2QDLA

Crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
154
structure length
154
Chain Sequence
KHHHHHHPMPKKIVVFSLAEELYGLDIFDVHEVVKDVSITKIPETPEFIEGIINLRGKIIPVIDLKKRFGIGKRGKSKDSRIIIVEILGQKAGLIVDAVHEVIPIDENSIEPPPPVTTIDTAFVEGIAKTDDKMIIIIKLHFLFEVNGKEMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of scaffolding protein CheW from thermoanaerobacter tengcongensis.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Signaling protein
molecule keywords Chemotaxis signal transduction protein
total genus 25
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2qdlA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2qdlA02
3QWYA 4GBQA 3CQTA 1SEMA 4J9GA 2RNAA 1JEGA 2K3BA 1NM7A 2LMJA 1ZUUA 1UDLA 2FRYA 1RI9A 1SRMA 1AWXA 2H8HA 4QT7A 2YUOA 2YUPA 1WXBA 3REAB 3VS3A 1AZEA 1J3TA 1SHGA 1QCFA 1JQQA 1OPKA 2I0NA 1I1JA 1BK2A 4Z89A 2DLPA 2HDAA 1H3HA 3M0TA 1YN8A 5EC7A 3UF4A 2GGRA 4KRTA 2CT3A 1UUEA 1W70A 4AFSC 2EBPA 2PTKA 2D1XA 1SRLA 3EG1A 2KBTA 1OEBA 1X69A 3H0IA 2VVKA 1VA7A 1YWOA 4CC2A 3VRZA 1KJWA 2KRMA 3JV3A 1PKSA 4D8DA 2A37A 4OMNA 4HVVA 1WYXA 2JM9A 2J05A 4RTUA 2RQUA 2YDLA 2CT4A 2YUQA 2CDTA 2JM8A 4IIOA 2E5KA 2J7IA 2AKLA 2K9GA 2HSPA 2VKNA 1WDXA 4JZ3A 1AD5A 2KROA 2YT6A 2KRNA 1M3BA 2DRKA 2X3XD 1JU5C 2AZVA 1NEGA 2DL3A 2EW3A 2MOXA 2LJ3A 3I9QA 2L2PA 1HSQA 1I07A 2JS0A 1M8MA 5HCKA 2O88A 1YP5A 4JJCA 1H8KA 1YCSB 2DBKA 2CUDA 4CC4B 1V1CA 3EHRA 2K7AA 1GCPA 4ESRA 4LNPA 1T0HA 1CKBA 1KFZA 1UECA 1GCQC 4EIKA 2QDLA 1ZUKA 2KXDA 3VS2A 2ROTA 4OMPA 1K9AA 2GNCA 1XOVA 2MCNA 2JMAA 2G6FX 1PKTA 2O31A 1KIKA 1B3QA 1RUWA 2GTOA 1TUDA 1AEYA 2ABLA 4AFUC 2RQRA 2X3WD 1HJDA 4OMOA 1BBZA 4R0KA 2KEAA 2IIMA 4RTWA 4LUEA 3RBBB 1WI7A 3M0PA 4WCIA 2BTTA 1VYUA 2HEQA 2M51A 2J6KA 5IH2A 1U3OA 2CSIA 3FJ5A 1PWTA 1E7OA 1MV0B 1QWEA 2A36A 4JZ4A 2EKHA 2L3PA 2XMFA 2J06A 2W0ZA 1QKWA 1T3SA 2PZ1A 2SEMA 1SPKA 4AG1C 4ORZA 2EYYA 2KNBB 2DL5A 2DF6A 1ZUYA 5IHNA 2CH4W 2O9VA 2P4RA 2C0OA 3VS4A 4ZNXA 2LJ1A 4RTXA 2SRCA 1WIEA 1UE9A 2AK5A 2O2OA 4Z8AA 1GRIA 3VS5A 4JJDA 2EGCA 3UATA 4J9HA 1NG2A 2GQIA 1Y57A 4LE9A 1GBQA 1Z9ZA 1NYGA 2GBQA 3SEMA 3THKA 1K76A 1TUCA 1ABQA 4HXJA 2B86A 2DL7A 1AOJA 2F2WA 3EG0A 2D0NA 2DBMA 2LNHB 1T0JA 1X27A 2DX1A 4D8KA 3GBQA 2PNIA 4RTTA 2J6FA 3PVLA 3PE0A 3SHWA 1GCQA 2ROLA 4JJBA 3UA6A 2FPDA 2DVJA 4OMQA 1E6GA 1BU1A 4AG2C 2L3QA 3RNJA 2FRWA 2C0TA 2K79A 2EPDA 1K1ZA 1A0NB 2JMCA 2JXBA 1FYNA 2RMOA 5IHIA 4LUDA 2LZ6B 3UA7A 2RF0A 2KYMA 4CC7A 2FEIA 3EG3A 1OV3A 1RLPC 3NGPA 1M3AA 1Y0MA 2GTJA 5IHKA 1PRLC 4CC3A 2KE9A 5FW9A 4J9CA 2RN8A 3TSWA 3EG2A 2KRSA 2ECZA 2KR3A 4F14A 2W10A 1UFFA 1NEBA 2V1QA 1AWWA 1U5SA 4K11A 1M27C 4RTVA 1KSWA 1K0XA 2JS2A 1W6XA 2DL8A 1UJYA 3I5SA 4X1VA 1M3CA 1X6GA 2LCSA 1IO6A 2ESWA 1ZLMA 1AZGB 1WX6A 2DYBA 5I11A 3A98A 4J9DA 1WA7A 3TSZA 3U23A 4HCKA 2DA9A 2LX7A 2YUNA 2NWMA 2LJ0A 3VS7A 4AFQC 2KYBA 5IXFA 2OI3A 5ECAA 4RUGA 4OMLA 2NUZA 1X2KA 1GFDA 1QWFA 1AWJA 4F17A 1UHFA 3VS0A 1M30A 1H92A 1HD3A 4JPBW 1ZSGA 2EYZA 4FSSA 1ZBJA 1AWOA 2RQWA 1X2QA 3NPFA 2O9SA 5FWCA 1SHFA 2VWFA 1WXUA 1S1NA 1GFCA 2BZXA 2HCKA 1ZX6A 3TVTA 5I22A 1OPLA 4J9FA 3LH5A 3ZL7C 4J9IA 1MV3A 2BZ8A 2D8JA 2KT1A 2BZYA 1CSKA 1X6BA 1RLQC 1WXTA 2A08A 2C0IA 2L3SA 1GL5A 4RTZA 2K6DA 5FWBA 1QKXA 2RPNA 1WFWA 4HVWA 2EGEA 1ABOA 1EFNA 1PHTA 1UG1A 1JXOA 3O5ZA 1JO8A 2ENMA 2EYWA 1UTIA 3QWXX 4LN2A 4OMMA 2V1RA 3PVQA 4HVUA 5GJWB 2HBWA 2M0YA 3VRYA 2CREA 2EVRA 2DMOA 1YNZA 2DM1A 1ARKA 1WLPB 2FO0A 4RTYA 2LP5A 1VYVA 1UJ0A 3NHNA 1G83A 2DNUA 1VYTA 5L23A 2DRMA 3M0QA 1NYFA 2OJ2A 1U06A 3R6NA 2JT4A 1AVZC 4A63B 2LQWA 5GJVB 3I5RA 3ULRB 2CUBA 1K4US 1UHCA 2EGAA 1Z9QA 2EQIA 1OOTA 2JTEA 1UGVA 3VS1A 3NMZC 1MUZA 2CH4A 4E6RA 4F16A 1W1FA 2EYXA 1CKAA 4GLMA 2L0AA 4DEYA 2KXCA 2LQNA 1LCKA 2RQTA 3IQLA 3VS6A 2RQVA 3REBB 2CSQA 2DILA 2KT8A 4IIMA 2YSQA 4J9BA 1X43A 1T3LA 1JXMA 4J9EA 3M0UA 3C0CA 3H0HA 1PNJA 3H0FA 4DEXA 1NLOC 2AZSA 1NLPC 2DL4A 1TG0A 2AKKA 2J6OA 2A28A 3EGUA 2KGTA 1K0SA 2OAWA 5IXBA 2D8HA 2K2MA 3I35A 1FMKA 1G2BA 1BB9A 1PRMC 2FPFA 3M0RA 1B07A 2ED1A 3H41A 4Z88A 1GBRA 2FPEA 2DE0X 2F2VA 3EHQA 4Y92A 2MIOA 4AFZC 2F2XA 1I0CA 2JW4A 2ED0A 1QLYA 2FG0A 1E6HA 3M0SA 4M4ZA 1YWPA 3KFVA 1SSHA 1N5ZA 2DJQA
chains in the Genus database with same CATH superfamily
1JOOA 1TUGB 2V8JA 3UT1A 3CQTA 5LJ5f 5KNBA 2K4KA 3AMUA 1S3OA 1MGSA 2RNAA 2H4OA 3TDQA 3CCQQ 1S5BD 1TY0A 1JWMD 3SB2A 2A69D 1HNZQ 1ONLA 2MPMA 1UNSA 3G1JA 5FO7B 4OL7A 2DZCA 3CC7A 4XTCS 3T51B 4QY7A 4MIUA 2PUKB 3R6OA 1MD2D 4JCVE 2DXCA 4A54A 2HD3A 4B9XA 4JI1Q 1DXMA 1I4XA 1QE6A 2RDHA 4WJ4A 4DXFA 3HRUA 4O2DA 2R92B 2YRCA 2KA7A 4L5RC 5CKBA 1OYXA 3OYNA 2SDFA 3M4QA 1J3TA 3GTMB 3AEVA 3S16B 4BBSG 1BCMA 3TP6A 3A8IE 4JV5Q 1OPKA 1I1JA 1X54A 1VQMA 1JMCA 1TWHH 2QEJC 1WGSA 4FYWB 4Z89A 5I21A 2DLPA 2YXYA 1CQFA 1CZGA 2F0VA 4GN3B 2CW0D 5LMNQ 2NUPA 1YHAA 1VQ4Q 3EBEA 3TZUA 1OTCA 1VQ7T 3MP6A 1WOCA 1O7ZA 4LNQA 3PUVA 3FPPA 2RQXA 4DR7Q 1TSFA 4C8QD 4E7KA 3UDCA 2F0SA 4KKSA 1QB5D 5ELCA 2E2JH 2A69C 4PJOF 4JI5L 2Z4IA 1ZSZB 2D1XA 3M5AA 3EG1A 1WQ7A 4N4GA 4KLKA 3H0GH 4LFAQ 2XTIA 3VUBA 1I3QH 1YWOA 3DM1A 3TMEA 1B50A 4CC2A 2KRMA 2E2DC 4M7AF 4KHZA 1PKSA 1XNRL 4OVAA 2LRQA 3F2BA 1GUWA 3CF5A 5FOBB 1QJOA 1WYXA 4HCCA 2JYOA 4A3FB 2JM9A 2L3RA 5I2XA 4C56C 2F3WA 3VYHB 3CCQT 5FLXc 1WPYA 1W2BP 4KHPL 2RQUA 2YDLA 2A7YA 2KVQG 1STYA 1I4QA 2HKNA 2MGSA 4V0BA 2AKLA 2R92G 3KBGA 1NE3A 3JCMX 1WDXA 2F0TA 1AD5A 1VQ4T 2KROA 4AIMA 1F1BB 1RIPA 4GKKQ 2A68D 4KN4C 1JU5C 2JZ2A 5M5XB 1RD9D 2DNEA 1KG1A 3CU7A 5KYLA 2KEEA 2DL3A 2EAYA 4M75B 3S1QH 3M4GA 4TRDA 2XKOC 4ZRZA 1PFSA 3GTJB 2F69A 2L2PA 4M7DE 1S5FD 2K04A 3RMHA 1YJ9Q 2D62A 4X62Q 2O88A 3DB3A 2VUMG 3A8LB 3C95A 2E5QA 4KJNA 1ASZA 1H8KA 1R4PB 2IL8A 4DR7L 1EFWA 2R93G 3MEWA 3I4LA 3V7RA 2IHEA 5C44H 2D2CC 4A3GH 4F7UA 1RKNA 4DA4A 3LX7A 4J6HA 1K83H 2R7DA 2K7AA 4DV3L 2WINB 2NUPB 1Q82R 1YJWQ 5D65A 4A3KB 4BDZA 3CC2A 3OYFA 2JE6I 4PLIA 1BQQT 2V4DA 3ULLA 3OTOL 1K3RA 4A3DB 1T0HA 4XTVA 2F0PA 1B34A 4FP5D 2O01E 2VZAA 1NCVA 2ZJPA 3M53A 1FNVA 2F3VA 1RAGB 1KHCA 2R5AA 2WSCE 2QKIC 3OOCA 4K8JA 4C3HB 3I56A 4M7AA 2ZJRA 3VS2A 3M3YH 4TVRA 2MI6A 3FJPA 4GLKA 4II1A 4OMPA 4DUYL 5GAMg 1HA5A 1SLJA 1PV4A 4M77F 4QW2A 2IVWA 5KYUA 4GNXB 2WSEE 4LF9L 4XTZA 2ZGWA 1NTGA 4E7ZA 4M7DF 5CQXA 2DY8A 2ICEC 5IP9G 1B3QA 1VQ8Q 4N8X1 1I94L 2ZJQA 1AEYA 2ZTEA 4FXKC 5I9OA 1QNKA 3CPWS 1SYDA 4DUZL 2VUMB 3FP9A 4E7SA 2ZXPA 3FB9A 5C6SA 3CCEQ 2X3WD 2IHFA 4X9DA 1ZBXA 2JA6B 1BBZA 1H9RA 1G2SA 2XNAC 3T4AC 1R0BG 4K2KA 4LK1C 5C0XG 3RBBB 3HKZB 4OB1B 2CP5A 4AMCA 3M0PA 1IL8A 3JCMQ 3QIIA 2F0WA 4YIJA 4B3MQ 1VYUA 4OX9Q 2YWWA 3TREA 1CKMA 2VB2X 2QEXT 3RMQA 2GF7A 2OTJQ 2DGYA 1W2BS 1ENAA 1ZYRD 4EMHA 1UGRB 1ZSZA 1PRTB 1HR0W 4JI0Q 4NXMQ 4C3HG 4Y28E 4BI3A 4RG2A 2W0ZA 3CXCS 4EMKB 2LSSA 2HD0A 1SE4A 4DAPA 4X9CA 4NMZA 4E7IA 1WHHA 3S24A 2L5QA 1QW1A 4ORZA 2EYYA 4AG1C 1AH9A 4E7LA 5C4JB 2CH4W 2F0FA 3S17B 4FSXA 1S72Q 2X4XA 3E1SA 4HCBA 2QILA 1PA6A 3CCSA 2QQBA 3BFMA 4P71A 2IX1A 3PGGA 2EJGA 5D7UA 1WFQA 2B63G 4YWKA 1X55A 5C6AA 4V190 2RO0A 3VS5A 3VV0A 2OTLT 1SBBB 4ZKCB 2COYA 5GQOA 4HSVA 1DCZA 2R58A 3UATA 1D5ZC 1CZWA 1T5EA 1K8GA 2HBPA 1NG2A 1N6AA 1Y57A 4BACA 1EU3A 1GBQA 2VB3X 5FROA 2QF7A 4K6DA 5CIUA 4HAEA 3C3LA 4KGXB 4Q5VA 2B2WC 2MK5A 1VQPA 3E9GA 2XWJB 4JYAQ 4O42A 3GOXA 3SEMA 3J80c 3U4ZA 3THKA 3TEEA 2LT4A 3T16A 2BUDA 1ABQA 4EGVA 2I0QA 1R8OB 1I3QB 4LF8L 3VU3C 2SNMA 3OPOA 2EYMA 1WI5A 2B86A 2DL7A 2F2WA 4ZYSA 4LF7Q 4IUQA 1KLUD 4HJAA 2D0NA 1SJHD 4JI1L 2LNHB 1X27A 1K73C 1Q86U 1TWGH 2CVRA 3O13A 2DX1A 1MNEA 4PFOA 4D8KA 1KD1R 4XT3B 4R4TA 3EGDA 3KUPA 2KSSA 5CAIA 4KV6A 2SNSA 3PVLA 3PE0A 1PRTC 1U4MA 4BY1B 1QP2A 4FF3A 1GCQA 2A8VA 3UA6A 2OEOA 4LJZC 2DVJA 4AG2C 3EA6A 2A74C 5EPKA 1WTXA 2L3QA 2E64A 4CRIA 3E3XA 2VYTA 5E7NA 4TKOB 1NPPA 5C4HA 3PO3G 1G3TA 2EPDA 4BE2A 1HR0Q 2O5JC 1K73U 2RMOA 3MP1A 4ZTFA 1HQRD 2NVTH 4XU0A 3GTJH 5IHIA 3K0XA 1NPRA 2P0QA 2LZ6B 1M90R 4C1NK 3FRNA 3UA7A 4RMOA 1Y71A 1HH2P 1K73R 3W3AA 4CC7A 3VR4A 4HJ5A 4DV2L 1RLPC 1Y1VB 3U9SA 1M3AA 1Y0MA 1HZBA 1F2ZA 3RMSA 3QOJA 1LLRD 4IUPA 4H0LC 4IURA 5DY9A 1KQ2A 4X34A 2KR3A 1L0WA 2QTVA 2FXQA 1QNUA 1KDBA 4XTWA 3L2QA 5I6WA 2K3YA 1YJWT 2EJFA 2Y0SB 4E6IA 3CXCP 1VQMT 5LJ3f 1SF9A 1UFFA 2VASA 2RHIA 5C44B 2X6GA 2CZ1B 1U5SA 4I7ZC 1Q95G 1NE8A 3I55A 2Y0SE 3DWPA 1Q3LA 3NSWA 4XYQA 5HURA 4ELZC 1M27C 1PYBA 2NZHA 4PMBA 5CV8A 5D6WA 1K0XA 5CV6A 2WB1E 1UJYA 2ZPHB 4A3EH 1M3CA 3DM3A 1VQ5A 1GVPA 1X6GA 4QIWB 4GKJL 1SE8A 4BY7B 4JOIA 1EY8A 2R93H 5M3FB 2ESWA 2CKZB 1WVLA 4M77G 1DJ7B 2FMMA 2JP1A 5C4JH 3S1NB 1S4ZA 4HCSA 4DV1Q 1AE2A 1CHQD 4A3LH 4FXDA 2EQJA 2ID0A 3OYJA 3HOXG 4A3BG 4YCVA 5C4XH 2QXFA 3QJYA 3JAML 1GHJA 3VS7A 1K9MU 3PIP3 4X65L 3A8GB 4PZ8A 5G3LF 4F7XA 3I4NB 4GKJQ 1EEFD 2OI3A 3I73A 1O9SA 1Q12A 1QWFA 5GAN3 1JE5A 3GTGB 2DFUA 1AWJA 2P84A 3MFGA 4XU3A 4C8QA 1D0ZA 2F52A 2BH2A 5DM73 1K28A 4ZCKA 5LJ5h 2WAQE 3H09A 1VQNQ 1ZXTA 2O9SA 5IP9H 2JVVA 3TBIB 3R8BA 4ZKBB 4OGEA 3PO3H 2RHQB 5IODA 4CGYB 1D1AA 1PXUA 3TVTA 1YNJC 4C3IH 3DEOA 4CDDC 3ZL7C 2GFUA 3QDRB 5GAMe 1MV3A 3ND8A 2LCLA 2MWOA 3EFRA 1I5FA 1B2TA 3K6OA 4M78G 4DV7Q 4IJLA 3MP8A 3QO3A 1RLQC 5FRNA 4M77B 1Q8KA 1PH6A 1OZ3A 4GLVB 2R7ZB 4KULA 5LJ3h 1D8LA 1HQMC 1VQPT 1RJTA 2NVQH 5M9OA 1ZHIA 2ZZDA 1I81A 2WSFE 1WJQA 1SNPA 3I3CA 1QKXA 2B8GA 2HIXA 1M1GA 1X75C 2RPNA 3X20B 1YNNC 2LCCA 2KI7A 2QGGA 3FRPB 1WHMA 4FF1A 2M00A 4JI6Q 3OIQA 1YCYA 1D0YA 1E3PA 4A3LG 2FMCA 3HFNA 2IW3A 4PK4A 1U9RA 2F5TX 5CV5A 4DV7L 3IFDA 1UTIA 1YIJQ 2Y4YA 4FM4B 4O6JA 1B4OA 3D7SB 2A68C 1VQKA 1FR3A 2WB1G 4OMMA 2K01A 5GJWB 4IFDH 1TVXA 1BCOA 1C8CA 4AT1B 4Q5WA 4DN4M 1YZ6A 2FL7A 4HR7B 2XIDA 4OX9L 3JSCA 1JICA 1WD0A 1D6EC 1WTOA 2OX7A 1Z6HA 3M54A 3WXMB 3EFSA 4JRIA 2CREA 3VRYA 1BXTA 4JI2Q 4CJ0B 2DEQA 5J39A 1YNZA 4ZN3A 2LDMA 2P5ZX 2XIWA 4NXNQ 1FJGQ 1I4GA 5JOBA 1EYCA 2WIIB 2VXFA 2NZOA 3OS5A 4RG1A 2R7ZG 4M7DB 1X3GA 1IKMA 1WTPA 1ENCA 2CQOA 1VYTA 3VKIA 2K5LA 1AN8A 2DRMA 2EWNA 3M0QA 2JK8A 2H5XA 4OHJA 3DLLA 2TMPA 4DAVA 3GTQH 2F0UA 3OTOQ 5JVH3 3HOYG 2CP7A 5ELDA 1OZ2A 1QVGP 1Z47A 1WCMB 2JN0A 2EJGC 3A8JE 5DNFA 4L59A 3ULRB 2CCZA 3JB9I 1EOTA 1V9PA 1W6JA 1QVPA 2H3JA 2DXTA 2EGAA 3X24B 1YJNQ 4FW1A 1OOTA 5C4XG 1VF7A 5GANj 1VQ9Q 4L8JA 4U68A 1UGVA 1CQVA 1PFBA 1H3ZA 3TZDA 2TSSA 2PW5A 2ZPGB 2PMZB 3C1EA 2UXDL 4BE1A 1ML0D 1F2MA 4F04B 1MUZA 3FEOA 3UI2A 3LWHA 4RKBA 3V7CA 2JA5B 2CH4A 5HK0A 5NUCA 4E6RA 4F16A 1TR5A 1NR4A 4I7AA 3G4SA 4DNIA 3S16H 4BBSH 1XJWB 1EQRA 3K59A 3BDCA 4CDEC 2HAXA 2AQ1B 3CC2T 1FMVA 2SOBA 2E76C 3K81C 2RQTA 3IQLA 3NQIA 3VS6A 2B2VC 4YTLA 3NTIA 3REBB 4DR1L 2JA9A 3OMGA 1QILA 1SFOH 4BY7H 1M1KU 3NBHA 3CC7T 2KT8A 5EJWA 2ZM6L 1AZQA 4EMKC 2B63H 4CJ1B 2BIVA 3M0UA 3BZDB 3ND9A 4HN7A 3GTKH 3EROA 3T9NA 1Q82C 1UE5A 1NLPC 4A3JH 4M7DA 1VQ5Q 2E75C 2EYJA 2F4VL 5G3LD 1D5MC 3HOVB 1SKUB 1RCVD 4A3GG 1JJ2P 3I55Q 4OO1G 3EGUA 1ZEQX 4QUCA 5EQ0A 2X35A 4QQ6A 5CK9A 2OAWA 5IXBA 2K2MA 1BCPB 2DJFC 4TQUS 3Q24A 1EIGA 2EXDA 1SSOA 1VUBA 2E2JB 4M78D 2EIFA 5GROA 4JRQA 1G2BA 2DIGA 1E2ZA 2KCTA 1PRMC 3P8DA 1BI0A 4QCLA 1KD1U 1B07A 2QA4Q 1YI2T 2ZTDA 4A3FG 