 3IESA 4U00A 4F6RA 1ZXBA 3PT5A 3AV0B 3LLSA 1Z45A 2BFNA 1RMYA 3SQDA 5ALMA 1UM8A 2I55A 3GZNA 3F6YA 2LBPA 4DMHA 2H06A 5BP7A 1MH1A 4NS1A 1R37A 3QKUA 1ZUWA 1FRZA 4EG4A 3KALA 1T6XA 2FPUA 2OFWA 3KKZA 3LHFA 2WYWA 3PUYA 4I8XA 4IOKA 4KHZA 5JS6A 3RKRA 5K9ZA 4JUDX 1SUPA 1UBSB 3ZD6A 3TQTA 1EUDB 3C0KA 5F3WB 1BS2A 3LZDA 1NVFA 3A6PC 2JLXA 1BEUB 1QE0A 4HPWA 5DGTA 4CL3A 1KU0A 1Q6YA 3ZYZA 3H6HA 1JNXX 1BH2A 1SHKA 4KFTA 2RDMA 4PX5A 3KHUA 3GLIB 4QFCA 2AZTA 1WZEA 3HJCA 4D8VA 3H2JA 2RGAA 1Z7YA 2CD7A 2CE2X 2EX0A 3TQIA 4R2KA 4HF7A 1CY0A 4K2AA 5DP1A 4NXNB 3F73A 1YR7A 5DK6A 4BBZA 4HNSA 1TUIA 4K6KA 4PQYA 2FSGA 4NYJQ 1T0IA 2W93A 4J8PA 5BPHA 2C4MA 4XVUA 1DBVO 1D2EA 3H1AA 5BNIA 4UBOA 2WE7A 1JB9A 4QFDA 1RQXA 1Y9DA 2YV4A 4DMRA 4JJIA 4Y6PA 1VMEA 3FB1A 1ZH8A 3PJEA 4R2IA 2OYRA 1Q3KA 5G0TA 4CM1A 5I9NA 1PGNA 2G1AA 3PEFA 4KWEA 5LJIA 1OAOA 5HS6A 4P92A 2E55A 3GBVA 4FUTA 3ASVA 1K08A 2FZ4A 2GKGA 2PKWA 1ZGHA 3W9UA 4NENB 4I9UA 2VPZA 1DFGA 3ACDA 3HCFA 3EXG1 3SZRA 2HCRA 2MJLA 2PU7A 1T0BA 2FWRA 3RUHA 2WYHA 1CULC 1U7PA 1SZPA 2BIFA 2J9FB 1GUZA 2XCUA 4GLBA 3RSCA 3UHAA 2VF4X 2J9ZB 2BMAA 4JJ7A 4JX8A 2EFJA 4YRAA 1IUPA 4PR3A 5AJVB 4ZV4A 1N6KA 3GP8A 4UZFA 2GASA 4AMVA 3ZDAA 1Q83A 1UZAA 1Z35A 2QZJA 3R3XA 5KTPA 1LBIA 4PHTA 2KQUA 4ZOLB 4B4WA 2JLYA 1EESA 1JTFA 3NDJA 2P41A 3I39X 2AJBA 1RVV1 3QWHA 1L1QA 3MN1A 4BP9A 2FW1A 3LECA 3VOBA 4E2XA 4I1SA 1S01A 2C8JA 4X94A 1OYWA 1B16A 1ZS9A 3O8NA 4PAQA 3U13A 2XITA 3I9JA 1WEHA 4Q7LA 4GOXA 4E11A 1QK3A 1YU6A 2VPPA 3KWJA 1N57A 1HE8B 3G49A 4Q24A 1GZ7A 1HFEL 2QZ9A 3B1ZA 3G88A 4MV3A 1WAMA 1LLUA 2C7GA 3R75A 3NR2A 3Q2OA 1GFSA 4U2FA 5FBWB 3H05A 3VNRA 1WQ3A 3DAPA 4KDRA 4BIMA 1RYNA 2W6IA 3IAS6 3KUCA 2G9ZA 1VXOA 2K87A 2PZEA 4BB6A 2EERA 3M2PA 4FCWA 4BX2A 4D3SA 3R7BA 1XHFA 3M6LA 5A7FA 4KXUA 3I9V1 2PQ0A 3V97A 1V8OA 4TZ6A 5G1NA 4RQBA 2NX2A 4EBFA 3QEOA 4L5AA 3G0BA 3T95A 1RSZA 2VWQA 1P0IA 4P4NA 1Z4LA 4C14A 1W47A 3EGDA 4XJVA 5HA5A 3UMFA 1DBRA 4R0VA 5E3IA 4OBEA 1T29A 2JIBA 3LLMA 1DWQA 5KHAA 2D06A 2F3QA 1KOLA 4BO5A 4EFNA 2O54A 4Z1MA 4LX0A 1YASA 2EBWA 3A11A 4BLVA 4IDCA 5JVDB 3GAZA 2PK3A 4P0QB 2VSQA 2LDBA 1ESEA 2YWCA 3QU9A 4PPQA 1O03A 5EP1A 5U4QA 2GRAA 3K1AB 5AK3A 5MHTA 1B14A 1UM9A 4F4JA 3HCCA 5KYWA 1SUSA 4L9WA 4FYWA 4G6ZA 2AOVA 1DQZA 2DUMA 2B5OA 4E21A 4N8DA 1Z73A 