2QDLA

Crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
154
structure length
154
Chain Sequence
KHHHHHHPMPKKIVVFSLAEELYGLDIFDVHEVVKDVSITKIPETPEFIEGIINLRGKIIPVIDLKKRFGIGKRGKSKDSRIIIVEILGQKAGLIVDAVHEVIPIDENSIEPPPPVTTIDTAFVEGIAKTDDKMIIIIKLHFLFEVNGKEMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis signal transduction protein
publication title Crystal structure of scaffolding protein CheW from thermoanaerobacter tengcongensis.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Signaling protein
total genus 25
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2qdlA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2qdlA02
1VYTA 2EYWA 4D8DA 2LNHB 1ZLMA 2J6FA 1JXMA 1NYGA 2D1XA 1PWTA 2ESWA 2O9SA 4LE9A 2A28A 1GCPA 2KR3A 1QWEA 3SHWA 4E6RA 4J9HA 5ECAA 1QWFA 1GFDA 3ULRB 3EG2A 4F16A 3UF4A 1TG0A 3NMZC 4AFQC 1UE9A 4J9EA 2DRKA 3PVQA 1SPKA 2IIMA 3M0QA 1I07A 1B07A 2OI3A 2KROA 4OMMA 2KT1A 2CUDA 4RTXA 2K9GA 2AK5A 2AZSA 3VS1A 2A36A 2H8HA 2ABLA 2KBTA 4HCKA 2X3XD 1ZUKA 1SHGA 1TUCA 2AZVA 1RLPC 2CUBA 2LP5A 2FRWA 2PNIA 3EG1A 3VRYA 1T0JA 1UJYA 3REBB 1PRMC 2OJ2A 5GJWB 2J6OA 1H3HA 2SEMA 2EBPA 3VS5A 1X6GA 1GL5A 2MCNA 4JJDA 3UATA 2KGTA 4AG2C 3I9QA 1U06A 2L3QA 1VYVA 1OOTA 4AG1C 1MV0B 2VWFA 2CH4W 1BK2A 2HEQA 3VS7A 2D8JA 2FPDA 2XMFA 3VS2A 4OMNA 1RI9A 2JMCA 1K0SA 1BU1A 2DYBA 3FJ5A 2RQWA 2LMJA 2JW4A 1A0NB 5FW9A 1HSQA 1RUWA 1VA7A 1XOVA 3EHRA 1WX6A 4GBQA 1AOJA 3VS3A 2YSQA 1UJ0A 4Z88A 2FPFA 1YP5A 1SSHA 2DJQA 1NEBA 2DRMA 4LN2A 5GJVB 4CC2A 2JS2A 2JTEA 2CSIA 1UDLA 4Y92A 2HDAA 1OEBA 3O5ZA 3KFVA 4WCIA 1M8MA 2DVJA 2J6KA 1YWPA 3EHQA 1ZSGA 2LQNA 1UGVA 1W70A 3NPFA 3PVLA 1KFZA 2JT4A 1K4US 2M51A 1M30A 1QKXA 2DBKA 1ARKA 1GBQA 2PTKA 1JEGA 2YUQA 2JS0A 4J9GA 1YWOA 1X43A 3EG0A 2L3SA 1MUZA 1AZEA 2NWMA 2O9VA 4R0KA 4A63B 2FPEA 3ZL7C 4Z89A 2V1RA 2KT8A 2KRMA 1ZUYA 1T0HA 4ORZA 2CSQA 2L3PA 3M0UA 1YNZA 1BBZA 2GGRA 2DBMA 2EGEA 4LUEA 3U23A 3TSWA 2K3BA 3VS4A 1T3LA 1X69A 3M0RA 4D8KA 2I0NA 2W10A 1V1CA 2DNUA 1E7OA 1UG1A 2CT3A 3A98A 3M0TA 1FYNA 3H0IA 2F2VA 1SRLA 2EGAA 1AWXA 2O2OA 2VKNA 4M4ZA 1PNJA 2NUZA 2GTJA 1HD3A 1WXTA 1K1ZA 2DX1A 1PRLC 2LJ3A 2YUNA 1PHTA 2L2PA 2AKLA 1AWWA 1ABQA 3VRZA 4HVUA 5FWCA 1WA7A 1EFNA 1UHFA 1M27C 2EGCA 4CC7A 3VS0A 2QDLA 3H0HA 1W1FA 3THKA 2RQVA 2YDLA 1GRIA 1M3BA 1JXOA 1OPLA 1B3QA 4KRTA 2KYMA 1N5ZA 1BB9A 1ZUUA 1UFFA 1NLOC 2J05A 2FRYA 4ZNXA 1UECA 2DL3A 5FWBA 2RMOA 4HXJA 4J9DA 4OMPA 1SRMA 2YUOA 2JM8A 4LNPA 1G83A 1CKBA 1Y0MA 1TUDA 1PKTA 2RQRA 1GBRA 1KSWA 2V1QA 4RTYA 2KYBA 4JZ3A 1SHFA 2F2WA 4Z8AA 4RTUA 1K9AA 1J3TA 2B86A 2K2MA 1M3AA 2LJ1A 1KJWA 1X6BA 1IO6A 1NEGA 1GCQC 1Z9ZA 1AVZC 3VS6A 2KRNA 2EKHA 4EIKA 2X3WD 2YT6A 2A08A 2EVRA 4CC4B 5I22A 2CT4A 2GBQA 2J06A 2YUPA 3JV3A 4JJCA 1GFCA 1QCFA 2W0ZA 2EYZA 1K0XA 1S1NA 2GTOA 3CQTA 3I35A 2KEAA 3H0FA 2RN8A 2BZ8A 2BZXA 2CH4A 3SEMA 5IH2A 2PZ1A 2LZ6B 2GQIA 1E6GA 3H41A 4HVWA 2DA9A 1AWOA 2KXCA 2RQUA 3QWXX 3M0PA 2SRCA 1LCKA 1X2QA 5L23A 5I11A 1CSKA 1E6HA 2EYXA 3UA6A 1NG2A 2FO0A 2D0NA 1FMKA 2CREA 2J7IA 4RTZA 2GNCA 2EW3A 2DL7A 5IXFA 2MOXA 3UA7A 2ROTA 2ED1A 2ECZA 2FEIA 2O88A 3TSZA 2O31A 3R6NA 3GBQA 2M0YA 2FG0A 2F2XA 5IHIA 2P4RA 2HBWA 1VYUA 2DLPA 2RQTA 1U5SA 3TVTA 1WFWA 1H8KA 1I0CA 2C0TA 5EC7A 1ZX6A 4AFUC 4F14A 2DM1A 1OPKA 2K6DA 4OMLA 2E5KA 4DEYA 1YCSB 3I5SA 4FSSA 1WXBA 4RUGA 1WIEA 2HSPA 3EGUA 2BZYA 1GCQA 2K7AA 3M0SA 5IXBA 2CDTA 2C0OA 1YN8A 3NHNA 1JU5C 2KNBB 4HVVA 1AD5A 5IHNA 4OMOA 1PKSA 1ZBJA 3C0CA 2KXDA 2LCSA 4LUDA 4CC3A 2KRSA 1JO8A 1UUEA 3REAB 4IIOA 4RTVA 4DEXA 1X27A 2D8HA 2A37A 1AWJA 2JM9A 2DL8A 1WYXA 1T3SA 2KE9A 2RNAA 1AEYA 2DL4A 3NGPA 2OAWA 2EPDA 4IIMA 4AFSC 2ENMA 1K76A 2ED0A 1H92A 2RF0A 1NLPC 3PE0A 4AFZC 5IHKA 1CKAA 4RTWA 2C0IA 2DMOA 2EYYA 4J9BA 1QKWA 3RBBB 4OMQA 4X1VA 4K11A 4JJBA 3EG3A 4QT7A 2DILA 4JPBW 2RPNA 2JMAA 1WI7A 1RLQC 4ESRA 3RNJA 1UTIA 3IQLA 2JXBA 2ROLA 1X2KA 2K79A 1I1JA 5HCKA 1OV3A 1AZGB 4F17A 2MIOA 2L0AA 1HJDA 1QLYA 2DF6A 1Y57A 1UHCA 1JQQA 4GLMA 4RTTA 4J9IA 1WLPB 1Z9QA 3I5RA 4JZ4A 1NM7A 2LJ0A 2LX7A 2DL5A 2LQWA 1M3CA 1U3OA 3QWYA 1ABOA 2G6FX 1MV3A 3LH5A 1WDXA 2HCKA 1SEMA 1KIKA 2AKKA 4J9FA 1NYFA 1W6XA 2VVKA 2BTTA 1WXUA 2DE0X 4J9CA 1G2BA 2EQIA
chains in the Genus database with same CATH superfamily
1VYTA 2EYWA 3A8HB 3GPLA 2LNHB 2YRCA 4GNXC 1ZLMA 1YZ6A 1JXMA 2HQEA 1LPLA 1MMGA 3G7ZA 4QQ6A 2RDHA 3NEMA 4LE9A 2H1EA 5GMKj 3OSVA 1QWEA 3GNFB 2LQKA 4E6RA 1B7YB 1PMRA 1Y14B 4LFCL 1GFDA 3OW2A 1KC8R 1P16A 3EG2A 1IHVA 4UHVA 5D7UA 5GAN7 2NN6I 3VDYA 1B53A 2L5QA 3EH2A 1S3OA 2AKWB 4NP5A 4XQ3A 4X66Q 3DWPA 3M4OH 4IFDH 4ULLA 2B2YA 1B07A 1MSHA 4O5VA 5JJIA 4OMMA 2PO4A 1N9RA 3CMAQ 1PH3A 5IYBH 5KYXB 2K9GA 1BUVT 2K7VA 4HMIA 2WP8J 1YITT 2A36A 2H8HA 2HD0A 3QZ9B 4HCKA 1VQ7T 1PLFA 4CHTB 3M53A 5KGUA 2PPBC 1HRJA 1VQJA 1C4QA 4P2CB 3CC2A 2LP5A 5C0MA 2PZWA 5EQ0A 1O9SA 1IBML 3EG1A 4R56A 4C2MH 1B50A 5KE2A 3D6WA 1Q82C 1D1AA 3STBD 2OJ2A 4WTOB 3CRKC 2GQVA 1RAIB 2MHVA 3K80C 2J6OA 4ANJA 2OCEA 5D3DA 4LF4Q 3S1MB 3E3XA 3OYNA 1VQNT 1IXDA 1XMOL 2NZ1D 1VQ4A 4XIGS 5COYA 3M4GA 3PIPA 2FHTA 4LFAL 3QWNA 4AG2C 2VS1A 3STBC 4JLIA 3KK7A 2P84A 2L3QA 4JI8L 4QMGA 1KXLA 4AG1C 2R58A 2LKVA 1PSFA 4BS9A 1DM0B 3FDRA 3H9NA 1RAHB 3JAML 2Z0SA 5GAMj 4C3IH 1TWFB 5IP9H 4HR7B 4DR1Q 3MHXA 1TWBA 3CCMA 1D0ZA 3HOWB 4IURA 3VKIA 1EU4A 3RNUA 4DV6L 1V9PA 2F0QA 2ZXPA 5DLQE 5A0GA 5KYNA 2D8JA 3OS0A 5ELBA 2JTFA 3JCMf 1SE4A 1M2VB 2PQEA 1BI3A 5LJ5d 1BO0A 4M75F 4UC4A 4QUFA 4LUVA 1BU1A 4ZTJA 3FJ5A 1EWCA 3VUBA 2K1BA 4J5YA 1VQOA 1R9TB 2HKQB 2CZ7B 2XRSD 3EVQA 4ME5A 3DHQA 1VA7A 1XOVA 2DETA 1WX6A 3CCUA 1AOJA 2XDBA 3D4WA 3EQLC 3MXNB 4LWCA 4C1NI 1YP5A 2K3YA 5GMKl 1OXXK 2SDFA 1H3ZA 5GJVB 5GAOm 9ATCB 1SYDA 1I81A 1DOMA 2AHOB 2QEXQ 3ITPA 5IP7H 1S5CD 1J5EL 1BIBA 4IOAA 1JC7A 5KYYA 2VGMA 1PA6A 4Y92A 1D5ZC 4HN7A 4FVMA 4AQYL 1X65A 2O5IC 1VDZA 3HOUG 3KFVA 3S16B 2ZPHB 2RCNA 3G6EA 2R3ZA 1SKUB 3I90A 3PUWA 3EHQA 4QQGA 2UUBL 1VIFA 3I4MG 2P0PA 1V1PA 1EFID 3TS0A 1NBWA 5LJ3e 2PQAA 2BA0A 4JI3L 2JA8H 2JT4A 3ERSX 1EY8A 5M3MB 1BOSA 4RGOS 4LF8L 2E70A 4LD6A 2NZOA 2PMZE 2PNHA 2D0PA 3GNGA 1GBQA 4OVAA 1A2TA 2HDMA 2K01A 2Q8RE 2OEOA 2YUQA 4C3JG 1D7QA 2JS0A 4J9GA 4R55A 3KYHC 4B08A 1KQ1A 5FLXL 2CP7A 2OTJA 2R92B 3S17B 1Q7YR 1A3VA 3MHBA 2QW7A 2R93B 3FIFA 4BE2A 4A63B 1EZ6A 1JWMD 1P8LA 1N34L 1FGUA 5L37A 1HNWL 2A69D 4Z89A 3PUYA 2F0WA 2KCTA 4A3GG 5FKAC 5A35A 1KC8U 2JZ2A 3OW2S 3CMAT 2OF1A 2K5LA 2N49A 2J7ZA 3RZOB 2R7ZB 2KRMA 4ORZA 2CVRA 4QL5A 1K9MR 2CSQA 3CXCP 2KHJA 4DFAA 2A69C 1Q81C 2CP2A 4QVDA 1VQ8Q 1Z9FA 3UDXA 1XNQL 4OO1H 4M7DE 5FOBB 4CRIA 3J80c 5GAN8 1LTTD 3S2DB 3OYFA 2RK2A 2VC8A 3OBYA 1Q12A 4QKUA 4M1UB 3KJOA 4E2FB 2Y4YA 1RAAB 1QOHA 2P0QA 4C0GA 4JRPA 1ZKOA 2JA6H 1T3LA 1ESFA 3M0RA 2V1CC 2I0NA 2W10A 4EMHA 2CZ6B 2JOYA 1ML0D 4GLXA 4MZTA 1ZBXA 5HGTA 3BYTB 4DOWA 2F0UA 2E2HH 2HKNA 1C6VX 2FMCA 1LUZA 2HL3A 2QGFB 1HXYD 3H3VC 1AWXA 2L9HA 1X6OA 4DNRB 4Y7NH 2O2OA 4NS5A 3SWNA 2B2VA 4R4QA 4GLVB 4IJHA 1HHVA 1K8AC 4HEDA 1WJSA 1TUGB 3M58A 5IODA 2VL6A 4EQPA 1B3AA 1BBWA 1SE3A 1YVCA 1C48A 1SNCA 4JYAQ 5JJKA 4QVZA 1YEZA 3QPHA 2DX1A 2LJ3A 4M78F 3RERA 4HT9A 2EJMA 1VQ5A 2Z4HA 4C3JH 4HIMA 4YCVA 4DUYQ 1E0BA 3OIPA 3H3VI 5GAN3 1NSNS 4CJ0B 3M3YH 4HVUA 1RCVD 1SYCA 1JMCA 2UXCL 1WA7A 1F2YA 1JR0D 1TXYA 4JC0A 1QB5D 3DM3A 5LMUL 1WTVA 1ACMB 1UHFA 4PJOF 3H15A 1M27C 4DV1L 4M77B 4TQUS 3H0HA 1EWHA 1J9OA 4A3GH 2QYZA 2RQVA 1GRIA 1M3BA 2I5HA 2QEXT 5CV7A 5M3FG 2V26A 1JXOA 1B3QA 1OPLA 2QG9B 1CT1D 1SDFA 2GVBA 4NPSA 4POGA 1QWYA 1N33L 1H641 1ZUUA 1IHWA 2QQRA 3MCAB 1G291 5CQXA 2FRYA 3JCMh 5HKCA 1G2TA 2PW5A 3OSOA 1UECA 3W3AA 2E12A 3RUZA 4DNTB 5C4JH 3U58A 1XPOA 4JI4Q 3C94A 2JE6I 4DV7Q 2EJ9A 3RESA 2F3IA 4CDEC 3K0YA 1HYOA 2J0TD 3NK9A 2JM8A 4A93G 2R7DA 1N27A 1N8RC 1KC8C 1TWAB 4A3CG 4AT1B 4QUCA 4KY5A 2JJQA 4CKEA 3S1NB 4IFDJ 1KSWA 5I2YA 3NBHA 4RTYA 2Y0SB 1OQKA 2MK5A 2FHDA 4C5IA 3HFZB 1K9AA 1UGQB 1PH6A 5C4XB 3GTQH 2B86A 2UUAL 3M9QA 1M3AA 3H94A 5DNFA 1WFQA 1EZZB 3HOVG 1KLGD 2B8GA 4A93B 1VIEA 1KJWA 5EAYA 1VOMA 4RKBA 1UGSB 4NMZA 5M5WH 1TU2B 3VS6A 1AE3A 4KI0A 2KRNA 2MWOA 1JBMA 1X32A 1MNEA 2NVYB 1KNAA 2X35A 3TDQA 4NDXA 2EY6A 4WORA 4CDFC 4QGUA 4CC4B 1K9MU 2XD0A 3NXWA 1LABA 3Q0AA 2BDOA 4O0AA 3EFOA 1CSPA 1IBMQ 4HJ9A 3M9BA 3HOVB 4GLKA 1ET9A 1Q95G 2W0ZA 3A7AB 3KF8A 4BBSG 1YJNQ 1EOTA 2GTOA 4ELZC 4N4GA 2EE1A 5M3FH 1TR5A 2R6GA 3PQIA 4PMBA 5KYYB 2BZ8A 1RODA 1WVLA 1BCMA 1XMOQ 4DK6C 4ZGEB 2F4VL 3OSSC 5DM7R 4DV3Q 3L2UA 1JT8A 4LFAQ 1XPUA 3G4SQ 4C8QE 2LT4A 4K0KQ 4A3JB 2RJEA 2EXDA 4JI8Q 4PJMA 4DBQA 3H41A 4HVWA 1NR4A 1V1PB 2DA9A 3I7FA 4WJ3M 4KGZB 4RKUE 1AWOA 3U4VA 2KXCA 2RQUA 2DGYA 2PQAB 2E1HA 5CO7A 3CC4A 2WV6D 4H7BA 3U4ZA 5FLMG 3OTOL 4A3MG 3PV0A 3GTPH 2Y4XA 2RM4A 1GO3E 5C0XG 2K14A 3ZFJA 5C44B 1DONA 3GQBA 3RLNA 1X2QA 1D6EC 2CHBD 2Z6KA 2Q2HA 5I11A 3DWAA 3FKIG 4DV6Q 1E6HA 4HJAA 3RD4A 2VNUD 3HOYB 2DXTA 2FO0A 3RMHA 1NMGA 4RTZA 2KENA 2E3IA 4KTAA 3N5BB 5LJ3h 3J81j 3OW7A 4FT2A 3RKXA 2MFIA 2VB3X 3MEWA 2QTXA 4B3ML 4IALA 2MYSA 1I3QH 4WRDA 1WYDA 2ED1A 5IT9E 1LTGD 2A68D 2F0OA 1QZHA 3L2WA 2NBFA 2FEIA 5L8RE 3K5MA 1Z47A 2VQEL 1ILPA 3SEBA 2RDGA 2AQ1B 1YJWQ 3FPPA 4PQXA 5CR3A 2JUFA 4RMFA 2M16A 3PF4A 2BKDN 3CCVA 2AT1B 2IJ0A 3SXHA 4JBMA 1OXUA 3QR8A 3SR1A 4AQYQ 2DLPA 1K73R 2A68C 2WFWA 4QF4A 3FEOA 2VUMB 4Y91A 2UUBQ 2F5KA 1CHQD 1WFWA 3UT1A 5LJ5e 2IL8A 2LX9A 2B8FA 1CI3M 4JI3Q 3CCET 2RK1A 3J7AV 4LF8Q 1EY4A 1EY6A 1Q7YC 1CK1A 1VQLA 4AFUC 1GKHA 1X3FA 4HJ5A 4BBSH 4G7HC 5KYUA 1BI0A 4N8FA 2PVOB 2DM1A 3J81E 2EYFA 2CQOA 4OMLA 2XDDA 4CJ2C 1LTID 2QK0A 3OYHA 2VW9A 5DY9A 4JS4A 4LMQD 2D6FA 3NSWA 1N34Q 1PRTB 3I5SA 3PFSA 3SWNB 2JA5G 3GTOH 2WAQE 4BY7B 1WXBA 5D65A 3H91A 3A55A 1ASYA 2VUBA 3FP9A 2BZYA 4LDUA 1EX4A 3M85A 3CC2Q 5AT1B 3AB9A 5KE3A 