2RDGA 2I2LA 3MPUB 4Y92A 2F2VA 3EHQA 2K2VA 3RZOB 1I0CA 3JAMi 5KH6A 2JW4A 4TSSA 2ED0A 5BN5A 5FJ8G 4MZPA 1VQKT 1WJRA 2IY5B 3JC66 4A93H 1SSHA 4PKCC 2DJQA 5JEAG 4FW2A 3QWYA 4GBQA 3S1RB 4HIMA 4JS5A 4QQBX 1YHQA 3DHQA 1GUOA 3AHUA 3EG9A 1SEMA 4KH0B 2VQEQ 4L5SA 2LY7A 1RAAB 1JORA 4DV6L 2K3BA 3VYRA 2LMJA 1ZUUA 4X3KA 4AQYL 5LJ5d 1Q86C 1GKHA 5GANf 4KKUA 3J7A5 3L2VA 1PTOD 1UWVA 4M8AA 4KHVA 2PW7A 7AT1B 2JA8G 4M78A 1HZCA 4QT7A 2YUOA 1DYQA 5HY6A 2N55A 5A2QE 1WXBA 3T13A 5KEEA 4H13C 1PD0A 4BI4A 3OYHA 1H9SA 2K3XA 2KOLA 3VS3A 4PZ7A 2XHCA 1SHGA 4JBMA 1QCFA 2YRDA 3QO2A 4OELB 2K6AA 1HNZL 5EG2A 1RAHB 1LTAD 1KQ1A 2QW7A 3LGFA 1V1OA 4ABNA 2N78A 3X26B 4A3KG 3JCMV 2Q2UA 1H3HA 1XNRQ 1A2UA 3G6EA 1VQPQ 1EWHA 3U4VA 2WP8J 1F2YA 2B8AA 1R0CB 3NWTA 4MNOA 3UF4A 2BE7D 4J1MA 5IY0A 4KGVB 2DY7A 3K7AB 3OYBA 1UUEA 5D3DA 2QYZA 3HPWA 2EBPA 2L11A 3FHWA 1CA5A 5KYYB 1OEBA 1IBML 2X4WA 3H0IA 2VVKA 1X3EA 2RBMA 5CMDA 4UPAA 5CVIA 2VUMH 4B3RQ 4RG8A 3JV3A 1BCPD 1I4HA 2K1BA 3PMIA 4JBWA 1G91A 3QBYA 4P75A 4C5EA 3H3VC 1YVCA 3BDOA 3CQZB 3UPUA 3S15B 4DV6Q 2JA6H 2Y4XA 1XPUA 2J05A 1CT1D 3U9OA 4GY5A 2FYKA 2CT4A 1VQLQ 1V8QA 2YUQA 2JM8A 5E4WC 3E9FA 5LJ5g 1YHQT 3UWNA 2J7IA 1LTBD 2HSPA 2VKNA 2ZPIB 3K80C 3P1HA 2LMCB 4PFZA 5CC4A 4ANJA 4M7AE 1MJCA 2X3XD 4DBHA 4CKEA 3KXTA 3H94A 1N36L 2VNUD 3HKZG 3BDUA 4QKUA 1F77A 4XXEA 1N33L 1S5DD 2ALYB 3G71T 1TXYA 2EW3A 3GTLB 3BZCA 1JWUD 2OTJA 1K9MC 4P5NA 3OYKA 1N27A 1PLFA 1BI2A 1HSQA 1I07A 4C3HH 4C0FA 4NKLA 3M3YB 1CFMA 3GLXA 1XXGA 2OT2A 2CP3A 2E4HA 1N34L 4GN5A 4L5TA 1K8AU 3KOJA 4J6YA 1QUQB 2M9VA 1YCSB 3ZBDA 2DBKA 1FVIA 1SRUA 5FLMG 5IYDH 4PJOC 5A2QL 3UDGA 1LTLA 4I65A 4CC4B 2A6HD 2L12A 1EUJA 2B2VA 5M3MG 1WHLA 3EHRA 3CD6A 4RCOA 1KXLA 4ATOA 4QUFA 1HR0L 3EFOB 1IW7D 1U4PA 2J7ZA 2MUYA 2L5TA 5LMUL 5GMKe 4L6V5 2N49A 1HXDA 2ZXRA 4M78F 1UECA 4N8FA 1AHJB 2RJCA 2V26A 5CKHA 3OYCA 3EVQA 4X66L 1GCQC 1PZKD 2NBFA 4YHHQ 3HOXH 4A3BH 4DV1L 2BA0A 3VR2A 2HZYA 2X4JA 1OX8A 2B63B 4MZ9A 1SXTA 1NBWA 5KYYA 1WTWA 1LO5D 4N9TA 2NTSA 1D1BA 2ROTA 3KFUA 2CP2A 4C8QE 4FCYA 1L2FA 1VOMA 2GNCA 3W2DA 5GANd 4P72A 2QQSA 1YJ9T 2F0GA 4EQPA 1BUVT 1Y96B 2JMAA 2IPKD 4ZUIA 3HOVH 2DJGC 4UC4A 3MC0B 1EZ6A 1I8FA 5HGQA 5GMKj 1HA6A 1A3TA 4IFDI 2MO0A 4LFCL 2QASA 4NS5A 1PRTD 2RDFA 3HEJA 3CC4T 4N9PA 1S40A 4M77A 1Y69U 4M77E 4DOWA 5GAMd 2DK3A 2MQHA 2OQ0A 4C92C 1OU9A 3Q8DA 5KE3A 2DUDA 1U1SA 3PSIA 5FU7B 5M3FG 4UP9A 4IZ8A 3I70A 4R0KA 4RTWA 4LUEA 1YJNT 3HFOA 4ODGA 1WI7A 5D6YA 1SYEA 3UDXA 3CKIB 4BY1G 4DV2Q 3MCAB 3S17H 1STNA 3JAMc 2NVTB 1ZYRC 2NLUA 4C2MH 3EAEA 5JVG3 1JJ2S 2Z1CA 4E47A 1S5CD 3FJ5A 2LQ8A 3HRTA 1MV0B 1Y1VH 1A3UA 4OIJA 3BVZA 4YHHL 4BS9A 1DM0B 2DTHA 4IUVA 1QKWA 4RH6A 1YBYA 4RCNA 2X4YA 2PZ1A 4NPSA 3SGIA 4A3IB 1EIHA 2SEMA 1VQOQ 1SPKA 2NYSA 3PO2B 2KNBB 2MF2A 3S1MB 3JB9H 3J7ZC 5IHNA 4DK1A 4JOIC 4UHVA 3A0JA 2YYZA 3UE1A 5K36H 3VS4A 4B08A 5IN1A 3CAMA 2LJ1A 2QI2A 5BN4A 2CW0C 3VDYA 1WIEA 1I94Q 4FT2A 1I4PA 4IPHA 5IYBG 4OEMB 4B3SL 2VGNA 1L1OA 2AK5A 4C3IG 2LTOA 4Z8AA 3J81i 1GRIA 3F70A 5GAHC 1EIYB 2Z6BA 5JJLA 1L1OB 2JA7B 5KYUB 2MPXC 3MEAA 2BE9B 4R55A 4MMKA 2KMTA 1ILPA 5IP7H 3KF8A 4J9HA 2XU8A 2GQIA 4LE9A 3CD6Q 3I72A 1VQ9A 3OSSC 1PMRA 1UE1A 1Z9ZA 2C5CA 2HMAA 2OTLQ 3DMUA 2QG9B 3DXJC 4QMGA 1KHIA 3OW2S 3KLSA 4DR5L 4C0DC 5GAMf 2F0MA 1K76A 1TUCA 2UUAQ 2WACA 2J4XA 3HOXB 4A3BB 3EG0A 1VQ5T 1LABA 1PG5B 4L5QA 1YHBA 5DLOA 1SNCA 3CQZH 1GJXA 2PNIA 4RTTA 2J6FA 1YI2A 3LWUA 4A3IG 3V8KA 4RGOS 1VQLT 4PMWA 3D4DA 3EGDB 4JJBA 1LM0A 3H0GB 3CCJQ 5IYCH 1M5Q1 2FPDA 2XDBA 2GA4B 1E6GA 4N4HA 1WQWA 2OCEA 5EAYA 1BKBA 4NOYA 1JOQA 4XQNA 5C0MA 5IGFA 3HP9A 3A7LA 1MI2A 2K79A 1A0NB 3CCSQ 1QVFS 2JXBA 1BBUA 4XIGS 1XTCD 4RGTA 1BDOA 1AE3A 1XWEA 2JN4A 1CM9A 2UXDQ 3FEWX 3IKJA 1MMNA 2KYMA 3BE3A 1NAPA 4M78E 1BR9A 4A3EB 4JI4Q 2F0QA 2IX3A 2GTJA 2K5VA 2KENA 4UDUC 5IHKA 1SJED 1KC8U 4CC3A 4K5XA 1CKNB 5FW9A 4XAXB 1N32L 5M5YB 3EG2A 1G5VA 2MO1A 3M57A 5HK3A 3B6YA 3OYYA 1V1QA 2ECZA 2L9HA 3F8TA 3VR3A 4OB3B 5GANe 2A3LA 3LGLA 3A8HB 1Q81C 2W10A 1QZHA 1G6ZA 4DPGA 1NEBA 3RR5A 2PZUA 3CC4A 2CQAA 3KDFB 2M2LA 1TU2B 2K28A 1G2TA 3I4NH 4K11A 4C92A 5GAN7 4JJNK 4P73A 4BY6B 1UB4A 4DA2A 1UEBA 1FX7A 3I5SA 1VIEA 2NWGA 4RGMA 4E7JA 1WHJA 5J22A 1AZGB 4D6WA 4NW2A 2KVMA 1HTLD 1VIFA 2DTOA 1WA7A 4LWCA 1VQLA 3KLSX 1MKHA 2D0OA 4H44C 1VDZA 4Y7NH 3ZJYC 1HTPA 2YUNA 3L2UA 3CCMT 1HHVA 4LXCA 4AFQC 1NJIC 3G7ZA 3SHLA 4U673 1ACMB 1GXDC 2K7VA 2PPBC 5J1ZA 4DK6C 3RLFA 2KQWA 3EFOA 2D9UA 4RUGA 1EQVA 3QZ9B 3GP7A 3CBMA 3ICEA 1UUPA 4A4HA 5C5LA 4E7HA 3QKJA 1SSFA 4M1UB 2NUTB 1VQOT 4F17A 1UHFA 1YITT 3D6WA 3VS0A 3QOLA 1I50B 3I56Q 2RKSA 1WZOA 1M30A 4AYBE 1HD3A 4JPBW 4GS3A 3J80E 2BCOA 3NENA 1A2TA 2PI2A 5LMNL 2R6GA 2VQFL 5CORA 2RQWA 4Z9CB 3QHSA 4Q0FA 1SHFA 2EJ9A 4MZMA 4JK1C 4C2MB 5ELBA 1WXUA 2AKWB 3HOZB 1GFCA 2BZXA 2OTJT 3KLWA 5I22A 5KYWB 4C5IA 2PQWA 4R8NA 5BR8Q 1RTOA 2D8JA 3EGXB 2KT1A 5AT1B 3SXHA 4APVA 1C9OA 1PFNA 4R4IA 3CCRT 3UDIA 2I46A 3JCMd 5GAGC 4C0GA 5E3FA 1G8XA 1WXTA 2C0IA 4CJ2C 4XDXA 1TH7A 4A3IH 4RCCA 5FWBA 3RNUA 4OXPA 1IGUA 1FL0A 5DLQE 1WFWA 4BBSB 1KAWA 1ABOA 1E2VA 1DOLA 5GAOp 1KQSA 2PO4A 1PHTA 2HL5C 3WOFA 1Q81U 5FLXE 1LACA 2JA5G 2EXZA 2QTXA 2ZM6Q 1JXOA 1TTHB 1JO8A 3PF5A 1MIUA 2ENMA 2MYSA 3HOWH 1EQQA 2CZ7B 2RJFA 4LN2A 3CPWA 2K5IA 2B2TA 4GOPC 3HGBA 3CCMA 1JR0D 1QZGA 1KDAA 1ZQ1A 2EY2A 1Y8OB 4R1JA 4M77D 4J8QA 5IP7G 2ES2A 1EYDA 3CCJT 2XDPA 2ZPBB 4MDWA 2A6EC 2M0YA 2L4NA 1FWZA 1EY5A 3PGZA 3G71Q 1SE2A 1A8VA 1TS5A 2B3GA 1BI3A 5COYA 4G57A 1HNWL 3BJUA 1LTID 2RVLA 1K8AC 2EVRA 2BE5D 2Z0SA 2HT1A 4KY5A 4WFN3 3U50C 4C92G 3HHTB 1A62A 2NN6I 1ARKA 2CKKA 1WLPB 4M75G 2K50A 2LP5A 3SWNC 3EFXD 1VYVA 1IYUA 1UE6A 5T1GA 3OMCA 1KQSP 4FXGC 2BA1A 2BH8A 1UJ0A 3NHNA 3AFQA 1IW7C 2L8DA 1R4QB 3A56A 3HOVG 5L23A 5GAOr 5KE2A 4ZN1A 1U06A 2JT4A 1YJNA 2HDMA 1PH1A 4A3JB 3S2HH 4DR6Q 1HFNA 4DR2Q 1PCXA 3HOWG 2EYOA 2EJMA 5GJVB 3QPHA 3I5RA 5TSSA 1V76A 1VQMQ 4EQNA 4A4IA 2CUBA 4B3SQ 1E22A 1UHCA 3OY9A 3OHXC 1PTOH 1PZJD 4NP5A 1RAEB 2DPPB 4DAMA 1ENFA 5C0XH 2Z8LA 1XJVA 5I6YA 1PHJA 1BIBA 3IFTA 1H641 2RA4A 2R93B 1I6HH 1VQHA 4QL5A 2G3RA 1NMGA 2F1LA 1XNQL 4K0KL 2ATCB 1SMXA 2XN9C 4H02A 4KHPQ 4X64Q 3PT9A 3MHXA 4C92D 3G4SQ 5FU7C 5BR8L 1W1FA 4XTYA 2EOTA 2PQEA 2M9UA 4LFBQ 5L8RE 4A3DG 2EYXA 3QUIA 2K5NA 3L2PA 1CKAA 1IBKL 2CWPA 3NXWA 5ELOA 1F2LA 3OYEA 2L0AA 1FGUA 2CFMA 2KXCA 3M59A 4XQJA 2AWOA 1LCKA 1Y07A 3GNFB 4G4KA 3KJPA 1G3WA 1WTHA 3URYA 2RQVA 1LYLA 2CSQA 5IIFA 4A3JG 1Q1BA 3K57A 2VY3A 2FJ2A 5LJ3d 4C8QF 2SEBD 4JI0L 1T3LA 1JXMA 4J9EA 1N34Q 3QXEB 1LTGD 4LMQD 5LMNW 2YLCA 3AFPA 4K5VA 2E2IB 2AZSA 4E2FB 5KCOA 2I5HA 3CC4Q 1EWCA 4Y7NB 4GOPA 4G7OC 3D3RA 5CV7A 2DL4A 1TG0A 2JQOA 4RHRA 2L55A 2MHVA 4P74A 2J6OA 4QJFA 2IG0A 1AP0A 3LX0A 2F0DA 2KGTA 2JTFA 1X9NA 3C1FA 3I7FA 3I35A 4IPDA 1HZAA 1EOVA 4LF6L 4DAYA 2NVXH 4G7ZC 4NXNL 4JI8L 2QGFB 4CDFC 3HOUH 3T56B 1U8RA 2E70A 2ED1A 1M1KC 2QQRA 1IB8A 1VQ8A 4Z88A 4DK0A 4LFBL 4OO1H 1NNXA 2UXCQ 3LGJA 1E7ZA 4DNRB 5CV9A 1JJGA 4LUZA 3X28B 2QDBA 2FG0A 1XPRA 4PQXA 2JEAI 5C3EG 4ZK9B 3C4SA 2FB7A 3OBWA 1ZA1B 4J7IA 3MEVA 1D3BB 1N5ZA 2D6FA 3NK9A 5HKCA 3CCJA 2PQAA 2Y90A 3PFSA 3J80L 4DR4L 3ZYYX 4J9GA 5GAN8 3M7NA 1EYGA 2YTYA 3E9HA 5ELFA 1NM7A 1JJ2A 4KBMB 4PJJA 3PQIA 3PF4A 1A6XA 1HRJA 4LF8Q 3RZDB 3S14H 1TS9A 4DKAC 2EVBA 5GAMj 3MXUA 2WAQG 1I4RA 5ELNA 4JI3Q 2DTIA 1TKWB 2H8HA 1MMGA 4QGUA 1OQKA 2R5MA 3LWEA 3FC3A 3GNGA 1DZ1A 3T1HL 4RGNA 1AZEA 4NXML 1Q7YR 2GVAA 4ZGDB 3QYGB 1RTNA 2HUGA 2DVEA 1M9SA 4OGCA 2NN6G 3JB9F 3MXNB 1BK2A 2R92H 2VUBA 2JJQA 3RERA 2JXMB 4ZTJA 5A35A 2HDAA 4LF9Q 3P7JA 4C3JB 5A0LA 1PRTF 3GDEA 5J3BA 3A74A 3NTKA 2LS01 4BBRH 3IAYA 3V8JA 2DD5A 1WJSA 3E6ZX 4KRTA 1TWHB 2FZKB 1E1OA 1TIID 2AMCB 3MTSA 4IO9A 2UUAL 2ASBA 3KLRA 4BWGB 4AFSC 3DLMA 1ESRA 5KCHA 1VMPA 4F7UF 2EFIA 2E3HA 5LJ3j 3NFCA 2QQAA 3MKDA 1PD1A 2KBTA 2F5KA 1JB0E 1X69A 1B44D 3D31A 4LDWA 4WF2A 3PIOA 4DAYB 5KIXA 1VA7A 2HHHQ 1IGQA 2FINB 1OXXK 2EQKA 1KJWA 1D1KA 1VQOA 1M2VA 4D8DA 4RA8A 3TU4K 5IWAL 4J5YA 4A53A 3RUZA 3MXGA 3H91A 1AW7A 1C4QA 4JDSA 1FGBD 1H9JA 4RTUA 4VUBA 5A0GA 4IKFA 2F0EA 3I4MG 1JBMA 4PV1C 1V29B 3LLRA 4QVZA 3EH1A 2E5KA 5LJ3g 1M90C 3M9BA 2K9GA 2OWOA 3PO3B 3MO8A 4A3CG 4JZ3A 1IYVA 1NZ9A 3MEFA 4PLLA 3NBHB 2DO3A 2KRNA 2YT6A 2DRKA 6AT1B 4MDXA 4UP8A 3RD4A 2I07B 5C3EH 3NUCA 2AZVA 2K4YA 4OP0A 4FDBA 1MSHA 4KH1B 2MFIA 4DV0Q 2MOXA 4HMIA 2A5HA 2LJ3A 2RI5A 4DUZQ 4POFA 5IGCA 4JI2L 3H6MA 1VQ4A 2PMZE 1EL0A 2G5DA 3HTRA 1HZ9A 1SEBD 4JJCA 3I4OA 4F7UE 4OONA 4FYDA 2Y0SG 3OBYA 1X3QA 3VR6A 3L2WA 3G6JB 2KECA 4PJMA 2EY6A 4F7UB 5IT9c 1TOVA 4PJOA 2RHZA 3PMTA 5D14A 2H3EB 1W2BA 1V1CA 1KD1C 3ITPA 2V8IA 3EN2A 4JW0A 4C0DB 3K8AA 1GCPA 4Z02A 4LNPA 4ESRA 1W3SA 2A6HC 4K6LA 1IBMQ 2K5QA 3PO2G 3KUFA 3QDFA 3CMET 1B1ZA 1PZID 1ZA2B 3GO5A 1TS4A 3ERSX 1CKBA 4HIKA 2LXKA 2Q8IB 3T53B 3HG9A 2X6LA 1RAIB 5IYDG 3JCMP 5CV4A 4EIKA 1GO3E 2JSOA 2R61A 1ZUKA 1PH5A 2QA4T 2KXDA 2F03A 1KNEA 2DEUA 4OGQC 3UDFA 1XYIA 3GTPH 4FYVB 1SN8A 3DWAA 1U4RA 2JA7G 2K33A 1XOVA 2UUBQ 4QVCA 2B29A 3IL8A 1M2VB 5AFWA 4GKKL 2PVOB 1Z9FA 3BG3A 1D2BA 2B2UC 1B9MA 2G6FX 1ET9A 4DK3C 4KI0A 2UXBQ 2JA7H 2O5IC 1PKTA 4IALA 2FHTA 1RUWA 2GTOA 4DV5Q 1TUDA 2GVBA 4RWSC 3PUZA 4C3JH 1OXTA 1KC8C 1TWAH 3RN5A 2ABLA 3RIRA 4BB7A 3G4ST 1XX8A 2NYZD 1IBKQ 4X3SA 1HJDA 1QG7A 2F0NA 5LJ5j 4OMOA 1STAA 2E65A 3L3OC 1MSGA 2FFKB 3D0FA 2E6NA 4S3SA 3PO2H 2IIMA 4DF7A 5GAOq 4JI8Q 2BTTA 3F2UA 2Q2HA 1I5OB 4FYYB 3H0GG 2M51A 2J6KA 5IH2A 5KYNA 3UE0A 2WB1B 4ALPA 4UP7A 5CGKA 1H95A 3TCJA 2NZ1D 1PWTA 1STHA 2RI3A 1QWEA 4EMKA 4R4QA 1X56A 2EKHA 3E2UA 1NUCA 1PTOC 3OYIA 1T9HA 4BA1I 3RZOH 1Q81R 2DETA 2AHOB 3PCOB 4PJOB 4JVZA 2CS7A 3A55A 4ZLTF 1T3SA 5EKLA 4LUOA 1R77A 2HCIA 2JNGA 2D5DA 4EVOA 4LF4Q 2H1EA 5CO7A 3J81L 4IPGA 2NN6H 1OU8A 1EEID 2O9VA 2C0OA 2DAQA 1VQKQ 5GAN2 2XWBB 4N4IA 3A8MB 1YIJA 3BVMA 3L9AX 2FHDA 2SRCA 1P16A 1M1FA 1GOZA 3N6RA 1YI2Q 1BIAA 1LT6D 3KBXA 1U0LA 1QP3A 3KYHC 3HS0C 2RJEA 1Y8NB 3WVDB 1SAPA 4RMFA 3CC2Q 1G291 4RKLA 2COWA 3D4RA 4CDCC 1DJRD 4B9WA 3MXPA 3CCST 1UEAB 1M1KR 3I8ZA 2OF1A 3AYHB 4POGA 3CMAT 1NYGA 3MEHA 1JB3A 1XMQQ 1W4SA 3NQTA 2GBQA 2B2WA 1XNQQ 2OTLA 4DV0L 3PV0A 1M4ZA 4K0KQ 1CTMA 4HKEA 1SNOA 3PUYA 5HGTA 2K75A 4V2SA 2L15A 4HXJA 1QVFA 5FJ8H 3Q23A 1N9RA 1AOJA 3S3NA 4NDXA 2DBMA 2GCXA 4GNXC 4J8OA 1T0JA 1PFMA 4WRDA 4QQGA 2E2HH 1WCMG 2RB6A 2XK0A 3E0EA 3CEYA 4DBFA 3SHWA 1XQHA 4C1NI 1YHQQ 3CXCA 3QSUA 1Y7XA 5GMKl 1VQAA 2EYPA 5M5YH 1JB7A 2HQXA 1TWCB 1SNMA 1TY2A 1STBA 4XK8E 3RNJA 2B2YC 2NUTA 1N8RU 1M90U 2C0TA 4QB4A 1E0BA 3BY7A 3LYIA 4KY7A 2LQKA 1B53A 4FIBA 4LUDA 3W1GA 5DAUA 1XNIA 2QA4A 4ID6A 1WTRA 3MEUA 2RF0A 2RCFA 3E9IA 1YJWA 4KUDK 4OB2B 3J7AV 3OW2A 1OV3A 3NGPA 1BVSA 4NL2A 4ZGJB 3TQ7P 1QVFP 4IPCA 1PRLC 4XT1B 3HOZH 1CI3M 2R3ZA 2B39A 5DM7R 3TSWA 4JRPA 2B2UA 2PYKA 3HRSA 3CRLC 5JAVA 2PVDB 2KRSA 3L0OA 4B3RL 2UXBL 4M7AG 2I5LX 4ZGEB 3BU2A 4JLIA 1LT5D 5JPNC 4XYOA 1SNDA 1LTTD 3NTHA 1M8AA 4AYBG 3L42A 4KN7C 4HJ9A 1RL2A 1U4LA 1V43A 4DBRA 2ZAEA 1PH9A 5CR2A 1AWWA 3CCRA 3KF8B 1IHZA 1IRXA 3MZ5A 5CBEE 3KDFA 2RK2A 