4E22A 4G24A 1IBKB 4YT4A 5JR3A 1B6GA 1U0LA 1OJLA 3E3LA 4YA6A 5K6TA 4AUMA 1V5FA 4NJOA 4FOLA 2GPAA 2P2GA 3UQZA 4W9NC 2B36A 1HXHA 1J9ZA 1N5DA 2FPIA 3EIQA 4Y2RA 5ADUS 1EAMA 1EBBA 4JQYA 4WKNA 1SKBA 1WVGA 1YU9A 3OTQA 2BF7A 1MZVA 1NFRA 2PD6A 2BGWA 3RJ9A 4GL2A 5EE1A 4E07A 2E89A 4CE6A 5AK0A 2PXAA 3O21A 5WRFA 5TX7A 3UFXA 4D42A 5EEHA 4DOMA 5AW6A 3MW8A 2EF1A 4HVTA 4Y9SA 4F4UA 1X7WA 1A8PA 3NH9A 4BCBA 1UDCA 2IYOA 3PD1A 4I4CA 1B74A 1WXIA 3OJFA 1ORIA 3U80A 4NBUA 2PRZA 2Z2KA 4C4ZA 1LDNA 1DG1G 4JDUA 1RAFA 5TPZA 3IBCA 3MWEB 1C1XB 2YIVX 3Q3VA 3O75A 5FBQB 3H1EA 4C0JA 4YUWA 1F9AA 2YHUA 1QF6A 1CK4A 5E4FA 2G82A 5IAOA 4RK0A 4AXXA 4DM4A 3MIIA 1W8DA 1VL5A 2RGYA 3FPEA 2XWQA 4G09A 5DU2A 3ZJTA 1DX9A 3PQ8A 3AUKA 2A1TS 3P71T 2HC9A 4IXWA 3J81A 3OT1A 4G85A 5ANRB 3VR2A 4ER3A 1HT3A 2BFBB 2CXPA 3AFMA 3JPYA 3KZXA 1TQ2A 1GNLA 1OLXA 1VKNA 3D6UA 1F8YA 1NOKA 2I1WA 4JJAA 4EY6A 5DHQA 5COBA 2Y2VA 3U16A 1RM4A 3IL2A 4KL8S 1CS0A 5EKUA 4YUYA 1F1JA 5KREA 4GDFA 3PCTA 1BU5A 2EFGA 5A3QA 3EQ6A 4OJKA 4S35A 5K0GA 5JSHA 4KFCA 1CUBA 3NB0A 5BVHB 3OC6A 4YVFA 4MV6A 1ESMA 4JLSA 3QFSA 2AKYA 4I7EA 2RFLA 5EN4A 5HDBB 4DPKA 5KS2A 1GUFA 4OXIA 4Q15A 4WFIA 4S1OA 1L7MA 4YAIA 4UD6A 4X65B 3WOHA 2VJYA 2Q9CA 3HKDA 4GZ3A 1CJKC 2PMCA 4CT0A 4EKYA 2IGBA 1P61B 1WABA 2NYRA 1L9XA 1NQXA 2BKVA 5GONA 3FGNA 1YZGA 2OFFA 3LI2A 4LZJA 1G60A 3OUZA 4XYLA 1E2KA 1KVQA 1V1RB 3MMNA 4QJBA 4CCWA 4YRKA 3USZA 4FXPA 4TM8A 1VHTA 3RRXA 4R1LA 4B83A 2BD0A 1PT6A 3PGVA 4MLPA 1OREA 1SZJG 2OSVA 1WCWA 1X94A 3BB3A 3F3KA 4IHKA 4KV7A 4N3AA 4PZLA 3TDMA 4FJ1A 1QB7A 2K7FA 1Q3HA 4L72A 3ZE2B 4DBLE 1N2EA 1UKVY 4FD2A 4H7DA 4OO3A 4Q4AB 3KYBA 5IWAB 5KWEA 1AV7A 3WRXC 1PTJC 1MB9A 1DLIA 1I5OA 4CTNA 4F0JA 5K8LA 3Q6IA 3AV3A 3RG8A 4CMEA 3NDIA 3SC2B 4U9UA 5FQOA 2Y1GA 1TNDA 1WUJS 4HNAB 4I5EA 3T3HA 4P3XA 3JASB 3JARB 4J0CA 3OF3A 1T8UA 2YRWA 1QGUA 4S0XA 3BXZA 2HK9A 4O29A 4ZT4A 4JLDA 1OH8A 5DO9A 4MVJD 2ZSEA 3STYA 2DEUA 1BX1A 2XGGA 3UJDA 1WP9A 3UWDA 2G17A 4II7A 2ZWMA 1N5MA 3RASA 1XEXB 1HE2A 1W35A 3K8QA 4CU5A 1WW3A 5D8DA 1DIHA 2BKAA 1XD2A 4EB0A 1ISGA 1JJAA 1DFIA 3I0MA 3WNZA 1EDDA 5CB8A 5TMEA 2IUEA 5DBOA 1YC5A 3JSXA 2A1UB 1YZYA 3HFGA 2VC2B 4J0FA 1Z3IX 2HNBA 4OGWA 4D1YA 1LCIA 3AR5A 4MR9A 5CJJA 4M9SA 1NP6A 1NL3A 2X6TA 4RPIA 1HR0B 1UANA 1YL7A 1YAHA 