1JB3A 4F7UA 3HFOA 2RA4A 2CDTA 4EMGA 2COYA 2RHZA 3KJPA 1YN8A 3NHNA 1RIPA 1XNQQ 4JG2A 1LOJA 4DR7L 3S3MA 2RDFA 1Q90A 2G9HD 5IHNA 4A4FA 5GROA 4OMOA 3VYSA 1VQ4Q 4R4TA 5LMNQ 2JA5B 1B70B 3S3NA 3X3NA 2KXDA 1WI5A 2HNIA 3L7ZC 3NQTA 1YJNT 3GO5A 4GN4B 5LJ3j 2L11A 4K8IA 3G48A 3OW2P 3D3RA 5BN4A 3I70A 2XI9A 2WB1G 2FZCB 2DVEA 5LJ5f 4YWMA 4QB4A 2H3EB 3KLWA 1FJGL 2A37A 1VQCA 1PYSB 4A3EG 2DL8A 3I55A 2JA7H 2KE9A 1RI0A 4BY1B 3NGPA 1Q1BA 2X6LA 4K8JA 4PFZA 2EPDA 1W4SA 2XICA 3HOZG 1GUOA 1VQOQ 2SNSA 4C8QD 3OYYA 1U9RA 3NBHB 1U8RA 4QCLA 3V2TA 2WB1B 2D0QB 1B1ZA 1GUNA 2C5CA 1AP0A 1V43A 1Y1VH 2B2YC 1Y1WB 1C0MA 2RF0A 2EQKA 4M7AG 1H92A 4M77C 1HZ9A 1STGA 3ER0A 3GV6A 1AH9A 4PNOA 1TY2A 5HURA 2C0IA 4KH0B 4JBJA 4P75A 4A3EB 2UXCQ 2CP3A 2DMOA 5KYLA 4IKFA 1VQAA 1C1AA 2X69A 5LMUQ 3F2DA 4DV1Q 1N32L 5IYDH 3M7NA 1RAFB 2SOBA 5CKHA 2K50A 4IPGA 3G6EQ 1OZ2A 3OYKA 3OS2A 4A3IH 1HUMA 3DXJC 1YJWT 3HOZB 4N9TA 2QEXA 4UAIA 3KBGA 4JI5L 2E2JH 2OQ0A 1WTRA 3JCMQ 2ZTEA 2EFIA 2H3JA 4JPBW 4X9DA 1EEID 3UE1A 1N33Q 2RPNA 4UDUC 5JEAH 1CA5A 3S2HH 1WI7A 1XTDA 4R4CA 1SJHD 1TIID 1M8VA 3EFOB 1KDAA 3M4YA 2F69A 4QW2A 3A0JA 4HJ8A 1X2KA 3ULPA 2ES2A 2PW7A 4XT1B 5HCKA 1BCPD 2OTJQ 3KF8B 1K73U 4H13C 5FU7B 1BDOA 4JV5L 3QJ6A 3META 1PSEA 2VASA 1HJDA 1QLYA 3I4NH 3X26B 1ENCA 5DM63 3MVVA 1EQQA 1Z9QA 6AT1B 1A62A 4J7IA 1AE2A 3JB9H 2A19A 1X55A 4PNYA 5GAN4 2UUAQ 1M1KR 3RR5A 2LX7A 3SK5A 2EQMA 1BI2A 1DJ7B 4LNQA 2NVQB 3CC2T 1N9SA 1AZQA 3X3MA 2D62A 3DWQA 4BBRG 5E7NA 1WDXA 1MBYA 3URYA 1SYEA 2DTHA 3L2RA 3R2TA 2KHIA 3NPPA 3GP7A 4M7AE 3OMCA 2D2CC 3MEFA 1VQ4T 2GCXA 2YTVA 3QO3A 1O7LA 4PZ6A 2OX7A 3S1QH 1NYFA 4A3FH 1W6XA 2XVSA 3GF5A 4KT0E 1JWSD 2YWWA 4LF7L 2CWPA 2PNRC 4K14A 1WXUA 3VYRA 4EVOA 3KUFA 4XU2A 4BBRB 1BF4A 4M75B 3JC66 4FF1A 2F4VQ 3M54A 1A3UA 2NUCA 3PSIA 3OYAA 4IUTA 2EVBA 3ASKA 2D1XA 4GLAC 4A3BG 3L42A 1I6HH 3A8MB 2A28A 1QVGP 4UP8A 3HPWA 2XU8A 3BY7A 5ECAA 1QWFA 4R9WA 4R8IA 1VQ5Q 2CZ1B 3ULRB 1VQOT 3FMCA 3UF4A 1TG0A 2NN6H 2VY3A 4OP0A 5KYUB 5KNCA 1FX7A 2NTTA 4XDXA 5EGTA 4PL6A 4X62L 2DRKA 3PVQA 1WGSA 2F0GA 3BDCA 3UE0A 1PFSA 4CGYB 2OI3A 4HKEA 2KROA 1WQWA 1ICWA 5ELEA 1ZYRD 2XSCA 1S4ZA 1H9JA 5LJ5h 4RTXA 2D9UA 3OYJA 2FZGB 1Q8KA 3VS1A 1CA6A 4A3BB 3JAMc 2SNMA 2CP0A 1E22A 1SMXA 4DBFA 1W6JA 5IYCH 4B3MQ 3CQZH 1MHWC 4NL3A 5CV9A 1ZUKA 4XTYA 1TUCA 4AFQC 1K0XA 1VQEA 1ZYRC 3VRYA 2R5MA 1K73C 1PFBA 3TQYA 2VQEQ 4F7UB 1WTQA 4B3SL 1WCMH 3VU3C 3F2UA 2DAQA 1E7ZA 2E2IH 3RMQA 4E7HA 3M55A 5FU6B 5KCHA 4IUPA 2EBPA 4A4HA 5M5XB 3EH1A 4RGMA 3VS5A 4XK8E 1X6GA 3INZA 2NVXB 3E9GA 2VQFL 1I4PA 1G91A 2JN0A 3JCMW 2OTJT 4JJDA 3UATA 3UDGA 2QA4A 1HA6A 3MZ5A 1Q86C 4HTHA 2YHTA 1PYWD 2QQAA 1F77A 1HH2P 3LWHA 3CCEA 3DB3A 5I21A 1SNMA 4ZK9B 1PRTC 1VQKA 3J81i 1GHJA 2HDLA 3CCRA 3F2CA 3VS7A 1RJTA 1PFNA 4MDWA 4IN3A 4LW1A 2F3VA 2FPDA 4FL6A 5ELFA 2CZ0B 2ICEC 2QAZA 5GAHC 2C06A 3FRPB 3W1GA 2R57A 4J6XA 3T1HL 1U5KA 4FT4A 4C92D 1K0SA 4QJFA 3A8GB 1ZHIA 3GOXA 4M7DA 2RQWA 2C35B 1U1TA 2B63H 2BCOA 1SFOH 1A0NB 1TS2A 3VS3A 2XHCA 1M1KU 1OX8A 1R0BG 5FLXc 3O8VA 1FXXA 2FPFA 3HRSA 4HSVA 1PG5B 1NEBA 2KVMA 4HSPA 5C3XA 4DR7Q 2JJ9A 3WVEB 1OO9B 2E75C 1ICFB 3TN2A 4DAVA 1A63A 1UDLA 1L1OA 2F0KA 1YHQA 1KLUD 3VYUA 3GTGH 1XJWB 3CP0A 5ELDA 2DVJA 3MEUA 1BVSA 1YWPA 5LJ5j 1ZSGA 2NLUA 4L5TA 1W70A 3IAYA 1A3TA 1TWCH 4HIDA 2Q2UA 4IFDG 3A8IE 1PTOD 2L4NA 3CC4Q 3CD6A 1HNXL 1EYCA 1WZOA 1E2ZA 5IYBG 4ZAIA 2DBKA 4J15A 1FJGQ 1HCZA 5I2MA 1B9NA 3C12A 1JEGA 2IX1A 1PTOC 1UNSA 1STAA 2HQHA 2P0KA 2WSEE 2RI3A 5FJ8G 2QCPX 2IX3A 1AFPA 3KDFA 3MAQA 4FO2A 4IUQA 3BVZA 3AYHB 3M4OB 2XK0A 3EFSA 1E2VA 1STEA 2F0VA 5JAVA 1ZUYA 4K5XA 3S14H 2PI2E 5CKDA 2L3PA 3M0UA 3OS5A 4XU3A 3X20B 3CCLQ 1W2BP 1YNND 1QCNA 1BBZA 3H09A 4IUNA 5JEAJ 3PO2B 3CCVQ 1JJ2S 1PFMA 1BKBA 2GFUA 5GAOq 2DFUA 2DN8A 1N32Q 2EGEA 4LUEA 4KY7A 4F04B 3HOXB 3OA6A 4V190 5IGBA 1FNUA 5IP9G 3HP9A 2IPOB 4EQNA 4BWGB 5CCAA 1PH9A 4JI5Q 4M8AA 1CKMA 2EY1A 1H9SA 4D8KA 3GLXA 1IHZA 4OONA 5FU7C 2FB7A 2QI2A 3U9SA 2EYQA 1E7OA 1UG1A 5M9OA 1VQLQ 4Y28E 2K03A 4AH6A 4LUZA 2G9DA 4A75A 1L2FA 3M4PA 3M0TA 1YBYA 5ELOA 3H0IA 1FR3A 2LRQA 2LS01 3JB9J 1WTWA 2BA1A 3AMUA 2LCCA 5KRUA 2QTVA 3DUZA 2HL5C 1MD2D 4C3IB 3T1YL 2DNCA 4JV5Q 2QDYB 3JCMc 1F9RA 2A74C 2EJFA 5C3EB 1M90R 5A2QE 4EQOA 2X4JA 1M1KC 3Q8DA 2NUZA 2E5LL 4JYAL 5IP7G 2A5HA 4U673 2Z6KC 3GTLB 1HD3A 4FYDA 1OXTA 2AQ2B 4ZUJA 3CRLC 1GUGA 1M4VA 1Q3LA 4RHRA 1PRLC 5EKLA 1PHTA 3HRUA 3CC7A 5GANe 2ZT9C 3H0GH 3H3VH 5FWCA 4B9WA 3HZXA 1PVOA 4XYOA 4FF4A 2G5DA 1M4ZA 5FJ8H 1EFNA 1L0YB 2ZJPA 4M75D 1XNRL 3MEVA 2JA8G 1NZ9A 1W1FA 3TCJA 3V7RA 3OPOA 3P7JA 2YDLA 3RN5A 4KD3A 5GAGC 1HZBA 2F03A 2KYMA 2B2UA 4E6IA 3BDLA 4DPGA 4M75C 1VQGA 3ZJYC 5BR8L 1NLOC 1C0AA 1KRSA 2J05A 1AT1B 2DL3A 2ZPBB 4TKOB 2RSOA 4LF7Q 1HNZL 3I55Q 2RMOA 4HXJA 3ME9A 1T5XD 3KF6A 3PUVA 1X54A 2Z4IA 4MZPA 1SEBD 3CC4T 3QOLA 2DNEA 2LMCB 1M5Q1 1BNZA 1SRMA 4DR3L 1J8IA 4P72A 5KIXA 1G83A 3NFCA 2PMZB 1KQSP 1E2WA 5CKBA 1Y0MA 4RG2A 4F7XA 1Y7XA 1PKTA 1NTGA 3SK8A 1PHJA 1ZSZA 2RQRA 3OYMA 1CKNA 2L12A 4OO1G 1EY5A 5CV6A 4M7DG 1TWGH 2LVMA 1NNXA 3CCJA 4DV4L 1EU3A 3CBOA 4HCZA 4Z8AA 1BCOA 2PCFB 3J7ZC 4E7SA 1J3TA 4PG3A 2UU9L 2K5HA 3WOFA 4FXKC 1TQOA 4X62Q 4QIWE 2HT1A 1D0YA 2JA6G 4I7AA 5GANf 3BJUA 4II1A 5EJWA 3M57A 2QDBA 1IO6A 3CCLT 5FO8B 1AVZC 3CCVT 1JE5A 3ZEHA 2RHYA 3QB3A 3X24B 4EIKA 4M7DB 2X3WD 3I56A 2YT6A 1MJEA 2EVRA 3UDIA 3D8GA 5AFWA 1L0XB 4PZ8A 2HHHL 2YUPA 3FRNA 2YV5A 5LL6X 3JV3A 4JJCA 1E1OA 1PH8A 2B8AA 2K52A 3DB4A 2K4KA 4ODGA 4KUDK 4B3SQ 3FEWX 2JA6B 1K8OA 2MF2A 3Q1JA 4RGTA 2XTIA 1RABB 3I35A 1VQPA 1VQLT 3VR3A 4R8NA 5IY0A 2QQ9A 3NTHA 1NE8A 1A2UA 3CPFA 1UEAB 1L1OB 3TRZA 3SEMA 3ZYYX 1UGPB 4F7UF 2VQFQ 2PZ1A 3S1MH 4L5QA 4BUGA 2LXKA 2GQIA 3HOUB 1E6GA 4JBKA 3EAEA 4NOYA 1XXGA 5J39A 4OX9L 2BE5D 5EBDA 5D6YA 3I4MB 1HZCA 5JVH3 5IWAL 4WJ4A 1UWVA 2F0EA 5KH6A 2IHEA 1LCKA 4JJNK 5K5PA 4L63B 1JOQA 5HK0A 3QO2A 3BVGA 4B6MA 1CSKA 1WNLA 2EYXA 3UA6A 1TWFH 1EQRA 2X4YA 4UP9A 2D0NA 1FMKA 1IGUA 4BI3A 2BE5C 4WFN3 2EIFA 1M90U 4C3JB 1DXMA 3T1HQ 2GNCA 3M3YB 2EW3A 2YRDA 2HSEB 3MXUA 4GZYC 2KQWA 2L3RA 3KDFB 2MOXA 3BS1A 3H8ZA 2I5MX 1HK9A 4M78D 5EKIA 4A3GB 1I5LA 1JQYD 1R9TH 1B7TA 4A53A 2RO0A 3TSZA 2M0YA 4RFBA 2FG0A 3MP1A 4PJOD 5BN5A 1YI2A 1SYBA 2JSOA 2Z1CA 4RGNA 2EYOA 3D0FA 5LJ3f 1CHPD 4M78C 2H5XA 1XNIA 2HBWA 1NJIR 5C4JB 2HQXA 3I55T 1STBA 3HRTA 3HKZE 4KGXB 1IBLL 1U5SA 2ZXOA 1Z7TA 2YRVA 2BE7D 4PJOC 3S16H 1H8KA 4ID6A 4B3TL 1H9SB 2NTSA 1UE1A 4F8MA 1SLJA 3RZDB 1HNXQ 2C0TA 1XTCD 5CQYA 1U1SA 1MSGA 1BBXC 1ZX6A 4N4IA 1HFGA 2RHSB 2QKIC 2KY9A 4F14A 3N6RA 3ULLA 2RH2A 1MIUA 5M3MH 3QZ5B 3BZKA 3EGDA 4A4KA 4GOPC 4OEMB 4X3KA 5IT9L 4NXML 2XN9C 2PUKB 1TVXA 1IBKL 3OHXC 4DEYA 1PH2A 3MPUB 2V8KA 1EIGA 1ZEQX 5IAYA 3UPUA 2B2TC 1UEBA 2KQ3A 4RMOA 3S6WA 1G3YA 2R93H 1FYCA 3C4SA 4ILWA 3U9OA 2EYMA 3M0SA 4A3LH 1NUCA 2O5JC 4ZN1A 2ATWA 2X9HA 4J1MA 1IB8A 4C8QG 4LD9K 4PJLA 3T13A 4HVVA 1AD5A 2C9OA 3QYGB 3R3OA 1M2OA 4HCCA 1EQTA 3NQIA 2JNGA 5GAMd 4DAYA 3EG9A 2E6NA 1A8VA 1KAAA 3J81L 3V8KA 3S2DH 2QA4Q 3LWUA 4L5SA 3FHWA 4CC3A 1FVIA 1JCKB 3OMGA 5M3FB 5GANh 3CCEQ 4DK1A 1JO8A 1OI1A 1SYGA 2BUDA 1TS3A 2BH8A 4RAUC 1VQKQ 2EYHA 4IIOA 2HQLA 3FC3A 3CCRQ 1P92A 5HK3A 4LFCQ 1AWJA 1ILQA 1WYXA 3KF6B 1WPYA 1IXRA 5JPMC 1K8MA 3T1YQ 2F3WA 2PYKA 1QP2A 1G5VA 3CPWA 5LHY1 1E24A 3GTPB 2K28A 3LX0A 4IIMA 1Q1EA 3S1RB 1ZSZB 1CKNB 2Q2TA 2ENMA 3VV0A 2EJGA 4MMKA 4RWSC 2VB6A 2XIWA 4MN3A 2MMPA 4AFZC 4KD4A 2QGGA 2Z0WA 2EYPA 4M7AA 5JVG3 2ZXRA 4DOVA 3OYLA 4WJWA 1DOKA 7AT1B 2KMTA 1I3QB 4HJ7A 3WXMB 2WSCE 1EOVA 2P5ZX 1XNRQ 4X3SA 3KFUA 1YHQQ 2EY5A 1JB7A 1S72A 1LM0A 3ERQA 4LXCA 1KDBA 1MGQA 2JTMA 3EG3A 3A56A 3UDFA 1O7YA 4M77E 5GAMg 2L8DA 3PO3H 4BY6B 4ZTFA 4DKAC 3CD6Q 2JMAA 1UE5A 2KECA 5BR8Q 5IGEA 4ESRA 3RNJA 1QW1A 2AWOA 3G7LA 2JXBA 2ENBA 1HNZQ 1EL0A 1Y96A 2WAQG 1RAEB 3P8HA 5KCOA 1K83H 4XT3B 4A4GA 3I4OA 2JN4A 1NJIU 1OV3A 2KEDA 1UE6A 1DZ1A 4ZGJB 5IIFA 1N36L 4BBSB 2XWJB 4DR5L 2L0AA 3VJPA 4FDBA 2LFNA 4NXNL 1OX9A 5M5YB 3LWEA 2NVTB 3D7SB 1Y57A 1KL9A 4C0FA 4RTTA 4H0LC 2M9UA 4BDYA 4EQ5A 3VA5A 4DV4Q 3S1NH 4ZUIA 1JRIA 4LF9L 2F5TX 1NM7A 2AIRB 5GANj 2UU9Q 2WAQB 1XQHA 1MNDA 2LJ0A 4E7KA 2DL5A 1SRUA 3DEOA 4A3MB 2B29A 3QWYA 1ZQ1A 3SDZA 2HIVA 3LH5A 1HTLD 4Q5VA 1NR2A 3CCLA 3FKIB 2HCKA 1J5EQ 2KAFA 2OTLA 1JJGA 2N8NA 5I9OA 4HAEA 1V1QA 2LC4A 2ZTDA 2JA7G 1KIKA 3LNNA 2HHHQ 2AKKA 3HSBA 1F2LA 4HIKA 3HHTB 2NWGA 2QA4T 2CP5A 3BG3A 2CKZB 4Q5WA 2JEAI 4M7DF 4OELB 2BTTA 3MA2B 5GAOr 2VV5A 2WINB 2XDPA 1G2BA 1VQKT 2EQIA 1Y1VG 3OYBA 4A3DH 3CCRT 2GA4B 5LL6S 1FWZA 1HUNA 3AU7A 4LK1C 4I7ZC 4K6LA 2V4DA 4Y52H 1NYGA 2ZM6L 2JA7B 1PWTA 2ESWA 2O9SA 4MTKA 2F1LA 1GCPA 2KR3A 5IYDG 3SHWA 2LCLA 4J9HA 1LO5D 4OX9Q 1K3BC 1K9MC 1SE8A 2IX0A 3NWSA 5CBEE 4A3JH 1W6KA 1CQVA 3KBXA 5IWAQ 3CC7Q 2XNAC 4A3IG 2CS7A 1F1BB 2DJZA 3NMZC 1QVFS 1UE9A 4J9EA 1RTOA 5ISRA 3M0QA 3EGDB 3CPWS 1I07A 1GXIE 3V96A 1EY9A 4YY3L 5JEAG 4FIBA 2Y90A 3HEJA 3P20A 3MKDA 4JUVA 1IRXA 2CUDA 4IO9A 1IYUA 5D6WA 2AK5A 4JW0A 3K8AA 1JB0E 1PD0A 5CR2A 1MMDA 4RHSA 3VR4A 4IUVA 1YHQT 2IW3A 2QILA 1XYIA 3N52A 3E0EA 2X3XD 4N0AC 1SHGA 2PNIA 2AZVA 4C0DB 4A3IB 1G51A 4C92G 1YIJT 3QSUA 1T0JA 2RI2A 2E2JB 2RCFA 3R93A 2N78A 4KN4C 1UJYA 1VQ9A 1IREB 2Z8LA 3CD6T 4KMUC 5DEHA 3I4NG 4V2SA 2AUJD 4FYYB 2N88A 4DXGA 3S2HB 1MHNA 5IGFA 3JB9G 1MKHA 3K7AB 4CI0C 3IKJA 4DK3C 1D1IA 2MCNA 4FNFA 3T51B 3VYTA 4BE0A 1G6ZA 2KBNA 4A3KH 2KGTA 4B3TQ 3I9QA 1LLRD 4M77D 3CCJQ 3HP3A 3QOJA 2QF7A 1VYVA 3K58A 2VUMH 1FNWA 1KDCA 4YIJA 4G7OC 3ZBDA 1VQMA 1WTPA 2CH4W 3VR2A 2DEQA 3MP6A 4MDXA 1HA5A 3HOYG 1BK2A 2E4HA 1QG7A 2HEQA 3ND8A 4NXMQ 1LYLA 1PV4A 2XMFA 3VS2A 3L3OC 2PI2A 1IBKQ 8ATCB 3J7YW 1I4HA 2RSNA 1R8OB 1CZGA 1FD7D 3B6YA 3S24A 4LF6L 1ENFA 4J7FA 1R4QB 3EFRA 1G2SA 4A3FG 2EZVA 