1TT2A 4PNYA 4M75A 2N88A 3TEHB 1W6XA 2DL8A 4MZTA 4X1VA 3ZFJA 2K05A 5EPLA 1E2WA 2I5MX 1JJCB 3ER0A 3EIVA 4C5GA 1FMWA 4RFBA 4C5HA 4JI7Q 2HQEA 3R2TA 1ZLMA 1NJIR 2A73B 4DGZA 4DR4Q 1WX6A 2DYBA 5I11A 3DEPA 3OW2P 1PDQA 1QUQA 3CPFA 1EIFA 3U23A 2QEXQ 4HCKA 1Z7TA 2D9TA 4LDUA 4WJWA 5GMKi 1DOKA 4X62L 4BY6C 1OULA 1OXVA 2RCNA 1D3BA 1LTSD 1U5KA 5I9PA 2UUBL 2KYBA 1IHWA 1VQDA 1W6KA 3E5SA 3NPPA 2RSNA 4MTKA 4DXGA 2Q2IA 1JT8A 4JLGA 3P20A 5ECAA 3C12A 2E12A 4F87A 4OMLA 1E1TA 4P2CB 5M3MH 1X2KA 5M3FH 4JYAL 4PJNA 3S2HB 1PYWD 3CCLT 1YNND 1CSPA 4HJ8A 4MHEA 3DB4A 4DR1Q 3JCMc 2ENBA 1CA6A 4M75C 3JB9D 3PMFA 4M7AB 3S2DB 2NTTA 1Q7YC 2MAMA 2EYZA 3RKWA 1ZBJA 1AWOA 5JJZA 1Q1EA 2DXBA 3NPFA 3CPWP 1YIJT 4AYBB 3FKIH 1KIXA 4R9WA 1WNLA 2RJDA 3GTLH 3GTGH 1MNDA 2N3SA 4IFDJ 2K32A 3HOWB 3LW5E 1P8LA 5GMKh 1OPLA 3LH5A 2EPBA 1VQ6A 3BYYB 3H6ZA 4JUVA 3DKMA 5KYWA 4R4OA 2BZYA 1HJPA 4DU9A 4IUNA 1CSKA 1D09B 1NR2A 4X3TA 3CRKC 5KRUA 5E1FA 3CCET 4PJOE 3S1QB 1TXQA 4RTZA 3CMAA 3X25B 2AUKA 3CW2C 3SK5A 4TVAB 1BI1A 3M7GA 5D3IB 1VQ9T 5EBDA 4HVWA 2EGEA 2E6ZA 3GV3A 2M1HA 1L0YB 1X6OA 2JA6G 2A1AA 3FDTA 3CMEA 4BDYA 1UG1A 3Q22A 2RH2A 3CCQA 4DOVA 3O5ZA 4KMUC 5FO8B 2E5LL 2B2YA 2EYWA 2CZ6B 1VQNT 1TWFH 2F0JA 4YCWA 1S72A 5KNDA 5H1SE 1R9TB 2V1RA 1Q8IA 2RHSB 3NEMA 5BN3A 1HFGA 3S1MH 4KY6A 3CCUA 1GD7A 3P75A 1JCKB 1C1AA 4OF1A 2HBWA 3VYGA 4M75F 4X64L 2MJ8A 1OO9B 4F8MA 3HL8A 2XI9A 2UU9L 1G51A 2EQSA 2UUCL 1SMYC 1ZKOA 2HSEB 2K5DA 2Z6KA 1GM5A 2HHHL 3P8BB 1HXYD 1UE7A 1MBYA 2BDNA 2DMOA 3KK7A 2DM1A 4IJHA 3CP0A 5CYUA 4A3FH 2EYQA 4KD4A 4L63B 4RTYA 1B7TA 3G6EQ 1Y1WH 2GN5A 3NE5B 3PUXA 3JB9G 1F9PA 2L1BA 5LJ3e 3SWNA 1G83A 4HMJA 1CHPD 1J8IA 2JTMA 3MJXA 3I4MH 1B3AA 1NYFA 3VR5A 3R6NA 1QCBD 1VQCA 4A76A 4FO2A 1GUNA 3G7LA 4MMLA 1AVZC 2VC8A 1H9SB 4RKUE 1KQSS 4FF4A 1TWCH 4A63B 2LQWA 2VXEA 2LX9A 3K7UC 3BYTB 3TN2A 3TRZA 1D1CA 3EGXA 2VV5A 1K4US 2KUMA 2ZPFB 3M4OB 3J80i 1T5XD 4AQYQ 4RHSA 2RI2A 2EQIA 3META 1S5ED 1EY9A 2XGTA 4HCZA 2ZCFB 4M75E 3J7AF 1WCMH 4YWLA 1FXXA 4JI3L 4HJ7A 2RA2A 3LWIA 4K8IA 2Z4HA 2O2LD 3RUXA 2RHUA 3VS1A 5GAN5 4OWTB 4DR5Q 2QQ9A 3S14B 2YU9B 2EKOA 1JC7A 4A3KH 1PH2A 5C0XJ 4B3TQ 1BCPC 3G48A 1K3BC 4IOCA 4CI0C 4M77C 3JCMb 1TQOA 1Y1VG 4C0ZA 3RLNA 1V1PA 2KJXA 1B8AA 1CKOA 3FVQA 4LF7L 1K8OA 3FKIG 5I2YA 3QZ5B 3V2TA 2DN8A 1KC8R 4GLMA 2WAQB 4DEYA 5GANh 2XRQD 1IREB 1QVGA 4J83A 3CCLA 2BE5C 2LQNA 3A7AB 1JRIA 4A3MH 2E10A 2DJZA 4B3ML 3C46A 5GAEC 4EQ5A 5C44G 2DIQA 1MMAA 3K5NA 1LVKA 2QEXA 4K14A 4J9BA 1RDPD 4CHTB 1XPOA 1X43A 2G9DA 2OXPA 4O1NA 3V05A 1UGSB 4PNOA 3C0CA 3RN2A 3H0HA 1RABB 1PNJA 1WHKA 4EQOA 2KHSA 1ILQA 1JWSD 4C3JG 1SFOB 1IHVA 4BY7G 2JJ9A 3FIFA 1YEZA 4IN3A 4HT9A 3N52A 2K57A 2PU9B 3FPUB 1C6VX 1SYBA 3TP5A 5LHY1 1N8RC 2JEBI 2Z6KC 4JV5L 4WTOB 3X3NA 2D8HA 5A0DA 1KAAA 2C9OA 1QVCA 2LC4A 4XTUA 4PL6A 3VJPA 2XRSD 5EKKA 2ATWA 4GN4B 2AIRB 3QG1A 1N32Q 1FMKA 3I56T 4HSPA 2R57A 4MTNA 3TSSA 5C5MA 1YITQ 4A4EA 2KBNA 1MGQA 2AT1B 2HIVA 2FPFA 1F9QA 4B3TL 3I4NG 3M0RA 4A4FA 1G8ZD 1TWGB 3S2DH 3Q1JA 4FYXB 2CZ0B 4FNFA 3QJ6A 3W1BA 5LL6X 2XICA 4A93B 2FPEA 3FKIB 2NVYH 2KK4A 2R7FA 3ONAB 4AFZC 2MIOA 3BW1A 4BY1H 1GUSA 4A4KA 2RF4A 2OQKA 4DNTB 1QLYA 3M0SA 1E6HA 3H9NA 1RF2D 1YWPA 3U58A 3OB9A 3SDZA 1XMOQ 1PSEA 1O7IA 1N8RR 1STEA 3PTAA 4DR2L 3EG9B 1N9WA 3H3VH 3N5BB 9ATCB 1MHNA 4M7AC 1E24A 5C3XA 5FLMH 4DBQA 1DD2A 2CGHA 1I6VC 1LT3D 3EQLC 1STGA 1JEGA 1F9RA 1SNQA 2PQAB 5E4XA 1LUZA 1UDLA 2FRYA 4HA8A 4XTXA 4BBRB 1RI9A 4CKBA 4M78B 3R93A 1SR3A 1SRMA 3SK8A 1AWXA 2WV6D 5IT9E 1I5LA 3SR1A 2MP1A 3FMCA 2EY5A 2YUPA 2V8KA 1JQYD 3HKSA 3G6ET 1PH4A 2F4IA 4CBVA 1K0RA 3REAB 3J7YW 2RHXA 3AT1B 1HNXQ 3JAME 1TWFB 4LAAA 1JQQA 5AYFA 1SYFA 2I0NA 4PJLA 5F2DA 2A6ED 5GAN4 2HNIA 4A3CH 1KK7A 1IXDA 4OWXB 4J7FA 8AT1B 3HZXA 5GAOm 2RSOA 4DR6L 1ZSZC 1EYAA 1FNUA 1Y14B 1NSNS 3GTPB 3LH0A 3CC7Q 2M16A 1YN8A 3M0TA 4EPCA 5L37A 1VQFA 3K5MA 1XMQL 1J5EQ 4BUGA 5EC7A 4JI4L 4LF5Q 2EQMA 2GGRA 1ESFA 1SYGA 2CT3A 4IUTA 2KCNA 1L0XB 3S9WA 4Y52H 3W5OA 1HNXL 3S3MA 1W70A 5FLXL 4DV4Q 2PTKA 3OS0A 3F2DA 1H9KA 2AHJB 4XQ3A 1EZZB 2J0TD 2XVSA 3TP7A 1SRLA 3NP8A 1DGSA 3S15H 3H8ZA 3VA5A 3GV6A 3PIPA 5LMUQ 1QQJA 4KK7A 3VRZA 2E41A 4DFAA 1I50H 2ZT9C 1QOHA 2A37A 4OMNA 4HVVA 3GTOB 1OX9A 3VUZA 3ULJA 4BBRG 5IGBA 4GZYC 4L5GA 4PJOD 1VQJA 2X69A 2IX0A 3NWSA 1HCZA 2CDTA 5IE8A 2DXUA 4IIOA 2N8NA 3OW7A 2EY1A 4H7BA 2MWPA 2VS1A 4XU2A 2Z0WA 1BOSA 1UAPA 3MVVA 1M3BA 3M4OH 1B7YB 3I91A 4X6AH 5JPMC 1X32A 3HOYB 1NEGA 5IT9L 5CQYA 1X01A 3L7ZC 1ASYA 2JA8H 3I9QA 4ILWA 4YY3Q 1MJEA 1O78A 3GTMH 2JS0A 3CD6T 1M8MA 4KKTA 4M7DG 5HCKA 5FU6B 4BXXG 1YFNA 1YP5A 4PZ6A 3OYGA 1FJGL 1NMFA 1LTRD 1VQIA 1PYSB 2FZGB 3OWFA 3QB3A 1I4K1 5I2SA 3NBIA 1RAFB 2CUDA 3F2CA 5GAOl 3M4YA 1EY7A 1EZ8A 1VQNA 3OSOA 1O7YA 4O5VA 3CCVQ 1S72T 4X3UA 2LXJA 2Z9HA 4PFPA 5CCAA 1VQGA 3ME9A 5M5XH 1GHKA 3S1NH 3M9QA 5EGTA 2VQFQ 3CCVT 1KFZA 3ASKA 2B2TC 3OYLA 4QQDA 3MHBA 2HCCA 5FK9C 2P0KA 5C4XB 3HOUG 5DM63 2YHTA 5GADC 4FL6A 1D7QA 2QDLA 1SE3A 1C7YA 1JE4A 3GD7A 1VF5C 1RI0A 5LJ5e 1EU4A 1RACB 1VCIA 2CP0A 3EJIA 1HK9A 3JCMg 1UGQB 1K9AA 2K14A 5EKIA 4F88A 2EYFA 1TS2A 2UXCL 1VQ8T 1O7LA 3VYUA 3HRZC 2Q2TA 2YTVA 2MCNA 3E19A 3PUWA 3GF5A 3M56A 2O31A 4OMFB 3I55T 1KIKA 2E74C 3ULPA 3QIAA 1TS3A 1PH7A 4NB3A 4A3DH 3TS0A 2WKCA 2E2IH 3VYSA 4AFUC 3STBD 1VMCA 3OYAA 2IJ0A 3OWEB 2RQRA 1BF4A 1YJ9A 1WTQA 3RKXA 1OXUA 1VS0A 1BNZA 2VL6A 3HOZG 3K0YA 2KEAA 1ICFB 2E5LQ 2F0HA 2XSCA 3MAQA 2BKDN 4WCIA 1IYJB 3HSBA 2K5HA 3IRBA 1VQBA 4DV3Q 2HEQA 4IFDG 4BD3A 1U3OA 1I6HB 2CSIA 3AU7A 5KYXA 1X3FA 1A15A 2COZA 3J81E 3HOUB 4UAIA 4ME3A 4EX5A 2IPOB 1E7OA 2A36A 4JZ4A 1LOJA 5KYXB 4A3GB 2L3PA 2XMFA 5CKFA 1K83B 2J06A 1MHWC 2VW9A 2K03A 1EY6A 2PVGB 4HTHA 2HQHA 4BE0A 1NBEB 1H9MA 3SE0A 2XD0A 5JEAJ 2DL5A 2DF6A 1BBWA 1SYCA 3OS2A 2HL3A 3OYDA 1ZUYA 4J6WA 1VQEA 4DV4L 5M5WB 1UGPB 2P4RA 3P8HA 3JRZA 4RAUC 2KHIA 4ZNXA 2JA8B 3DWQA 2BOSA 4RTXA 2RK1A 2PNHA 4LF6Q 3C2PA 2E3IA 3AQQA 2PZTA 1EQTA 1UE9A 3GQBA 4JC0A 5CR3A 3SD4A 3RR6A 3A5UA 2O2OA 2VXWA 1B9NA 1C0AA 1LNXA 1RHPA 4EMGA 3WWVA 2KEDA 5I4DA 4C92E 1L1OC 2YV5A 2XDDA 3QYHB 3CCUT 4JG2A 3SEBA 3F1ZA 1GUTA 1G6PA 4JJDA 2E8GA 3I2ZA 2EGCA 2EYHA 3L2RA 3VA7A 3OYMA 4N0AC 2EQUA 4C92B 1Q90A 3C94A 2GQVA 2F3IA 4ME7A 3Q0AA 1TU0B 5CBAE 1WTVA 1XMOL 5IAYA 2K5WA 3T1YQ 2MMPA 1D0XA 2O4XA 2JOYA 5CKDA 5GANg 1QMCA 2F0KA 4JI5Q 1SMYD 3URGA 4LW1A 3D4WA 4CKCA 1WD1A 2KDSA 5IGEA 2NVXB 5IYCG 5IGDA 4RCBA 5K36G 5IGGA 2M02A 3GBQA 1A3VA 1KL9A 2DZ9A 1NY4A 1O80A 3H3VI 1P92A 4J15A 3V7SA 4J6XA 1K9MR 2A19A 2ROLA 2RD1A 1X3PA 4M7DC 4OMQA 2C06A 2ZPEB 1BU1A 1V1PB 4FF2A 2FZCB 3X3MA 2FRWA 3SK4A 1Q46A 3HOYH 2XG8D 4ME5A 1K1ZA 3GPLA 2F1MA 2JMCA 4B6MA 2JA5H 1A63A 1FYNA 3EH2A 1J6QA 2EYLA 1G3YA 3INZA 1AZPA 3RZDH 3RDVA 3OQ5A 2FEIA 3EG3A 5GAOn 1WHGA 1PM3A 2QGQA 5EPJA 4AH6A 3CCUQ 3K5LA 3JCMW 3DUZA 2FVUA 4C8QC 4WJ3M 4JBJA 5JEAH 4IUUA 2CYZB 2KE9A 4M78C 4J9CA 2AWNA 2RN8A 3JCMh 1SG5A 4BI8B 1BYMA 4O0AA 3O8VA 4GOPB 4UY8C 3L2ZA 4LDYA 4F14A 3GP8A 4C8QG 4DV5L 1D5XC 2RHYA 1HPCA 2G9HD 3CMEQ 5IWAQ 4OWWB 1PC0A 1TWBA 2V1QA 3NHHA 1U1TA 2BDOA 4KUIA 4LD9K 4WORA 3KF6B 2Q8TA 5KNCA 4ELYC 2HKQB 4R56A 1LT4D 2JUFA 3E0JA 3M4PA 3CCEA 3OSVA 4K2LA 5DEHA 1IBLL 3CMAQ 5M3MB 4RTVA 1B70B 2KAFA 1KSWA 2JS2A 1KNAA 1HUNA 2DNCA 5FO9B 1HUMA 2GFAA 2LCSA 2O4XB 1IO6A 4R8IA 3OS1A 2VGMA 2X9HA 2ZXOA 4K5WA 1BBXC 3KJOA 2VQEL 3WVEB 1VQ6Q 1N36Q 3A98A 4FU6A 4J9DA 3TSZA 1KRTA 1DOMA 5AJ3Q 2ICIA 1R9TH 2DA9A 3RKYA 2LX7A 1CSQA 1JOKA 2IT1A 4DUYQ 2QCPX 4LD6A 2NWMA 2Q8RE 2RM4A 2X51A 2LJ0A 1GUGA 4YY3L 3K7AH 3PIO3 3BS1A 3SK6A 5IXFA 5C3WA 2F0IA 2DD4A 3WOEA 4HCEA 3GIBA 3PNWC 3T1HQ 2NUZA 2PI2E 1GFDA 1GXIE 2M0OA 3T1YL 2YLBA 4HT8A 1PSFA 2LFNA 2YRVA 1KRSA 2PCFB 4KTAA 1ET6A 4LFCQ 2DERA 3L1AA 1AT1B 1H92A 1LV9A 1M4VA 1ZSGA 5C3EB 4FSSA 3S1RH 4C8QB 4LUVA 1X2QA 1Y1WB 2AUJD 1TWAB 5FWCA 5GAN6 1QVGS 2VWFA 3VYTA 4L6TB 1BCPF 4GNXA 1S1NA 4Y91A 1KABA 2HCKA 2D0QB 3D8GA 4JBKA 1QCOA 1ZX6A 2F4VQ 1YITA 2PNRC 4J9FA 2WKDA 1IL2A 4J9IA 3V96A 3JCMf 2BZ8A 2QK0A 1C48A 1WJJA 1CUKA 2NB0A 1RODA 2KCMA 1KDCA 3I90A 2YU9H 1X6BA 3FLGA 1K8AR 2KCCA 4JS4A 3AB9A 4DQ2A 3K5OA 2A08A 2L3SA 4C92F 1GL5A 2K6DA 1Q7YU 4LFAL 4M7AD 5EBCA 2DYIA 3CHBD 3CCRQ 2L0CA 3KF6A 1QCNA 5M5WH 1A0IA 1EFNA 3HKZE 2IWHA 4BA2I 2UUCQ 2UU9Q 4FT4A 2CWAA 3TQYA 5T1IA 1MMDA 3R2IA 4YWMA 3QWXX 3HP3A 1BO0A 4X65Q 4IOAA 1KLGD 4XU1A 5C4ZA 1IZ6A 3PVQA 3FDRA 4M7DD 4HVUA 3J81j 3I4MB 2AQ3B 2LT1A 4OO1I 3CCLQ 1IKLA 3BVGA 5K5PA 3WDNA 2R7ZH 2K52A 5ELEA 4JRKA 1G3SA 3H15A 1Y1WG 4G7HC 3G71A 4ZAIA 1SROA 3M55A 5GAMh 3Q6SA 5FKAC 3TS2A 3CBOA 4M75D 1M8VA 2ZTCA 4DR3Q 3M85A 1PH8A 4EDUA 2FO0A 8ATCB 3CCMQ 4KGZB 5LL6S 4NL3A 1C0MA 1K8MA 3CBPA 1OI1A 3SWNB 3D6CA 4PG3A 5KGUA 4JI7L 1Y8PB 4LF4L 2P0PA 1AEXA 2DNUA 4OB0B 3MWYW 4KT0E 3NELA 2HDLA 3J81c 4C3IB 2C35B 2A0FB 2OJ2A 3BZKA 4YCUA 5J26A 2KQ3A 1F9SA 3RESA 4HEDA 2NVYB 4F7UG 5D6XA 2LNVA 1ICWA 1WYDA 3QWNA 5IOCA 2NUCA 3MFYA 4KJOA 1YNXA 1O75A 2OAUA 4ULLA 3MXNA 3OIPA 3JB9J 2F0LA 2E2HB 3M58A 1LPLA 1II3A 4HIOA 4A93G 1Z9QA 2EZVA 3S6WA 5GMKm 1IXRA 2PZWA 2JTEA 4N0AA 4A3MB 1OXSC 4R4CA 3OA6A 1YNJD 5CKEA 3LNNA 1X65A 1PTOB 3NMZC 1Q82U 1FNWA 4HIDA 1SDFA 2EJFC 1QWYA 4LDXA 4A3EG 3A54A 2DKGA 2NVQB 1EFID 4GLAC 3QR8A 4QVDA 1Y96A 4FVMA 1XTDA 4XQQA 4DR3L 3GTKB 1D1IA 3SFMA 4KD3A 3S3OA 1FD7D 2P4TA 2AQ2B 1EY4A 3TP8A 3A8KE 2YTXA 3CCVA 2DILA 4ZQ3A 4GLXA 4JI6L 3ZEHA 2LVMA 3JCMe 1HYOA 2EDGA 1N33Q 1KTKA 2KHJA 1VQ7Q 4A75A 4IIMA 2EE1A 2YSQA 5IYBH 2K5FA 5FRMA 5FU6C 1J9OA 4IQZA 3R3OA 3A8OB 1CKNA 3H0FA 2MNAA 4DEXA 5JJIA 1NLOC 4OIKA 2E1HA 1PVOA 3SVMA 5KYIA 2CP6A 2V1CC 3HFZB 1PH3A 4A3MG 1LJOA 1M2OA 2B8FA 1Q86R 2AKKA 1EWIA 1FYCA 5AJ3L 2A28A 4LDVA 1NJIU 2F0OA 1N9SA 1VQ7A 1K0SA 1VQ6T 5ISRA 3GTOH 1RADB 1PTOF 1HNWQ 4X66Q 4PMCA 3K58A 3ERQA 3A1PA 5JJKA 4BXXH 1BB9A 4QIWE 4A4GA 2D0PA 1J5EL 1CK1A 2HQLA 3MA2B 2L89A 1EY0A 3STBC 3JCMJ 2CHBD 4LF5L 3RLOA 1IBLQ 3H41A 3GTQB 1AFPA 2LKVA 1GBRA 4ZUJA 1DONA 3A5ZB 2DE0X 1EX4A 2VB6A 2F2XA 2PUOB 2QAZA 5I2MA 1B34B 2QDYB 4MN3A 5C0XI 3BDLA 2KY9A 3V8LA 4M4ZA 2WFWA 3KFVA 4PJOG 4QF4A
chains in the Genus database with same CATH topology