3VAAA 1UXHA 3ITNA 3JATB 3AF0A 3IMKA 1US8A 1JFFA 5LKAA 4GT1A 2RG7A 4ZOBA 5BOVA 2VP2A 4UOEA 5HUHA 3KXPA 1B73A 1RYBA 3HQ4O 4FE4A 2WJPA 5DI3A 3FUVA 3WIDA 1FVOA 4PYIA 5TT0A 3A1DA 3WMEA 3SMVA 1MX1A 3K0AB 2PGLA 4PQEA 1KMNA 1WQ4A 3FMVA 3JU3A 4YDRA 1U6KA 3F6PA 3KSUA 1TUBA 1M3SA 3QELA 2RK3A 3FZQA 3BRQA 2HWUA 3ZCTA 3TR0A 5CFOA 1FP7A 4QYIB 1E9EA 2XWPA 3MJCA 4XARA 3NIDB 2COUA 4CM4B 5CEEA 4G0ZA 1GT91 1XZQA 2N3ZA 5I6DA 4QM7A 5CRIA 1RC8A 1ZGBA 5B37A 2CCKA 1C0EA 2C3OA 3SYMA 5JYCA 2Y66A 4CQMA 3VR1A 3X3HA 4EF5A 1CS4C 1N1DA 3FUXA 1T36A 3E9ZA 3MPUA 5IASA 4AG3A 1A77A 2G0NA 4ZI7A 4RX1A 5BN3B 1DIGA 3WGOA 2HKIA 3K96A 4O2AF 5E8JA 4QT4A 4JZYA 3QUAA 3M82A 1C3JA 4H16A 3FGPA 4I1VA 3ZHCA 1ZK2A 2XGJA 1X13A 2XRMA 1QZZA 3UB3A 1EPUA 3MS4A 1KOFA 1CZUA 1LVUA 2PUBA 1K5PA 4IVNA 3ZDQA 3G0DA 3T3GA 1PT5A 2WVGA 3G5TA 3JD2A 3ANYB 4DT1B 1B1CA 3IIEA 3K3PA 3D6JA 3OQMA 4YY3B 4B4OA 1N9ZA 1ZL0A 4MRAA 2B1JA 3LKZA 4LS3A 1I6MA 5JRDS 1PW7A 4R1QA 4D4GA 4ARVA 1H5NA 2BHLA 2OTCA 2W4QA 1YR1A 3QPVA 4O3MA 4B09A 1ZW6A 3HC7A 3FNRA 1P2FA 4ZVSA 3TLKA 3A4YA 4WA7A 1X80A 3K16A 4EFKA 2DR0A 1DI0A 4XR9A 2BKUA 2EATA 1PYOA 2XYQA 3VR4D 3PNYA 4L75A 1PT8A 5K8JB 3C3XA 3CE9A 1ZVJA 3PXUA 1QPBA 3JYLA 3TEMA 1IHUA 3ZI0A 1GL7A 1T5BA 3WQSB 3N58A 5JNVA 2A1IA 3SQXA 2OZPA 3WLEA 1JBEA 4V1CA 4TLEA 5LWQA 4EF6A 2XTZA 1NQOA 1GPH1 4QOEA 3L05A 4GW3A 3HFSA 2OGTA 4YP0A 4LE0A 1EJ6A 4PPYA 3OVMA 3PHBE 4TKLA 2BM8A 1RI4A 3LWDA 4UZSA 4XFDA 1SC1A 2W71A 1CF4A 4CTKA 2RGUA 3FB4A 1PJBA 4X7BA 3NGLA 4JBNA 1X1DA 3PNQA 4BNXA 2B8EA 4K6OA 2CLFB 2X4LA 4PR0A 5AKGA 3SLRA 5LIRA 2AN3A 3ZK7A 3D4BA 4W5QA 4URZR 4L8FA 5BMVB 1GTVA 2YWRA 3RI3A 1ZGJA 1IEXA 1YGPA 3OTHA 5KYXA 1UBFA 4P4SA 1R9NA 3N7UA 3OPXA 1DKUA 3KR0A 5KYYB 4ZCMA 2OV4A 5BURA 3N59A 2AMYA 1HE4A 4MEBA 1GARA 4AL4A 1S2NA 2XMQA 3MMXA 1YBHA 4QEKA 3ZV3A 3ADDA 1L5HB 2A9KA 4XGRA 5ARDA 1J4AA 2VWPA 1Y5MA 1E1CB 3A7EA 1O8CA 1QH0A 2FXIA 4MGHA 4X9XA 5FL3A 1PP4A 5LA6B 3R5TA 4OA8A 4E4YA 3UMMA 4CF6A 1NR7A 3DJYA 5BW8A 1DE0A 1K8ZB 3ZEAA 4P9NA 3GFVA 2V54A 3LFHA 4ZEVA 3DZFA 4PXYA 4ZRNA 1P8AA 2W6ZA 4EX6A 1AJEA 3E5HA 3K0BA 3RTCA 1I3MA 3PL1A 4ZVMA 4J49A 4IGFA 4QODA 4A7PA 2JK0A 2PSFA 2CLIB 2QL6A 4U7DA 2PVSA 1TVKB 4Z0PA 3U4GA 5A4DA 4V0OA 4YJGB 3TG8A 4QQKA 4W5HA 3TSWA 1TQDA 4CVNA 1KDYA 3RK0A 4C6SA 2XYVA 