1VF7A 2DYBA 4XU1A 5GMKe 3I56Q 2E2DC 3L2QA 3C1FA 2JW4A 2EDGA 3CU7A 4DA2A 4K5WA 3A5UA 1LJOA 5FW9A 1HSQA 2PQWA 3FDTA 4N8X1 4KKUA 3EHRA 3S15H 4BY7H 2EQSA 4Q0FA 2F0MA 2YSQA 2HIXA 5I6YA 2HCIA 1TU0B 4DV0L 4E7IA 1SF9A 1FNVA 1SSHA 4M7AB 4LN2A 2R7FA 4CC2A 1Y07A 2JS2A 1VQPQ 1ENAA 2CSIA 4IUUA 4KN7C 1I5FA 1EYGA 4LUOA 3F70A 3O5ZA 4KHVA 5IGDA 3LYIA 2K04A 4OB3B 1EYAA 2RHQB 3G6JB 3A8KE 5C4ZA 4FU6A 3JCMd 1I50H 2J6KA 4FW2A 2NN6G 2DZCA 2LQNA 4A54A 5JOBA 4MIUA 3PVLA 2GVAA 5G3LF 3SK4A 4XTXA 2LSSA 1S5FD 4C92E 1WHGA 3CXCA 4JBWA 1UB4A 1G8ZD 3K0XA 4OL7A 1FMWA 2F0FA 3IRBA 2RD1A 1ARKA 3K6OA 1Y96B 1ZSZC 5I4DA 5IYCG 1CUKA 1SSOA 1WHMA 1CFMA 4GY5A 1TWHB 3EG0A 2L3SA 3P8BB 4RCCA 3CC7T 2AQ3B 2NWMA 2O9VA 4R0KA 2L15A 3I2ZA 4JLGA 4C8QF 2FPEA 3ZL7C 2JP1A 3NE5B 4BY1H 1WCMG 4OWXB 1H95A 5D14A 4H02A 2V1RA 1X3GA 5NUCA 3UI2A 2DD5A 5J26A 3JRZA 1KTKA 4B3RL 3SD4A 2DXCA 2XG8D 3JCMP 1BYMA 4IPHA 1VMCA 5GAN6 4IPDA 1PTOH 1SROA 3ND9A 1YNZA 1YI2Q 4N9PA 4A4EA 1E1TA 5DAUA 1Y1WH 3J80E 4OB1B 1A15A 2FL7A 3WVDB 4BY6C 3CQZB 3P75A 4JRIA 2MO0A 4L59A 3CCQA 4CJ1B 2X4WA 3U23A 2F0DA 3BU2A 1WCMB 4YWKA 1EIFA 4KBMB 3LH0A 5KNBA 1HNWQ 2O4XA 2E2IB 3VS4A 4R1JA 3RLFA 1X69A 3BVMA 1PH4A 2OWOA 3JCMg 2CT3A 2NYSA 4JI0L 2HAXA 1BCPF 4XQQA 1QE6A 1SNQA 3PUZA 3CCJT 1IW7C 3BFMA 3KOJA 3GTKH 5I2SA 2B63G 2F2VA 4MZ9A 3OTOQ 4OB0B 1K0RA 3W2DA 3GTMB 4PKCC 2EGAA 3CMEQ 1N36Q 1KNEA 4E47A 1I4QA 4DR5Q 1RAGB 2VKNA 1SYFA 4NXNQ 2PU9B 1PNJA 3DKMA 1LTLA 2JXMB 1JJ2A 4DAMA 1OU8A 4C5EA 3E5SA 4X9CA 3E2UA 2MUYA 2GTJA 2CFMA 2WKDA 2VGNA 4IJLA 1WXTA 4LDYA 4LF9Q 5C6SA 1K1ZA 3L1AA 1PZJD 3Q23A 2YUNA 3I56T 3SK6A 1BXTA 2JYOA 1IL2A 1ABQA 3RMSA 2LNVA 3VRZA 4G57A 1SFOB 2M1HA 4ZN3A 2FXQA 3OYDA 2BE9B 3RKWA 1PZKD 4KKSA 3URGA 2KOLA 4AYBE 2EGCA 2QDLA 2HMAA 5C0XI 5AJ3L 3LGFA 3THKA 2NVQH 1BR9A 1VQPT 2N3SA 4KRTA 1F9QA 3TZDA 2IPKD 1PRTD 1UFFA 3ULJA 1B34A 2F4IA 4C0ZA 5A2QL 1A0IA 1KIXA 2IWHA 5JJLA 1AHJB 4KULA 2KSSA 1TWCB 4NKLA 4J9DA 3K5OA 4DU9A 4OMPA 4CDCC 3QKJA 1EUJA 3G71A 3SWNC 2XGTA 2B2VC 3QUIA 4XQNA 3RR6A 1SN8A 5D3IB 1AN8A 1G3SA 1ASZA 1GUWA 1SSFA 4M75E 1GBRA 4H44C 5IOCA 1KRTA 3CXCS 1QVCA 3TU4K 1VS0A 4C3HH 1WHJA 3I73A 4RTUA 3DEPA 2R61A 3EGXA 4LF5L 2K2MA 2QQSA 5ELCA 4DK0A 2G3RA 3I3CA 2LJ1A 3WOEA 4YY3Q 2YU9H 1UAPA 3BZDB 1S72Q 1TTHB 2RB6A 3CW2C 5LJ3g 1NEGA 1YI2T 3GTJB 1QCOA 1PYBA 1Q46A 3UWNA 4R4OA 2KHSA 4FP5D 1U0LA 2EKHA 2HD3A 4LJZC 3TQ7P 4LDWA 4IOCA 5CC4A 5GAN2 5I22A 2ZAEA 4PLIA 1K28A 4JOIA 2LDMA 4KY6A 4O1NA 4PMWA 3CBMA 2EOTA 1YIJA 3QIAA 5KNDA 3BYYB 1IZ6A 5C5LA 3GD7A 4C5GA 1O78A 2A73B 2EYZA 2M2LA 1B9MA 1TT2A 4M78G 1S1NA 3CQTA 3CPWP 1YCYA 3H0FA 5GAOn 2RKSA 4GKJL 3OYEA 1QP3A 2NZHA 4MTNA 2CH4A 1GUSA 5EPKA 2DEUA 4DV2L 1FMVA 4PJOG 2DXBA 2LZ6B 1D5XC 3H0GG 1X9NA 2UUCL 3WDNA 3CMET 3M59A 4OIKA 4FW1A 2NVXH 2K5WA 3CEYA 5CV4A 3QYHB 1ZA1B 1CTMA 1HFNA 3LLRA 2FFKB 3QWXX 3M0PA 2SRCA 1YHBA 1DJRD 1DD2A 2E64A 3D4DA 2CREA 2NUTA 2J7IA 4LF6Q 3PMIA 2OTLQ 1GOZA 2WIIB 2DL7A 4O42A 2DKGA 5IXFA 1Y71A 3JCMb 1X3QA 4VUBA 4YTLA 1EZ8A 3EA6A 5CORA 1JE4A 1D3BA 2D5DA 2MI6A 3MTSA 1I4K1 3JB9F 1E3PA 2ICIA 3D6CA 2DERA 2K57A 2EWNA 3P8DA 2SEBD 4HMJA 1EWIA 3I91A 4C2MB 1IL8A 2K05A 2F0PA 3C46A 3DLLA 2RHXA 5A0DA 4DV0Q 2MP1A 5IT9c 2O88A 1H9KA 3MJXA 2O31A 1R0CB 1N6AA 1ET6A 2F2XA 5EBCA 1Y8PB 2RA2A 2KEEA 4XU0A 5IHIA 2GFAA 2P4RA 4B9XA 5EPLA 1VYUA 4UPAA 4ABNA 5K36H 5F2DA 2RQTA 3MC0B 3DLMA 2AUKA 2PUOB 1D2BA 4M7AF 3TVTA 1EY7A 1B2TA 1EYDA 1PCXA 1BI1A 1MI2A 3R8BA 2O4XB 3MO8A 3PIO3 4XTZA 2F52A 3SVMA 2KCNA 2CWAA 2YLBA 3R2IA 5E1FA 3GDEA 2F0LA 4M78E 4XTUA 1X56A 4X6AH 2JK8A 1DCZA 2ZPIB 1TWGB 3IL8A 4C56C 2QXFA 2NB0A 3J81c 2K6DA 5AYFA 4R4IA 4PV1C 4RA8A 2E5KA 4PJOE 3E6ZX 1N8RR 2VXFA 4KHPL 2D0OA 3A5ZB 5GAN5 4QIWB 2KCCA 1B8AA 2K5VA 1NY4A 2ZTCA 5CGKA 4DGZA 4TVAB 4DR4L 1S72T 1YNJD 3SHLA 1KK7A 3MP8A 1GCQA 4B3RQ 4ME7A 4O6JA 3JCMe 5IXBA 2ID0A 2OXPA 1GM5A 3J80i 3CF5A 1LACA 4M77A 1VQ9Q 1Y8OB 2C0OA 3EFXD 1ZXTA 2KNBB 4IQZA 1YNJC 2EXZA 4DV5L 4C8QA 4X34A 3PO2H 2RF4A 1NMFA 3NTIA 4F87A 2ALYB 2LCSA 2JA8B 4LUDA 3HOXH 1B44D 2FJ2A 4C5HA 3ICEA 1RDPD 1VUBA 5FROA 3M5AA 3UDCA 2KRSA 3L9AX 3HOWG 3A8OB 1T5EA 1VQMQ 1B34B 4KJOA 4JI0Q 3EIVA 4ZGDB 1TXQA 5IGCA 4FF3A 1C8CA 4DEXA 1QMCA 3VYHB 2D8HA 1Q81U 1M9SA 1PZID 2JM9A 1X75C 1SMYD 1N9WA 4DV3L 3I4LA 1KABA 3DM1A 3OWFA 1AEYA 2DL4A 1TKWB 4K0KL 2OAWA 3J7AF 2QQBA 4P74A 2F0JA 4RCOA 3SE0A 3V8JA 2LY7A 4AFSC 3WWVA 1SMYC 4BI4A 4E7ZA 4X65L 3GV3A 4HT8A 4PZ7A 2OTLT 5C3EH 2DD4A 2KA7A 2ED0A 1F2MA 1NCVA 1NLPC 3QJYA 4HCSA 3AEVA 3GTLH 4DR6L 3RN2A 5IHKA 1CKAA 2DK3A 2IG0A 2KK4A 1DYQA 3EGXB 3T9NA 1QILA 3HKZG 2DTIA 4FM4B 3HFNA 5FU6C 2EYYA 3VYGA 1F9SA 3VUZA 1JJCB 1GXDC 2IY5B 2DJFC 3L0OA 4LF5Q 3TREA 1SR3A 3RBBB 4BACA 5AJ3Q 4X1VA 4DBRA 4LDXA 4K11A 3V05A 1K8AU 5FO7B 4QT7A 4YWLA 1OZ3A 3KXTA 1IKLA 2K5DA 2UXDL 2I07B 5M3MG 1HPCA 4GN5A 2CP6A 1TH7A 2GN5A 2IT1A 2E2HB 1AEXA 1PH1A 5I2XA 1X01A 3IQLA 3HKZB 2R92G 3AQQA 2ASBA 2ROLA 1I94L 2J4XA 1S40A 5GAEC 1IYVA 3KLSX 4Y7NB 1RF2D 2R93G 3CHBD 1FGBD 3K5NA 1AZGB 4BXXG 2X6GA 2MIOA 4OGQC 3EN2A 3CKIB 3HKSA 1F9PA 4A3LG 2DUDA 4ZKBB 3TS2A 1WJJA 2R7ZG 3GP8A 2DF6A 3HOWH 1D09B 1JQQA 1PC0A 4HCBA 3JCMV 2MPMA 4J9IA 5D6XA 1LTBD 3F1ZA 1QNKA 2HUGA 3MFYA 4EGVA 3HS0C 2A7YA 3PUXA 3E9FA 4YCWA 3PMTA 3PIP3 2LQWA 4D6WA 2E76C 1M3CA 4TVRA 3GIBA 3C95A 1K3RA 3L2ZA 2G6FX 2MWPA 1MV3A 3CCQQ 1EEFD 5LJ5g 1N8RU 2CW0D 3GTOB 1VQ9T 2NUTB 3CCSA 4CDDC 1QVGA 2JVVA 1D3BB 4Z9CB 2K4YA 1LTAD 3BDOA 8AT1B 4FXGC 1UGRB 2CW0C 4OXPA 1EFWA 1D5MC 3LGJA 2CCZA 3F8TA 3K81C 5ELNA 2MJ8A 3H6MA 1WD0A 1LTRD 4PFOA 3OYIA 3FLGA 5LMNL 1STNA 4L5GA 1VQMT 4ATOA 2DE0X 3FJPA 5EPJA 1KQ2A 4GKJQ 2DYIA 2YTXA 3C3LA 2AHJB 2F1MA 4D8DA 1KD1R 2E41A 3T53B 2J6FA 4DV2Q 2L0CA 2UUCQ 4EPCA 1YNXA 2V8JA 4J6WA 3CMEA 4JI1L 1DGSA 3GTQB 2R92H 2O01E 1DOLA 4PJJA 5GAOp 4OWTB 3HOUH 2WKCA 3S17H 1WOCA 5DM73 4F16A 4PLLA 3S3OA 4BXXH 3I4MH 2UXBL 2PVDB 5FO9B 5M5WB 4M77G 4IFDI 1SPKA 2IIMA 1H9RA 2KUMA 1EIYB 1XMQL 3PO3G 3CBPA 1IKMA 3X25B 1EQVA 1OYXA 4P71A 2R7ZH 3RZOH 3AHUA 3AFPA 1WHHA 2KT1A 4QVCA 3DMUA 3LX7A 3QG1A 4KUIA 3QBYA 3JAME 2AZSA 1ONLA 1D0XA 2IHFA 4TSSA 3E9HA 2R5AA 4K2KA 3Q24A 4OWWB 2AWNA 2K75A 2ABLA 2KBTA 1T9HA 2RJFA 1SE2A 3SGIA 4JI6L 4XTWA 2B39A 3RKYA 1A6XA 2CUBA 4EMKA 1RLPC 4N4HA 2FRWA 2RVLA 1RADB 4WF2A 1STYA 3REBB 3NHHA 2A1AA 3ONAB 1VQ6A 3PO3B 1PRMC 3E1SA 4C92A 1KHIA 5GJWB 3G71Q 3PF5A 1H3HA 2SEMA 1JWUD 3I8ZA 4C8QB 2A6HD 1M90C 1HXDA 1JJ2P 3OWEB 1GL5A 1QVFA 2Y0SG 1K83B 2RHUA 1FL0A 4UP7A 3P1HA 2LT1A 2K33A 1QNUA 3BE3A 2L1BA 1TSFA 1U06A 3KLSA 3TP7A 1OOTA 5C4XG 3J7A5 3D31A 1JORA 1G3WA 3RUXA 3TP8A 2EQUA 4E7JA 2E5LQ 2A6HC 3IFDA 2RHIA 1MV0B 5J3BA 2VWFA 3NP8A 2ZCFB 5GAOl 3RZDH 2LXJA 2JEBI 1S5DD 1GJXA 2RJDA 2FZKB 5CKFA 1KG1A 5CVIA 5EKKA 4OMNA 2L55A 1RI9A 4HCEA 1G8XA 1HQRD 4KHPQ 2Z9HA 1K8GA 2JMCA 1U4MA 4DR4Q 4KHZA 4NB3A 2ATCB 1VQBA 3CCQT 2LMJA 1U4LA 4MZMA 4NL2A 1LT5D 3LGLA 3E9IA 1RUWA 3V8LA 3OOCA 4GBQA 1BCPB 5FLXE 4A3DG 1Q7YU 1YIJQ 1UJ0A 4Z88A 4DA4A 2CYZB 2B2WA 3A54A 5H1SE 1RACB 1WQ7A 1V1OA 2DJQA 2DRMA 1I4RA 1PDQA 4XTCS 1VQ8T 3K5LA 2JTEA 2TMPA 1PD1A 4DV5Q 1YITA 4CKCA 1II3A 3LW5E 4J8OA 4A3JG 2HDAA 1OEBA 3RIRA 1QVGS 1VQ7A 4DUZL 4WCIA 1M8MA 4DR3Q 1UGVA 2OAUA 3NPFA 4LAAA 1UE7A 2MO1A 1SG5A 1KFZA 4A3DB 1W2BA 5C44G 1BIAA 2E65A 1K4US 5GMKi 2M51A 4M7DD 4GNXA 1M30A 1QKXA 3FB9A 1VQNA 1TWAH 5HGQA 2MQHA 1MJCA 3MEHA 4NW2A 2DIGA 2PTKA 1MMAA 4JDSA 5KYIA 1YWOA 5KYWA 1X43A 4E7LA 2O2LD 2Y0SE 1KD1U 3D4RA 5JPNC 5IN1A 2KCMA 3OQ5A 1MUZA 1AZEA 3Q22A 5I9PA 4K5VA 4M7DC 3QDFA 1LTSD 1LT3D 3RLOA 5C4XH 1O75A 1CKOA 3EJIA 4X65Q 2FMMA 2KT8A 2JA9A 4A93H 1VQIA 2E8GA 1YJ9Q 1PH5A 3E0JA 3S1RH 4DR6Q 2PZUA 1T0HA 4J6HA 3W5OA 4A3CH 1RHPA 1QJOA 4DAPA 2MAMA 4KJNA 3LWIA 4OO1I 2DIQA 1LV9A 2GGRA 2DY7A 4A3KG 3M56A 4L6TB 4OGCA 2Z6BA 2NVYH 5E4XA 1C7YA 2DBMA 2YYZA 2LTOA 1HJPA 1L1OC 2VUMG 3PMFA 1QQJA 4JOIC 1HQMC 1TS5A 3TSWA 1D1CA 1SBBB 4AIMA 2ZJRA 1HR0L 4QY7A 2UXDQ 1WTOA 2K3BA 3KUPA 4QQBX 3G71T 3HOVH 4PJNA 1PM3A 4OF1A 4J83A 1V1CA 2DNUA 4OMFB 4XTVA 4M75A 4X64L 4CBVA 1I94Q 1VF5C 3A98A 1F2ZA 3VR6A 4X3TA 3OBWA 1FYNA 4A3KB 4X3UA 1NE3A 4XQJA 1SRLA 4JRKA 2BOSA 1S5ED 4BY7G 2LQ8A 2VYTA 3MXGA 1WJRA 1WHLA 5CKEA 4RH6A 2EKOA 1QUQA 3J80L 2CGHA 4HA8A 4M4ZA 1Y1VB 1VCIA 5IE8A 5C44H 3T56B 5A0LA 5M5YH 2DY8A 2K5NA 1U4PA 1Q86R 3K59A 3HOYH 1IGQA 2DZ9A 2NVTH 2BDNA 3AFQA 1RTNA 5CIUA 2FYKA 2L2PA 1SNOA 1KHCA 2AKLA 3H6ZA 1AWWA 1YHAA 4ZRZA 4FCYA 4ELYC 3EBEA 4JCVE 5KEEA 3NTKA 1KQSA 1NJIC 3S15B 5CMDA 4DNIA 4CC7A 3W1BA 3VS0A 1J6QA 4A3MH 4ZCKA 5FLMH 1LVKA 3CMAA 1CQFA 5C0XH 5FRMA 3TBIB 2WSFE 2RJCA 3QIIA 2VXEA 3FKIH 1N5ZA 5CV5A 4S3SA 4A4IA 1BB9A 2RI5A 1VQHA 4ME3A 2M00A 1BQQT 4DAYB 1IBLQ 3EG9B 4BDZA 4KK7A 4ZNXA 4YHHL 3V7SA 4EMKB 1RD9D 1I50B 4BB7A 3OYGA 5FWBA 1KD1C 4CKBA 4GKKL 4BY1G 4A76A 2HCCA 1WTHA 3NELA 4C92B 2YUOA 3OY9A 2K5FA 4LNPA 3I4NB 2EJFC 3NENA 4KGVB 1QCBD 2TSSA 3HTRA 5T1GA 1CKBA 1W3SA 1KAWA 1TUDA 3KLRA 5FRNA 2COZA 4IZ8A 5G3LD 5CBAE 1Y1WG 4JI2L 4LFBL 2V1QA 5JJZA 3G4ST 3CCMQ 4JI1Q 3TSSA 1W2BS 2KYBA 4JZ3A 4HIOA 2EPBA 3OB9A 1SHFA 2F2WA 2HBPA 2K2VA 4BE1A 4YCUA 1GHKA 4XXEA 2DTOA 4APVA 5J22A 1CZWA 2UXBQ 1SNPA 4OHJA 3TEHB 1WD1A 1TY0A 4FF2A 1YJ9T 1XMQQ 2BIVA 5C5MA 4DR2L 3PTAA 4PFPA 3JAMi 1X6BA 4IPCA 4JI7L 1Z9ZA 1GCQC 5E3FA 3A8LB 1PTOB 3CCUQ 2E6ZA 2NUPA 1O7IA 2A0FB 1Q8IA 2B2UC 2KI7A 3U50C 5IGGA 5E4WC 3S1QB 1LT6D 4A3FB 2A08A 2A8VA 4JI6Q 4FYXB 4G7ZC 3NBIA 2CT4A 4C8QC 2GBQA 2J06A 2V8IA 4LDVA 2AMCB 3QHSA 3V7CA 3MEAA 2JA5H 2F0IA 2KDSA 4AMCA 1HZAA 1HTPA 1ESRA 2VB2X 1GFCA 5T1IA 3T16A 1QCFA 2E74C 3A7LA 3NUCA 2COWA 2BH2A 2L5TA 2KEAA 2RN8A 1UUPA 1D8LA 2CQAA 4J8QA 3K57A 4M78A 1I6HB 5GANd 1QVPA 2BZXA 5IH2A 5CYUA 4RKLA 3GTKB 2ZPGB 4M77F 3HG9A 4RG8A 3L2PA 4JK1C 