3QWYA 4GBQA 3CQTA 1SEMA 4J9GA 2RNAA 1JEGA 2K3BA 1NM7A 2LMJA 1ZUUA 1UDLA 2FRYA 1RI9A 1SRMA 1AWXA 2H8HA 4QT7A 2YUOA 2YUPA 1WXBA 3REAB 3VS3A 1AZEA 1J3TA 1SHGA 1QCFA 1JQQA 1OPKA 2I0NA 1I1JA 1BK2A 4Z89A 2DLPA 2HDAA 1H3HA 3M0TA 1YN8A 5EC7A 3UF4A 2GGRA 4KRTA 2CT3A 1UUEA 1W70A 4AFSC 2EBPA 2PTKA 2D1XA 1SRLA 3EG1A 2KBTA 1OEBA 1X69A 3H0IA 2VVKA 1VA7A 1YWOA 4CC2A 3VRZA 1KJWA 2KRMA 3JV3A 1PKSA 4D8DA 2A37A 4OMNA 4HVVA 1WYXA 2JM9A 2J05A 4RTUA 2RQUA 2YDLA 2CT4A 2YUQA 2CDTA 2JM8A 4IIOA 2E5KA 2J7IA 2AKLA 2K9GA 2HSPA 2VKNA 1WDXA 4JZ3A 1AD5A 2KROA 2YT6A 2KRNA 1M3BA 2DRKA 2X3XD 1JU5C 2AZVA 1NEGA 2DL3A 2EW3A 2MOXA 2LJ3A 3I9QA 2L2PA 1HSQA 1I07A 2JS0A 1M8MA 5HCKA 2O88A 1YP5A 4JJCA 1H8KA 1YCSB 2DBKA 2CUDA 4CC4B 1V1CA 3EHRA 2K7AA 1GCPA 4ESRA 4LNPA 1T0HA 1CKBA 1KFZA 1UECA 1GCQC 4EIKA 2QDLA 1ZUKA 2KXDA 3VS2A 2ROTA 4OMPA 1K9AA 2GNCA 1XOVA 2MCNA 2JMAA 2G6FX 1PKTA 2O31A 1KIKA 1B3QA 1RUWA 2GTOA 1TUDA 1AEYA 2ABLA 4AFUC 2RQRA 2X3WD 1HJDA 4OMOA 1BBZA 4R0KA 2KEAA 2IIMA 4RTWA 4LUEA 3RBBB 1WI7A 3M0PA 4WCIA 2BTTA 1VYUA 2HEQA 2M51A 2J6KA 5IH2A 1U3OA 2CSIA 3FJ5A 1PWTA 1E7OA 1MV0B 1QWEA 2A36A 4JZ4A 2EKHA 2L3PA 2XMFA 2J06A 2W0ZA 1QKWA 1T3SA 2PZ1A 2SEMA 1SPKA 4AG1C 4ORZA 2EYYA 2KNBB 2DL5A 2DF6A 1ZUYA 5IHNA 2CH4W 2O9VA 2P4RA 2C0OA 3VS4A 4ZNXA 2LJ1A 4RTXA 2SRCA 1WIEA 1UE9A 2AK5A 2O2OA 4Z8AA 1GRIA 3VS5A 4JJDA 2EGCA 3UATA 4J9HA 1NG2A 2GQIA 1Y57A 4LE9A 1GBQA 1Z9ZA 1NYGA 2GBQA 3SEMA 3THKA 1K76A 1TUCA 1ABQA 4HXJA 2B86A 2DL7A 1AOJA 2F2WA 3EG0A 2D0NA 2DBMA 2LNHB 1T0JA 1X27A 2DX1A 4D8KA 3GBQA 2PNIA 4RTTA 2J6FA 3PVLA 3PE0A 3SHWA 1GCQA 2ROLA 4JJBA 3UA6A 2FPDA 2DVJA 4OMQA 1E6GA 1BU1A 4AG2C 2L3QA 3RNJA 2FRWA 2C0TA 2K79A 2EPDA 1K1ZA 1A0NB 2JMCA 2JXBA 1FYNA 2RMOA 5IHIA 4LUDA 2LZ6B 3UA7A 2RF0A 2KYMA 4CC7A 2FEIA 3EG3A 1OV3A 1RLPC 3NGPA 1M3AA 1Y0MA 2GTJA 5IHKA 1PRLC 4CC3A 2KE9A 5FW9A 4J9CA 2RN8A 3TSWA 3EG2A 2KRSA 2ECZA 2KR3A 4F14A 2W10A 1UFFA 1NEBA 2V1QA 1AWWA 1U5SA 4K11A 1M27C 4RTVA 1KSWA 1K0XA 2JS2A 1W6XA 2DL8A 1UJYA 3I5SA 4X1VA 1M3CA 1X6GA 2LCSA 1IO6A 2ESWA 1ZLMA 1AZGB 1WX6A 2DYBA 5I11A 3A98A 4J9DA 1WA7A 3TSZA 3U23A 4HCKA 2DA9A 2LX7A 2YUNA 2NWMA 2LJ0A 3VS7A 4AFQC 2KYBA 5IXFA 2OI3A 5ECAA 4RUGA 4OMLA 2NUZA 1X2KA 1GFDA 1QWFA 1AWJA 4F17A 1UHFA 3VS0A 1M30A 1H92A 1HD3A 4JPBW 1ZSGA 2EYZA 4FSSA 1ZBJA 1AWOA 2RQWA 1X2QA 3NPFA 2O9SA 5FWCA 1SHFA 2VWFA 1WXUA 1S1NA 1GFCA 2BZXA 2HCKA 1ZX6A 3TVTA 5I22A 1OPLA 4J9FA 3LH5A 3ZL7C 4J9IA 1MV3A 2BZ8A 2D8JA 2KT1A 2BZYA 1CSKA 1X6BA 1RLQC 1WXTA 2A08A 2C0IA 2L3SA 1GL5A 4RTZA 2K6DA 5FWBA 1QKXA 2RPNA 1WFWA 4HVWA 2EGEA 1ABOA 1EFNA 1PHTA 1UG1A 1JXOA 3O5ZA 1JO8A 2ENMA 2EYWA 1UTIA 3QWXX 4LN2A 4OMMA 2V1RA 3PVQA 4HVUA 5GJWB 2HBWA 2M0YA 3VRYA 2CREA 2EVRA 2DMOA 1YNZA 2DM1A 1ARKA 1WLPB 2FO0A 4RTYA 2LP5A 1VYVA 1UJ0A 3NHNA 1G83A 2DNUA 1VYTA 5L23A 2DRMA 3M0QA 1NYFA 2OJ2A 1U06A 3R6NA 2JT4A 1AVZC 4A63B 2LQWA 5GJVB 3I5RA 3ULRB 2CUBA 1K4US 1UHCA 2EGAA 1Z9QA 2EQIA 1OOTA 2JTEA 1UGVA 3VS1A 3NMZC 1MUZA 2CH4A 4E6RA 4F16A 1W1FA 2EYXA 1CKAA 4GLMA 2L0AA 4DEYA 2KXCA 2LQNA 1LCKA 2RQTA 3IQLA 3VS6A 2RQVA 3REBB 2CSQA 2DILA 2KT8A 4IIMA 2YSQA 4J9BA 1X43A 1T3LA 1JXMA 4J9EA 3M0UA 3C0CA 3H0HA 1PNJA 3H0FA 4DEXA 1NLOC 2AZSA 1NLPC 2DL4A 1TG0A 2AKKA 2J6OA 2A28A 3EGUA 2KGTA 1K0SA 2OAWA 5IXBA 2D8HA 2K2MA 3I35A 1FMKA 1G2BA 1BB9A 1PRMC 2FPFA 3M0RA 1B07A 2ED1A 3H41A 4Z88A 1GBRA 2FPEA 2DE0X 2F2VA 3EHQA 4Y92A 2MIOA 4AFZC 2F2XA 1I0CA 2JW4A 2ED0A 1QLYA 2FG0A 1E6HA 3M0SA 4M4ZA 1YWPA 3KFVA 1SSHA 1N5ZA 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWY A;  4GBQ A;  3CQT A;  1SEM A;  4J9G A;  2RNA A;  1JEG A;  2K3B A;  1NM7 A;  2LMJ A;  1ZUU A;  1UDL A;  2FRY A;  1RI9 A;  1SRM A;  1AWX A;  2H8H A;  4QT7 A;  2YUO A;  2YUP A;  1WXB A;  3REA B;  3VS3 A;  1AZE A;  1J3T A;  1SHG A;  1QCF A;  1JQQ A;  1OPK A;  2I0N A;  1I1J A;  1BK2 A;  4Z89 A;  2DLP A;  2HDA A;  1H3H A;  3M0T A;  1YN8 A;  5EC7 A;  3UF4 A;  2GGR A;  4KRT A;  2CT3 A;  1UUE A;  1W70 A;  4AFS C;  2EBP A;  2PTK A;  2D1X A;  1SRL A;  3EG1 A;  2KBT A;  1OEB A;  1X69 A;  3H0I A;  2VVK A;  1VA7 A;  1YWO A;  4CC2 A;  3VRZ A;  1KJW A;  2KRM A;  3JV3 A;  1PKS A;  4D8D A;  2A37 A;  4OMN A;  4HVV A;  1WYX A;  2JM9 A;  2J05 A;  4RTU A;  2RQU A;  2YDL A;  2CT4 A;  2YUQ A;  2CDT A;  2JM8 A;  4IIO A;  2E5K A;  2J7I A;  2AKL A;  2K9G A;  2HSP A;  2VKN A;  1WDX A;  4JZ3 A;  1AD5 A;  2KRO A;  2YT6 A;  2KRN A;  1M3B A;  2DRK A;  2X3X D;  1JU5 C;  2AZV A;  1NEG A;  2DL3 A;  2EW3 A;  2MOX A;  2LJ3 A;  3I9Q A;  2L2P A;  1HSQ A;  1I07 A;  2JS0 A;  1M8M A;  5HCK A;  2O88 A;  1YP5 A;  4JJC A;  1H8K A;  1YCS B;  2DBK A;  2CUD A;  4CC4 B;  1V1C A;  3EHR A;  2K7A A;  1GCP A;  4ESR A;  4LNP A;  1T0H A;  1CKB A;  1KFZ A;  1UEC A;  1GCQ C;  4EIK A;  2QDL A;  1ZUK A;  2KXD A;  3VS2 A;  2ROT A;  4OMP A;  1K9A A;  2GNC A;  1XOV A;  2MCN A;  2JMA A;  2G6F X;  1PKT A;  2O31 A;  1KIK A;  1B3Q A;  1RUW A;  2GTO A;  1TUD A;  1AEY A;  2ABL A;  4AFU C;  2RQR A;  2X3W D;  1HJD A;  4OMO A;  1BBZ A;  4R0K A;  2KEA A;  2IIM A;  4RTW A;  4LUE A;  3RBB B;  1WI7 A;  3M0P A;  4WCI A;  2BTT A;  1VYU A;  2HEQ A;  2M51 A;  2J6K A;  5IH2 A;  1U3O A;  2CSI A;  3FJ5 A;  1PWT A;  1E7O A;  1MV0 B;  1QWE A;  2A36 A;  4JZ4 A;  2EKH A;  2L3P A;  2XMF A;  2J06 A;  2W0Z A;  1QKW A;  1T3S A;  2PZ1 A;  2SEM A;  1SPK A;  4AG1 C;  4ORZ A;  2EYY A;  2KNB B;  2DL5 A;  2DF6 A;  1ZUY A;  5IHN A;  2CH4 W;  2O9V A;  2P4R A;  2C0O A;  3VS4 A;  4ZNX A;  2LJ1 A;  4RTX A;  2SRC A;  1WIE A;  1UE9 A;  2AK5 A;  2O2O A;  4Z8A A;  1GRI A;  3VS5 A;  4JJD A;  2EGC A;  3UAT A;  4J9H A;  1NG2 A;  2GQI A;  1Y57 A;  4LE9 A;  1GBQ A;  1Z9Z A;  1NYG A;  2GBQ A;  3SEM A;  3THK A;  1K76 A;  1TUC A;  1ABQ A;  4HXJ A;  2B86 A;  2DL7 A;  1AOJ A;  2F2W A;  3EG0 A;  2D0N A;  2DBM A;  2LNH B;  1T0J A;  1X27 A;  2DX1 A;  4D8K A;  3GBQ A;  2PNI A;  4RTT A;  2J6F A;  3PVL A;  3PE0 A;  3SHW A;  1GCQ A;  2ROL A;  4JJB A;  3UA6 A;  2FPD A;  2DVJ A;  4OMQ A;  1E6G A;  1BU1 A;  4AG2 C;  2L3Q A;  3RNJ A;  2FRW A;  2C0T A;  2K79 A;  2EPD A;  1K1Z A;  1A0N B;  2JMC A;  2JXB A;  1FYN A;  2RMO A;  5IHI A;  4LUD A;  2LZ6 B;  3UA7 A;  2RF0 A;  2KYM A;  4CC7 A;  2FEI A;  3EG3 A;  1OV3 A;  1RLP C;  3NGP A;  1M3A A;  1Y0M A;  2GTJ A;  5IHK A;  1PRL C;  4CC3 A;  2KE9 A;  5FW9 A;  4J9C A;  2RN8 A;  3TSW A;  3EG2 A;  2KRS A;  2ECZ A;  2KR3 A;  4F14 A;  2W10 A;  1UFF A;  1NEB A;  2V1Q A;  1AWW A;  1U5S A;  4K11 A;  1M27 C;  4RTV A;  1KSW A;  1K0X A;  2JS2 A;  1W6X A;  2DL8 A;  1UJY A;  3I5S A;  4X1V A;  1M3C A;  1X6G A;  2LCS A;  1IO6 A;  2ESW A;  1ZLM A;  1AZG B;  1WX6 A;  2DYB A;  5I11 A;  3A98 A;  4J9D A;  1WA7 A;  3TSZ A;  3U23 A;  4HCK A;  2DA9 A;  2LX7 A;  2YUN A;  2NWM A;  2LJ0 A;  3VS7 A;  4AFQ C;  2KYB A;  5IXF A;  2OI3 A;  5ECA A;  4RUG A;  4OML A;  2NUZ A;  1X2K A;  1GFD A;  1QWF A;  1AWJ A;  4F17 A;  1UHF A;  3VS0 A;  1M30 A;  1H92 A;  1HD3 A;  4JPB W;  1ZSG A;  2EYZ A;  4FSS A;  1ZBJ A;  1AWO A;  2RQW A;  1X2Q A;  3NPF A;  2O9S A;  5FWC A;  1SHF A;  2VWF A;  1WXU A;  1S1N A;  1GFC A;  2BZX A;  2HCK A;  1ZX6 A;  3TVT A;  5I22 A;  1OPL A;  4J9F A;  3LH5 A;  3ZL7 C;  4J9I A;  1MV3 A;  2BZ8 A;  2D8J A;  2KT1 A;  2BZY A;  1CSK A;  1X6B A;  1RLQ C;  1WXT A;  2A08 A;  2C0I A;  2L3S A;  1GL5 A;  4RTZ A;  2K6D A;  5FWB A;  1QKX A;  2RPN A;  1WFW A;  4HVW A;  2EGE A;  1ABO A;  1EFN A;  1PHT A;  1UG1 A;  1JXO A;  3O5Z A;  1JO8 A;  2ENM A;  2EYW A;  1UTI A;  3QWX X;  4LN2 A;  4OMM A;  2V1R A;  3PVQ A;  4HVU A;  5GJW B;  2HBW A;  2M0Y A;  3VRY A;  2CRE A;  2EVR A;  2DMO A;  1YNZ A;  2DM1 A;  1ARK A;  1WLP B;  2FO0 A;  4RTY A;  2LP5 A;  1VYV A;  1UJ0 A;  3NHN A;  1G83 A;  2DNU A;  1VYT A;  5L23 A;  2DRM A;  3M0Q A;  1NYF A;  2OJ2 A;  1U06 A;  3R6N A;  2JT4 A;  1AVZ C;  4A63 B;  2LQW A;  5GJV B;  3I5R A;  3ULR B;  2CUB A;  1K4U S;  1UHC A;  2EGA A;  1Z9Q A;  2EQI A;  1OOT A;  2JTE A;  1UGV A;  3VS1 A;  3NMZ C;  1MUZ A;  2CH4 A;  4E6R A;  4F16 A;  1W1F A;  2EYX A;  1CKA A;  4GLM A;  2L0A A;  4DEY A;  2KXC A;  2LQN A;  1LCK A;  2RQT A;  3IQL A;  3VS6 A;  2RQV A;  3REB B;  2CSQ A;  2DIL A;  2KT8 A;  4IIM A;  2YSQ A;  4J9B A;  1X43 A;  1T3L A;  1JXM A;  4J9E A;  3M0U A;  3C0C A;  3H0H A;  1PNJ A;  3H0F A;  4DEX A;  1NLO C;  2AZS A;  1NLP C;  2DL4 A;  1TG0 A;  2AKK A;  2J6O A;  2A28 A;  3EGU A;  2KGT A;  1K0S A;  2OAW A;  5IXB A;  2D8H A;  2K2M A;  3I35 A;  1FMK A;  1G2B A;  1BB9 A;  1PRM C;  2FPF A;  3M0R A;  1B07 A;  2ED1 A;  3H41 A;  4Z88 A;  1GBR A;  2FPE A;  2DE0 X;  2F2V A;  3EHQ A;  4Y92 A;  2MIO A;  4AFZ C;  2F2X A;  1I0C A;  2JW4 A;  2ED0 A;  1QLY A;  2FG0 A;  1E6H A;  3M0S A;  4M4Z A;  1YWP A;  3KFV A;  1SSH A;  1N5Z A;  2DJQ A; 
#chains in the Genus database with same CATH topology
 1JOO A;  1TUG B;  2V8J A;  3UT1 A;  3CQT A;  5LJ5 f;  5KNB A;  2K4K A;  3AMU A;  1S3O A;  1MGS A;  2RNA A;  2H4O A;  3TDQ A;  3CCQ Q;  1S5B D;  1TY0 A;  1JWM D;  3SB2 A;  2A69 D;  1HNZ Q;  1ONL A;  2MPM A;  1UNS A;  3G1J A;  5FO7 B;  4OL7 A;  2DZC A;  3CC7 A;  4XTC S;  3T51 B;  4QY7 A;  4MIU A;  2PUK B;  3R6O A;  1MD2 D;  4JCV E;  2DXC A;  4A54 A;  2HD3 A;  4B9X A;  4JI1 Q;  1DXM A;  1I4X A;  1QE6 A;  2RDH A;  4WJ4 A;  4DXF A;  3HRU A;  4O2D A;  2R92 B;  2YRC A;  2KA7 A;  4L5R C;  5CKB A;  1OYX A;  3OYN A;  2SDF A;  3M4Q A;  1J3T A;  3GTM B;  3AEV A;  3S16 B;  4BBS G;  1BCM A;  3TP6 A;  3A8I E;  4JV5 Q;  1OPK A;  1I1J A;  1X54 A;  1VQM A;  1JMC A;  1TWH H;  2QEJ C;  1WGS A;  4FYW B;  4Z89 A;  5I21 A;  2DLP A;  2YXY A;  1CQF A;  1CZG A;  2F0V A;  4GN3 B;  2CW0 D;  5LMN Q;  2NUP A;  1YHA A;  1VQ4 Q;  3EBE A;  3TZU A;  1OTC A;  1VQ7 T;  3MP6 A;  1WOC A;  1O7Z A;  4LNQ A;  3PUV A;  3FPP A;  2RQX A;  4DR7 Q;  1TSF A;  4C8Q D;  4E7K A;  3UDC A;  2F0S A;  4KKS A;  1QB5 D;  5ELC A;  2E2J H;  2A69 C;  4PJO F;  4JI5 L;  2Z4I A;  1ZSZ B;  2D1X A;  3M5A A;  3EG1 A;  1WQ7 A;  4N4G A;  4KLK A;  3H0G H;  4LFA Q;  2XTI A;  3VUB A;  1I3Q H;  1YWO A;  3DM1 A;  3TME A;  1B50 A;  4CC2 A;  2KRM A;  2E2D C;  4M7A F;  4KHZ A;  1PKS A;  1XNR L;  4OVA A;  2LRQ A;  3F2B A;  1GUW A;  3CF5 A;  5FOB B;  1QJO A;  1WYX A;  4HCC A;  2JYO A;  4A3F B;  2JM9 A;  2L3R A;  5I2X A;  4C56 C;  2F3W A;  3VYH B;  3CCQ T;  5FLX c;  1WPY A;  1W2B P;  4KHP L;  2RQU A;  2YDL A;  2A7Y A;  2KVQ G;  1STY A;  1I4Q A;  2HKN A;  2MGS A;  4V0B A;  2AKL A;  2R92 G;  3KBG A;  1NE3 A;  3JCM X;  1WDX A;  2F0T A;  1AD5 A;  1VQ4 T;  2KRO A;  4AIM A;  1F1B B;  1RIP A;  4GKK Q;  2A68 D;  4KN4 C;  1JU5 C;  2JZ2 A;  5M5X B;  1RD9 D;  2DNE A;  1KG1 A;  3CU7 A;  5KYL A;  2KEE A;  2DL3 A;  2EAY A;  4M75 B;  3S1Q H;  3M4G A;  4TRD A;  2XKO C;  4ZRZ A;  1PFS A;  3GTJ B;  2F69 A;  2L2P A;  4M7D E;  1S5F D;  2K04 A;  3RMH A;  1YJ9 Q;  2D62 A;  4X62 Q;  2O88 A;  3DB3 A;  2VUM G;  3A8L B;  3C95 A;  2E5Q A;  4KJN A;  1ASZ A;  1H8K A;  1R4P B;  2IL8 A;  4DR7 L;  1EFW A;  2R93 G;  3MEW A;  3I4L A;  3V7R A;  2IHE A;  5C44 H;  2D2C C;  4A3G H;  4F7U A;  1RKN A;  4DA4 A;  3LX7 A;  4J6H A;  1K83 H;  2R7D A;  2K7A A;  4DV3 L;  2WIN B;  2NUP B;  1Q82 R;  1YJW Q;  5D65 A;  4A3K B;  4BDZ A;  3CC2 A;  3OYF A;  2JE6 I;  4PLI A;  1BQQ T;  2V4D A;  3ULL A;  3OTO L;  1K3R A;  4A3D B;  1T0H A;  4XTV A;  2F0P A;  1B34 A;  4FP5 D;  2O01 E;  2VZA A;  1NCV A;  2ZJP A;  3M53 A;  1FNV A;  2F3V A;  1RAG B;  1KHC A;  2R5A A;  2WSC E;  2QKI C;  3OOC A;  4K8J A;  4C3H B;  3I56 A;  4M7A A;  2ZJR A;  3VS2 A;  3M3Y H;  4TVR A;  2MI6 A;  3FJP A;  4GLK A;  4II1 A;  4OMP A;  4DUY L;  5GAM g;  1HA5 A;  1SLJ A;  1PV4 A;  4M77 F;  4QW2 A;  2IVW A;  5KYU A;  4GNX B;  2WSE E;  4LF9 L;  4XTZ A;  2ZGW A;  1NTG A;  4E7Z A;  4M7D F;  5CQX A;  2DY8 A;  2ICE C;  5IP9 G;  1B3Q A;  1VQ8 Q;  4N8X 1;  1I94 