5C5CA 3KQHA 4HWTA 3LYHA 4N03A 2JVIA 4PG7A 2BF4A 3VM6A 4NCHA 5FAXA 1SEPA 2W6CX 5CB4B 2OM2A 3K72B 3NT4A 1A9OA 4JJGA 3JQEA 2VO1A 2H9AA 3K70C 2D00A 3DUFA 1YQUA 3MGAA 2ZCUA 2WUFA 3PNSA 2QAGB 4UTPA 4AO7A 2CV2A 1LWOA 3DLAA 4WEOA 1P6XA 4YAUA 4YCNA 1U81A 2AYZA 2VEDA 1C50A 3DT9A 3MGCA 3UIEA 1B2RA 1K6EA 4XVRA 3D0QA 1R8QA 2GTPA 3ONEA 3L7JA 3UVEA 1A2QA 1B0AA 1GV0A 1WPQA 4UOZA 1KKLA 2VFAA 3BCRA 3PXAA 5JG7A 1NW5A 4B6JA 3D5TA 1ANKA 4C89A 4HR7A 3ROMA 1BMDA 3WHLA 2HJVA 3W90A 3FGZA 3NFRA 4G5FA 2Q3DA 2OCIA 4JJ4A 3FMGA 4JI5B 2JLBA 3QRWA 3ABQB 4KFUA 2I54A 1AK1A 4NQZA 4QWMA 5TT1A 4ZGGA 3BOSA 3IE0A 3G3EA 1SQ6A 3R3HA 3QMVA 3Q6MA 4CFZA 5C1OA 3RYCB 2ZGVA 4U9IS 3I6MA 2HU8A 3FY4A 1MX3A 4KU4A 4C2TA 4RZUA 4F97A 5AI5A 5ALOA 1WCIB 2QR2A 4JT4A 3THYA 3LKDA 4KQXA 4BOYA 1B7GO 1KDOA 1P45A 2C8KA 3VU9A 2ZOSA 3Q9LA 1I1HA 3EFHA 1YRLA 4Q9IA 4EI2A 3UGJA 3MAJA 1XTQA 4XM1A 2CF6A 1QFMA 3RBVA 4KCGA 3P4UA 4KZPA 4L73A 3TPZA 5JARA 4Y9RA 1IULA 3IQFA 3B6KA 4MW6A 4CQJA 1Q14A 1VRWA 2R4TA 3SU8A 3WRWA 2JJ1D 4ZAYA 1BHQ1 4NYIQ 3I9KA 1QCCA 4CEJB 4RUKA 1Q95A 1E8DA 1L5FA 1N5KA 4L50A 3PDWA 3RVRA 4BNJA 4UEQA 4E5NA 5LMZA 2E48A 2GCPA 3SSOA 1RXVA 1TT7A 2UYGA 5IVKA 1I1NA 5KNCH 4GPTA 2ASVA 1POWA 2WM8A 2F8MA 4O4JB 4FFDA 5IJXA 4EFMA 5A5VA 1JLSA 1MQSA 3T3IA 3PX3A 4PPGA 3ECSA 1XDDA 1FFXB 1XWFA 1DXQA 1XL0A 4TWIA 1TC2A 2REQA 4NE9A 3L41A 2AN1A 4IUDS 5BSTA 3NHRA 3MSXA 3N7AA 1P7VA 1E9DA 1L7RA 4P4GA 2G9RA 3TW8B 1URPA 1HDRA 4DIFA 1YI0A 3RU3A 5UKDA 1ISIA 2PUCA 2VR1A 4B76A 1TJ3A 2WVJA 1XI2A 3WLNA 4E31A 2AZ4A 4UCQA 1XMVA 1YC2A 3NPMA 3ISVA 2I4LA 2F1IA 2ZTMA 3NS7A 5JH7F 3O8CA 4FNOA 4CMHA 1R4ZA 4UMFA 5KOJB 1OWOA 1P0QA 3BHJA 1XYGA 2JKYA 2X0RA 4XWTA 5CUQA 2O2YA 2ZYUX 4WCFC 5IFKA 2X7JA 2DWUA 3NVDA 5FWNA 4F4DA 3LVQE 4D82A 1VOTA 4WBNA 2J30A 5FFNA 1Z68A 1Z18A 3EZ6A 1UFQA 2O2EA 2Q1WA 1ZD4A 5EFOA 4BNDA 1M2VA 3UWPA 3QVMA 5FBLB 5KU7A 3EDRA 4V0RA 3BYZA 4HZIA 2YZNA 1OC4A 5F5XA 4G1UC 4I4TA 3F3MA 1YZKA 3PR3A 4LFCB 2QU7A 1NQ5A 3BDAA 3ORHA 3GVCA 3FPKA 3HCWA 1E7QA 4EECA 3S1AA 4EI7A 2ZUTA 1FW8A 1KJJA 3E9QA 1ODLA 4RJLA 1OZAA 3E15A 3T99A 1O96A 2GYYA 2C3UA 5TC4A 4EO9A 2ZBVA 1LK7A 3F8TA 5ESDA 3EFBA 1ONBA 2EJCA 4C0BA 5J4YA 2B5VA 4BLPA 1D7AA 4HOYA 4WZZA 5F76A 4Q4CA 1JBKA 4BXOB 2BFFA 3LO5A 4PFSA 2IY8A 5BVGB 5IZCC 1SKQA 3NC4A 