3K7AH 3JSCA 4FYWB 4FSXA 5DLOA 2N55A 4PJOA 4GN3B 2I0QA 4AYBG 4L8JA 3A74A 1AW7A 4ZKCB 1YFNA 2KJXA 4GNXB 4JVZA 2XIDA 3A1PA 4KKTA 5GAMe 3F2BA 2EQJA 5L23A 4X66L 3PNWC 3TP6A 1NG2A 1NPPA 2WB1E 2EAYA 5KYWB 4GOPA 1VQDA 1BCPC 1STHA 1JOOA 4V0BA 3CCSQ 4POFA 5J1ZA 2F0HA 3FPUB 4OB2B 1VQFA 3FVQA 1VMPA 2B3GA 1X3PA 2B2TA 4L5RC 4FXDA 2YLCA 5CAIA 3TP5A 4A3EH 1Q86U 3UA7A 3BZCA 4RG1A 4J6YA 4DXFA 2ROTA 4AYBB 1TS4A 4PMCA 1IW7D 4C1NK 2FVUA 5CK9A 5FK9C 5GQOA 1EY0A 4MNOA 2DJGC 2ECZA 4ZYSA 3HOZH 3R6NA 3GBQA 4M75G 1M1FA 1KQSS 1O80A 1VQ8A 2YTYA 4LF4L 1JICA 2F0NA 3VA7A 4C3HG 2E3HA 4DUZQ 1OTCA 2KVQG 1Q82R 5CV8A 2IVWA 5GANg 4P73A 1Y69U 1V8QA 3S9WA 1WHKA 1I0CA 4OIJA 1PH7A 5EC7A 2E5QA 3OS1A 3OIQA 4JS5A 3TMEA 3C2PA 4DR1L 3CCMT 1RL2A 5LMNW 2JQOA 4MMLA 1OPKA 3TZUA 5GAMf 1SXTA 3NWTA 1NPRA 1BBUA 4C3HB 1XPRA 2B63B 1S5BD 1YCSB 5KYXA 2ZJQA 4RCBA 5LJ3d 4KV6A 1JOKA 3G1JA 1QUQB 4FSSA 1CM9A 5I6WA 1PXUA 2D9TA 1TWHH 2K5IA 4RUGA 2M02A 4RCNA 4GS3A 2WACA 4F88A 2A3LA 2YU9B 1WIEA 2HSPA 3EGUA 1MGSA 3IFTA 2M0OA 2HZYA 4F7UG 3CCUT 1SNDA 2K7AA 1D1KA 2MPXC 1TOVA 3CAMA 1Y8NB 1VQ6Q 2XRQD 2ZGWA 3HL8A 3Q6SA 3GTGB 1JU5C 2K3XA 1L0WA 4P5NA 3AT1B 1EIHA 1WJQA 4PK4A 1PKSA 1G3TA 2X51A 1ZBJA 2XKOC 3C0CA 2I46A 2NYZD 4XYQA 1HR0Q 1M1GA 3G6ET 1U4RA 4U68A 2F0SA 1Z6HA 4ALPA 1NAPA 3X28B 3JCMJ 3K7UC 3QDRB 1UUEA 4BBRH 3REAB 2I5LX 2ZM6Q 4RTVA 4X64Q 3MXPA 4K2LA 2OQKA 5C6AA 3PGZA 1X27A 2QASA 2GF7A 4UY8C 3A8JE 1RKNA 1T3SA 1TS9A 2RNAA 1I4GA 3T4AC 1C9OA 3PGGA 1M2VA 3RDVA 2DPPB 1H9MA 3GTMH 2EYLA 1R77A 2QGQA 1I5OB 4DBHA 3S14B 5EG2A 1SAPA 4I65A 3HGBA 4C0DC 3O13A 3CCST 3SFMA 1K76A 3VR5A 5C0XJ 3PE0A 1AZPA 3MXNA 5K36G 3SB2A 1OULA 4RTWA 4MHEA 2H4OA 4TRDA 4BD3A 1IYJB 2A6ED 2XWBB 3MWYW 4A3BH 4XAXB 1YITQ 4DF7A 3R6OA 3C1EA 4J9BA 3PIOA 1V29B 1QKWA 1VQ7Q 1GUTA 1QVFP 1D1BA 4OMQA 2Q8TA 4EMKC 2NUPB 2Q2IA 4JJBA 1Q81R 3JB9D 3HRZC 5GMKh 3TEEA 4F7UE 1PRTF 2F0TA 2DILA 1V76A 2ZPEB 2A6EC 2RQXA 4C92C 3BW1A 1OU9A 2VZAA 1RLQC 2PVGB 5M5XH 1UTIA 4YHHQ 1VQNQ 4GKKQ 3OYCA 4EDUA 2VXWA 1MMNA 2K79A 1I4XA 4G4KA 2ZZDA 1I1JA 1XWEA 2OT2A 4O2DA 5GADC 2P4TA 1B4OA 1QZGA 3PT9A 4F17A 1G6PA 1YJNA 2DO3A 2M9VA 1Q82U 4M7AD 2K32A 3PCOB 4BA2I 4M78B 1GVPA 4ZQ3A 4JI2Q 4Z02A 4EX5A 4LFBQ 3L2VA 1GD7A 4L6V5 4GLMA 2EJGC 1UHCA 1LT4D 4K6DA 3G4SA 3EROA 4C92F 4DN4M 1WLPB 3JB9I 4PJOB 5GMKm 3E19A 1CSQA 3H0GB 3QXEB 5BN3A 3PO2G 3I5RA 4JZ4A 4M7AC 3M7GA 1VQ5T 1K8AR 2CKKA 3MFGA 4DUYL 3BDUA 2X4XA 4FYVB 1U3OA 1OXVA 1ZA2B 2EY2A 3I72A 3HOXG 1OXSC 2FINB 2YXYA 4DR2Q 1ABOA 1LNXA 5HY6A 1YJ9A 2E10A 4BI8B 2ZPFB 4JI7Q 4GOPB 1R4PB 4OGEA 5C3WA 2RBMA 1VQ6T 2MNAA 1XJVA 2DXUA 2Q8IB 1SEMA 1O7ZA 4ZLTF 2B2WC 2K5QA 4QQDA 3GTJH 1XX8A 1WTXA 4DQ2A 4KLKA 1SJED 1NBEB 5GAMh 1X3EA 2EYJA 4J9FA 2K6AA 1PTOF 4N0AA 2QEJC 2I2LA 4JI4L 1I8FA 4JRQA 2VVKA 2PZTA 5TSSA 1I6VC 4C3IG 4KH1B 3JCMX 1M8AA 5C4HA 4DV7L 1YNNC 4BA1I 1YJWA 4J9CA 5C3EG 2MGSA 3M4QA 2L89A 1HR0W
chains in the Genus database with same CATH topology
1VYTA 2EYWA 4D8DA 2LNHB 1ZLMA 2J6FA 1JXMA 1NYGA 2D1XA 1PWTA 2ESWA 2O9SA 4LE9A 2A28A 1GCPA 2KR3A 1QWEA 3SHWA 4E6RA 4J9HA 5ECAA 1QWFA 1GFDA 3ULRB 3EG2A 4F16A 3UF4A 1TG0A 3NMZC 4AFQC 1UE9A 4J9EA 2DRKA 3PVQA 1SPKA 2IIMA 3M0QA 1I07A 1B07A 2OI3A 2KROA 4OMMA 2KT1A 2CUDA 4RTXA 2K9GA 2AK5A 2AZSA 3VS1A 2A36A 2H8HA 2ABLA 2KBTA 4HCKA 2X3XD 1ZUKA 1SHGA 1TUCA 2AZVA 1RLPC 2CUBA 2LP5A 2FRWA 2PNIA 3EG1A 3VRYA 1T0JA 1UJYA 3REBB 1PRMC 2OJ2A 5GJWB 2J6OA 1H3HA 2SEMA 2EBPA 3VS5A 1X6GA 1GL5A 2MCNA 4JJDA 3UATA 2KGTA 4AG2C 3I9QA 1U06A 2L3QA 1VYVA 1OOTA 4AG1C 1MV0B 2VWFA 2CH4W 1BK2A 2HEQA 3VS7A 2D8JA 2FPDA 2XMFA 3VS2A 4OMNA 1RI9A 2JMCA 1K0SA 1BU1A 2DYBA 3FJ5A 2RQWA 2LMJA 2JW4A 1A0NB 5FW9A 1HSQA 1RUWA 1VA7A 1XOVA 3EHRA 1WX6A 4GBQA 1AOJA 3VS3A 2YSQA 1UJ0A 4Z88A 2FPFA 1YP5A 1SSHA 2DJQA 1NEBA 2DRMA 4LN2A 5GJVB 4CC2A 2JS2A 2JTEA 2CSIA 1UDLA 4Y92A 2HDAA 1OEBA 3O5ZA 3KFVA 4WCIA 1M8MA 2DVJA 2J6KA 1YWPA 3EHQA 1ZSGA 2LQNA 1UGVA 1W70A 3NPFA 3PVLA 1KFZA 2JT4A 1K4US 2M51A 1M30A 1QKXA 2DBKA 1ARKA 1GBQA 2PTKA 1JEGA 2YUQA 2JS0A 4J9GA 1YWOA 1X43A 3EG0A 2L3SA 1MUZA 1AZEA 2NWMA 2O9VA 4R0KA 4A63B 2FPEA 3ZL7C 4Z89A 2V1RA 2KT8A 2KRMA 1ZUYA 1T0HA 4ORZA 2CSQA 2L3PA 3M0UA 1YNZA 1BBZA 2GGRA 2DBMA 2EGEA 4LUEA 3U23A 3TSWA 2K3BA 3VS4A 1T3LA 1X69A 3M0RA 4D8KA 2I0NA 2W10A 1V1CA 2DNUA 1E7OA 1UG1A 2CT3A 3A98A 3M0TA 1FYNA 3H0IA 2F2VA 1SRLA 2EGAA 1AWXA 2O2OA 2VKNA 4M4ZA 1PNJA 2NUZA 2GTJA 1HD3A 1WXTA 1K1ZA 2DX1A 1PRLC 2LJ3A 2YUNA 1PHTA 2L2PA 2AKLA 1AWWA 1ABQA 3VRZA 4HVUA 5FWCA 1WA7A 1EFNA 1UHFA 1M27C 2EGCA 4CC7A 3VS0A 2QDLA 3H0HA 1W1FA 3THKA 2RQVA 2YDLA 1GRIA 1M3BA 1JXOA 1OPLA 1B3QA 4KRTA 2KYMA 1N5ZA 1BB9A 1ZUUA 1UFFA 1NLOC 2J05A 2FRYA 4ZNXA 1UECA 2DL3A 5FWBA 2RMOA 4HXJA 4J9DA 4OMPA 1SRMA 2YUOA 2JM8A 4LNPA 1G83A 1CKBA 1Y0MA 1TUDA 1PKTA 2RQRA 1GBRA 1KSWA 2V1QA 4RTYA 2KYBA 4JZ3A 1SHFA 2F2WA 4Z8AA 4RTUA 1K9AA 1J3TA 2B86A 2K2MA 1M3AA 2LJ1A 1KJWA 1X6BA 1IO6A 1NEGA 1GCQC 1Z9ZA 1AVZC 3VS6A 2KRNA 2EKHA 4EIKA 2X3WD 2YT6A 2A08A 2EVRA 4CC4B 5I22A 2CT4A 2GBQA 2J06A 2YUPA 3JV3A 4JJCA 1GFCA 1QCFA 2W0ZA 2EYZA 1K0XA 1S1NA 2GTOA 3CQTA 3I35A 2KEAA 3H0FA 2RN8A 2BZ8A 2BZXA 2CH4A 3SEMA 5IH2A 2PZ1A 2LZ6B 2GQIA 1E6GA 3H41A 4HVWA 2DA9A 1AWOA 2KXCA 2RQUA 3QWXX 3M0PA 2SRCA 1LCKA 1X2QA 5L23A 5I11A 1CSKA 1E6HA 2EYXA 3UA6A 1NG2A 2FO0A 2D0NA 1FMKA 2CREA 2J7IA 4RTZA 2GNCA 2EW3A 2DL7A 5IXFA 2MOXA 3UA7A 2ROTA 2ED1A 2ECZA 2FEIA 2O88A 3TSZA 2O31A 3R6NA 3GBQA 2M0YA 2FG0A 2F2XA 5IHIA 2P4RA 2HBWA 1VYUA 2DLPA 2RQTA 1U5SA 3TVTA 1WFWA 1H8KA 1I0CA 2C0TA 5EC7A 1ZX6A 4AFUC 4F14A 2DM1A 1OPKA 2K6DA 4OMLA 2E5KA 4DEYA 1YCSB 3I5SA 4FSSA 1WXBA 4RUGA 1WIEA 2HSPA 3EGUA 2BZYA 1GCQA 2K7AA 3M0SA 5IXBA 2CDTA 2C0OA 1YN8A 3NHNA 1JU5C 2KNBB 4HVVA 1AD5A 5IHNA 4OMOA 1PKSA 1ZBJA 3C0CA 2KXDA 2LCSA 4LUDA 4CC3A 2KRSA 1JO8A 1UUEA 3REAB 4IIOA 4RTVA 4DEXA 1X27A 2D8HA 2A37A 1AWJA 2JM9A 2DL8A 1WYXA 1T3SA 2KE9A 2RNAA 1AEYA 2DL4A 3NGPA 2OAWA 2EPDA 4IIMA 4AFSC 2ENMA 1K76A 2ED0A 1H92A 2RF0A 1NLPC 3PE0A 4AFZC 5IHKA 1CKAA 4RTWA 2C0IA 2DMOA 2EYYA 4J9BA 1QKWA 3RBBB 4OMQA 4X1VA 4K11A 4JJBA 3EG3A 4QT7A 2DILA 4JPBW 2RPNA 2JMAA 1WI7A 1RLQC 4ESRA 3RNJA 1UTIA 3IQLA 2JXBA 2ROLA 1X2KA 2K79A 1I1JA 5HCKA 1OV3A 1AZGB 4F17A 2MIOA 2L0AA 1HJDA 1QLYA 2DF6A 1Y57A 1UHCA 1JQQA 4GLMA 4RTTA 4J9IA 1WLPB 1Z9QA 3I5RA 4JZ4A 1NM7A 2LJ0A 2LX7A 2DL5A 2LQWA 1M3CA 1U3OA 3QWYA 1ABOA 2G6FX 1MV3A 3LH5A 1WDXA 2HCKA 1SEMA 1KIKA 2AKKA 4J9FA 1NYFA 1W6XA 2VVKA 2BTTA 1WXUA 2DE0X 4J9CA 1G2BA 2EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  2EYW A;  4D8D A;  2LNH B;  1ZLM A;  2J6F A;  1JXM A;  1NYG A;  2D1X A;  1PWT A;  2ESW A;  2O9S A;  4LE9 A;  2A28 A;  1GCP A;  2KR3 A;  1QWE A;  3SHW A;  4E6R A;  4J9H A;  5ECA A;  1QWF A;  1GFD A;  3ULR B;  3EG2 A;  4F16 A;  3UF4 A;  1TG0 A;  3NMZ C;  4AFQ C;  1UE9 A;  4J9E A;  2DRK A;  3PVQ A;  1SPK A;  2IIM A;  3M0Q A;  1I07 A;  1B07 A;  2OI3 A;  2KRO A;  4OMM A;  2KT1 A;  2CUD A;  4RTX A;  2K9G A;  2AK5 A;  2AZS A;  3VS1 A;  2A36 A;  2H8H A;  2ABL A;  2KBT A;  4HCK A;  2X3X D;  1ZUK A;  1SHG A;  1TUC A;  2AZV A;  1RLP C;  2CUB A;  2LP5 A;  2FRW A;  2PNI A;  3EG1 A;  3VRY A;  1T0J A;  1UJY A;  3REB B;  1PRM C;  2OJ2 A;  5GJW B;  2J6O A;  1H3H A;  2SEM A;  2EBP A;  3VS5 A;  1X6G A;  1GL5 A;  2MCN A;  4JJD A;  3UAT A;  2KGT A;  4AG2 C;  3I9Q A;  1U06 A;  2L3Q A;  1VYV A;  1OOT A;  4AG1 C;  1MV0 B;  2VWF A;  2CH4 W;  1BK2 A;  2HEQ A;  3VS7 A;  2D8J A;  2FPD A;  2XMF A;  3VS2 A;  4OMN A;  1RI9 A;  2JMC A;  1K0S A;  1BU1 A;  2DYB A;  3FJ5 A;  2RQW A;  2LMJ A;  2JW4 A;  1A0N B;  5FW9 A;  1HSQ A;  1RUW A;  1VA7 A;  1XOV A;  3EHR A;  1WX6 A;  4GBQ A;  1AOJ A;  3VS3 A;  2YSQ A;  1UJ0 A;  4Z88 A;  2FPF A;  1YP5 A;  1SSH A;  2DJQ A;  1NEB A;  2DRM A;  4LN2 A;  5GJV B;  4CC2 A;  2JS2 A;  2JTE A;  2CSI A;  1UDL A;  4Y92 A;  2HDA A;  1OEB A;  3O5Z A;  3KFV A;  4WCI A;  1M8M A;  2DVJ A;  2J6K A;  1YWP A;  3EHQ A;  1ZSG A;  2LQN A;  1UGV A;  1W70 A;  3NPF A;  3PVL A;  1KFZ A;  2JT4 A;  1K4U S;  2M51 A;  1M30 A;  1QKX A;  2DBK A;  1ARK A;  1GBQ A;  2PTK A;  1JEG A;  2YUQ A;  2JS0 A;  4J9G A;  1YWO A;  1X43 A;  3EG0 A;  2L3S A;  1MUZ A;  1AZE A;  2NWM A;  2O9V A;  4R0K A;  4A63 B;  2FPE A;  3ZL7 C;  4Z89 A;  2V1R A;  2KT8 A;  2KRM A;  1ZUY A;  1T0H A;  4ORZ A;  2CSQ A;  2L3P A;  3M0U A;  1YNZ A;  1BBZ A;  2GGR A;  2DBM A;  2EGE A;  4LUE A;  3U23 A;  3TSW A;  2K3B A;  3VS4 A;  1T3L A;  1X69 A;  3M0R A;  4D8K A;  2I0N A;  2W10 A;  1V1C A;  2DNU A;  1E7O A;  1UG1 A;  2CT3 A;  3A98 A;  3M0T A;  1FYN A;  3H0I A;  2F2V A;  1SRL A;  2EGA A;  1AWX A;  2O2O A;  2VKN A;  4M4Z A;  1PNJ A;  2NUZ A;  2GTJ A;  1HD3 A;  1WXT A;  1K1Z A;  2DX1 A;  1PRL C;  2LJ3 A;  2YUN A;  1PHT A;  2L2P A;  2AKL A;  1AWW A;  1ABQ A;  3VRZ A;  4HVU A;  5FWC A;  1WA7 A;  1EFN A;  1UHF A;  1M27 C;  2EGC A;  4CC7 A;  3VS0 A;  2QDL A;  3H0H A;  1W1F A;  3THK A;  2RQV A;  2YDL A;  1GRI A;  1M3B A;  1JXO A;  1OPL A;  1B3Q A;  4KRT A;  2KYM A;  1N5Z A;  1BB9 A;  1ZUU A;  1UFF A;  1NLO C;  2J05 A;  2FRY A;  4ZNX A;  1UEC A;  2DL3 A;  5FWB A;  2RMO A;  4HXJ A;  4J9D A;  4OMP A;  1SRM A;  2YUO A;  2JM8 A;  4LNP A;  1G83 A;  1CKB A;  1Y0M A;  1TUD A;  1PKT A;  2RQR A;  1GBR A;  1KSW A;  2V1Q A;  4RTY A;  2KYB A;  4JZ3 A;  1SHF A;  2F2W A;  4Z8A A;  4RTU A;  1K9A A;  1J3T A;  2B86 A;  2K2M A;  1M3A A;  2LJ1 A;  1KJW A;  1X6B A;  1IO6 A;  1NEG A;  1GCQ C;  1Z9Z A;  1AVZ C;  3VS6 A;  2KRN A;  2EKH A;  4EIK A;  2X3W D;  2YT6 A;  2A08 A;  2EVR A;  4CC4 B;  5I22 A;  2CT4 A;  2GBQ A;  2J06 A;  2YUP A;  3JV3 A;  4JJC A;  1GFC A;  1QCF A;  2W0Z A;  2EYZ A;  1K0X A;  1S1N A;  2GTO A;  