L;  2ZJQ A;  1AEY A;  2ZTE A;  4FXK C;  5I9O A;  1QNK A;  3CPW S;  1SYD A;  4DUZ L;  2VUM B;  3FP9 A;  4E7S A;  2ZXP A;  3FB9 A;  5C6S A;  3CCE Q;  2X3W D;  2IHF A;  4X9D A;  1ZBX A;  2JA6 B;  1BBZ A;  1H9R A;  1G2S A;  2XNA C;  3T4A C;  1R0B G;  4K2K A;  4LK1 C;  5C0X G;  3RBB B;  3HKZ B;  4OB1 B;  2CP5 A;  4AMC A;  3M0P A;  1IL8 A;  3JCM Q;  3QII A;  2F0W A;  4YIJ A;  4B3M Q;  1VYU A;  4OX9 Q;  2YWW A;  3TRE A;  1CKM A;  2VB2 X;  2QEX T;  3RMQ A;  2GF7 A;  2OTJ Q;  2DGY A;  1W2B S;  1ENA A;  1ZYR D;  4EMH A;  1UGR B;  1ZSZ A;  1PRT B;  1HR0 W;  4JI0 Q;  4NXM Q;  4C3H G;  4Y28 E;  4BI3 A;  4RG2 A;  2W0Z A;  3CXC S;  4EMK B;  2LSS A;  2HD0 A;  1SE4 A;  4DAP A;  4X9C A;  4NMZ A;  4E7I A;  1WHH A;  3S24 A;  2L5Q A;  1QW1 A;  4ORZ A;  2EYY A;  4AG1 C;  1AH9 A;  4E7L A;  5C4J B;  2CH4 W;  2F0F A;  3S17 B;  4FSX A;  1S72 Q;  2X4X A;  3E1S A;  4HCB A;  2QIL A;  1PA6 A;  3CCS A;  2QQB A;  3BFM A;  4P71 A;  2IX1 A;  3PGG A;  2EJG A;  5D7U A;  1WFQ A;  2B63 G;  4YWK A;  1X55 A;  5C6A A;  4V19 0;  2RO0 A;  3VS5 A;  3VV0 A;  2OTL T;  1SBB B;  4ZKC B;  2COY A;  5GQO A;  4HSV A;  1DCZ A;  2R58 A;  3UAT A;  1D5Z C;  1CZW A;  1T5E A;  1K8G A;  2HBP A;  1NG2 A;  1N6A A;  1Y57 A;  4BAC A;  1EU3 A;  1GBQ A;  2VB3 X;  5FRO A;  2QF7 A;  4K6D A;  5CIU A;  4HAE A;  3C3L A;  4KGX B;  4Q5V A;  2B2W C;  2MK5 A;  1VQP A;  3E9G A;  2XWJ B;  4JYA Q;  4O42 A;  3GOX A;  3SEM A;  3J80 c;  3U4Z A;  3THK A;  3TEE A;  2LT4 A;  3T16 A;  2BUD A;  1ABQ A;  4EGV A;  2I0Q A;  1R8O B;  1I3Q B;  4LF8 L;  3VU3 C;  2SNM A;  3OPO A;  2EYM A;  1WI5 A;  2B86 A;  2DL7 A;  2F2W A;  4ZYS A;  4LF7 Q;  4IUQ A;  1KLU D;  4HJA A;  2D0N A;  1SJH D;  4JI1 L;  2LNH B;  1X27 A;  1K73 C;  1Q86 U;  1TWG H;  2CVR A;  3O13 A;  2DX1 A;  1MNE A;  4PFO A;  4D8K A;  1KD1 R;  4XT3 B;  4R4T A;  3EGD A;  3KUP A;  2KSS A;  5CAI A;  4KV6 A;  2SNS A;  3PVL A;  3PE0 A;  1PRT C;  1U4M A;  4BY1 B;  1QP2 A;  4FF3 A;  1GCQ A;  2A8V A;  3UA6 A;  2OEO A;  4LJZ C;  2DVJ A;  4AG2 C;  3EA6 A;  2A74 C;  5EPK A;  1WTX A;  2L3Q A;  2E64 A;  4CRI A;  3E3X A;  2VYT A;  5E7N A;  4TKO B;  1NPP A;  5C4H A;  3PO3 G;  1G3T A;  2EPD A;  4BE2 A;  1HR0 Q;  2O5J C;  1K73 U;  2RMO A;  3MP1 A;  4ZTF A;  1HQR D;  2NVT H;  4XU0 A;  3GTJ H;  5IHI A;  3K0X A;  1NPR A;  2P0Q A;  2LZ6 B;  1M90 R;  4C1N K;  3FRN A;  3UA7 A;  4RMO A;  1Y71 A;  1HH2 P;  1K73 R;  3W3A A;  4CC7 A;  3VR4 A;  4HJ5 A;  4DV2 L;  1RLP C;  1Y1V B;  3U9S A;  1M3A A;  1Y0M A;  1HZB A;  1F2Z A;  3RMS A;  3QOJ A;  1LLR D;  4IUP A;  4H0L C;  4IUR A;  5DY9 A;  1KQ2 A;  4X34 A;  2KR3 A;  1L0W A;  2QTV A;  2FXQ A;  1QNU A;  1KDB A;  4XTW A;  3L2Q A;  5I6W A;  2K3Y A;  1YJW T;  2EJF A;  2Y0S B;  4E6I A;  3CXC P;  1VQM T;  5LJ3 f;  1SF9 A;  1UFF A;  2VAS A;  2RHI A;  5C44 B;  2X6G A;  2CZ1 B;  1U5S A;  4I7Z C;  1Q95 G;  1NE8 A;  3I55 A;  2Y0S E;  3DWP A;  1Q3L A;  3NSW A;  4XYQ A;  5HUR A;  4ELZ C;  1M27 C;  1PYB A;  2NZH A;  4PMB A;  5CV8 A;  5D6W A;  1K0X A;  5CV6 A;  2WB1 E;  1UJY A;  2ZPH B;  4A3E H;  1M3C A;  3DM3 A;  1VQ5 A;  1GVP A;  1X6G A;  4QIW B;  4GKJ L;  1SE8 A;  4BY7 B;  4JOI A;  1EY8 A;  2R93 H;  5M3F B;  2ESW A;  2CKZ B;  1WVL A;  4M77 G;  1DJ7 B;  2FMM A;  2JP1 A;  5C4J H;  3S1N B;  1S4Z A;  4HCS A;  4DV1 Q;  1AE2 A;  1CHQ D;  4A3L H;  4FXD A;  2EQJ A;  2ID0 A;  3OYJ A;  3HOX G;  4A3B G;  4YCV A;  5C4X H;  2QXF A;  3QJY A;  3JAM L;  1GHJ A;  3VS7 A;  1K9M U;  3PIP 3;  4X65 L;  3A8G B;  4PZ8 A;  5G3L F;  4F7X A;  3I4N B;  4GKJ Q;  1EEF D;  2OI3 A;  3I73 A;  1O9S A;  1Q12 A;  1QWF A;  5GAN 3;  1JE5 A;  3GTG B;  2DFU A;  1AWJ A;  2P84 A;  3MFG A;  4XU3 A;  4C8Q A;  1D0Z A;  2F52 A;  2BH2 A;  5DM7 3;  1K28 A;  4ZCK A;  5LJ5 h;  2WAQ E;  3H09 A;  1VQN Q;  1ZXT A;  2O9S A;  5IP9 H;  2JVV A;  3TBI B;  3R8B A;  4ZKB B;  4OGE A;  3PO3 H;  2RHQ B;  5IOD A;  4CGY B;  1D1A A;  1PXU A;  3TVT A;  1YNJ C;  4C3I H;  3DEO A;  4CDD C;  3ZL7 C;  2GFU A;  3QDR B;  5GAM e;  1MV3 A;  3ND8 A;  2LCL A;  2MWO A;  3EFR A;  1I5F A;  1B2T A;  3K6O A;  4M78 G;  4DV7 Q;  4IJL A;  3MP8 A;  3QO3 A;  1RLQ C;  5FRN A;  4M77 B;  1Q8K A;  1PH6 A;  1OZ3 A;  4GLV B;  2R7Z B;  4KUL A;  5LJ3 h;  1D8L A;  1HQM C;  1VQP T;  1RJT A;  2NVQ H;  5M9O A;  1ZHI A;  2ZZD A;  1I81 A;  2WSF E;  1WJQ A;  1SNP A;  3I3C A;  1QKX A;  2B8G A;  2HIX A;  1M1G A;  1X75 C;  2RPN A;  3X20 B;  1YNN C;  2LCC A;  2KI7 A;  2QGG A;  3FRP B;  1WHM A;  4FF1 A;  2M00 A;  4JI6 Q;  3OIQ A;  1YCY A;  1D0Y A;  1E3P A;  4A3L G;  2FMC A;  3HFN A;  2IW3 A;  4PK4 A;  1U9R A;  2F5T X;  5CV5 A;  4DV7 L;  3IFD A;  1UTI A;  1YIJ Q;  2Y4Y A;  4FM4 B;  4O6J A;  1B4O A;  3D7S B;  2A68 C;  1VQK A;  1FR3 A;  2WB1 G;  4OMM A;  2K01 A;  5GJW B;  4IFD H;  1TVX A;  1BCO A;  1C8C A;  4AT1 B;  4Q5W A;  4DN4 M;  1YZ6 A;  2FL7 A;  4HR7 B;  2XID A;  4OX9 L;  3JSC A;  1JIC A;  1WD0 A;  1D6E C;  1WTO A;  2OX7 A;  1Z6H A;  3M54 A;  3WXM B;  3EFS A;  4JRI A;  2CRE A;  3VRY A;  1BXT A;  4JI2 Q;  4CJ0 B;  2DEQ A;  5J39 A;  1YNZ A;  4ZN3 A;  2LDM A;  2P5Z X;  2XIW A;  4NXN Q;  1FJG Q;  1I4G A;  5JOB A;  1EYC A;  2WII B;  2VXF A;  2NZO A;  3OS5 A;  4RG1 A;  2R7Z G;  4M7D B;  1X3G A;  1IKM A;  1WTP A;  1ENC A;  2CQO A;  1VYT A;  3VKI A;  2K5L A;  1AN8 A;  2DRM A;  2EWN A;  3M0Q A;  2JK8 A;  2H5X A;  4OHJ A;  3DLL A;  2TMP A;  4DAV A;  3GTQ H;  2F0U A;  3OTO Q;  5JVH 3;  3HOY G;  2CP7 A;  5ELD A;  1OZ2 A;  1QVG P;  1Z47 A;  1WCM B;  2JN0 A;  2EJG C;  3A8J E;  5DNF A;  4L59 A;  3ULR B;  2CCZ A;  3JB9 I;  1EOT A;  1V9P A;  1W6J A;  1QVP A;  2H3J A;  2DXT A;  2EGA A;  3X24 B;  1YJN Q;  4FW1 A;  1OOT A;  5C4X G;  1VF7 A;  5GAN j;  1VQ9 Q;  4L8J A;  4U68 A;  1UGV A;  1CQV A;  1PFB A;  1H3Z A;  3TZD A;  2TSS A;  2PW5 A;  2ZPG B;  2PMZ B;  3C1E A;  2UXD L;  4BE1 A;  1ML0 D;  1F2M A;  4F04 B;  1MUZ A;  3FEO A;  3UI2 A;  3LWH A;  4RKB A;  3V7C A;  2JA5 B;  2CH4 A;  5HK0 A;  5NUC A;  4E6R A;  4F16 A;  1TR5 A;  1NR4 A;  4I7A A;  3G4S A;  4DNI A;  3S16 H;  4BBS H;  1XJW B;  1EQR A;  3K59 A;  3BDC A;  4CDE C;  2HAX A;  2AQ1 B;  3CC2 T;  1FMV A;  2SOB A;  2E76 C;  3K81 C;  2RQT A;  3IQL A;  3NQI A;  3VS6 A;  2B2V C;  4YTL A;  3NTI A;  3REB B;  4DR1 L;  2JA9 A;  3OMG A;  1QIL A;  1SFO H;  4BY7 H;  1M1K U;  3NBH A;  3CC7 T;  2KT8 A;  5EJW A;  2ZM6 L;  1AZQ A;  4EMK C;  2B63 H;  4CJ1 B;  2BIV A;  3M0U A;  3BZD B;  3ND9 A;  4HN7 A;  3GTK H;  3ERO A;  3T9N A;  1Q82 C;  1UE5 A;  1NLP C;  4A3J H;  4M7D A;  1VQ5 Q;  2E75 C;  2EYJ A;  2F4V L;  5G3L D;  1D5M C;  3HOV B;  1SKU B;  1RCV D;  4A3G G;  1JJ2 P;  3I55 Q;  4OO1 G;  3EGU A;  1ZEQ X;  4QUC A;  5EQ0 A;  2X35 A;  4QQ6 A;  5CK9 A;  2OAW A;  5IXB A;  2K2M A;  1BCP B;  2DJF C;  4TQU S;  3Q24 A;  1EIG A;  2EXD A;  1SSO A;  1VUB A;  2E2J B;  4M78 D;  2EIF A;  5GRO A;  4JRQ A;  1G2B A;  2DIG A;  1E2Z A;  2KCT A;  1PRM C;  3P8D A;  1BI0 A;  4QCL A;  1KD1 U;  1B07 A;  2QA4 Q;  1YI2 T;  2ZTD A;  4A3F G;  2RDG A;  2I2L A;  3MPU B;  4Y92 A;  2F2V A;  3EHQ A;  2K2V A;  3RZO B;  1I0C A;  3JAM i;  5KH6 A;  2JW4 A;  4TSS A;  2ED0 A;  5BN5 A;  5FJ8 G;  4MZP A;  1VQK T;  1WJR A;  2IY5 B;  3JC6 6;  4A93 H;  1SSH A;  4PKC C;  2DJQ A;  5JEA G;  4FW2 A;  3QWY A;  4GBQ A;  3S1R B;  4HIM A;  4JS5 A;  4QQB X;  1YHQ A;  3DHQ A;  1GUO A;  3AHU A;  3EG9 A;  1SEM A;  4KH0 B;  2VQE Q;  4L5S A;  2LY7 A;  1RAA B;  1JOR A;  4DV6 L;  2K3B A;  3VYR A;  2LMJ A;  1ZUU A;  4X3K A;  4AQY L;  5LJ5 d;  1Q86 C;  1GKH A;  5GAN f;  4KKU A;  3J7A 5;  3L2V A;  1PTO D;  1UWV A;  4M8A A;  4KHV A;  2PW7 A;  7AT1 B;  2JA8 G;  4M78 A;  1HZC A;  4QT7 A;  2YUO A;  1DYQ A;  5HY6 A;  2N55 A;  5A2Q E;  1WXB A;  3T13 A;  5KEE A;  4H13 C;  1PD0 A;  4BI4 A;  3OYH A;  1H9S A;  2K3X A;  2KOL A;  3VS3 A;  4PZ7 A;  2XHC A;  1SHG A;  4JBM A;  1QCF A;  2YRD A;  3QO2 A;  4OEL B;  2K6A A;  1HNZ L;  5EG2 A;  1RAH B;  1LTA D;  1KQ1 A;  2QW7 A;  3LGF A;  1V1O A;  4ABN A;  2N78 A;  3X26 B;  4A3K G;  3JCM V;  2Q2U A;  1H3H A;  1XNR Q;  1A2U A;  3G6E A;  1VQP Q;  1EWH A;  3U4V A;  2WP8 J;  1F2Y A;  2B8A A;  1R0C B;  3NWT A;  4MNO A;  3UF4 A;  2BE7 D;  4J1M A;  5IY0 A;  4KGV B;  2DY7 A;  3K7A B;  3OYB A;  1UUE A;  5D3D A;  2QYZ A;  3HPW A;  2EBP A;  2L11 A;  3FHW A;  1CA5 A;  5KYY B;  1OEB A;  1IBM L;  2X4W A;  3H0I A;  2VVK A;  1X3E A;  2RBM A;  5CMD A;  4UPA A;  5CVI A;  2VUM H;  4B3R Q;  4RG8 A;  3JV3 A;  1BCP D;  1I4H A;  2K1B A;  3PMI A;  4JBW A;  1G91 A;  3QBY A;  4P75 A;  4C5E A;  3H3V C;  1YVC A;  3BDO A;  3CQZ B;  3UPU A;  3S15 B;  4DV6 Q;  2JA6 H;  2Y4X A;  1XPU A;  2J05 A;  1CT1 D;  3U9O A;  4GY5 A;  2FYK A;  2CT4 A;  1VQL Q;  1V8Q A;  2YUQ A;  2JM8 A;  5E4W C;  3E9F A;  5LJ5 g;  1YHQ T;  3UWN A;  2J7I A;  1LTB D;  2HSP A;  2VKN A;  2ZPI B;  3K80 C;  3P1H A;  2LMC B;  4PFZ A;  5CC4 A;  4ANJ A;  4M7A E;  1MJC A;  2X3X D;  4DBH A;  4CKE A;  3KXT A;  3H94 A;  1N36 L;  2VNU D;  3HKZ G;  3BDU A;  4QKU A;  1F77 A;  4XXE A;  1N33 L;  1S5D D;  2ALY B;  3G71 T;  1TXY A;  2EW3 A;  3GTL B;  3BZC A;  1JWU D;  2OTJ A;  1K9M C;  4P5N A;  3OYK A;  1N27 A;  1PLF A;  1BI2 A;  1HSQ A;  1I07 A;  4C3H H;  4C0F A;  4NKL A;  3M3Y B;  1CFM A;  3GLX A;  1XXG A;  2OT2 A;  2CP3 A;  2E4H A;  1N34 L;  4GN5 A;  4L5T A;  1K8A U;  3KOJ A;  4J6Y A;  1QUQ B;  2M9V A;  1YCS B;  3ZBD A;  2DBK A;  1FVI A;  1SRU A;  5FLM G;  5IYD H;  4PJO C;  5A2Q L;  3UDG A;  1LTL A;  4I65 A;  4CC4 B;  2A6H D;  2L12 A;  1EUJ A;  2B2V A;  5M3M G;  1WHL A;  3EHR A;  3CD6 A;  4RCO A;  1KXL A;  4ATO A;  4QUF A;  1HR0 L;  3EFO B;  1IW7 D;  1U4P A;  2J7Z A;  2MUY A;  2L5T A;  5LMU L;  5GMK e;  4L6V 5;  2N49 A;  1HXD A;  2ZXR A;  4M78 F;  1UEC A;  4N8F A;  1AHJ B;  2RJC A;  2V26 A;  5CKH A;  3OYC A;  3EVQ A;  4X66 L;  1GCQ C;  1PZK D;  2NBF A;  4YHH Q;  3HOX H;  4A3B H;  4DV1 L;  2BA0 A;  3VR2 A;  2HZY A;  2X4J A;  1OX8 A;  2B63 B;  4MZ9 A;  1SXT A;  1NBW A;  5KYY A;  1WTW A;  1LO5 D;  4N9T A;  2NTS A;  1D1B A;  2ROT A;  3KFU A;  2CP2 A;  4C8Q E;  4FCY A;  1L2F A;  1VOM A;  2GNC A;  3W2D A;  5GAN d;  4P72 A;  2QQS A;  1YJ9 T;  2F0G A;  4EQP A;  1BUV T;  1Y96 B;  2JMA A;  2IPK D;  4ZUI A;  3HOV H;  2DJG C;  4UC4 A;  3MC0 B;  1EZ6 A;  1I8F A;  5HGQ A;  5GMK j;  1HA6 A;  1A3T A;  4IFD I;  2MO0 A;  4LFC L;  2QAS A;  4NS5 A;  1PRT D;  2RDF A;  3HEJ A;  3CC4 T;  4N9P A;  1S40 A;  4M77 A;  1Y69 U;  4M77 E;  4DOW A;  5GAM d;  2DK3 A;  2MQH A;  2OQ0 A;  4C92 C;  1OU9 A;  3Q8D A;  5KE3 A;  2DUD A;  1U1S A;  3PSI A;  5FU7 B;  5M3F G;  4UP9 A;  4IZ8 A;  3I70 A;  4R0K A;  4RTW A;  4LUE A;  1YJN T;  3HFO A;  4ODG A;  1WI7 A;  5D6Y A;  1SYE A;  3UDX A;  3CKI B;  4BY1 G;  4DV2 Q;  3MCA B;  3S17 H;  1STN A;  3JAM c;  2NVT B;  1ZYR C;  2NLU A;  4C2M H;  3EAE A;  5JVG 3;  1JJ2 S;  2Z1C A;  4E47 A;  1S5C D;  3FJ5 A;  