3F47A 4GLFA 3A9SA 4J4TA 4HGYA 3FZEA 2ZIXA 3DDSA 5BSHA 4O25A 1J42A 3JRWA 1LDMA 1RCUA 3O1HB 2XGMA 4QPNA 4YP1A 5H02A 3TIXB 5IF9A 1WP4A 3F5SA 2LE0A 3KKLA 1XN1A 4IMJB 3UJAA 3KO8A 2QQ0A 3FF1A 1AZSC 4PXAA 1I7PA 4KSYA 4EFDA 3L4JA 3QUSA 2XQGA 1M66A 1QGAA 3PJFA 5BW6B 4RGYA 1L4MA 1KJ8A 1VJRA 1YWGO 4MV7A 2ZRNA 2P9HA 2ZRGA 1PZFA 1S7CA 1FRNA 2IOFK 4GL4A 4GUAA 3ZCPA 1VA4A 3WWEA 1N1MA 2GCOA 2GPSA 3ZZ0A 4D0GA 1ULTA 4H1UA 1UKCA 3EE6A 4XEHA 2B2NA 3VHXA 3G13A 4A2QA 4BATA 2TMYA 3UMVA 1Q7EA 3R3ZA 3FJ1A 4E6EA 1RWQA 1SIBE 4I9FA 4F9FA 5JH7A 5KEIA 4EEZA 3AVOA 3MTBA 2WJ4A 1Q1GA 2X8WA 1XVTA 3QQPA 4ACAA 1CUEA 4IG4A 2FQXA 2H63A 5FNVB 5ICFA 3U2QA 4BAZA 4D0SA 1ZUIA 5AW2A 3QBVA 4WKCA 3S0JA 3I04M 4HXFB 4GKJB 1AV6A 3V4ZA 3T1OA 2JB9A 2ZYDA 1Z7BA 5AP9A 2I7TA 4FE7A 1RKXA 3MCUA 5CDFE 2C04A 1Z06A 2RHRA 3B9QA 1ZVMA 4CI9A 5CT9A 3TPFA 2R5WA 3VPHA 3LZ6A 1TKAA 3WICA 4RY0A 4BMYA 4AMZA 5EJFA 3OFNA 1W87A 2AS0A 5SZKB 4JFAA 3K32A 2N1BA 3II6X 1TKCA 1OAKA 3WBBA 2CW5A 1JMKC 3W2GA 2OY0A 4LV5B 3TSZA 4UBJA 4BAGA 5EQJB 1XEXA 2Q3LA 2UVPB 2XD9A 4C0QC 2XCQA 3H4IA 3IQHX 3PVSA 2GPYA 3D02A 3ZI7A 4B4KA 5F12A 2Z30A 3CCCA 4F9EA 1M6VB 4R7ZA 2PQ2A 2UYYA 5TDHA 3TL3A 5D3MB 3PLNA 1K68A 2DYKA 3CT4A 4TUYF 1M1XB 2YWXA 4UBLA 2UUPA 1R0CA 1SU8A 1K6JA 1ORWA 3QJ5A 2XVAA 1L4EA 4CR6A 4FGSA 1NHGA 2BFEA 3E2PA 1FP2A 3I2KA 3NHBA 3UK2A 3EA5A 5DBHX 3CZ4A 3JAWB 5ILOA 1HL7A 4KVFA 1LA2A 4RVHA 4CGZA 2R6FA 4WXYB 3ZDCA 3I5MA 1JHVA 3RU2A 2WW8A 4LXHA 1GTZA 4KRYA 2AOWA 2NWQA 4K1XA 1HBJA 3K0AA 1WZNA 1PLKA 4GG1A 4HX9A 4RK7A 1R4MB 3RD5A 4FB4A 3GGCA 4UFPA 4M3NA 5GMOA 3WZ2A 4DRZA 5JANA 1FU4A 3MFQA 4NK5A 4RTMA 1DDGA 4EB6B 3D3WA 2E4XA 3C85A 1G21B 4GX1A 4C20A 1RJGA 3UB2A 1P75A 2JGIA 5FOWA 2PUJA 3RDPA 4AQDA 2AOUB 4G89A 5EMKA 4TYNA 1VI6A 1V5WA 1XU7A 3LC0A 4DCMA 3OPVA 4KO2S 5EIXA 4LHVA 2ZUVA 1N8SA 3F6BX 3FIUA 3QNUA 4O0MA 4EVQA 4E1AA 5BV0A 3DBLA 3GLVA 4GI1A 1VCOA 3IB6A 1X9HA 4KFSA 1FNDA 3V6MA 2JD1A 1PQPA 1EFDN 5A5FA 1S3GA 4MWDA 4Q02A 2RB5A 3WLRA 2A2ZA 1XWIA 4DA6A 5K45A 4Q4JA 1GA6A 3ZHSA 2C4WA 3TF5A 5CVVA 1YNOA 4TYYA 3HHEA 1XCPA 1MGPA 5B1DA 4M1KA 1PN3A 3P0EA 2D4AA 1E66A 2ZRAA 5HCNA 2OHIA 4IXNA 3HP4A 3QVXA 1NW3A 4I1OA 3D7LA 3V1KA 5JPIA 1A1SA 1RJFA 4XAQA 4DB4A 4HNAA 3A3KA 4O5AA 2DETA 1JVSA 1IHPA 1NJ2A 3KKKA 4R98A 1LPMA 4AY6A 