3CQT A;  3I35 A;  2KEA A;  3H0F A;  2RN8 A;  2BZ8 A;  2BZX A;  2CH4 A;  3SEM A;  5IH2 A;  2PZ1 A;  2LZ6 B;  2GQI A;  1E6G A;  3H41 A;  4HVW A;  2DA9 A;  1AWO A;  2KXC A;  2RQU A;  3QWX X;  3M0P A;  2SRC A;  1LCK A;  1X2Q A;  5L23 A;  5I11 A;  1CSK A;  1E6H A;  2EYX A;  3UA6 A;  1NG2 A;  2FO0 A;  2D0N A;  1FMK A;  2CRE A;  2J7I A;  4RTZ A;  2GNC A;  2EW3 A;  2DL7 A;  5IXF A;  2MOX A;  3UA7 A;  2ROT A;  2ED1 A;  2ECZ A;  2FEI A;  2O88 A;  3TSZ A;  2O31 A;  3R6N A;  3GBQ A;  2M0Y A;  2FG0 A;  2F2X A;  5IHI A;  2P4R A;  2HBW A;  1VYU A;  2DLP A;  2RQT A;  1U5S A;  3TVT A;  1WFW A;  1H8K A;  1I0C A;  2C0T A;  5EC7 A;  1ZX6 A;  4AFU C;  4F14 A;  2DM1 A;  1OPK A;  2K6D A;  4OML A;  2E5K A;  4DEY A;  1YCS B;  3I5S A;  4FSS A;  1WXB A;  4RUG A;  1WIE A;  2HSP A;  3EGU A;  2BZY A;  1GCQ A;  2K7A A;  3M0S A;  5IXB A;  2CDT A;  2C0O A;  1YN8 A;  3NHN A;  1JU5 C;  2KNB B;  4HVV A;  1AD5 A;  5IHN A;  4OMO A;  1PKS A;  1ZBJ A;  3C0C A;  2KXD A;  2LCS A;  4LUD A;  4CC3 A;  2KRS A;  1JO8 A;  1UUE A;  3REA B;  4IIO A;  4RTV A;  4DEX A;  1X27 A;  2D8H A;  2A37 A;  1AWJ A;  2JM9 A;  2DL8 A;  1WYX A;  1T3S A;  2KE9 A;  2RNA A;  1AEY A;  2DL4 A;  3NGP A;  2OAW A;  2EPD A;  4IIM A;  4AFS C;  2ENM A;  1K76 A;  2ED0 A;  1H92 A;  2RF0 A;  1NLP C;  3PE0 A;  4AFZ C;  5IHK A;  1CKA A;  4RTW A;  2C0I A;  2DMO A;  2EYY A;  4J9B A;  1QKW A;  3RBB B;  4OMQ A;  4X1V A;  4K11 A;  4JJB A;  3EG3 A;  4QT7 A;  2DIL A;  4JPB W;  2RPN A;  2JMA A;  1WI7 A;  1RLQ C;  4ESR A;  3RNJ A;  1UTI A;  3IQL A;  2JXB A;  2ROL A;  1X2K A;  2K79 A;  1I1J A;  5HCK A;  1OV3 A;  1AZG B;  4F17 A;  2MIO A;  2L0A A;  1HJD A;  1QLY A;  2DF6 A;  1Y57 A;  1UHC A;  1JQQ A;  4GLM A;  4RTT A;  4J9I A;  1WLP B;  1Z9Q A;  3I5R A;  4JZ4 A;  1NM7 A;  2LJ0 A;  2LX7 A;  2DL5 A;  2LQW A;  1M3C A;  1U3O A;  3QWY A;  1ABO A;  2G6F X;  1MV3 A;  3LH5 A;  1WDX A;  2HCK A;  1SEM A;  1KIK A;  2AKK A;  4J9F A;  1NYF A;  1W6X A;  2VVK A;  2BTT A;  1WXU A;  2DE0 X;  4J9C A;  1G2B A;  2EQI A; 
#chains in the Genus database with same CATH topology
 1VYT A;  2EYW A;  3A8H B;  3GPL A;  2LNH B;  2YRC A;  4GNX C;  1ZLM A;  1YZ6 A;  1JXM A;  2HQE A;  1LPL A;  1MMG A;  3G7Z A;  4QQ6 A;  2RDH A;  3NEM A;  4LE9 A;  2H1E A;  5GMK j;  3OSV A;  1QWE A;  3GNF B;  2LQK A;  4E6R A;  1B7Y B;  1PMR A;  1Y14 B;  4LFC L;  1GFD A;  3OW2 A;  1KC8 R;  1P16 A;  3EG2 A;  1IHV A;  4UHV A;  5D7U A;  5GAN 7;  2NN6 I;  3VDY A;  1B53 A;  2L5Q A;  3EH2 A;  1S3O A;  2AKW B;  4NP5 A;  4XQ3 A;  4X66 Q;  3DWP A;  3M4O H;  4IFD H;  4ULL A;  2B2Y A;  1B07 A;  1MSH A;  4O5V A;  5JJI A;  4OMM A;  2PO4 A;  1N9R A;  3CMA Q;  1PH3 A;  5IYB H;  5KYX B;  2K9G A;  1BUV T;  2K7V A;  4HMI A;  2WP8 J;  1YIT T;  2A36 A;  2H8H A;  2HD0 A;  3QZ9 B;  4HCK A;  1VQ7 T;  1PLF A;  4CHT B;  3M53 A;  5KGU A;  2PPB C;  1HRJ A;  1VQJ A;  1C4Q A;  4P2C B;  3CC2 A;  2LP5 A;  5C0M A;  2PZW A;  5EQ0 A;  1O9S A;  1IBM L;  3EG1 A;  4R56 A;  4C2M H;  1B50 A;  5KE2 A;  3D6W A;  1Q82 C;  1D1A A;  3STB D;  2OJ2 A;  4WTO B;  3CRK C;  2GQV A;  1RAI B;  2MHV A;  3K80 C;  2J6O A;  4ANJ A;  2OCE A;  5D3D A;  4LF4 Q;  3S1M B;  3E3X A;  3OYN A;  1VQN T;  1IXD A;  1XMO L;  2NZ1 D;  1VQ4 A;  4XIG S;  5COY A;  3M4G A;  3PIP A;  2FHT A;  4LFA L;  3QWN A;  4AG2 C;  2VS1 A;  3STB C;  4JLI A;  3KK7 A;  2P84 A;  2L3Q A;  4JI8 L;  4QMG A;  1KXL A;  4AG1 C;  2R58 A;  2LKV A;  1PSF A;  4BS9 A;  1DM0 B;  3FDR A;  3H9N A;  1RAH B;  3JAM L;  2Z0S A;  5GAM j;  4C3I H;  1TWF B;  5IP9 H;  4HR7 B;  4DR1 Q;  3MHX A;  1TWB A;  3CCM A;  1D0Z A;  3HOW B;  4IUR A;  3VKI A;  1EU4 A;  3RNU A;  4DV6 L;  1V9P A;  2F0Q A;  2ZXP A;  5DLQ E;  5A0G A;  5KYN A;  2D8J A;  3OS0 A;  5ELB A;  2JTF A;  3JCM f;  1SE4 A;  1M2V B;  2PQE A;  1BI3 A;  5LJ5 d;  1BO0 A;  4M75 F;  4UC4 A;  4QUF A;  4LUV A;  1BU1 A;  4ZTJ A;  3FJ5 A;  1EWC A;  3VUB A;  2K1B A;  4J5Y A;  1VQO A;  1R9T B;  2HKQ B;  2CZ7 B;  2XRS D;  3EVQ A;  4ME5 A;  3DHQ A;  1VA7 A;  1XOV A;  2DET A;  1WX6 A;  3CCU A;  1AOJ A;  2XDB A;  3D4W A;  3EQL C;  3MXN B;  4LWC A;  4C1N I;  1YP5 A;  2K3Y A;  5GMK l;  1OXX K;  2SDF A;  1H3Z A;  5GJV B;  5GAO m;  9ATC B;  1SYD A;  1I81 A;  1DOM A;  2AHO B;  2QEX Q;  3ITP A;  5IP7 H;  1S5C D;  1J5E L;  1BIB A;  4IOA A;  1JC7 A;  5KYY A;  2VGM A;  1PA6 A;  4Y92 A;  1D5Z C;  4HN7 A;  4FVM A;  4AQY L;  1X65 A;  2O5I C;  1VDZ A;  3HOU G;  3KFV A;  3S16 B;  2ZPH B;  2RCN A;  3G6E A;  2R3Z A;  1SKU B;  3I90 A;  3PUW A;  3EHQ A;  4QQG A;  2UUB L;  1VIF A;  3I4M G;  2P0P A;  1V1P A;  1EFI D;  3TS0 A;  1NBW A;  5LJ3 e;  2PQA A;  2BA0 A;  4JI3 L;  2JA8 H;  2JT4 A;  3ERS X;  1EY8 A;  5M3M B;  1BOS A;  4RGO S;  4LF8 L;  2E70 A;  4LD6 A;  2NZO A;  2PMZ E;  2PNH A;  2D0P A;  3GNG A;  1GBQ A;  4OVA A;  1A2T A;  2HDM A;  2K01 A;  2Q8R E;  2OEO A;  2YUQ A;  4C3J G;  1D7Q A;  2JS0 A;  4J9G A;  4R55 A;  3KYH C;  4B08 A;  1KQ1 A;  5FLX L;  2CP7 A;  2OTJ A;  2R92 B;  3S17 B;  1Q7Y R;  1A3V A;  3MHB A;  2QW7 A;  2R93 B;  3FIF A;  4BE2 A;  4A63 B;  1EZ6 A;  1JWM D;  1P8L A;  1N34 L;  1FGU A;  5L37 A;  1HNW L;  2A69 D;  4Z89 A;  3PUY A;  2F0W A;  2KCT A;  4A3G G;  5FKA C;  5A35 A;  1KC8 U;  2JZ2 A;  3OW2 S;  3CMA T;  2OF1 A;  2K5L A;  2N49 A;  2J7Z A;  3RZO B;  2R7Z B;  2KRM A;  4ORZ A;  2CVR A;  4QL5 A;  1K9M R;  2CSQ A;  3CXC P;  2KHJ A;  4DFA A;  2A69 C;  1Q81 C;  2CP2 A;  4QVD A;  1VQ8 Q;  1Z9F A;  3UDX A;  1XNQ L;  4OO1 H;  4M7D E;  5FOB B;  4CRI A;  3J80 c;  5GAN 8;  1LTT D;  3S2D B;  3OYF A;  2RK2 A;  2VC8 A;  3OBY A;  1Q12 A;  4QKU A;  4M1U B;  3KJO A;  4E2F B;  2Y4Y A;  1RAA B;  1QOH A;  2P0Q A;  4C0G A;  4JRP A;  1ZKO A;  2JA6 H;  1T3L A;  1ESF A;  3M0R A;  2V1C C;  2I0N A;  2W10 A;  4EMH A;  2CZ6 B;  2JOY A;  1ML0 D;  4GLX A;  4MZT A;  1ZBX A;  5HGT A;  3BYT B;  4DOW A;  2F0U A;  2E2H H;  2HKN A;  1C6V X;  2FMC A;  1LUZ A;  2HL3 A;  2QGF B;  1HXY D;  3H3V C;  1AWX A;  2L9H A;  1X6O A;  4DNR B;  4Y7N H;  2O2O A;  4NS5 A;  3SWN A;  2B2V A;  4R4Q A;  4GLV B;  4IJH A;  1HHV A;  1K8A C;  4HED A;  1WJS A;  1TUG B;  3M58 A;  5IOD A;  2VL6 A;  4EQP A;  1B3A A;  1BBW A;  1SE3 A;  1YVC A;  1C48 A;  1SNC A;  4JYA Q;  5JJK A;  4QVZ A;  1YEZ A;  3QPH A;  2DX1 A;  2LJ3 A;  4M78 F;  3RER A;  4HT9 A;  2EJM A;  1VQ5 A;  2Z4H A;  4C3J H;  4HIM A;  4YCV A;  4DUY Q;  1E0B A;  3OIP A;  3H3V I;  5GAN 3;  1NSN S;  4CJ0 B;  3M3Y H;  4HVU A;  1RCV D;  1SYC A;  1JMC A;  2UXC L;  1WA7 A;  1F2Y A;  1JR0 D;  1TXY A;  4JC0 A;  1QB5 D;  3DM3 A;  5LMU L;  1WTV A;  1ACM B;  1UHF A;  4PJO F;  3H15 A;  1M27 C;  4DV1 L;  4M77 B;  4TQU S;  3H0H A;  1EWH A;  1J9O A;  4A3G H;  2QYZ A;  2RQV A;  1GRI A;  1M3B A;  2I5H A;  2QEX T;  5CV7 A;  5M3F G;  2V26 A;  1JXO A;  1B3Q A;  1OPL A;  2QG9 B;  1CT1 D;  1SDF A;  2GVB A;  4NPS A;  4POG A;  1QWY A;  1N33 L;  1H64 1;  1ZUU A;  1IHW A;  2QQR A;  3MCA B;  1G29 1;  5CQX A;  2FRY A;  3JCM h;  5HKC A;  1G2T A;  2PW5 A;  3OSO A;  1UEC A;  3W3A A;  2E12 A;  3RUZ A;  4DNT B;  5C4J H;  3U58 A;  1XPO A;  4JI4 Q;  3C94 A;  2JE6 I;  4DV7 Q;  2EJ9 A;  3RES A;  2F3I A;  4CDE C;  3K0Y A;  1HYO A;  2J0T D;  3NK9 A;  2JM8 A;  4A93 G;  2R7D A;  1N27 A;  1N8R C;  1KC8 C;  1TWA B;  4A3C G;  4AT1 B;  4QUC A;  4KY5 A;  2JJQ A;  4CKE A;  3S1N B;  4IFD J;  1KSW A;  5I2Y A;  3NBH A;  4RTY A;  2Y0S B;  1OQK A;  2MK5 A;  2FHD A;  4C5I A;  3HFZ B;  1K9A A;  1UGQ B;  1PH6 A;  5C4X B;  3GTQ H;  2B86 A;  2UUA L;  3M9Q A;  1M3A A;  3H94 A;  5DNF A;  1WFQ A;  1EZZ B;  3HOV G;  1KLG D;  2B8G A;  4A93 B;  1VIE A;  1KJW A;  5EAY A;  1VOM A;  4RKB A;  1UGS B;  4NMZ A;  5M5W H;  1TU2 B;  3VS6 A;  1AE3 A;  4KI0 A;  2KRN A;  2MWO A;  1JBM A;  1X32 A;  1MNE A;  2NVY B;  1KNA A;  2X35 A;  3TDQ A;  4NDX A;  2EY6 A;  4WOR A;  4CDF C;  4QGU A;  4CC4 B;  1K9M U;  2XD0 A;  3NXW A;  1LAB A;  3Q0A A;  2BDO A;  4O0A A;  3EFO A;  1CSP A;  1IBM Q;  4HJ9 A;  3M9B A;  3HOV B;  4GLK A;  1ET9 A;  1Q95 G;  2W0Z A;  3A7A B;  3KF8 A;  4BBS G;  1YJN Q;  1EOT A;  2GTO A;  4ELZ C;  4N4G A;  2EE1 A;  5M3F H;  1TR5 A;  2R6G A;  3PQI A;  4PMB A;  5KYY B;  2BZ8 A;  1ROD A;  1WVL A;  1BCM A;  1XMO Q;  4DK6 C;  4ZGE B;  2F4V L;  3OSS C;  5DM7 R;  4DV3 Q;  3L2U A;  1JT8 A;  4LFA Q;  1XPU A;  3G4S Q;  4C8Q E;  2LT4 A;  4K0K Q;  4A3J B;  2RJE A;  2EXD A;  4JI8 Q;  4PJM A;  4DBQ A;  3H41 A;  4HVW A;  1NR4 A;  1V1P B;  2DA9 A;  3I7F A;  4WJ3 M;  4KGZ B;  4RKU E;  1AWO A;  3U4V A;  2KXC A;  2RQU A;  2DGY A;  2PQA B;  2E1H A;  5CO7 A;  3CC4 A;  2WV6 D;  4H7B A;  3U4Z A;  5FLM G;  3OTO L;  4A3M G;  3PV0 A;  3GTP H;  2Y4X A;  2RM4 A;  1GO3 E;  5C0X G;  2K14 A;  3ZFJ A;  5C44 B;  1DON A;  3GQB A;  3RLN A;  1X2Q A;  1D6E C;  2CHB D;  2Z6K A;  2Q2H A;  5I11 A;  3DWA A;  3FKI G;  4DV6 Q;  1E6H A;  4HJA A;  3RD4 A;  2VNU D;  3HOY B;  2DXT A;  2FO0 A;  3RMH A;  1NMG A;  4RTZ A;  2KEN A;  2E3I A;  4KTA A;  3N5B B;  5LJ3 h;  3J81 j;  3OW7 A;  4FT2 A;  3RKX A;  2MFI A;  2VB3 X;  3MEW A;  2QTX A;  4B3M L;  4IAL A;  2MYS A;  1I3Q H;  4WRD A;  1WYD A;  2ED1 A;  5IT9 E;  1LTG D;  2A68 D;  2F0O A;  1QZH A;  3L2W A;  2NBF A;  2FEI A;  5L8R E;  3K5M A;  1Z47 A;  2VQE L;  1ILP A;  3SEB A;  2RDG A;  2AQ1 B;  1YJW Q;  3FPP A;  4PQX A;  5CR3 A;  2JUF A;  4RMF A;  2M16 A;  3PF4 A;  2BKD N;  3CCV A;  2AT1 B;  2IJ0 A;  3SXH A;  4JBM A;  1OXU A;  3QR8 A;  3SR1 A;  4AQY Q;  2DLP A;  1K73 R;  2A68 C;  2WFW A;  4QF4 A;  3FEO A;  2VUM B;  4Y91 A;  2UUB Q;  2F5K A;  1CHQ D;  1WFW A;  3UT1 A;  5LJ5 e;  2IL8 A;  