2LQ8 A;  3HRT A;  1MV0 B;  1Y1V H;  1A3U A;  4OIJ A;  3BVZ A;  4YHH L;  4BS9 A;  1DM0 B;  2DTH A;  4IUV A;  1QKW A;  4RH6 A;  1YBY A;  4RCN A;  2X4Y A;  2PZ1 A;  4NPS A;  3SGI A;  4A3I B;  1EIH A;  2SEM A;  1VQO Q;  1SPK A;  2NYS A;  3PO2 B;  2KNB B;  2MF2 A;  3S1M B;  3JB9 H;  3J7Z C;  5IHN A;  4DK1 A;  4JOI C;  4UHV A;  3A0J A;  2YYZ A;  3UE1 A;  5K36 H;  3VS4 A;  4B08 A;  5IN1 A;  3CAM A;  2LJ1 A;  2QI2 A;  5BN4 A;  2CW0 C;  3VDY A;  1WIE A;  1I94 Q;  4FT2 A;  1I4P A;  4IPH A;  5IYB G;  4OEM B;  4B3S L;  2VGN A;  1L1O A;  2AK5 A;  4C3I G;  2LTO A;  4Z8A A;  3J81 i;  1GRI A;  3F70 A;  5GAH C;  1EIY B;  2Z6B A;  5JJL A;  1L1O B;  2JA7 B;  5KYU B;  2MPX C;  3MEA A;  2BE9 B;  4R55 A;  4MMK A;  2KMT A;  1ILP A;  5IP7 H;  3KF8 A;  4J9H A;  2XU8 A;  2GQI A;  4LE9 A;  3CD6 Q;  3I72 A;  1VQ9 A;  3OSS C;  1PMR A;  1UE1 A;  1Z9Z A;  2C5C A;  2HMA A;  2OTL Q;  3DMU A;  2QG9 B;  3DXJ C;  4QMG A;  1KHI A;  3OW2 S;  3KLS A;  4DR5 L;  4C0D C;  5GAM f;  2F0M A;  1K76 A;  1TUC A;  2UUA Q;  2WAC A;  2J4X A;  3HOX B;  4A3B B;  3EG0 A;  1VQ5 T;  1LAB A;  1PG5 B;  4L5Q A;  1YHB A;  5DLO A;  1SNC A;  3CQZ H;  1GJX A;  2PNI A;  4RTT A;  2J6F A;  1YI2 A;  3LWU A;  4A3I G;  3V8K A;  4RGO S;  1VQL T;  4PMW A;  3D4D A;  3EGD B;  4JJB A;  1LM0 A;  3H0G B;  3CCJ Q;  5IYC H;  1M5Q 1;  2FPD A;  2XDB A;  2GA4 B;  1E6G A;  4N4H A;  1WQW A;  2OCE A;  5EAY A;  1BKB A;  4NOY A;  1JOQ A;  4XQN A;  5C0M A;  5IGF A;  3HP9 A;  3A7L A;  1MI2 A;  2K79 A;  1A0N B;  3CCS Q;  1QVF S;  2JXB A;  1BBU A;  4XIG S;  1XTC D;  4RGT A;  1BDO A;  1AE3 A;  1XWE A;  2JN4 A;  1CM9 A;  2UXD Q;  3FEW X;  3IKJ A;  1MMN A;  2KYM A;  3BE3 A;  1NAP A;  4M78 E;  1BR9 A;  4A3E B;  4JI4 Q;  2F0Q A;  2IX3 A;  2GTJ A;  2K5V A;  2KEN A;  4UDU C;  5IHK A;  1SJE D;  1KC8 U;  4CC3 A;  4K5X A;  1CKN B;  5FW9 A;  4XAX B;  1N32 L;  5M5Y B;  3EG2 A;  1G5V A;  2MO1 A;  3M57 A;  5HK3 A;  3B6Y A;  3OYY A;  1V1Q A;  2ECZ A;  2L9H A;  3F8T A;  3VR3 A;  4OB3 B;  5GAN e;  2A3L A;  3LGL A;  3A8H B;  1Q81 C;  2W10 A;  1QZH A;  1G6Z A;  4DPG A;  1NEB A;  3RR5 A;  2PZU A;  3CC4 A;  2CQA A;  3KDF B;  2M2L A;  1TU2 B;  2K28 A;  1G2T A;  3I4N H;  4K11 A;  4C92 A;  5GAN 7;  4JJN K;  4P73 A;  4BY6 B;  1UB4 A;  4DA2 A;  1UEB A;  1FX7 A;  3I5S A;  1VIE A;  2NWG A;  4RGM A;  4E7J A;  1WHJ A;  5J22 A;  1AZG B;  4D6W A;  4NW2 A;  2KVM A;  1HTL D;  1VIF A;  2DTO A;  1WA7 A;  4LWC A;  1VQL A;  3KLS X;  1MKH A;  2D0O A;  4H44 C;  1VDZ A;  4Y7N H;  3ZJY C;  1HTP A;  2YUN A;  3L2U A;  3CCM T;  1HHV A;  4LXC A;  4AFQ C;  1NJI C;  3G7Z A;  3SHL A;  4U67 3;  1ACM B;  1GXD C;  2K7V A;  2PPB C;  5J1Z A;  4DK6 C;  3RLF A;  2KQW A;  3EFO A;  2D9U A;  4RUG A;  1EQV A;  3QZ9 B;  3GP7 A;  3CBM A;  3ICE A;  1UUP A;  4A4H A;  5C5L A;  4E7H A;  3QKJ A;  1SSF A;  4M1U B;  2NUT B;  1VQO T;  4F17 A;  1UHF A;  1YIT T;  3D6W A;  3VS0 A;  3QOL A;  1I50 B;  3I56 Q;  2RKS A;  1WZO A;  1M30 A;  4AYB E;  1HD3 A;  4JPB W;  4GS3 A;  3J80 E;  2BCO A;  3NEN A;  1A2T A;  2PI2 A;  5LMN L;  2R6G A;  2VQF L;  5COR A;  2RQW A;  4Z9C B;  3QHS A;  4Q0F A;  1SHF A;  2EJ9 A;  4MZM A;  4JK1 C;  4C2M B;  5ELB A;  1WXU A;  2AKW B;  3HOZ B;  1GFC A;  2BZX A;  2OTJ T;  3KLW A;  5I22 A;  5KYW B;  4C5I A;  2PQW A;  4R8N A;  5BR8 Q;  1RTO A;  2D8J A;  3EGX B;  2KT1 A;  5AT1 B;  3SXH A;  4APV A;  1C9O A;  1PFN A;  4R4I A;  3CCR T;  3UDI A;  2I46 A;  3JCM d;  5GAG C;  4C0G A;  5E3F A;  1G8X A;  1WXT A;  2C0I A;  4CJ2 C;  4XDX A;  1TH7 A;  4A3I H;  4RCC A;  5FWB A;  3RNU A;  4OXP A;  1IGU A;  1FL0 A;  5DLQ E;  1WFW A;  4BBS B;  1KAW A;  1ABO A;  1E2V A;  1DOL A;  5GAO p;  1KQS A;  2PO4 A;  1PHT A;  2HL5 C;  3WOF A;  1Q81 U;  5FLX E;  1LAC A;  2JA5 G;  2EXZ A;  2QTX A;  2ZM6 Q;  1JXO A;  1TTH B;  1JO8 A;  3PF5 A;  1MIU A;  2ENM A;  2MYS A;  3HOW H;  1EQQ A;  2CZ7 B;  2RJF A;  4LN2 A;  3CPW A;  2K5I A;  2B2T A;  4GOP C;  3HGB A;  3CCM A;  1JR0 D;  1QZG A;  1KDA A;  1ZQ1 A;  2EY2 A;  1Y8O B;  4R1J A;  4M77 D;  4J8Q A;  5IP7 G;  2ES2 A;  1EYD A;  3CCJ T;  2XDP A;  2ZPB B;  4MDW A;  2A6E C;  2M0Y A;  2L4N A;  1FWZ A;  1EY5 A;  3PGZ A;  3G71 Q;  1SE2 A;  1A8V A;  1TS5 A;  2B3G A;  1BI3 A;  5COY A;  4G57 A;  1HNW L;  3BJU A;  1LTI D;  2RVL A;  1K8A C;  2EVR A;  2BE5 D;  2Z0S A;  2HT1 A;  4KY5 A;  4WFN 3;  3U50 C;  4C92 G;  3HHT B;  1A62 A;  2NN6 I;  1ARK A;  2CKK A;  1WLP B;  4M75 G;  2K50 A;  2LP5 A;  3SWN C;  3EFX D;  1VYV A;  1IYU A;  1UE6 A;  5T1G A;  3OMC A;  1KQS P;  4FXG C;  2BA1 A;  2BH8 A;  1UJ0 A;  3NHN A;  3AFQ A;  1IW7 C;  2L8D A;  1R4Q B;  3A56 A;  3HOV G;  5L23 A;  5GAO r;  5KE2 A;  4ZN1 A;  1U06 A;  2JT4 A;  1YJN A;  2HDM A;  1PH1 A;  4A3J B;  3S2H H;  4DR6 Q;  1HFN A;  4DR2 Q;  1PCX A;  3HOW G;  2EYO A;  2EJM A;  5GJV B;  3QPH A;  3I5R A;  5TSS A;  1V76 A;  1VQM Q;  4EQN A;  4A4I A;  2CUB A;  4B3S Q;  1E22 A;  1UHC A;  3OY9 A;  3OHX C;  1PTO H;  1PZJ D;  4NP5 A;  1RAE B;  2DPP B;  4DAM A;  1ENF A;  5C0X H;  2Z8L A;  1XJV A;  5I6Y A;  1PHJ A;  1BIB A;  3IFT A;  1H64 1;  2RA4 A;  2R93 B;  1I6H H;  1VQH A;  4QL5 A;  2G3R A;  1NMG A;  2F1L A;  1XNQ L;  4K0K L;  2ATC B;  1SMX A;  2XN9 C;  4H02 A;  4KHP Q;  4X64 Q;  3PT9 A;  3MHX A;  4C92 D;  3G4S Q;  5FU7 C;  5BR8 L;  1W1F A;  4XTY A;  2EOT A;  2PQE A;  2M9U A;  4LFB Q;  5L8R E;  4A3D G;  2EYX A;  3QUI A;  2K5N A;  3L2P A;  1CKA A;  1IBK L;  2CWP A;  3NXW A;  5ELO A;  1F2L A;  3OYE A;  2L0A A;  1FGU A;  2CFM A;  2KXC A;  3M59 A;  4XQJ A;  2AWO A;  1LCK A;  1Y07 A;  3GNF B;  4G4K A;  3KJP A;  1G3W A;  1WTH A;  3URY A;  2RQV A;  1LYL A;  2CSQ A;  5IIF A;  4A3J G;  1Q1B A;  3K57 A;  2VY3 A;  2FJ2 A;  5LJ3 d;  4C8Q F;  2SEB D;  4JI0 L;  1T3L A;  1JXM A;  4J9E A;  1N34 Q;  3QXE B;  1LTG D;  4LMQ D;  5LMN W;  2YLC A;  3AFP A;  4K5V A;  2E2I B;  2AZS A;  4E2F B;  5KCO A;  2I5H A;  3CC4 Q;  1EWC A;  4Y7N B;  4GOP A;  4G7O C;  3D3R A;  5CV7 A;  2DL4 A;  1TG0 A;  2JQO A;  4RHR A;  2L55 A;  2MHV A;  4P74 A;  2J6O A;  4QJF A;  2IG0 A;  1AP0 A;  3LX0 A;  2F0D A;  2KGT A;  2JTF A;  1X9N A;  3C1F A;  3I7F A;  3I35 A;  4IPD A;  1HZA A;  1EOV A;  4LF6 L;  4DAY A;  2NVX H;  4G7Z C;  4NXN L;  4JI8 L;  2QGF B;  4CDF C;  3HOU H;  3T56 B;  1U8R A;  2E70 A;  2ED1 A;  1M1K C;  2QQR A;  1IB8 A;  1VQ8 A;  4Z88 A;  4DK0 A;  4LFB L;  4OO1 H;  1NNX A;  2UXC Q;  3LGJ A;  1E7Z A;  4DNR B;  5CV9 A;  1JJG A;  4LUZ A;  3X28 B;  2QDB A;  2FG0 A;  1XPR A;  4PQX A;  2JEA I;  5C3E G;  4ZK9 B;  3C4S A;  2FB7 A;  3OBW A;  1ZA1 B;  4J7I A;  3MEV A;  1D3B B;  1N5Z A;  2D6F A;  3NK9 A;  5HKC A;  3CCJ A;  2PQA A;  2Y90 A;  3PFS A;  3J80 L;  4DR4 L;  3ZYY X;  4J9G A;  5GAN 8;  3M7N A;  1EYG A;  2YTY A;  3E9H A;  5ELF A;  1NM7 A;  1JJ2 A;  4KBM B;  4PJJ A;  3PQI A;  3PF4 A;  1A6X A;  1HRJ A;  4LF8 Q;  3RZD B;  3S14 H;  1TS9 A;  4DKA C;  2EVB A;  5GAM j;  3MXU A;  2WAQ G;  1I4R A;  5ELN A;  4JI3 Q;  2DTI A;  1TKW B;  2H8H A;  1MMG A;  4QGU A;  1OQK A;  2R5M A;  3LWE A;  3FC3 A;  3GNG A;  1DZ1 A;  3T1H L;  4RGN A;  1AZE A;  4NXM L;  1Q7Y R;  2GVA A;  4ZGD B;  3QYG B;  1RTN A;  2HUG A;  2DVE A;  1M9S A;  4OGC A;  2NN6 G;  3JB9 F;  3MXN B;  1BK2 A;  2R92 H;  2VUB A;  2JJQ A;  3RER A;  2JXM B;  4ZTJ A;  5A35 A;  2HDA A;  4LF9 Q;  3P7J A;  4C3J B;  5A0L A;  1PRT F;  3GDE A;  5J3B A;  3A74 A;  3NTK A;  2LS0 1;  4BBR H;  3IAY A;  3V8J A;  2DD5 A;  1WJS A;  3E6Z X;  4KRT A;  1TWH B;  2FZK B;  1E1O A;  1TII D;  2AMC B;  3MTS A;  4IO9 A;  2UUA L;  2ASB A;  3KLR A;  4BWG B;  4AFS C;  3DLM A;  1ESR A;  5KCH A;  1VMP A;  4F7U F;  2EFI A;  2E3H A;  5LJ3 j;  3NFC A;  2QQA A;  3MKD A;  1PD1 A;  2KBT A;  2F5K A;  1JB0 E;  1X69 A;  1B44 D;  3D31 A;  4LDW A;  4WF2 A;  3PIO A;  4DAY B;  5KIX A;  1VA7 A;  2HHH Q;  1IGQ A;  2FIN B;  1OXX K;  2EQK A;  1KJW A;  1D1K A;  1VQO A;  1M2V A;  4D8D A;  4RA8 A;  3TU4 K;  5IWA L;  4J5Y A;  4A53 A;  3RUZ A;  3MXG A;  3H91 A;  1AW7 A;  1C4Q A;  4JDS A;  1FGB D;  1H9J A;  4RTU A;  4VUB A;  5A0G A;  4IKF A;  2F0E A;  3I4M G;  1JBM A;  4PV1 C;  1V29 B;  3LLR A;  4QVZ A;  3EH1 A;  2E5K A;  5LJ3 g;  1M90 C;  3M9B A;  2K9G A;  2OWO A;  3PO3 B;  3MO8 A;  4A3C G;  4JZ3 A;  1IYV A;  1NZ9 A;  3MEF A;  4PLL A;  3NBH B;  2DO3 A;  2KRN A;  2YT6 A;  2DRK A;  6AT1 B;  4MDX A;  4UP8 A;  3RD4 A;  2I07 B;  5C3E H;  3NUC A;  2AZV A;  2K4Y A;  4OP0 A;  4FDB A;  1MSH A;  4KH1 B;  2MFI A;  4DV0 Q;  2MOX A;  4HMI A;  2A5H A;  2LJ3 A;  2RI5 A;  4DUZ Q;  4POF A;  5IGC A;  4JI2 L;  3H6M A;  1VQ4 A;  2PMZ E;  1EL0 A;  2G5D A;  3HTR A;  1HZ9 A;  1SEB D;  4JJC A;  3I4O A;  4F7U E;  4OON A;  4FYD A;  2Y0S G;  3OBY A;  1X3Q A;  3VR6 A;  3L2W A;  3G6J B;  2KEC A;  4PJM A;  2EY6 A;  4F7U B;  5IT9 c;  1TOV A;  4PJO A;  2RHZ A;  3PMT A;  5D14 A;  2H3E B;  1W2B A;  1V1C A;  1KD1 C;  3ITP A;  2V8I A;  3EN2 A;  4JW0 A;  4C0D B;  3K8A A;  1GCP A;  4Z02 A;  4LNP A;  4ESR A;  1W3S A;  2A6H C;  4K6L A;  1IBM Q;  2K5Q A;  3PO2 G;  3KUF A;  3QDF A;  3CME T;  1B1Z A;  1PZI D;  1ZA2 B;  3GO5 A;  1TS4 A;  3ERS X;  1CKB A;  4HIK A;  2LXK A;  2Q8I B;  3T53 B;  3HG9 A;  2X6L A;  1RAI B;  5IYD G;  3JCM P;  5CV4 A;  4EIK A;  1GO3 E;  2JSO A;  2R61 A;  1ZUK A;  1PH5 A;  2QA4 T;  2KXD A;  2F03 A;  1KNE A;  2DEU A;  4OGQ C;  3UDF A;  1XYI A;  3GTP H;  4FYV B;  1SN8 A;  3DWA A;  1U4R A;  2JA7 G;  2K33 A;  1XOV A;  2UUB Q;  4QVC A;  2B29 A;  3IL8 A;  1M2V B;  5AFW A;  4GKK L;  2PVO B;  1Z9F A;  3BG3 A;  1D2B A;  2B2U C;  1B9M A;  2G6F X;  1ET9 A;  4DK3 C;  4KI0 A;  2UXB Q;  2JA7 H;  2O5I C;  1PKT A;  4IAL A;  2FHT A;  1RUW A;  2GTO A;  4DV5 Q;  1TUD A;  2GVB A;  4RWS C;  3PUZ A;  4C3J H;  1OXT A;  1KC8 C;  1TWA H;  3RN5 A;  2ABL A;  3RIR A;  4BB7 A;  3G4S T;  1XX8 A;  2NYZ D;  1IBK Q;  4X3S A;  1HJD A;  1QG7 A;  2F0N A;  5LJ5 j;  4OMO A;  1STA A;  2E65 A;  3L3O C;  1MSG A;  2FFK B;  3D0F A;  2E6N A;  4S3S A;  3PO2 H;  2IIM A;  4DF7 A;  5GAO q;  4JI8 Q;  2BTT A;  3F2U A;  2Q2H A;  1I5O B;  4FYY B;  3H0G G;  2M51 A;  2J6K A;  5IH2 A;  5KYN A;  3UE0 A;  2WB1 B;  4ALP A;  4UP7 A;  5CGK A;  1H95 A;  3TCJ A;  2NZ1 D;  1PWT A;  1STH A;  2RI3 A;  1QWE A;  4EMK A;  4R4Q A;  1X56 A;  2EKH A;  3E2U A;  1NUC A;  1PTO C;  3OYI A;  1T9H A;  4BA1 I;  3RZO H;  1Q81 R;  2DET A;  2AHO B;  3PCO B;  4PJO B;  4JVZ A;  2CS7 A;  3A55 A;  4ZLT F;  1T3S A;  5EKL A;  4LUO A;  1R77 A;  2HCI A;  2JNG A;  2D5D A;  4EVO A;  4LF4 Q;  2H1E A;  5CO7 A;  3J81 L;  4IPG A;  2NN6 H;  1OU8 A;  1EEI D;  2O9V A;  2C0O A;  2DAQ A;  1VQK Q;  5GAN 2;  2XWB B;  4N4I A;  3A8M B;  1YIJ A;  3BVM A;  3L9A X;  2FHD A;  2SRC A;  1P16 A;  1M1F A;  1GOZ A;  3N6R A;  1YI2 Q;  1BIA A;  1LT6 D;  3KBX A;  1U0L A;  1QP3 A;  3KYH C;  3HS0 C;  2RJE A;  1Y8N B;  3WVD B;  1SAP A;  4RMF A;  3CC2 Q;  1G29 1;  4RKL A;  2COW