4MUAA 1M6EX 4AJJA 1I3OA 1A4XA 3PJRA 1KE2A 1JSCA 1NZFA 3JYHA 1MR3F 1C2YA 1C2TA 3EXIB 2GN8A 1IXYA 2PA3A 2GF0A 3G23A 5LQDA 4LSGA 3J7TA 2VRBA 3DC2A 3C6MA 4LYHA 1A4UA 4PG6A 1R0ZA 2WKSA 4YO7A 3TVTA 1QGZA 1YVEI 2C8LA 1A7UA 3EY9A 3PGJA 4C3OB 1ABFA 2C31A 4NG5A 3VU1A 1QANA 2YJ4A 2ZREA 3BCSA 3L1UA 1TC1A 4MI6A 4JI1B 3MRTA 4DADA 1QVWA 1Y3FE 2ZB8A 5E0KB 1L4BA 1F6DA 5TEVA 1L4HA 4XQ0A 3QELB 2FLWA 3SEFA 5FADA 2EWMA 3L0ZA 3VI4B 1PEYA 3KQOA 2JHFA 2FPKA 3RLFA 1MV5A 1YA6A 3OKFA 3PBKA 3ZDDA 1W46A 4DIDA 1U8EA 5C34B 2IT1A 4EM6A 3AK4A 1EUCA 1YONA 3MJVA 4LV6A 2P62A 2ZWPA 4MR8B 4GSLA 4MVYA 1Z5WA 3P5BA 3GUUA 2VXCA 2VOJA 4QDOA 3T35A 5J2TA 1VSTA 2Z5VA 1YFKA 2LTAA 3MA0A 4OQLA 3PRKE 4KAJA 5HCIA 3ZHOA 2ZTSA 4IW3B 3AOEC 4OQMA 4AY2A 1QIJA 2CK3D 2W7TA 3L8GA 4KJXA 2I3GA 1KI7A 4CF3A 4HDMA 2PSHA 1TM2A 1IZ7A 4LHXA 3ORRA 5DNWA 1UC8A 1FFCA 2W2PA 5AICA 4TVSA 1I13A 2H7XA 4CETA 4ITUA 1HEIA 2UAGA 4BNUA 4H1WA 3V1YA 1E98A 1F60A 3LUHA 3QPAA 5A9SA 3GT3A 4R6XA 2KWIA 3UAZA 1DX6A 5F9FA 4ZVVA 1O94D 3E58A 3OPYB 2VJNA 4I8IA 4Y1RB 4OPMA 5BR1A 3F74A 1Q21A 3LM8A 3W34A 3JQ7B 5I7HA 1QLHA 1Z38A 3C6YA 2LR0A 4NZ9A 4NABA 1LD3A 5DM70 1SHLA 2C9OA 4LCJA 3LQKA 1QX4A 2ERCA 2R5FA 2VSOA 3C6XA 4LVUA 3ZU3A 1POXA 1JTEA 4MYTA 2C9CA 4UPEA 1P7YA 4KXQA 1HY3A 2IW3A 4A10A 2C61A 1HF3A 3HY6A 5DHRA 2J08A 3FRHA 3H19A 4EQ6A 3DLBA 3E7PA 4D5GA 5F77A 4LE1A 4PO8A 4D96A 4E7PA 1NSTA 2C5HA 3AR3A 3C3CA 3UGTA 4EDFA 3N2LA 4CMAA 2LNDA 1RPAA 1SCNE 5TGDA 2OCDA 1ESDA 4JL5A 4CXMA 1T5LA 2ZJ0A 3E6AA 4MH0R 1H2WA 1N0IA 2LCQA 3RT7A 5HUQA 5AT1A 5BR4A 4LC1A 2I9KA 1PJRA 3GN1A 2PGJA 4X8HA 5H70A 1TU0A 5EJ6A 5K0SA 4J1TA 3O74A 4LXXA 1XVVA 4RKQA 1EM8A 3JQGB 4GRDA 5FX2A 5JFTA 1GFWA 3VZCA 1PR0A 2IZ0A 4MAMA 4E5DA 3H5TA 4RTKA 1R0LA 2Q4RA 3D0RA 4B3MB 1E5VA 1XTZA 4ZJYA 4J94A 1KZ9A 4RD1A 3HBJA 2NU9A 1Y37A 1PNOA 2O5RA 3RKSA 4LQLA 2OZLB 1DADA 3G0IA 2G88A 1H6AA 2A9OA 5AM4A 3RS4A 1T5SA 5J23A 4J0HA 5CB4F 1VCHA 2GS9A 2WJGA 3OMLA 1N32B 4GPAA 1PF7E 3ZQUA 2F67A 1QAMA 2QJOA 1N3LA 2B2CA 2WU3A 4GYWA 3BRCA 5H3HA 3GZJA 9GPBA 1EWRA 3M33A 3PNPA 1JDZA 1ZIOA 4WNAB 2ZBDA 3OMXA 3QIAA 1U8UA 2C5GA 5ELMA 3C5HA 1XZBA 2IDJA 4O8ZA 5KYKA 3K9FC 1YCFA 3WWDA 3CPHA 2ZE8A 3A10A 2HCTA 3UC5A 2YV3A 3TB6A 2P4UA 3RYIB 3PI7A 3V8NA 5CEJA 1VJ5A 4TYMA 3H9EO 2VZ0A 4FHDA 