2LX9 A;  2B8F A;  1CI3 M;  4JI3 Q;  3CCE T;  2RK1 A;  3J7A V;  4LF8 Q;  1EY4 A;  1EY6 A;  1Q7Y C;  1CK1 A;  1VQL A;  4AFU C;  1GKH A;  1X3F A;  4HJ5 A;  4BBS H;  4G7H C;  5KYU A;  1BI0 A;  4N8F A;  2PVO B;  2DM1 A;  3J81 E;  2EYF A;  2CQO A;  4OML A;  2XDD A;  4CJ2 C;  1LTI D;  2QK0 A;  3OYH A;  2VW9 A;  5DY9 A;  4JS4 A;  4LMQ D;  2D6F A;  3NSW A;  1N34 Q;  1PRT B;  3I5S A;  3PFS A;  3SWN B;  2JA5 G;  3GTO H;  2WAQ E;  4BY7 B;  1WXB A;  5D65 A;  3H91 A;  3A55 A;  1ASY A;  2VUB A;  3FP9 A;  2BZY A;  4LDU A;  1EX4 A;  3M85 A;  3CC2 Q;  5AT1 B;  3AB9 A;  5KE3 A;  1JB3 A;  4F7U A;  3HFO A;  2RA4 A;  2CDT A;  4EMG A;  2COY A;  2RHZ A;  3KJP A;  1YN8 A;  3NHN A;  1RIP A;  1XNQ Q;  4JG2 A;  1LOJ A;  4DR7 L;  3S3M A;  2RDF A;  1Q90 A;  2G9H D;  5IHN A;  4A4F A;  5GRO A;  4OMO A;  3VYS A;  1VQ4 Q;  4R4T A;  5LMN Q;  2JA5 B;  1B70 B;  3S3N A;  3X3N A;  2KXD A;  1WI5 A;  2HNI A;  3L7Z C;  3NQT A;  1YJN T;  3GO5 A;  4GN4 B;  5LJ3 j;  2L11 A;  4K8I A;  3G48 A;  3OW2 P;  3D3R A;  5BN4 A;  3I70 A;  2XI9 A;  2WB1 G;  2FZC B;  2DVE A;  5LJ5 f;  4YWM A;  4QB4 A;  2H3E B;  3KLW A;  1FJG L;  2A37 A;  1VQC A;  1PYS B;  4A3E G;  2DL8 A;  3I55 A;  2JA7 H;  2KE9 A;  1RI0 A;  4BY1 B;  3NGP A;  1Q1B A;  2X6L A;  4K8J A;  4PFZ A;  2EPD A;  1W4S A;  2XIC A;  3HOZ G;  1GUO A;  1VQO Q;  2SNS A;  4C8Q D;  3OYY A;  1U9R A;  3NBH B;  1U8R A;  4QCL A;  3V2T A;  2WB1 B;  2D0Q B;  1B1Z A;  1GUN A;  2C5C A;  1AP0 A;  1V43 A;  1Y1V H;  2B2Y C;  1Y1W B;  1C0M A;  2RF0 A;  2EQK A;  4M7A G;  1H92 A;  4M77 C;  1HZ9 A;  1STG A;  3ER0 A;  3GV6 A;  1AH9 A;  4PNO A;  1TY2 A;  5HUR A;  2C0I A;  4KH0 B;  4JBJ A;  4P75 A;  4A3E B;  2UXC Q;  2CP3 A;  2DMO A;  5KYL A;  4IKF A;  1VQA A;  1C1A A;  2X69 A;  5LMU Q;  3F2D A;  4DV1 Q;  1N32 L;  5IYD H;  3M7N A;  1RAF B;  2SOB A;  5CKH A;  2K50 A;  4IPG A;  3G6E Q;  1OZ2 A;  3OYK A;  3OS2 A;  4A3I H;  1HUM A;  3DXJ C;  1YJW T;  3HOZ B;  4N9T A;  2QEX A;  4UAI A;  3KBG A;  4JI5 L;  2E2J H;  2OQ0 A;  1WTR A;  3JCM Q;  2ZTE A;  2EFI A;  2H3J A;  4JPB W;  4X9D A;  1EEI D;  3UE1 A;  1N33 Q;  2RPN A;  4UDU C;  5JEA H;  1CA5 A;  3S2H H;  1WI7 A;  1XTD A;  4R4C A;  1SJH D;  1TII D;  1M8V A;  3EFO B;  1KDA A;  3M4Y A;  2F69 A;  4QW2 A;  3A0J A;  4HJ8 A;  1X2K A;  3ULP A;  2ES2 A;  2PW7 A;  4XT1 B;  5HCK A;  1BCP D;  2OTJ Q;  3KF8 B;  1K73 U;  4H13 C;  5FU7 B;  1BDO A;  4JV5 L;  3QJ6 A;  3MET A;  1PSE A;  2VAS A;  1HJD A;  1QLY A;  3I4N H;  3X26 B;  1ENC A;  5DM6 3;  3MVV A;  1EQQ A;  1Z9Q A;  6AT1 B;  1A62 A;  4J7I A;  1AE2 A;  3JB9 H;  2A19 A;  1X55 A;  4PNY A;  5GAN 4;  2UUA Q;  1M1K R;  3RR5 A;  2LX7 A;  3SK5 A;  2EQM A;  1BI2 A;  1DJ7 B;  4LNQ A;  2NVQ B;  3CC2 T;  1N9S A;  1AZQ A;  3X3M A;  2D62 A;  3DWQ A;  4BBR G;  5E7N A;  1WDX A;  1MBY A;  3URY A;  1SYE A;  2DTH A;  3L2R A;  3R2T A;  2KHI A;  3NPP A;  3GP7 A;  4M7A E;  3OMC A;  2D2C C;  3MEF A;  1VQ4 T;  2GCX A;  2YTV A;  3QO3 A;  1O7L A;  4PZ6 A;  2OX7 A;  3S1Q H;  1NYF A;  4A3F H;  1W6X A;  2XVS A;  3GF5 A;  4KT0 E;  1JWS D;  2YWW A;  4LF7 L;  2CWP A;  2PNR C;  4K14 A;  1WXU A;  3VYR A;  4EVO A;  3KUF A;  4XU2 A;  4BBR B;  1BF4 A;  4M75 B;  3JC6 6;  4FF1 A;  2F4V Q;  3M54 A;  1A3U A;  2NUC A;  3PSI A;  3OYA A;  4IUT A;  2EVB A;  3ASK A;  2D1X A;  4GLA C;  4A3B G;  3L42 A;  1I6H H;  3A8M B;  2A28 A;  1QVG P;  4UP8 A;  3HPW A;  2XU8 A;  3BY7 A;  5ECA A;  1QWF A;  4R9W A;  4R8I A;  1VQ5 Q;  2CZ1 B;  3ULR B;  1VQO T;  3FMC A;  3UF4 A;  1TG0 A;  2NN6 H;  2VY3 A;  4OP0 A;  5KYU B;  5KNC A;  1FX7 A;  2NTT A;  4XDX A;  5EGT A;  4PL6 A;  4X62 L;  2DRK A;  3PVQ A;  1WGS A;  2F0G A;  3BDC A;  3UE0 A;  1PFS A;  4CGY B;  2OI3 A;  4HKE A;  2KRO A;  1WQW A;  1ICW A;  5ELE A;  1ZYR D;  2XSC A;  1S4Z A;  1H9J A;  5LJ5 h;  4RTX A;  2D9U A;  3OYJ A;  2FZG B;  1Q8K A;  3VS1 A;  1CA6 A;  4A3B B;  3JAM c;  2SNM A;  2CP0 A;  1E22 A;  1SMX A;  4DBF A;  1W6J A;  5IYC H;  4B3M Q;  3CQZ H;  1MHW C;  4NL3 A;  5CV9 A;  1ZUK A;  4XTY A;  1TUC A;  4AFQ C;  1K0X A;  1VQE A;  1ZYR C;  3VRY A;  2R5M A;  1K73 C;  1PFB A;  3TQY A;  2VQE Q;  4F7U B;  1WTQ A;  4B3S L;  1WCM H;  3VU3 C;  3F2U A;  2DAQ A;  1E7Z A;  2E2I H;  3RMQ A;  4E7H A;  3M55 A;  5FU6 B;  5KCH A;  4IUP A;  2EBP A;  4A4H A;  5M5X B;  3EH1 A;  4RGM A;  3VS5 A;  4XK8 E;  1X6G A;  3INZ A;  2NVX B;  3E9G A;  2VQF L;  1I4P A;  1G91 A;  2JN0 A;  3JCM W;  2OTJ T;  4JJD A;  3UAT A;  3UDG A;  2QA4 A;  1HA6 A;  3MZ5 A;  1Q86 C;  4HTH A;  2YHT A;  1PYW D;  2QQA A;  1F77 A;  1HH2 P;  3LWH A;  3CCE A;  3DB3 A;  5I21 A;  1SNM A;  4ZK9 B;  1PRT C;  1VQK A;  3J81 i;  1GHJ A;  2HDL A;  3CCR A;  3F2C A;  3VS7 A;  1RJT A;  1PFN A;  4MDW A;  4IN3 A;  4LW1 A;  2F3V A;  2FPD A;  4FL6 A;  5ELF A;  2CZ0 B;  2ICE C;  2QAZ A;  5GAH C;  2C06 A;  3FRP B;  3W1G A;  2R57 A;  4J6X A;  3T1H L;  1U5K A;  4FT4 A;  4C92 D;  1K0S A;  4QJF A;  3A8G B;  1ZHI A;  3GOX A;  4M7D A;  2RQW A;  2C35 B;  1U1T A;  2B63 H;  2BCO A;  1SFO H;  1A0N B;  1TS2 A;  3VS3 A;  2XHC A;  1M1K U;  1OX8 A;  1R0B G;  5FLX c;  3O8V A;  1FXX A;  2FPF A;  3HRS A;  4HSV A;  1PG5 B;  1NEB A;  2KVM A;  4HSP A;  5C3X A;  4DR7 Q;  2JJ9 A;  3WVE B;  1OO9 B;  2E75 C;  1ICF B;  3TN2 A;  4DAV A;  1A63 A;  1UDL A;  1L1O A;  2F0K A;  1YHQ A;  1KLU D;  3VYU A;  3GTG H;  1XJW B;  3CP0 A;  5ELD A;  2DVJ A;  3MEU A;  1BVS A;  1YWP A;  5LJ5 j;  1ZSG A;  2NLU A;  4L5T A;  1W70 A;  3IAY A;  1A3T A;  1TWC H;  4HID A;  2Q2U A;  4IFD G;  3A8I E;  1PTO D;  2L4N A;  3CC4 Q;  3CD6 A;  1HNX L;  1EYC A;  1WZO A;  1E2Z A;  5IYB G;  4ZAI A;  2DBK A;  4J15 A;  1FJG Q;  1HCZ A;  5I2M A;  1B9N A;  3C12 A;  1JEG A;  2IX1 A;  1PTO C;  1UNS A;  1STA A;  2HQH A;  2P0K A;  2WSE E;  2RI3 A;  5FJ8 G;  2QCP X;  2IX3 A;  1AFP A;  3KDF A;  3MAQ A;  4FO2 A;  4IUQ A;  3BVZ A;  3AYH B;  3M4O B;  2XK0 A;  3EFS A;  1E2V A;  1STE A;  2F0V A;  5JAV A;  1ZUY A;  4K5X A;  3S14 H;  2PI2 E;  5CKD A;  2L3P A;  3M0U A;  3OS5 A;  4XU3 A;  3X20 B;  3CCL Q;  1W2B P;  1YNN D;  1QCN A;  1BBZ A;  3H09 A;  4IUN A;  5JEA J;  3PO2 B;  3CCV Q;  1JJ2 S;  1PFM A;  1BKB A;  2GFU A;  5GAO q;  2DFU A;  2DN8 A;  1N32 Q;  2EGE A;  4LUE A;  4KY7 A;  4F04 B;  3HOX B;  3OA6 A;  4V19 0;  5IGB A;  1FNU A;  5IP9 G;  3HP9 A;  2IPO B;  4EQN A;  4BWG B;  5CCA A;  1PH9 A;  4JI5 Q;  4M8A A;  1CKM A;  2EY1 A;  1H9S A;  4D8K A;  3GLX A;  1IHZ A;  4OON A;  5FU7 C;  2FB7 A;  2QI2 A;  3U9S A;  2EYQ A;  1E7O A;  1UG1 A;  5M9O A;  1VQL Q;  4Y28 E;  2K03 A;  4AH6 A;  4LUZ A;  2G9D A;  4A75 A;  1L2F A;  3M4P A;  3M0T A;  1YBY A;  5ELO A;  3H0I A;  1FR3 A;  2LRQ A;  2LS0 1;  3JB9 J;  1WTW A;  2BA1 A;  3AMU A;  2LCC A;  5KRU A;  2QTV A;  3DUZ A;  2HL5 C;  1MD2 D;  4C3I B;  3T1Y L;  2DNC A;  4JV5 Q;  2QDY B;  3JCM c;  1F9R A;  2A74 C;  2EJF A;  5C3E B;  1M90 R;  5A2Q E;  4EQO A;  2X4J A;  1M1K C;  3Q8D A;  2NUZ A;  2E5L L;  4JYA L;  5IP7 G;  2A5H A;  4U67 3;  2Z6K C;  3GTL B;  1HD3 A;  4FYD A;  1OXT A;  2AQ2 B;  4ZUJ A;  3CRL C;  1GUG A;  1M4V A;  1Q3L A;  4RHR A;  1PRL C;  5EKL A;  1PHT A;  3HRU A;  3CC7 A;  5GAN e;  2ZT9 C;  3H0G H;  3H3V H;  5FWC A;  4B9W A;  3HZX A;  1PVO A;  4XYO A;  4FF4 A;  2G5D A;  1M4Z A;  5FJ8 H;  1EFN A;  1L0Y B;  2ZJP A;  4M75 D;  1XNR L;  3MEV A;  2JA8 G;  1NZ9 A;  1W1F A;  3TCJ A;  3V7R A;  3OPO A;  3P7J A;  2YDL A;  3RN5 A;  4KD3 A;  5GAG C;  1HZB A;  2F03 A;  2KYM A;  2B2U A;  4E6I A;  3BDL A;  4DPG A;  4M75 C;  1VQG A;  3ZJY C;  5BR8 L;  1NLO C;  1C0A A;  1KRS A;  2J05 A;  1AT1 B;  2DL3 A;  2ZPB B;  4TKO B;  2RSO A;  4LF7 Q;  1HNZ L;  3I55 Q;  2RMO A;  4HXJ A;  3ME9 A;  1T5X D;  3KF6 A;  3PUV A;  1X54 A;  2Z4I A;  4MZP A;  1SEB D;  3CC4 T;  3QOL A;  2DNE A;  2LMC B;  1M5Q 1;  1BNZ A;  1SRM A;  4DR3 L;  1J8I A;  4P72 A;  5KIX A;  1G83 A;  3NFC A;  2PMZ B;  1KQS P;  1E2W A;  5CKB A;  1Y0M A;  4RG2 A;  4F7X A;  1Y7X A;  1PKT A;  1NTG A;  3SK8 A;  1PHJ A;  1ZSZ A;  2RQR A;  3OYM A;  1CKN A;  2L12 A;  4OO1 G;  1EY5 A;  5CV6 A;  4M7D G;  1TWG H;  2LVM A;  1NNX A;  3CCJ A;  4DV4 L;  1EU3 A;  3CBO A;  4HCZ A;  4Z8A A;  1BCO A;  2PCF B;  3J7Z C;  4E7S A;  1J3T A;  4PG3 A;  2UU9 L;  2K5H A;  3WOF A;  4FXK C;  1TQO A;  4X62 Q;  4QIW E;  2HT1 A;  1D0Y A;  2JA6 G;  4I7A A;  5GAN f;  3BJU A;  4II1 A;  5EJW A;  3M57 A;  2QDB A;  1IO6 A;  3CCL T;  5FO8 B;  1AVZ C;  3CCV T;  1JE5 A;  3ZEH A;  2RHY A;  3QB3 A;  3X24 B;  4EIK A;  4M7D B;  2X3W D;  3I56 A;  2YT6 A;  1MJE A;  2EVR A;  3UDI A;  3D8G A;  5AFW A;  1L0X B;  4PZ8 A;  2HHH L;  2YUP A;  3FRN A;  2YV5 A;  5LL6 X;  3JV3 A;  4JJC A;  1E1O A;  1PH8 A;  2B8A A;  2K52 A;  3DB4 A;  2K4K A;  4ODG A;  4KUD K;  4B3S Q;  3FEW X;  2JA6 B;  1K8O A;  2MF2 A;  3Q1J A;  4RGT A;  2XTI A;  1RAB B;  3I35 A;  1VQP A;  1VQL T;  3VR3 A;  4R8N A;  5IY0 A;  2QQ9 A;  3NTH A;  1NE8 A;  1A2U A;  3CPF A;  1UEA B;  1L1O B;  3TRZ A;  3SEM A;  3ZYY X;  1UGP B;  4F7U F;  2VQF Q;  2PZ1 A;  3S1M H;  4L5Q A;  4BUG A;  2LXK A;  2GQI A;  3HOU B;  1E6G A;  4JBK A;  3EAE A;  4NOY A;  1XXG A;  5J39 A;  4OX9 L;  2BE5 D;  5EBD A;  5D6Y A;  3I4M B;  1HZC A;  5JVH 3;  5IWA L;  4WJ4 A;  1UWV A;  2F0E A;  5KH6 A;  2IHE A;  1LCK A;  4JJN K;  5K5P A;  4L63 B;  1JOQ A;  5HK0 A;  3QO2 A;  3BVG A;  4B6M A;  1CSK A;  1WNL A;  2EYX A;  3UA6 A;  1TWF H;  1EQR A;  2X4Y A;  4UP9 A;  2D0N A;  1FMK A;  1IGU A;  4BI3 A;  2BE5 C;  4WFN 3;  2EIF A;  1M90 U;  4C3J B;  1DXM A;  3T1H Q;  2GNC A;  3M3Y B;  2EW3 A;  2YRD A;  2HSE B;  3MXU A;  4GZY C;  2KQW A;  2L3R A;  3KDF