A;  3D4R A;  4CDC C;  1DJR D;  4B9W A;  3MXP A;  3CCS T;  1UEA B;  1M1K R;  3I8Z A;  2OF1 A;  3AYH B;  4POG A;  3CMA T;  1NYG A;  3MEH A;  1JB3 A;  1XMQ Q;  1W4S A;  3NQT A;  2GBQ A;  2B2W A;  1XNQ Q;  2OTL A;  4DV0 L;  3PV0 A;  1M4Z A;  4K0K Q;  1CTM A;  4HKE A;  1SNO A;  3PUY A;  5HGT A;  2K75 A;  4V2S A;  2L15 A;  4HXJ A;  1QVF A;  5FJ8 H;  3Q23 A;  1N9R A;  1AOJ A;  3S3N A;  4NDX A;  2DBM A;  2GCX A;  4GNX C;  4J8O A;  1T0J A;  1PFM A;  4WRD A;  4QQG A;  2E2H H;  1WCM G;  2RB6 A;  2XK0 A;  3E0E A;  3CEY A;  4DBF A;  3SHW A;  1XQH A;  4C1N I;  1YHQ Q;  3CXC A;  3QSU A;  1Y7X A;  5GMK l;  1VQA A;  2EYP A;  5M5Y H;  1JB7 A;  2HQX A;  1TWC B;  1SNM A;  1TY2 A;  1STB A;  4XK8 E;  3RNJ A;  2B2Y C;  2NUT A;  1N8R U;  1M90 U;  2C0T A;  4QB4 A;  1E0B A;  3BY7 A;  3LYI A;  4KY7 A;  2LQK A;  1B53 A;  4FIB A;  4LUD A;  3W1G A;  5DAU A;  1XNI A;  2QA4 A;  4ID6 A;  1WTR A;  3MEU A;  2RF0 A;  2RCF A;  3E9I A;  1YJW A;  4KUD K;  4OB2 B;  3J7A V;  3OW2 A;  1OV3 A;  3NGP A;  1BVS A;  4NL2 A;  4ZGJ B;  3TQ7 P;  1QVF P;  4IPC A;  1PRL C;  4XT1 B;  3HOZ H;  1CI3 M;  2R3Z A;  2B39 A;  5DM7 R;  3TSW A;  4JRP A;  2B2U A;  2PYK A;  3HRS A;  3CRL C;  5JAV A;  2PVD B;  2KRS A;  3L0O A;  4B3R L;  2UXB L;  4M7A G;  2I5L X;  4ZGE B;  3BU2 A;  4JLI A;  1LT5 D;  5JPN C;  4XYO A;  1SND A;  1LTT D;  3NTH A;  1M8A A;  4AYB G;  3L42 A;  4KN7 C;  4HJ9 A;  1RL2 A;  1U4L A;  1V43 A;  4DBR A;  2ZAE A;  1PH9 A;  5CR2 A;  1AWW A;  3CCR A;  3KF8 B;  1IHZ A;  1IRX A;  3MZ5 A;  5CBE E;  3KDF A;  2RK2 A;  1TT2 A;  4PNY A;  4M75 A;  2N88 A;  3TEH B;  1W6X A;  2DL8 A;  4MZT A;  4X1V A;  3ZFJ A;  2K05 A;  5EPL A;  1E2W A;  2I5M X;  1JJC B;  3ER0 A;  3EIV A;  4C5G A;  1FMW A;  4RFB A;  4C5H A;  4JI7 Q;  2HQE A;  3R2T A;  1ZLM A;  1NJI R;  2A73 B;  4DGZ A;  4DR4 Q;  1WX6 A;  2DYB A;  5I11 A;  3DEP A;  3OW2 P;  1PDQ A;  1QUQ A;  3CPF A;  1EIF A;  3U23 A;  2QEX Q;  4HCK A;  1Z7T A;  2D9T A;  4LDU A;  4WJW A;  5GMK i;  1DOK A;  4X62 L;  4BY6 C;  1OUL A;  1OXV A;  2RCN A;  1D3B A;  1LTS D;  1U5K A;  5I9P A;  2UUB L;  2KYB A;  1IHW A;  1VQD A;  1W6K A;  3E5S A;  3NPP A;  2RSN A;  4MTK A;  4DXG A;  2Q2I A;  1JT8 A;  4JLG A;  3P20 A;  5ECA A;  3C12 A;  2E12 A;  4F87 A;  4OML A;  1E1T A;  4P2C B;  5M3M H;  1X2K A;  5M3F H;  4JYA L;  4PJN A;  3S2H B;  1PYW D;  3CCL T;  1YNN D;  1CSP A;  4HJ8 A;  4MHE A;  3DB4 A;  4DR1 Q;  3JCM c;  2ENB A;  1CA6 A;  4M75 C;  3JB9 D;  3PMF A;  4M7A B;  3S2D B;  2NTT A;  1Q7Y C;  2MAM A;  2EYZ A;  3RKW A;  1ZBJ A;  1AWO A;  5JJZ A;  1Q1E A;  2DXB A;  3NPF A;  3CPW P;  1YIJ T;  4AYB B;  3FKI H;  1KIX A;  4R9W A;  1WNL A;  2RJD A;  3GTL H;  3GTG H;  1MND A;  2N3S A;  4IFD J;  2K32 A;  3HOW B;  3LW5 E;  1P8L A;  5GMK h;  1OPL A;  3LH5 A;  2EPB A;  1VQ6 A;  3BYY B;  3H6Z A;  4JUV A;  3DKM A;  5KYW A;  4R4O A;  2BZY A;  1HJP A;  4DU9 A;  4IUN A;  1CSK A;  1D09 B;  1NR2 A;  4X3T A;  3CRK C;  5KRU A;  5E1F A;  3CCE T;  4PJO E;  3S1Q B;  1TXQ A;  4RTZ A;  3CMA A;  3X25 B;  2AUK A;  3CW2 C;  3SK5 A;  4TVA B;  1BI1 A;  3M7G A;  5D3I B;  1VQ9 T;  5EBD A;  4HVW A;  2EGE A;  2E6Z A;  3GV3 A;  2M1H A;  1L0Y B;  1X6O A;  2JA6 G;  2A1A A;  3FDT A;  3CME A;  4BDY A;  1UG1 A;  3Q22 A;  2RH2 A;  3CCQ A;  4DOV A;  3O5Z A;  4KMU C;  5FO8 B;  2E5L L;  2B2Y A;  2EYW A;  2CZ6 B;  1VQN T;  1TWF H;  2F0J A;  4YCW A;  1S72 A;  5KND A;  5H1S E;  1R9T B;  2V1R A;  1Q8I A;  2RHS B;  3NEM A;  5BN3 A;  1HFG A;  3S1M H;  4KY6 A;  3CCU A;  1GD7 A;  3P75 A;  1JCK B;  1C1A A;  4OF1 A;  2HBW A;  3VYG A;  4M75 F;  4X64 L;  2MJ8 A;  1OO9 B;  4F8M A;  3HL8 A;  2XI9 A;  2UU9 L;  1G51 A;  2EQS A;  2UUC L;  1SMY C;  1ZKO A;  2HSE B;  2K5D A;  2Z6K A;  1GM5 A;  2HHH L;  3P8B B;  1HXY D;  1UE7 A;  1MBY A;  2BDN A;  2DMO A;  3KK7 A;  2DM1 A;  4IJH A;  3CP0 A;  5CYU A;  4A3F H;  2EYQ A;  4KD4 A;  4L63 B;  4RTY A;  1B7T A;  3G6E Q;  1Y1W H;  2GN5 A;  3NE5 B;  3PUX A;  3JB9 G;  1F9P A;  2L1B A;  5LJ3 e;  3SWN A;  1G83 A;  4HMJ A;  1CHP D;  1J8I A;  2JTM A;  3MJX A;  3I4M H;  1B3A A;  1NYF A;  3VR5 A;  3R6N A;  1QCB D;  1VQC A;  4A76 A;  4FO2 A;  1GUN A;  3G7L A;  4MML A;  1AVZ C;  2VC8 A;  1H9S B;  4RKU E;  1KQS S;  4FF4 A;  1TWC H;  4A63 B;  2LQW A;  2VXE A;  2LX9 A;  3K7U C;  3BYT B;  3TN2 A;  3TRZ A;  1D1C A;  3EGX A;  2VV5 A;  1K4U S;  2KUM A;  2ZPF B;  3M4O B;  3J80 i;  1T5X D;  4AQY Q;  4RHS A;  2RI2 A;  2EQI A;  3MET A;  1S5E D;  1EY9 A;  2XGT A;  4HCZ A;  2ZCF B;  4M75 E;  3J7A F;  1WCM H;  4YWL A;  1FXX A;  4JI3 L;  4HJ7 A;  2RA2 A;  3LWI A;  4K8I A;  2Z4H A;  2O2L D;  3RUX A;  2RHU A;  3VS1 A;  5GAN 5;  4OWT B;  4DR5 Q;  2QQ9 A;  3S14 B;  2YU9 B;  2EKO A;  1JC7 A;  4A3K H;  1PH2 A;  5C0X J;  4B3T Q;  1BCP C;  3G48 A;  1K3B C;  4IOC A;  4CI0 C;  4M77 C;  3JCM b;  1TQO A;  1Y1V G;  4C0Z A;  3RLN A;  1V1P A;  2KJX A;  1B8A A;  1CKO A;  3FVQ A;  4LF7 L;  1K8O A;  3FKI G;  5I2Y A;  3QZ5 B;  3V2T A;  2DN8 A;  1KC8 R;  4GLM A;  2WAQ B;  4DEY A;  5GAN h;  2XRQ D;  1IRE B;  1QVG A;  4J83 A;  3CCL A;  2BE5 C;  2LQN A;  3A7A B;  1JRI A;  4A3M H;  2E10 A;  2DJZ A;  4B3M L;  3C46 A;  5GAE C;  4EQ5 A;  5C44 G;  2DIQ A;  1MMA A;  3K5N A;  1LVK A;  2QEX A;  4K14 A;  4J9B A;  1RDP D;  4CHT B;  1XPO A;  1X43 A;  2G9D A;  2OXP A;  4O1N A;  3V05 A;  1UGS B;  4PNO A;  3C0C A;  3RN2 A;  3H0H A;  1RAB B;  1PNJ A;  1WHK A;  4EQO A;  2KHS A;  1ILQ A;  1JWS D;  4C3J G;  1SFO B;  1IHV A;  4BY7 G;  2JJ9 A;  3FIF A;  1YEZ A;  4IN3 A;  4HT9 A;  3N52 A;  2K57 A;  2PU9 B;  3FPU B;  1C6V X;  1SYB A;  3TP5 A;  5LHY 1;  1N8R C;  2JEB I;  2Z6K C;  4JV5 L;  4WTO B;  3X3N A;  2D8H A;  5A0D A;  1KAA A;  2C9O A;  1QVC A;  2LC4 A;  4XTU A;  4PL6 A;  3VJP A;  2XRS D;  5EKK A;  2ATW A;  4GN4 B;  2AIR B;  3QG1 A;  1N32 Q;  1FMK A;  3I56 T;  4HSP A;  2R57 A;  4MTN A;  3TSS A;  5C5M A;  1YIT Q;  4A4E A;  2KBN A;  1MGQ A;  2AT1 B;  2HIV A;  2FPF A;  1F9Q A;  4B3T L;  3I4N G;  3M0R A;  4A4F A;  1G8Z D;  1TWG B;  3S2D H;  3Q1J A;  4FYX B;  2CZ0 B;  4FNF A;  3QJ6 A;  3W1B A;  5LL6 X;  2XIC A;  4A93 B;  2FPE A;  3FKI B;  2NVY H;  2KK4 A;  2R7F A;  3ONA B;  4AFZ C;  2MIO A;  3BW1 A;  4BY1 H;  1GUS A;  4A4K A;  2RF4 A;  2OQK A;  4DNT B;  1QLY A;  3M0S A;  1E6H A;  3H9N A;  1RF2 D;  1YWP A;  3U58 A;  3OB9 A;  3SDZ A;  1XMO Q;  1PSE A;  1O7I A;  1N8R R;  1STE A;  3PTA A;  4DR2 L;  3EG9 B;  1N9W A;  3H3V H;  3N5B B;  9ATC B;  1MHN A;  4M7A C;  1E24 A;  5C3X A;  5FLM H;  4DBQ A;  1DD2 A;  2CGH A;  1I6V C;  1LT3 D;  3EQL C;  1STG A;  1JEG A;  1F9R A;  1SNQ A;  2PQA B;  5E4X A;  1LUZ A;  1UDL A;  2FRY A;  4HA8 A;  4XTX A;  4BBR B;  1RI9 A;  4CKB A;  4M78 B;  3R93 A;  1SR3 A;  1SRM A;  3SK8 A;  1AWX A;  2WV6 D;  5IT9 E;  1I5L A;  3SR1 A;  2MP1 A;  3FMC A;  2EY5 A;  2YUP A;  2V8K A;  1JQY D;  3HKS A;  3G6E T;  1PH4 A;  2F4I A;  4CBV A;  1K0R A;  3REA B;  3J7Y W;  2RHX A;  3AT1 B;  1HNX Q;  3JAM E;  1TWF B;  4LAA A;  1JQQ A;  5AYF A;  1SYF A;  2I0N A;  4PJL A;  5F2D A;  2A6E D;  5GAN 4;  2HNI A;  4A3C H;  1KK7 A;  1IXD A;  4OWX B;  4J7F A;  8AT1 B;  3HZX A;  5GAO m;  2RSO A;  4DR6 L;  1ZSZ C;  1EYA A;  1FNU A;  1Y14 B;  1NSN S;  3GTP B;  3LH0 A;  3CC7 Q;  2M16 A;  1YN8 A;  3M0T A;  4EPC A;  5L37 A;  1VQF A;  3K5M A;  1XMQ L;  1J5E Q;  4BUG A;  5EC7 A;  4JI4 L;  4LF5 Q;  2EQM A;  2GGR A;  1ESF A;  1SYG A;  2CT3 A;  4IUT A;  2KCN A;  1L0X B;  3S9W A;  4Y52 H;  3W5O A;  1HNX L;  3S3M A;  1W70 A;  5FLX L;  4DV4 Q;  2PTK A;  3OS0 A;  3F2D A;  1H9K A;  2AHJ B;  4XQ3 A;  1EZZ B;  2J0T D;  2XVS A;  3TP7 A;  1SRL A;  3NP8 A;  1DGS A;  3S15 H;  3H8Z A;  3VA5 A;  3GV6 A;  3PIP A;  5LMU Q;  1QQJ A;  4KK7 A;  3VRZ A;  2E41 A;  4DFA A;  1I50 H;  2ZT9 C;  1QOH A;  2A37 A;  4OMN A;  4HVV A;  3GTO B;  1OX9 A;  3VUZ A;  3ULJ A;  4BBR G;  5IGB A;  4GZY C;  4L5G A;  4PJO D;  1VQJ A;  2X69 A;  2IX0 A;  3NWS A;  1HCZ A;  2CDT A;  5IE8 A;  2DXU A;  4IIO A;  2N8N A;  3OW7 A;  2EY1 A;  4H7B A;  2MWP A;  2VS1 A;  4XU2 A;  2Z0W A;  1BOS A;  1UAP A;  3MVV A;  1M3B A;  3M4O H;  1B7Y B;  3I91 A;  4X6A H;  5JPM C;  1X32 A;  3HOY B;  1NEG A;  5IT9 L;  5CQY A;  1X01 A;  3L7Z C;  1ASY A;  2JA8 H;  3I9Q A;  4ILW A;  4YY3 Q;  1MJE A;  1O78 A;  3GTM H;  2JS0 A;  3CD6 T;  1M8M A;  4KKT A;  4M7D G;  5HCK A;  5FU6 B;  4BXX G;  1YFN A;  1YP5 A;  4PZ6 A;  3OYG A;  1FJG L;  1NMF A;  1LTR D;  1VQI A;  1PYS B;  2FZG B;  3OWF A;  3QB3 A;  1I4K 1;  5I2S A;  3NBI A;  1RAF B;  2CUD A;  3F2C A;  5GAO l;  3M4Y A;  1EY7 A;  1EZ8 A;  1VQN A;  3OSO A;  1O7Y A;  4O5V A;  3CCV Q;  1S72 T;  4X3U A;  2LXJ A;  2Z9H A;  4PFP A;  5CCA A;  1VQG A;  3ME9 A;  5M5X H;  1GHK A;  3S1N H;  3M9Q A;  5EGT A;  2VQF Q;  3CCV T;  1KFZ A;  3ASK A;  2B2T C;  3OYL A;  4QQD A;  3MHB A;  2HCC A;  5FK9 C;  2P0K A;  5C4X B;  3HOU G;  5DM6 3;  2YHT A;  5GAD C;  4FL6 A;  1D7Q A;  2QDL A;  1SE3 A;  1C7Y A;  1JE4 A;  3GD7 A;  1VF5 C;  1RI0 A;  5LJ5 e;  1EU4 A;  1RAC B;  1VCI A;  2CP0 A;  3EJI A;  1HK9 A;  3JCM g;  1UGQ B;  1K9A A;  2K14 A;  5EKI A;  4F88 A;  2EYF A;  1TS2 A;  2UXC L;  1VQ8 T;  1O7L A;  3VYU A;  3HRZ C;  2Q2T A;  2YTV A;  2MCN A;  3E19 A;  3PUW A;  3GF5 A;  3M56 A;  2O31 A;  4OMF B;  3I55 T;  1KIK A;  2E74 C;  3ULP A;  3QIA A;  1TS3 A;  1PH7 A;  4NB3 A;  4A3D H;  3TS0 A;  2WKC A;  2E2I H;  3VYS A;  4AFU C;  3STB D;  1VMC A;  3OYA A;  2IJ0 A;  3OWE B;  2RQR A;  1BF4 A;  1YJ9 A;  1WTQ A;  3RKX A;  1OXU A;  1VS0 A;  1BNZ A;  2VL6 A;  3HOZ G;  3K0Y A;  2KEA A;  1ICF B;  2E5L Q;  2F0H A;  2XSC A;  3MAQ A;  2BKD N;  4WCI A;  1IYJ B;  3HSB A;  2K5H A;  3IRB A;  1VQB A;  4DV3 Q;  2HEQ A;  4IFD G;  4BD3 A;  1U3O A;  1I6H B;  2CSI A;  3AU7 A;  5KYX A;  1X3F A;  1A15 A;  2COZ A;  3J81 E;  3HOU B;  4UAI A;  4ME3 A;  4EX5 A;  2IPO B;  1E7O A;  2A36 A;  4JZ4 A;  1LOJ A;  5KYX B;  4A3G B;  2L3P A;  2XMF A;  5CKF A;  1K83 B;  2J06 A;  1MHW C;  2VW9 A;  2K03 A;  1EY6 A;  2PVG B;  4HTH A;  2HQH A;  4BE0 A;  1NBE B;  1H9M A;  3SE0 A;  2XD0 A;  5JEA J;  2DL5 A;  2DF6 A;  1BBW A;  1SYC A;  3OS2 A;  2HL3 A;  3OYD A;  1ZUY A;  4J6W A;  1VQE A;  4DV4 L;  5M5W B;  1UGP B;  2P4R A;  3P8H A;  3JRZ A;  4RAU C;  2KHI A;  4ZNX A;  2JA8 B;  3DWQ A;  2BOS A;  4RTX A;  2RK1 A;  2PNH A;  4LF6 Q;  3C2P A;  2E3I A;  3AQQ A;  2PZT A;  1EQT A;  1UE9 A;  3GQB A;  4JC0 A;  5CR3 A;  3SD4 A;  3RR6 A;  3A5U A;  2O2O A;  2VXW A;  1B9N A;  1C0A A;  1LNX A;  1RHP A;  4EMG A;  3WWV A;  2KED A;  5I4D A;  4C92 E;  1L1O C;  2YV5 A;  2XDD A;  3QYH B;  3CCU T;  4JG2 A;  3SEB A;  3F1Z A;  1GUT A;  1G6P A;  4JJD A;  2E8G A;  3I2Z A;  2EGC A;  2EYH A;  3L2R A;  3VA7 A;  3OYM A;  4N0A C;  2EQU A;  4C92 B;  1Q90 A;  3C94 A;  2GQV A;  2F3I A;  4ME7 A;  3Q0A A;  1TU0 B;  5CBA E;  1WTV A;  1XMO L;  5IAY A;  2K5W A;  3T1Y Q;  2MMP A;  1D0X