4GKBA 1NV8A 1T9GR 4LDRA 5L3QA 1ZH4A 1UEJA 2GXQA 1UPUA 2YXNA 3CRRA 2J7KA 2NU6B 3HGQA 3VC7A 1ZEMA 2I7XA 3L6EA 3T34A 4DJAA 1M1UA 1CUIA 3AUXA 1Y6GA 3PDJA 4J3NA 1QFZA 4PLYA 1U1CA 1PWYE 4MCJA 3LVFO 1I94B 4BP8A 2O5VA 2RKWA 3KQQA 3F90A 3NM5A 4OUKX 4RLQA 4DQXA 1LJUA 5AXAA 4X85A 4NFSA 1E3EA 1HPLA 4PCUA 1W36C 2B7CA 1JJIA 1VPVA 1T9AA 4JXJA 1I0ZA 2EBHX 2YIMA 3G2MA 3VQTA 4KXNA 3UT5A 2VNKA 4H31A 3V3KA 5KPJA 2VDQB 1PZEA 2SHKA 1AHHA 1GVNB 2VYVD 1O4VA 4M1OA 2RAFA 2PX8A 1F0KA 1LS6A 5I9LA 1H3EA 3RIYA 3V32A 2C5BA 1R6XA 3Q87B 2QE6A 3ZUGA 1DO8A 3SYLA 1HH4A 5EUBA 5L7WA 3WJ1A 5HWSA 5HQTA 1Y89A 2C7VA 2H1RA 3OQBA 4DKJA 2VJLA 1GGVA 2GBCA 3BC1A 3L7AA 1RXUA 4QJ4A 4Q9DA 3ZG6A 4EWLA 1TU3A 4MUJA 5IHPA 2UZ3A 4NBSA 1AE1A 3C1OA 1ZH0A 2AR0A 1IMJA 3GG9A 2IYUA 4U2KA 1P60A 4IKEA 3OZWA 4ARAA 1FQKA 2H2AA 4OXKA 2UDPA 2CN1A 4GQAA 5JV5A 2SKDA 4ZVKA 2ZJ6A 3SLGA 2CF5A 2GZRA 5J5CA 3U61B 1X7WB 3B1YA 3DKPA 1KE1A 3WWZA 4WN9A 2XMCA 3O8OB 1PJ8A 4BWVA 3E81A 4D9HA 2BEWA 2UVDA 1SG0A 3I1FA 4C30A 1AQNA 4EAQA 1C4WA 1LPSA 4PC2A 3E22A 4WXPA 3W4KA 1MTOA 1V6SA 2R1TB 3ACBA 2C3YA 5AM0A 5G53C 1TTTA 2PHZA 3ZWNA 1H1LB 3P2KA 4IMIB 5E7MA 5FTWA 1GD1O 2ANCA 4ANFA 3GVIA 1XF9A 1PYDA 2JI7A 4Y30A 2QV0A 4RYDA 3NUZA 3OF5A 1XNJA 2X41A 2YH2A 3DYBA 3IAXA 3PEUA 1I9GA 4CF5A 1K4KA 5CYPA 4KEAA 4XIJA 1X3SA 5JXJA 5DYIA 1C1YA 5FBRB 1H4SA 3WLMA 1R6VA 3UPTA 1DUIA 1LQ2A 4N9WA 3DG9A 4UJ3A 4YB8A 1DAFA 4IGIA 4DDHA 4I9NA 4R7GA 4UJ5A 4E46A 3EXG2 1YS4A 3GOQA 3SDBA 1HYHA 3I01A 2E4ZA 2D13A 1P3Y1 2YYZA 3MXTA 4LRSB 4ZRMA 5BQ5A 3R8CA 2P6RA 1GWNA 3TLBA 3SD7A 4TYWA 2JPDA 2Z09A 2C0QA 4OGLA 1JPVA 2H17A 2HIHA 4DCUA 5SYNA 2GEKA 4ZDWA 2J8ZA 1CR1A 1UPFA 3OCXA 2GERA 1XROA 2NTVA 1DCKA 1HLDA 3F8SA 4IDPA 4RVSA 3AERA 3WL8A 5B4VA 2YTZA 3TTWA 5A3SA 4YJ3A 4HWGA 3OD5A 4NPAA 5AIAA 3UK7A 3ADOA 2ZIXB 2CLLB 4BVGA 1XQXA 5HQJA 4NNPA 1Y5LA 4MR9B 3NONA 1EFCA 4IICA 4MGKR 2BMJA 2AJCA 3SJBA 3WXBA 2DFDA 3P9PA 4MVJG 4WEQA 4CKCA 1YQTA 2YHBA 4QVIA 2IODA 1NG1A 1KIMA 2BFCA 4LI3X 4R8KA 3V4VB 3CRQA 4B3TB 2QTVA 2CUZA 4W7SA 3D6HA 4MKZA 4UUAA 4AKTA 1FDWA 5DIZA 3UAWA 1QV9A 1XJ5A 4NLLA 3GAAA 5K2MA 5AM2A 1FB5A 4Z9FA 4ZD6A 3MERA 3K30A 3COSA 4MKHA 2P9BA 1Z6TA 4DRYA 1J5XA 1P7PA 1UPXA 3WYAA 1Z0IA 4JIMA 1J8FA 1MVNA 4IJKA 5ALQA 3V2UA 1SQSA 3MJRA 4KYIB 2QQEA 1VHDA 