B;  2MOX A;  3BS1 A;  3H8Z A;  2I5M X;  1HK9 A;  4M78 D;  5EKI A;  4A3G B;  1I5L A;  1JQY D;  1R9T H;  1B7T A;  4A53 A;  2RO0 A;  3TSZ A;  2M0Y A;  4RFB A;  2FG0 A;  3MP1 A;  4PJO D;  5BN5 A;  1YI2 A;  1SYB A;  2JSO A;  2Z1C A;  4RGN A;  2EYO A;  3D0F A;  5LJ3 f;  1CHP D;  4M78 C;  2H5X A;  1XNI A;  2HBW A;  1NJI R;  5C4J B;  2HQX A;  3I55 T;  1STB A;  3HRT A;  3HKZ E;  4KGX B;  1IBL L;  1U5S A;  2ZXO A;  1Z7T A;  2YRV A;  2BE7 D;  4PJO C;  3S16 H;  1H8K A;  4ID6 A;  4B3T L;  1H9S B;  2NTS A;  1UE1 A;  4F8M A;  1SLJ A;  3RZD B;  1HNX Q;  2C0T A;  1XTC D;  5CQY A;  1U1S A;  1MSG A;  1BBX C;  1ZX6 A;  4N4I A;  1HFG A;  2RHS B;  2QKI C;  2KY9 A;  4F14 A;  3N6R A;  3ULL A;  2RH2 A;  1MIU A;  5M3M H;  3QZ5 B;  3BZK A;  3EGD A;  4A4K A;  4GOP C;  4OEM B;  4X3K A;  5IT9 L;  4NXM L;  2XN9 C;  2PUK B;  1TVX A;  1IBK L;  3OHX C;  4DEY A;  1PH2 A;  3MPU B;  2V8K A;  1EIG A;  1ZEQ X;  5IAY A;  3UPU A;  2B2T C;  1UEB A;  2KQ3 A;  4RMO A;  3S6W A;  1G3Y A;  2R93 H;  1FYC A;  3C4S A;  4ILW A;  3U9O A;  2EYM A;  3M0S A;  4A3L H;  1NUC A;  2O5J C;  4ZN1 A;  2ATW A;  2X9H A;  4J1M A;  1IB8 A;  4C8Q G;  4LD9 K;  4PJL A;  3T13 A;  4HVV A;  1AD5 A;  2C9O A;  3QYG B;  3R3O A;  1M2O A;  4HCC A;  1EQT A;  3NQI A;  2JNG A;  5GAM d;  4DAY A;  3EG9 A;  2E6N A;  1A8V A;  1KAA A;  3J81 L;  3V8K A;  3S2D H;  2QA4 Q;  3LWU A;  4L5S A;  3FHW A;  4CC3 A;  1FVI A;  1JCK B;  3OMG A;  5M3F B;  5GAN h;  3CCE Q;  4DK1 A;  1JO8 A;  1OI1 A;  1SYG A;  2BUD A;  1TS3 A;  2BH8 A;  4RAU C;  1VQK Q;  2EYH A;  4IIO A;  2HQL A;  3FC3 A;  3CCR Q;  1P92 A;  5HK3 A;  4LFC Q;  1AWJ A;  1ILQ A;  1WYX A;  3KF6 B;  1WPY A;  1IXR A;  5JPM C;  1K8M A;  3T1Y Q;  2F3W A;  2PYK A;  1QP2 A;  1G5V A;  3CPW A;  5LHY 1;  1E24 A;  3GTP B;  2K28 A;  3LX0 A;  4IIM A;  1Q1E A;  3S1R B;  1ZSZ B;  1CKN B;  2Q2T A;  2ENM A;  3VV0 A;  2EJG A;  4MMK A;  4RWS C;  2VB6 A;  2XIW A;  4MN3 A;  2MMP A;  4AFZ C;  4KD4 A;  2QGG A;  2Z0W A;  2EYP A;  4M7A A;  5JVG 3;  2ZXR A;  4DOV A;  3OYL A;  4WJW A;  1DOK A;  7AT1 B;  2KMT A;  1I3Q B;  4HJ7 A;  3WXM B;  2WSC E;  1EOV A;  2P5Z X;  1XNR Q;  4X3S A;  3KFU A;  1YHQ Q;  2EY5 A;  1JB7 A;  1S72 A;  1LM0 A;  3ERQ A;  4LXC A;  1KDB A;  1MGQ A;  2JTM A;  3EG3 A;  3A56 A;  3UDF A;  1O7Y A;  4M77 E;  5GAM g;  2L8D A;  3PO3 H;  4BY6 B;  4ZTF A;  4DKA C;  3CD6 Q;  2JMA A;  1UE5 A;  2KEC A;  5BR8 Q;  5IGE A;  4ESR A;  3RNJ A;  1QW1 A;  2AWO A;  3G7L A;  2JXB A;  2ENB A;  1HNZ Q;  1EL0 A;  1Y96 A;  2WAQ G;  1RAE B;  3P8H A;  5KCO A;  1K83 H;  4XT3 B;  4A4G A;  3I4O A;  2JN4 A;  1NJI U;  1OV3 A;  2KED A;  1UE6 A;  1DZ1 A;  4ZGJ B;  5IIF A;  1N36 L;  4BBS B;  2XWJ B;  4DR5 L;  2L0A A;  3VJP A;  4FDB A;  2LFN A;  4NXN L;  1OX9 A;  5M5Y B;  3LWE A;  2NVT B;  3D7S B;  1Y57 A;  1KL9 A;  4C0F A;  4RTT A;  4H0L C;  2M9U A;  4BDY A;  4EQ5 A;  3VA5 A;  4DV4 Q;  3S1N H;  4ZUI A;  1JRI A;  4LF9 L;  2F5T X;  1NM7 A;  2AIR B;  5GAN j;  2UU9 Q;  2WAQ B;  1XQH A;  1MND A;  2LJ0 A;  4E7K A;  2DL5 A;  1SRU A;  3DEO A;  4A3M B;  2B29 A;  3QWY A;  1ZQ1 A;  3SDZ A;  2HIV A;  3LH5 A;  1HTL D;  4Q5V A;  1NR2 A;  3CCL A;  3FKI B;  2HCK A;  1J5E Q;  2KAF A;  2OTL A;  1JJG A;  2N8N A;  5I9O A;  4HAE A;  1V1Q A;  2LC4 A;  2ZTD A;  2JA7 G;  1KIK A;  3LNN A;  2HHH Q;  2AKK A;  3HSB A;  1F2L A;  4HIK A;  3HHT B;  2NWG A;  2QA4 T;  2CP5 A;  3BG3 A;  2CKZ B;  4Q5W A;  2JEA I;  4M7D F;  4OEL B;  2BTT A;  3MA2 B;  5GAO r;  2VV5 A;  2WIN B;  2XDP A;  1G2B A;  1VQK T;  2EQI A;  1Y1V G;  3OYB A;  4A3D H;  3CCR T;  2GA4 B;  5LL6 S;  1FWZ A;  1HUN A;  3AU7 A;  4LK1 C;  4I7Z C;  4K6L A;  2V4D A;  4Y52 H;  1NYG A;  2ZM6 L;  2JA7 B;  1PWT A;  2ESW A;  2O9S A;  4MTK A;  2F1L A;  1GCP A;  2KR3 A;  5IYD G;  3SHW A;  2LCL A;  4J9H A;  1LO5 D;  4OX9 Q;  1K3B C;  1K9M C;  1SE8 A;  2IX0 A;  3NWS A;  5CBE E;  4A3J H;  1W6K A;  1CQV A;  3KBX A;  5IWA Q;  3CC7 Q;  2XNA C;  4A3I G;  2CS7 A;  1F1B B;  2DJZ A;  3NMZ C;  1QVF S;  1UE9 A;  4J9E A;  1RTO A;  5ISR A;  3M0Q A;  3EGD B;  3CPW S;  1I07 A;  1GXI E;  3V96 A;  1EY9 A;  4YY3 L;  5JEA G;  4FIB A;  2Y90 A;  3HEJ A;  3P20 A;  3MKD A;  4JUV A;  1IRX A;  2CUD A;  4IO9 A;  1IYU A;  5D6W A;  2AK5 A;  4JW0 A;  3K8A A;  1JB0 E;  1PD0 A;  5CR2 A;  1MMD A;  4RHS A;  3VR4 A;  4IUV A;  1YHQ T;  2IW3 A;  2QIL A;  1XYI A;  3N52 A;  3E0E A;  2X3X D;  4N0A C;  1SHG A;  2PNI A;  2AZV A;  4C0D B;  4A3I B;  1G51 A;  4C92 G;  1YIJ T;  3QSU A;  1T0J A;  2RI2 A;  2E2J B;  2RCF A;  3R93 A;  2N78 A;  4KN4 C;  1UJY A;  1VQ9 A;  1IRE B;  2Z8L A;  3CD6 T;  4KMU C;  5DEH A;  3I4N G;  4V2S A;  2AUJ D;  4FYY B;  2N88 A;  4DXG A;  3S2H B;  1MHN A;  5IGF A;  3JB9 G;  1MKH A;  3K7A B;  4CI0 C;  3IKJ A;  4DK3 C;  1D1I A;  2MCN A;  4FNF A;  3T51 B;  3VYT A;  4BE0 A;  1G6Z A;  2KBN A;  4A3K H;  2KGT A;  4B3T Q;  3I9Q A;  1LLR D;  4M77 D;  3CCJ Q;  3HP3 A;  3QOJ A;  2QF7 A;  1VYV A;  3K58 A;  2VUM H;  1FNW A;  1KDC A;  4YIJ A;  4G7O C;  3ZBD A;  1VQM A;  1WTP A;  2CH4 W;  3VR2 A;  2DEQ A;  3MP6 A;  4MDX A;  1HA5 A;  3HOY G;  1BK2 A;  2E4H A;  1QG7 A;  2HEQ A;  3ND8 A;  4NXM Q;  1LYL A;  1PV4 A;  2XMF A;  3VS2 A;  3L3O C;  2PI2 A;  1IBK Q;  8ATC B;  3J7Y W;  1I4H A;  2RSN A;  1R8O B;  1CZG A;  1FD7 D;  3B6Y A;  3S24 A;  4LF6 L;  1ENF A;  4J7F A;  1R4Q B;  3EFR A;  1G2S A;  4A3F G;  2EZV A;  1VF7 A;  2DYB A;  4XU1 A;  5GMK e;  3I56 Q;  2E2D C;  3L2Q A;  3C1F A;  2JW4 A;  2EDG A;  3CU7 A;  4DA2 A;  4K5W A;  3A5U A;  1LJO A;  5FW9 A;  1HSQ A;  2PQW A;  3FDT A;  4N8X 1;  4KKU A;  3EHR A;  3S15 H;  4BY7 H;  2EQS A;  4Q0F A;  2F0M A;  2YSQ A;  2HIX A;  5I6Y A;  2HCI A;  1TU0 B;  4DV0 L;  4E7I A;  1SF9 A;  1FNV A;  1SSH A;  4M7A B;  4LN2 A;  2R7F A;  4CC2 A;  1Y07 A;  2JS2 A;  1VQP Q;  1ENA A;  2CSI A;  4IUU A;  4KN7 C;  1I5F A;  1EYG A;  4LUO A;  3F70 A;  3O5Z A;  4KHV A;  5IGD A;  3LYI A;  2K04 A;  4OB3 B;  1EYA A;  2RHQ B;  3G6J B;  3A8K E;  5C4Z A;  4FU6 A;  3JCM d;  1I50 H;  2J6K A;  4FW2 A;  2NN6 G;  2DZC A;  2LQN A;  4A54 A;  5JOB A;  4MIU A;  3PVL A;  2GVA A;  5G3L F;  3SK4 A;  4XTX A;  2LSS A;  1S5F D;  4C92 E;  1WHG A;  3CXC A;  4JBW A;  1UB4 A;  1G8Z D;  3K0X A;  4OL7 A;  1FMW A;  2F0F A;  3IRB A;  2RD1 A;  1ARK A;  3K6O A;  1Y96 B;  1ZSZ C;  5I4D A;  5IYC G;  1CUK A;  1SSO A;  1WHM A;  1CFM A;  4GY5 A;  1TWH B;  3EG0 A;  2L3S A;  3P8B B;  4RCC A;  3CC7 T;  2AQ3 B;  2NWM A;  2O9V A;  4R0K A;  2L15 A;  3I2Z A;  4JLG A;  4C8Q F;  2FPE A;  3ZL7 C;  2JP1 A;  3NE5 B;  4BY1 H;  1WCM G;  4OWX B;  1H95 A;  5D14 A;  4H02 A;  2V1R A;  1X3G A;  5NUC A;  3UI2 A;  2DD5 A;  5J26 A;  3JRZ A;  1KTK A;  4B3R L;  3SD4 A;  2DXC A;  2XG8 D;  3JCM P;  1BYM A;  4IPH A;  1VMC A;  5GAN 6;  4IPD A;  1PTO H;  1SRO A;  3ND9 A;  1YNZ A;  1YI2 Q;  4N9P A;  4A4E A;  1E1T A;  5DAU A;  1Y1W H;  3J80 E;  4OB1 B;  1A15 A;  2FL7 A;  3WVD B;  4BY6 C;  3CQZ B;  3P75 A;  4JRI A;  2MO0 A;  4L59 A;  3CCQ A;  4CJ1 B;  2X4W A;  3U23 A;  2F0D A;  3BU2 A;  1WCM B;  4YWK A;  1EIF A;  4KBM B;  3LH0 A;  5KNB A;  1HNW Q;  2O4X A;  2E2I B;  3VS4 A;  4R1J A;  3RLF A;  1X69 A;  3BVM A;  1PH4 A;  2OWO A;  3JCM g;  2CT3 A;  2NYS A;  4JI0 L;  2HAX A;  1BCP F;  4XQQ A;  1QE6 A;  1SNQ A;  3PUZ A;  3CCJ T;  1IW7 C;  3BFM A;  3KOJ A;  3GTK H;  5I2S A;  2B63 G;  2F2V A;  4MZ9 A;  3OTO Q;  4OB0 B;  1K0R A;  3W2D A;  3GTM B;  4PKC C;  2EGA A;  3CME Q;  1N36 Q;  1KNE A;  4E47 A;  1I4Q A;  4DR5 Q;  1RAG B;  2VKN A;  1SYF A;  4NXN Q;  2PU9 B;  1PNJ A;  3DKM A;  1LTL A;  2JXM B;  1JJ2 A;  4DAM A;  1OU8 A;  4C5E A;  3E5S A;  4X9C A;  3E2U A;  2MUY A;  2GTJ A;  2CFM A;  2WKD A;  2VGN A;  4IJL A;  1WXT A;  4LDY A;  4LF9 Q;  5C6S A;  1K1Z A;  3L1A A;  1PZJ D;  3Q23 A;  2YUN A;  3I56 T;  3SK6 A;  1BXT A;  2JYO A;  1IL2 A;  1ABQ A;  3RMS A;  2LNV A;  3VRZ A;  4G57 A;  1SFO B;  2M1H A;  4ZN3 A;  2FXQ A;  3OYD A;  2BE9 B;  3RKW A;  1PZK D;  4KKS A;  3URG A;  2KOL A;  4AYB E;  2EGC A;  2QDL A;  2HMA A;  5C0X I;  5AJ3 L;  3LGF A;  3THK A;  2NVQ H;  1BR9 A;  1VQP T;  2N3S A;  4KRT A;  1F9Q A;  3TZD A;  2IPK D;  1PRT D;  1UFF A;  3ULJ A;  1B34 A;  2F4I A;  4C0Z A;  5A2Q L;  1A0I A;  1KIX A;  2IWH A;  5JJL A;  1AHJ B;  4KUL A;  2KSS A;  1TWC B;  4NKL A;  4J9D A;  3K5O A;  4DU9 A;  4OMP A;  4CDC C;  3QKJ A;  1EUJ A;  3G71 A;  3SWN C;  2XGT A;  2B2V C;  3QUI A;  4XQN A;  3RR6 A;  1SN8 A;  5D3I B;  1AN8 A;  1G3S A;  1ASZ A;  1GUW A;  1SSF A;  4M75 E;  1GBR A;  4H44 C;  5IOC A;  1KRT A;  3CXC S;  1QVC A;  3TU4 K;  1VS0 A;  4C3H H;  1WHJ A;  3I73 A;  4RTU A;  3DEP A;  2R61 A;  3EGX A;  4LF5 L;  2K2M A;  2QQS A;  5ELC A;  4DK0 A;  2G3R A;  3I3C A;  2LJ1 A;  3WOE A;  4YY3 Q;  2YU9 H;  1UAP A;  3BZD B;  1S72 Q;  1TTH B;  2RB6 A;  3CW2 C;  5LJ3 g;  1NEG A;  1YI2 T;  3GTJ B;  1QCO A;  1PYB A;  1Q46 A;  3UWN A;  4R4O A;  2KHS A;  4FP5 D;  1U0L A;  2EKH A;  2HD3 A;  4LJZ C;  3TQ7 P;  4LDW A;  4IOC A;  5CC4 A;  5GAN 2;  5I22 A;  2ZAE A;  4PLI A;  1K28 A;  4JOI A;  2LDM A;  4KY6 A;  4O1N A;  4PMW A;  3CBM A;  2EOT A;  1YIJ A;  3QIA A;  5KND A;  3BYY B;  1IZ6 A;  5C5L A;  3GD7 A;  4C5G A;  1O78 A;  2A73 B;  2EYZ A;  2M2L A;  1B9M A;  1TT2 A;  4M78 G;  1S1N A;  3CQT A;  3CPW P;  1YCY A;  3H0F A;  5GAO n;  2RKS A;  4GKJ L;  3OYE A;  1QP3 A;  2NZH A;  4MTN A;  2CH4 A;  1GUS A;  5EPK A;  2DEU A;  4DV2 L;  1FMV A;  4PJO G;  2DXB A;  2LZ6 B;  1D5X C;  3H0G G;  1X9N A;  2UUC L;  3WDN A;  3CME T;  3M59 A;  4OIK A;  4FW1 A;  2NVX H;  2K5W A;  3CEY A;  5CV4 A;  3QYH B;  1ZA1 B;  