A;  2O4X A;  2JOY A;  5CKD A;  5GAN g;  1QMC A;  2F0K A;  4JI5 Q;  1SMY D;  3URG A;  4LW1 A;  3D4W A;  4CKC A;  1WD1 A;  2KDS A;  5IGE A;  2NVX B;  5IYC G;  5IGD A;  4RCB A;  5K36 G;  5IGG A;  2M02 A;  3GBQ A;  1A3V A;  1KL9 A;  2DZ9 A;  1NY4 A;  1O80 A;  3H3V I;  1P92 A;  4J15 A;  3V7S A;  4J6X A;  1K9M R;  2A19 A;  2ROL A;  2RD1 A;  1X3P A;  4M7D C;  4OMQ A;  2C06 A;  2ZPE B;  1BU1 A;  1V1P B;  4FF2 A;  2FZC B;  3X3M A;  2FRW A;  3SK4 A;  1Q46 A;  3HOY H;  2XG8 D;  4ME5 A;  1K1Z A;  3GPL A;  2F1M A;  2JMC A;  4B6M A;  2JA5 H;  1A63 A;  1FYN A;  3EH2 A;  1J6Q A;  2EYL A;  1G3Y A;  3INZ A;  1AZP A;  3RZD H;  3RDV A;  3OQ5 A;  2FEI A;  3EG3 A;  5GAO n;  1WHG A;  1PM3 A;  2QGQ A;  5EPJ A;  4AH6 A;  3CCU Q;  3K5L A;  3JCM W;  3DUZ A;  2FVU A;  4C8Q C;  4WJ3 M;  4JBJ A;  5JEA H;  4IUU A;  2CYZ B;  2KE9 A;  4M78 C;  4J9C A;  2AWN A;  2RN8 A;  3JCM h;  1SG5 A;  4BI8 B;  1BYM A;  4O0A A;  3O8V A;  4GOP B;  4UY8 C;  3L2Z A;  4LDY A;  4F14 A;  3GP8 A;  4C8Q G;  4DV5 L;  1D5X C;  2RHY A;  1HPC A;  2G9H D;  3CME Q;  5IWA Q;  4OWW B;  1PC0 A;  1TWB A;  2V1Q A;  3NHH A;  1U1T A;  2BDO A;  4KUI A;  4LD9 K;  4WOR A;  3KF6 B;  2Q8T A;  5KNC A;  4ELY C;  2HKQ B;  4R56 A;  1LT4 D;  2JUF A;  3E0J A;  3M4P A;  3CCE A;  3OSV A;  4K2L A;  5DEH A;  1IBL L;  3CMA Q;  5M3M B;  4RTV A;  1B70 B;  2KAF A;  1KSW A;  2JS2 A;  1KNA A;  1HUN A;  2DNC A;  5FO9 B;  1HUM A;  2GFA A;  2LCS A;  2O4X B;  1IO6 A;  4R8I A;  3OS1 A;  2VGM A;  2X9H A;  2ZXO A;  4K5W A;  1BBX C;  3KJO A;  2VQE L;  3WVE B;  1VQ6 Q;  1N36 Q;  3A98 A;  4FU6 A;  4J9D A;  3TSZ A;  1KRT A;  1DOM A;  5AJ3 Q;  2ICI A;  1R9T H;  2DA9 A;  3RKY A;  2LX7 A;  1CSQ A;  1JOK A;  2IT1 A;  4DUY Q;  2QCP X;  4LD6 A;  2NWM A;  2Q8R E;  2RM4 A;  2X51 A;  2LJ0 A;  1GUG A;  4YY3 L;  3K7A H;  3PIO 3;  3BS1 A;  3SK6 A;  5IXF A;  5C3W A;  2F0I A;  2DD4 A;  3WOE A;  4HCE A;  3GIB A;  3PNW C;  3T1H Q;  2NUZ A;  2PI2 E;  1GFD A;  1GXI E;  2M0O A;  3T1Y L;  2YLB A;  4HT8 A;  1PSF A;  2LFN A;  2YRV A;  1KRS A;  2PCF B;  4KTA A;  1ET6 A;  4LFC Q;  2DER A;  3L1A A;  1AT1 B;  1H92 A;  1LV9 A;  1M4V A;  1ZSG A;  5C3E B;  4FSS A;  3S1R H;  4C8Q B;  4LUV A;  1X2Q A;  1Y1W B;  2AUJ D;  1TWA B;  5FWC A;  5GAN 6;  1QVG S;  2VWF A;  3VYT A;  4L6T B;  1BCP F;  4GNX A;  1S1N A;  4Y91 A;  1KAB A;  2HCK A;  2D0Q B;  3D8G A;  4JBK A;  1QCO A;  1ZX6 A;  2F4V Q;  1YIT A;  2PNR C;  4J9F A;  2WKD A;  1IL2 A;  4J9I A;  3V96 A;  3JCM f;  2BZ8 A;  2QK0 A;  1C48 A;  1WJJ A;  1CUK A;  2NB0 A;  1ROD A;  2KCM A;  1KDC A;  3I90 A;  2YU9 H;  1X6B A;  3FLG A;  1K8A R;  2KCC A;  4JS4 A;  3AB9 A;  4DQ2 A;  3K5O A;  2A08 A;  2L3S A;  4C92 F;  1GL5 A;  2K6D A;  1Q7Y U;  4LFA L;  4M7A D;  5EBC A;  2DYI A;  3CHB D;  3CCR Q;  2L0C A;  3KF6 A;  1QCN A;  5M5W H;  1A0I A;  1EFN A;  3HKZ E;  2IWH A;  4BA2 I;  2UUC Q;  2UU9 Q;  4FT4 A;  2CWA A;  3TQY A;  5T1I A;  1MMD A;  3R2I A;  4YWM A;  3QWX X;  3HP3 A;  1BO0 A;  4X65 Q;  4IOA A;  1KLG D;  4XU1 A;  5C4Z A;  1IZ6 A;  3PVQ A;  3FDR A;  4M7D D;  4HVU A;  3J81 j;  3I4M B;  2AQ3 B;  2LT1 A;  4OO1 I;  3CCL Q;  1IKL A;  3BVG A;  5K5P A;  3WDN A;  2R7Z H;  2K52 A;  5ELE A;  4JRK A;  1G3S A;  3H15 A;  1Y1W G;  4G7H C;  3G71 A;  4ZAI A;  1SRO A;  3M55 A;  5GAM h;  3Q6S A;  5FKA C;  3TS2 A;  3CBO A;  4M75 D;  1M8V A;  2ZTC A;  4DR3 Q;  3M85 A;  1PH8 A;  4EDU A;  2FO0 A;  8ATC B;  3CCM Q;  4KGZ B;  5LL6 S;  4NL3 A;  1C0M A;  1K8M A;  3CBP A;  1OI1 A;  3SWN B;  3D6C A;  4PG3 A;  5KGU A;  4JI7 L;  1Y8P B;  4LF4 L;  2P0P A;  1AEX A;  2DNU A;  4OB0 B;  3MWY W;  4KT0 E;  3NEL A;  2HDL A;  3J81 c;  4C3I B;  2C35 B;  2A0F B;  2OJ2 A;  3BZK A;  4YCU A;  5J26 A;  2KQ3 A;  1F9S A;  3RES A;  4HED A;  2NVY B;  4F7U G;  5D6X A;  2LNV A;  1ICW A;  1WYD A;  3QWN A;  5IOC A;  2NUC A;  3MFY A;  4KJO A;  1YNX A;  1O75 A;  2OAU A;  4ULL A;  3MXN A;  3OIP A;  3JB9 J;  2F0L A;  2E2H B;  3M58 A;  1LPL A;  1II3 A;  4HIO A;  4A93 G;  1Z9Q A;  2EZV A;  3S6W A;  5GMK m;  1IXR A;  2PZW A;  2JTE A;  4N0A A;  4A3M B;  1OXS C;  4R4C A;  3OA6 A;  1YNJ D;  5CKE A;  3LNN A;  1X65 A;  1PTO B;  3NMZ C;  1Q82 U;  1FNW A;  4HID A;  1SDF A;  2EJF C;  1QWY A;  4LDX A;  4A3E G;  3A54 A;  2DKG A;  2NVQ B;  1EFI D;  4GLA C;  3QR8 A;  4QVD A;  1Y96 A;  4FVM A;  1XTD A;  4XQQ A;  4DR3 L;  3GTK B;  1D1I A;  3SFM A;  4KD3 A;  3S3O A;  1FD7 D;  2P4T A;  2AQ2 B;  1EY4 A;  3TP8 A;  3A8K E;  2YTX A;  3CCV A;  2DIL A;  4ZQ3 A;  4GLX A;  4JI6 L;  3ZEH A;  2LVM A;  3JCM e;  1HYO A;  2EDG A;  1N33 Q;  1KTK A;  2KHJ A;  1VQ7 Q;  4A75 A;  4IIM A;  2EE1 A;  2YSQ A;  5IYB H;  2K5F A;  5FRM A;  5FU6 C;  1J9O A;  4IQZ A;  3R3O A;  3A8O B;  1CKN A;  3H0F A;  2MNA A;  4DEX A;  5JJI A;  1NLO C;  4OIK A;  2E1H A;  1PVO A;  3SVM A;  5KYI A;  2CP6 A;  2V1C C;  3HFZ B;  1PH3 A;  4A3M G;  1LJO A;  1M2O A;  2B8F A;  1Q86 R;  2AKK A;  1EWI A;  1FYC A;  5AJ3 L;  2A28 A;  4LDV A;  1NJI U;  2F0O A;  1N9S A;  1VQ7 A;  1K0S A;  1VQ6 T;  5ISR A;  3GTO H;  1RAD B;  1PTO F;  1HNW Q;  4X66 Q;  4PMC A;  3K58 A;  3ERQ A;  3A1P A;  5JJK A;  4BXX H;  1BB9 A;  4QIW E;  4A4G A;  2D0P A;  1J5E L;  1CK1 A;  2HQL A;  3MA2 B;  2L89 A;  1EY0 A;  3STB C;  3JCM J;  2CHB D;  4LF5 L;  3RLO A;  1IBL Q;  3H41 A;  3GTQ B;  1AFP A;  2LKV A;  1GBR A;  4ZUJ A;  1DON A;  3A5Z B;  2DE0 X;  1EX4 A;  2VB6 A;  2F2X A;  2PUO B;  2QAZ A;  5I2M A;  1B34 B;  2QDY B;  4MN3 A;  5C0X I;  3BDL A;  2KY9 A;  3V8L A;  4M4Z A;  2WFW A;  3KFV A;  4PJO G;  4QF4 A; 
#chains in the Genus database with same CATH homology
 3QWY A;  4GBQ A;  3CQT A;  1SEM A;  4J9G A;  2RNA A;  1JEG A;  2K3B A;  1NM7 A;  2LMJ A;  1ZUU A;  1UDL A;  2FRY A;  1RI9 A;  1SRM A;  1AWX A;  2H8H A;  4QT7 A;  2YUO A;  2YUP A;  1WXB A;  3REA B;  3VS3 A;  1AZE A;  1J3T A;  1SHG A;  1QCF A;  1JQQ A;  1OPK A;  2I0N A;  1I1J A;  1BK2 A;  4Z89 A;  2DLP A;  2HDA A;  1H3H A;  3M0T A;  1YN8 A;  5EC7 A;  3UF4 A;  2GGR A;  4KRT A;  2CT3 A;  1UUE A;  1W70 A;  4AFS C;  2EBP A;  2PTK A;  2D1X A;  1SRL A;  3EG1 A;  2KBT A;  1OEB A;  1X69 A;  3H0I A;  2VVK A;  1VA7 A;  1YWO A;  4CC2 A;  3VRZ A;  1KJW A;  2KRM A;  3JV3 A;  1PKS A;  4D8D A;  2A37 A;  4OMN A;  4HVV A;  1WYX A;  2JM9 A;  2J05 A;  4RTU A;  2RQU A;  2YDL A;  2CT4 A;  2YUQ A;  2CDT A;  2JM8 A;  4IIO A;  2E5K A;  2J7I A;  2AKL A;  2K9G A;  2HSP A;  2VKN A;  1WDX A;  4JZ3 A;  1AD5 A;  2KRO A;  2YT6 A;  2KRN A;  1M3B A;  2DRK A;  2X3X D;  1JU5 C;  2AZV A;  1NEG A;  2DL3 A;  2EW3 A;  2MOX A;  2LJ3 A;  3I9Q A;  2L2P A;  1HSQ A;  1I07 A;  2JS0 A;  1M8M A;  5HCK A;  2O88 A;  1YP5 A;  4JJC A;  1H8K A;  1YCS B;  2DBK A;  2CUD A;  4CC4 B;  1V1C A;  3EHR A;  2K7A A;  1GCP A;  4ESR A;  4LNP A;  1T0H A;  1CKB A;  1KFZ A;  1UEC A;  1GCQ C;  4EIK A;  2QDL A;  1ZUK A;  2KXD A;  3VS2 A;  2ROT A;  4OMP A;  1K9A A;  2GNC A;  1XOV A;  2MCN A;  2JMA A;  2G6F X;  1PKT A;  2O31 A;  1KIK A;  1B3Q A;  1RUW A;  2GTO A;  1TUD A;  1AEY A;  2ABL A;  4AFU C;  2RQR A;  2X3W D;  1HJD A;  4OMO A;  1BBZ A;  4R0K A;  2KEA A;  2IIM A;  4RTW A;  4LUE A;  3RBB B;  1WI7 A;  3M0P A;  4WCI A;  2BTT A;  1VYU A;  2HEQ A;  2M51 A;  2J6K A;  5IH2 A;  1U3O A;  2CSI A;  3FJ5 A;  1PWT A;  1E7O A;  1MV0 B;  1QWE A;  2A36 A;  4JZ4 A;  2EKH A;  2L3P A;  2XMF A;  2J06 A;  2W0Z A;  1QKW A;  1T3S A;  2PZ1 A;  2SEM A;  1SPK A;  4AG1 C;  4ORZ A;  2EYY A;  2KNB B;  2DL5 A;  2DF6 A;  1ZUY A;  5IHN A;  2CH4 W;  2O9V A;  2P4R A;  2C0O A;  3VS4 A;  4ZNX A;  2LJ1 A;  4RTX A;  2SRC A;  1WIE A;  1UE9 A;  2AK5 A;  2O2O A;  4Z8A A;  1GRI A;  3VS5 A;  4JJD A;  2EGC A;  3UAT A;  4J9H A;  1NG2 A;  2GQI A;  1Y57 A;  4LE9 A;  1GBQ A;  1Z9Z A;  1NYG A;  2GBQ A;  3SEM A;  3THK A;  1K76 A;  1TUC A;  1ABQ A;  4HXJ A;  2B86 A;  2DL7 A;  1AOJ A;  2F2W A;  3EG0 A;  2D0N A;  2DBM A;  2LNH B;  1T0J A;  1X27 A;  2DX1 A;  4D8K A;  3GBQ A;  2PNI A;  4RTT A;  2J6F A;  3PVL A;  3PE0 A;  3SHW A;  1GCQ A;  2ROL A;  4JJB A;  3UA6 A;  2FPD A;  2DVJ A;  4OMQ A;  1E6G A;  1BU1 A;  4AG2 C;  2L3Q A;  3RNJ A;  2FRW A;  2C0T A;  2K79 A;  2EPD A;  1K1Z A;  1A0N B;  2JMC A;  2JXB A;  1FYN A;  2RMO A;  5IHI A;  4LUD A;  2LZ6 B;  3UA7 A;  2RF0 A;  2KYM A;  4CC7 A;  2FEI A;  3EG3 A;  1OV3 A;  1RLP C;  3NGP A;  1M3A A;  1Y0M A;  2GTJ A;  5IHK A;  1PRL C;  4CC3 A;  2KE9 A;  5FW9 A;  4J9C A;  2RN8 A;  3TSW A;  3EG2 A;  2KRS A;  2ECZ A;  2KR3 A;  4F14 A;  2W10 A;  1UFF A;  1NEB A;  2V1Q A;  1AWW A;  1U5S A;  4K11 A;  1M27 C;  4RTV A;  1KSW A;  1K0X A;  2JS2 A;  1W6X A;  2DL8 A;  1UJY A;  3I5S A;  4X1V A;  1M3C A;  1X6G A;  2LCS A;  1IO6 A;  2ESW A;  1ZLM A;  1AZG B;  1WX6 A;  2DYB A;  5I11 A;  3A98 A;  4J9D A;  1WA7 A;  3TSZ A;  3U23 A;  4HCK A;  2DA9 A;  2LX7 A;  2YUN A;  2NWM A;  2LJ0 A;  3VS7 A;  4AFQ C;  2KYB A;  5IXF A;  2OI3 A;  5ECA A;  4RUG A;  4OML A;  2NUZ A;  1X2K A;  1GFD A;  1QWF A;  1AWJ A;  4F17 A;  1UHF A;  3VS0 A;  1M30 A;  1H92 A;  1HD3 A;  4JPB W;  1ZSG A;  2EYZ A;  4FSS A;  1ZBJ A;  1AWO A;  2RQW A;  1X2Q A;  3NPF A;  2O9S A;  5FWC A;  1SHF A;  2VWF A;  1WXU A;  1S1N A;  1GFC A;  2BZX A;  2HCK A;  1ZX6 A;  3TVT A;  5I22 A;  1OPL A;  4J9F A;  3LH5 A;  3ZL7 C;  4J9I A;  1MV3 A;  2BZ8 A;  2D8J A;  2KT1 A;  2BZY A;  1CSK A;  1X6B A;  1RLQ C;  1WXT A;  2A08 A;  2C0I A;  2L3S A;  1GL5 A;  4RTZ A;  2K6D A;  5FWB A;  1QKX A;  2RPN A;  1WFW A;  4HVW A;  2EGE A;  1ABO A;  1EFN A;  1PHT A;  1UG1 A;  1JXO A;  3O5Z A;  1JO8 A;  2ENM A;  2EYW A;  1UTI A;  3QWX X;  4LN2 A;  4OMM A;  2V1R A;  3PVQ A;  4HVU A;  5GJW B;  2HBW A;  2M0Y A;  3VRY A;  2CRE A;  2EVR A;  2DMO A;  1YNZ A;  2DM1 A;  1ARK A;  1WLP B;  2FO0 A;  4RTY A;  2LP5 A;  1VYV A;  1UJ0 A;  3NHN A;  1G83 A;  2DNU A;  1VYT A;  5L23 A;  2DRM A;  3M0Q A;  1NYF A;  2OJ2 A;  1U06 A;  3R6N A;  2JT4 A;  1AVZ C;  4A63 B;  2LQW A;  5GJV B;  3I5R A;  3ULR B;  2CUB A;  1K4U S;  1UHC A;  2EGA A;  1Z9Q A;  2EQI A;  1OOT A;  2JTE A;  1UGV A;  3VS1 A;  3NMZ C;  1MUZ A;  2CH4 A;  4E6R A;  4F16 A;  1W1F A;  2EYX A;  1CKA A;  4GLM A;  2L0A A;  4DEY A;  2KXC A;  2LQN A;  1LCK A;  2RQT A;  3IQL A;  3VS6 A;  2RQV A;  3REB B;  2CSQ A;  2DIL A;  2KT8 A;  4IIM A;  2YSQ A;  4J9B A;  1X43 A;  1T3L A;  1JXM A;  4J9E A;  3M0U A;  3C0C A;  3H0H A;  1PNJ A;  3H0F A;  4DEX A;  1NLO C;  2AZS A;  1NLP C;  2DL4 A;  1TG0 A;  2AKK A;  2J6O A;  2A28 A;  3EGU A;  2KGT A;  1K0S A;  2OAW A;  5IXB A;  2D8H A;  2K2M A;  3I35 A;  1FMK A;  1G2B A;  1BB9 A;  1PRM C;  2FPF A;  3M0R A;  1B07 A;  2ED1 A;  3H41 A;  4Z88 A;  1GBR A;  2FPE A;  2DE0 X;  2F2V A;  3EHQ A;  4Y92 A;  2MIO A;  4AFZ C;  2F2X A;  1I0C A;  2JW4 A;  2ED0 A;  1QLY A;  2FG0 A;  1E6H A;  3M0S A;  4M4Z A;  1YWP A;  3KFV A;  1SSH A;  1N5Z A;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...