2JANA 2JG3A 1EM6A 4MNTA 5C1BA 3G0OA 1WXGA 1J20A 4AP6A 1L5WA 4LCBA 4YAFA 4RFSB 1YB7A 3TQFA 3USCS 2GHQA 2FZGA 4QRDA 3RNOA 4D0RA 1TUGA 2DPXA 2ECKA 2DECA 4M8IA 4RE5A 2QR5A 3P9ZA 4YCSA 1EFPA 4ED9A 4I5GA 1J25A 3ZGZA 1TMKA 4RULA 4EX7A 4LDPA 4AYWA 2R97A 4O59O 1PJ4A 3T1VA 3RRFA 3ZXYA 4PZDA 3DZIA 4Z0HO 5K8TA 4BNZA 5CDGA 4QLBA 3S6JA 3SG0A 4W6ZA 4Z7OB 2NG1A 2DY1A 2IXBA 2DR3A 4RHXA 5CDSA 3D59A 5K3EA 4E1BA 5L51A 4OF4A 4HS4A 1W88B 4F1JA 2UYHA 1V8FA 2IP1A 5FULA 1XNHA 4MRMB 1QJ4A 1TO2E 3A25A 4KX5A 2FWBA 4Z5XA 4F86A 1A7JA 1H9AA 3H4VA 1H1LA 1G8PA 2I8CA 4Q4JB 2QPLA 4F2HA 3WLJA 9ABPA 3F1LA 4C7MA 2IYNA 3D0OA 4CFYA 4L0CA 1QNLA 5LP6B 2E6UX 2XNKA 3TPCA 4RADA 3EXHC 4J90A 4UATA 4CKEB 1SUWA 3BXXA 3G7SA 1QIGA 3H2ZA 3JY6A 3TM5A 3EZXA 2WUGA 1P18A 5JAOA 5IM4A 4G5XA 1V6CA 4GKKB 4KIWA 3U4QA 3EGVA 3NWOA 1DG3A 1KI2A 1NOIA 4HFNA 5E38A 1GSIA 3SM3A 4ER5A 2CGEA 4CFSA 4MPRA 5KNDD 4GKAA 4GPIB 2ZSAA 2RHBA 4ZVTA 3TN7A 3IALA 3UUGA 4UAUA 3ZQKA 4XWOA 1UXJA 4FD3A 4PTLA 2SKCA 4MUXA 3DWGA 5A3RA 2PD3A 4CL2A 5KBYA 3JPWA 3MAGA 3HZOA 2QM3A 1FL9A 1QDUA 1YKFA 4XQGA 1QYCA 3SS8A 1JYFA 3TNJA 4BQIA 4AVYA 4Q3DA 5DN6D 4M9XA 3USES 1U90A 2IYSA 4CMBA 3DLCA 1Z25A 2PZLA 3OCJA 4J0IA 4NYMR 2ZPAA 3LNTA 4GPEA 5HBRA 2YHIA 3VHXB 3A9TA 5FO0A 1OT5A 2C1XA 2XMBA 1FVXA 3DXXA 3GP3A 1L0BA 2AEJA 3ASUA 4IDAA 4X45A 5IABA 1E8NA 2BI7A 1NBME 2CXSA 2RH5A 4AF8A 3UZUA 4ZC1A 2C54A 1GU7A 3HMKA 2FKNA 4MWEA 3CKMA 2EP8A 3EGOA 4KMSA 1J2UA 3VVCA 3KJQA 3ZV6A 1QV7A 2ZRBA 3UUEA 1EXDA 1BX0A 2V6GA 1NMXA 4IQGA 2VQDA 3H1GA 4JODA 4X93A 5CM2Z 5FLEX 2Q6OA 2RHWA 4P80A 3Q10A 4RVNA 3U7HB 2UVPA 1F7UA 4FWIB 5G40A 1PL0A 1H2AS 1MENA 2H9IA 1RIFA 3SICE 3S1LA 2WM9B 3AZPA 2QI9C 1KH2A 2RMKA 1B76A 1K4MA 1QYWA 3QX8A 2H51A 3KOZA 1BVUA 3O38A 4G8BA 1SPBS 3AEZA 3KJZA 4Z86A 1P6QA 4DL9A 1LPBB 4UCFA 4YT5A 2FX5A 1WV0A 1QIFA 2X15A 1KF0A 5FWYB 4ALNA 3JZAA 2Z8ZA 1N8NA 4KP7A 3LXXA 4URFA 4EUEA 4DMUB 1DLJA 3RROA 1C9YA 3JR3A 4PSUA 3GNTA 3ECCA 4DZRA 4U6SA 2VATA 2DBQA 3RJZA 2JZCA 1DBPA 2LKDA 4YQEA 3DDOA 5D1NA 2QTBA 2IK8A 2JAOA 3N6RA 3OIDA 5IAJA 3IP1A 1N3BA 5KAPA 3O82A 5D3MA 4XCQA 5KUTA 2Q4OA 1WSAA 4LHYA 3LGXA 2ZI4A 3OZ7A 2W4IA 2Q1TA 1A9ZA 2J6CA 4M46A 1CZLA 8ABPA 1XNQB 4MVJI 3L4SO 2VHVA 3BL6A 4HTAA 3IHLA 2RI0A 4JBWA 2VIIA 1DBIA 1OU4A 4G8JA 3AL0C 1CEEA