1CTM A;  1HFN A;  3LLR A;  2FFK B;  3QWX X;  3M0P A;  2SRC A;  1YHB A;  1DJR D;  1DD2 A;  2E64 A;  3D4D A;  2CRE A;  2NUT A;  2J7I A;  4LF6 Q;  3PMI A;  2OTL Q;  1GOZ A;  2WII B;  2DL7 A;  4O42 A;  2DKG A;  5IXF A;  1Y71 A;  3JCM b;  1X3Q A;  4VUB A;  4YTL A;  1EZ8 A;  3EA6 A;  5COR A;  1JE4 A;  1D3B A;  2D5D A;  2MI6 A;  3MTS A;  1I4K 1;  3JB9 F;  1E3P A;  2ICI A;  3D6C A;  2DER A;  2K57 A;  2EWN A;  3P8D A;  2SEB D;  4HMJ A;  1EWI A;  3I91 A;  4C2M B;  1IL8 A;  2K05 A;  2F0P A;  3C46 A;  3DLL A;  2RHX A;  5A0D A;  4DV0 Q;  2MP1 A;  5IT9 c;  2O88 A;  1H9K A;  3MJX A;  2O31 A;  1R0C B;  1N6A A;  1ET6 A;  2F2X A;  5EBC A;  1Y8P B;  2RA2 A;  2KEE A;  4XU0 A;  5IHI A;  2GFA A;  2P4R A;  4B9X A;  5EPL A;  1VYU A;  4UPA A;  4ABN A;  5K36 H;  5F2D A;  2RQT A;  3MC0 B;  3DLM A;  2AUK A;  2PUO B;  1D2B A;  4M7A F;  3TVT A;  1EY7 A;  1B2T A;  1EYD A;  1PCX A;  1BI1 A;  1MI2 A;  3R8B A;  2O4X B;  3MO8 A;  3PIO 3;  4XTZ A;  2F52 A;  3SVM A;  2KCN A;  2CWA A;  2YLB A;  3R2I A;  5E1F A;  3GDE A;  2F0L A;  4M78 E;  4XTU A;  1X56 A;  4X6A H;  2JK8 A;  1DCZ A;  2ZPI B;  1TWG B;  3IL8 A;  4C56 C;  2QXF A;  2NB0 A;  3J81 c;  2K6D A;  5AYF A;  4R4I A;  4PV1 C;  4RA8 A;  2E5K A;  4PJO E;  3E6Z X;  1N8R R;  2VXF A;  4KHP L;  2D0O A;  3A5Z B;  5GAN 5;  4QIW B;  2KCC A;  1B8A A;  2K5V A;  1NY4 A;  2ZTC A;  5CGK A;  4DGZ A;  4TVA B;  4DR4 L;  1S72 T;  1YNJ D;  3SHL A;  1KK7 A;  3MP8 A;  1GCQ A;  4B3R Q;  4ME7 A;  4O6J A;  3JCM e;  5IXB A;  2ID0 A;  2OXP A;  1GM5 A;  3J80 i;  3CF5 A;  1LAC A;  4M77 A;  1VQ9 Q;  1Y8O B;  2C0O A;  3EFX D;  1ZXT A;  2KNB B;  4IQZ A;  1YNJ C;  2EXZ A;  4DV5 L;  4C8Q A;  4X34 A;  3PO2 H;  2RF4 A;  1NMF A;  3NTI A;  4F87 A;  2ALY B;  2LCS A;  2JA8 B;  4LUD A;  3HOX H;  1B44 D;  2FJ2 A;  4C5H A;  3ICE A;  1RDP D;  1VUB A;  5FRO A;  3M5A A;  3UDC A;  2KRS A;  3L9A X;  3HOW G;  3A8O B;  1T5E A;  1VQM Q;  1B34 B;  4KJO A;  4JI0 Q;  3EIV A;  4ZGD B;  1TXQ A;  5IGC A;  4FF3 A;  1C8C A;  4DEX A;  1QMC A;  3VYH B;  2D8H A;  1Q81 U;  1M9S A;  1PZI D;  2JM9 A;  1X75 C;  1SMY D;  1N9W A;  4DV3 L;  3I4L A;  1KAB A;  3DM1 A;  3OWF A;  1AEY A;  2DL4 A;  1TKW B;  4K0K L;  2OAW A;  3J7A F;  2QQB A;  4P74 A;  2F0J A;  4RCO A;  3SE0 A;  3V8J A;  2LY7 A;  4AFS C;  3WWV A;  1SMY C;  4BI4 A;  4E7Z A;  4X65 L;  3GV3 A;  4HT8 A;  4PZ7 A;  2OTL T;  5C3E H;  2DD4 A;  2KA7 A;  2ED0 A;  1F2M A;  1NCV A;  1NLP C;  3QJY A;  4HCS A;  3AEV A;  3GTL H;  4DR6 L;  3RN2 A;  5IHK A;  1CKA A;  2DK3 A;  2IG0 A;  2KK4 A;  1DYQ A;  3EGX B;  3T9N A;  1QIL A;  3HKZ G;  2DTI A;  4FM4 B;  3HFN A;  5FU6 C;  2EYY A;  3VYG A;  1F9S A;  3VUZ A;  1JJC B;  1GXD C;  2IY5 B;  2DJF C;  3L0O A;  4LF5 Q;  3TRE A;  1SR3 A;  3RBB B;  4BAC A;  5AJ3 Q;  4X1V A;  4DBR A;  4LDX A;  4K11 A;  3V05 A;  1K8A U;  5FO7 B;  4QT7 A;  4YWL A;  1OZ3 A;  3KXT A;  1IKL A;  2K5D A;  2UXD L;  2I07 B;  5M3M G;  1HPC A;  4GN5 A;  2CP6 A;  1TH7 A;  2GN5 A;  2IT1 A;  2E2H B;  1AEX A;  1PH1 A;  5I2X A;  1X01 A;  3IQL A;  3HKZ B;  2R92 G;  3AQQ A;  2ASB A;  2ROL A;  1I94 L;  2J4X A;  1S40 A;  5GAE C;  1IYV A;  3KLS X;  4Y7N B;  1RF2 D;  2R93 G;  3CHB D;  1FGB D;  3K5N A;  1AZG B;  4BXX G;  2X6G A;  2MIO A;  4OGQ C;  3EN2 A;  3CKI B;  3HKS A;  1F9P A;  4A3L G;  2DUD A;  4ZKB B;  3TS2 A;  1WJJ A;  2R7Z G;  3GP8 A;  2DF6 A;  3HOW H;  1D09 B;  1JQQ A;  1PC0 A;  4HCB A;  3JCM V;  2MPM A;  4J9I A;  5D6X A;  1LTB D;  3F1Z A;  1QNK A;  2HUG A;  3MFY A;  4EGV A;  3HS0 C;  2A7Y A;  3PUX A;  3E9F A;  4YCW A;  3PMT A;  3PIP 3;  2LQW A;  4D6W A;  2E76 C;  1M3C A;  4TVR A;  3GIB A;  3C95 A;  1K3R A;  3L2Z A;  2G6F X;  2MWP A;  1MV3 A;  3CCQ Q;  1EEF D;  5LJ5 g;  1N8R U;  2CW0 D;  3GTO B;  1VQ9 T;  2NUT B;  3CCS A;  4CDD C;  1QVG A;  2JVV A;  1D3B B;  4Z9C B;  2K4Y A;  1LTA D;  3BDO A;  8AT1 B;  4FXG C;  1UGR B;  2CW0 C;  4OXP A;  1EFW A;  1D5M C;  3LGJ A;  2CCZ A;  3F8T A;  3K81 C;  5ELN A;  2MJ8 A;  3H6M A;  1WD0 A;  1LTR D;  4PFO A;  3OYI A;  3FLG A;  5LMN L;  1STN A;  4L5G A;  1VQM T;  4ATO A;  2DE0 X;  3FJP A;  5EPJ A;  1KQ2 A;  4GKJ Q;  2DYI A;  2YTX A;  3C3L A;  2AHJ B;  2F1M A;  4D8D A;  1KD1 R;  2E41 A;  3T53 B;  2J6F A;  4DV2 Q;  2L0C A;  2UUC Q;  4EPC A;  1YNX A;  2V8J A;  4J6W A;  3CME A;  4JI1 L;  1DGS A;  3GTQ B;  2R92 H;  2O01 E;  1DOL A;  4PJJ A;  5GAO p;  4OWT B;  3HOU H;  2WKC A;  3S17 H;  1WOC A;  5DM7 3;  4F16 A;  4PLL A;  3S3O A;  4BXX H;  3I4M H;  2UXB L;  2PVD B;  5FO9 B;  5M5W B;  4M77 G;  4IFD I;  1SPK A;  2IIM A;  1H9R A;  2KUM A;  1EIY B;  1XMQ L;  3PO3 G;  3CBP A;  1IKM A;  3X25 B;  1EQV A;  1OYX A;  4P71 A;  2R7Z H;  3RZO H;  3AHU A;  3AFP A;  1WHH A;  2KT1 A;  4QVC A;  3DMU A;  3LX7 A;  3QG1 A;  4KUI A;  3QBY A;  3JAM E;  2AZS A;  1ONL A;  1D0X A;  2IHF A;  4TSS A;  3E9H A;  2R5A A;  4K2K A;  3Q24 A;  4OWW B;  2AWN A;  2K75 A;  2ABL A;  2KBT A;  1T9H A;  2RJF A;  1SE2 A;  3SGI A;  4JI6 L;  4XTW A;  2B39 A;  3RKY A;  1A6X A;  2CUB A;  4EMK A;  1RLP C;  4N4H A;  2FRW A;  2RVL A;  1RAD B;  4WF2 A;  1STY A;  3REB B;  3NHH A;  2A1A A;  3ONA B;  1VQ6 A;  3PO3 B;  1PRM C;  3E1S A;  4C92 A;  1KHI A;  5GJW B;  3G71 Q;  3PF5 A;  1H3H A;  2SEM A;  1JWU D;  3I8Z A;  4C8Q B;  2A6H D;  1M90 C;  1HXD A;  1JJ2 P;  3OWE B;  1GL5 A;  1QVF A;  2Y0S G;  1K83 B;  2RHU A;  1FL0 A;  4UP7 A;  3P1H A;  2LT1 A;  2K33 A;  1QNU A;  3BE3 A;  2L1B A;  1TSF A;  1U06 A;  3KLS A;  3TP7 A;  1OOT A;  5C4X G;  3J7A 5;  3D31 A;  1JOR A;  1G3W A;  3RUX A;  3TP8 A;  2EQU A;  4E7J A;  2E5L Q;  2A6H C;  3IFD A;  2RHI A;  1MV0 B;  5J3B A;  2VWF A;  3NP8 A;  2ZCF B;  5GAO l;  3RZD H;  2LXJ A;  2JEB I;  1S5D D;  1GJX A;  2RJD A;  2FZK B;  5CKF A;  1KG1 A;  5CVI A;  5EKK A;  4OMN A;  2L55 A;  1RI9 A;  4HCE A;  1G8X A;  1HQR D;  4KHP Q;  2Z9H A;  1K8G A;  2JMC A;  1U4M A;  4DR4 Q;  4KHZ A;  4NB3 A;  2ATC B;  1VQB A;  3CCQ T;  2LMJ A;  1U4L A;  4MZM A;  4NL2 A;  1LT5 D;  3LGL A;  3E9I A;  1RUW A;  3V8L A;  3OOC A;  4GBQ A;  1BCP B;  5FLX E;  4A3D G;  1Q7Y U;  1YIJ Q;  1UJ0 A;  4Z88 A;  4DA4 A;  2CYZ B;  2B2W A;  3A54 A;  5H1S E;  1RAC B;  1WQ7 A;  1V1O A;  2DJQ A;  2DRM A;  1I4R A;  1PDQ A;  4XTC S;  1VQ8 T;  3K5L A;  2JTE A;  2TMP A;  1PD1 A;  4DV5 Q;  1YIT A;  4CKC A;  1II3 A;  3LW5 E;  4J8O A;  4A3J G;  2HDA A;  1OEB A;  3RIR A;  1QVG S;  1VQ7 A;  4DUZ L;  4WCI A;  1M8M A;  4DR3 Q;  1UGV A;  2OAU A;  3NPF A;  4LAA A;  1UE7 A;  2MO1 A;  1SG5 A;  1KFZ A;  4A3D B;  1W2B A;  5C44 G;  1BIA A;  2E65 A;  1K4U S;  5GMK i;  2M51 A;  4M7D D;  4GNX A;  1M30 A;  1QKX A;  3FB9 A;  1VQN A;  1TWA H;  5HGQ A;  2MQH A;  1MJC A;  3MEH A;  4NW2 A;  2DIG A;  2PTK A;  1MMA A;  4JDS A;  5KYI A;  1YWO A;  5KYW A;  1X43 A;  4E7L A;  2O2L D;  2Y0S E;  1KD1 U;  3D4R A;  5JPN C;  5IN1 A;  2KCM A;  3OQ5 A;  1MUZ A;  1AZE A;  3Q22 A;  5I9P A;  4K5V A;  4M7D C;  3QDF A;  1LTS D;  1LT3 D;  3RLO A;  5C4X H;  1O75 A;  1CKO A;  3EJI A;  4X65 Q;  2FMM A;  2KT8 A;  2JA9 A;  4A93 H;  1VQI A;  2E8G A;  1YJ9 Q;  1PH5 A;  3E0J A;  3S1R H;  4DR6 Q;  2PZU A;  1T0H A;  4J6H A;  3W5O A;  4A3C H;  1RHP A;  1QJO A;  4DAP A;  2MAM A;  4KJN A;  3LWI A;  4OO1 I;  2DIQ A;  1LV9 A;  2GGR A;  2DY7 A;  4A3K G;  3M56 A;  4L6T B;  4OGC A;  2Z6B A;  2NVY H;  5E4X A;  1C7Y A;  2DBM A;  2YYZ A;  2LTO A;  1HJP A;  1L1O C;  2VUM G;  3PMF A;  1QQJ A;  4JOI C;  1HQM C;  1TS5 A;  3TSW A;  1D1C A;  1SBB B;  4AIM A;  2ZJR A;  1HR0 L;  4QY7 A;  2UXD Q;  1WTO A;  2K3B A;  3KUP A;  4QQB X;  3G71 T;  3HOV H;  4PJN A;  1PM3 A;  4OF1 A;  4J83 A;  1V1C A;  2DNU A;  4OMF B;  4XTV A;  4M75 A;  4X64 L;  4CBV A;  1I94 Q;  1VF5 C;  3A98 A;  1F2Z A;  3VR6 A;  4X3T A;  3OBW A;  1FYN A;  4A3K B;  4X3U A;  1NE3 A;  4XQJ A;  1SRL A;  4JRK A;  2BOS A;  1S5E D;  4BY7 G;  2LQ8 A;  2VYT A;  3MXG A;  1WJR A;  1WHL A;  5CKE A;  4RH6 A;  2EKO A;  1QUQ A;  3J80 L;  2CGH A;  4HA8 A;  4M4Z A;  1Y1V B;  1VCI A;  5IE8 A;  5C44 H;  3T56 B;  5A0L A;  5M5Y H;  2DY8 A;  2K5N A;  1U4P A;  1Q86 R;  3K59 A;  3HOY H;  1IGQ A;  2DZ9 A;  2NVT H;  2BDN A;  3AFQ A;  1RTN A;  5CIU A;  2FYK A;  2L2P A;  1SNO A;  1KHC A;  2AKL A;  3H6Z A;  1AWW A;  1YHA A;  4ZRZ A;  4FCY A;  4ELY C;  3EBE A;  4JCV E;  5KEE A;  3NTK A;  1KQS A;  1NJI C;  3S15 B;  5CMD A;  4DNI A;  4CC7 A;  3W1B A;  3VS0 A;  1J6Q A;  4A3M H;  4ZCK A;  5FLM H;  1LVK A;  3CMA A;  1CQF A;  5C0X H;  5FRM A;  3TBI B;  2WSF E;  2RJC A;  3QII A;  2VXE A;  3FKI H;  1N5Z A;  5CV5 A;  4S3S A;  4A4I A;  1BB9 A;  2RI5 A;  1VQH A;  4ME3 A;  2M00 A;  1BQQ T;  4DAY B;  1IBL Q;  3EG9 B;  4BDZ A;  4KK7 A;  4ZNX A;  4YHH L;  3V7S A;  4EMK B;  1RD9 D;  1I50 B;  4BB7 A;  3OYG A;  5FWB A;  1KD1 C;  4CKB A;  4GKK L;  4BY1 G;  4A76 A;  2HCC A;  1WTH A;  3NEL A;  4C92 B;  2YUO A;  3OY9 A;  2K5F A;  4LNP A;  3I4N B;  2EJF C;  3NEN A;  4KGV B;  1QCB D;  2TSS A;  3HTR A;  5T1G A;  1CKB A;  1W3S A;  1KAW A;  1TUD A;  3KLR A;  5FRN A;  2COZ A;  4IZ8 A;  5G3L D;  5CBA E;  1Y1W G;  4JI2 L;  4LFB L;  2V1Q A;  5JJZ A;  3G4S T;  3CCM Q;  4JI1 Q;  3TSS A;  1W2B S;  2KYB A;  4JZ3 A;  4HIO A;  2EPB A;  3OB9 A;  1SHF A;  2F2W A;  2HBP A;  2K2V A;  4BE1 A;  4YCU A;  1GHK A;  4XXE A;  2DTO A;  4APV A;  5J22 A;  1CZW A;  2UXB Q;  1SNP A;  4OHJ A;  3TEH B;  1WD1 A;  1TY0 A;  4FF2 A;  1YJ9 T;  1XMQ Q;  2BIV A;  5C5M A;  4DR2 L;  3PTA A;  4PFP A;  3JAM i;  1X6B A;  4IPC A;  4JI7 L;  1Z9Z A;  1GCQ C;  5E3F A;  3A8L B;  1PTO B;  3CCU Q;  2E6Z A;  2NUP A;  1O7I A;  2A0F B;  1Q8I A;  2B2U C;  2KI7 A;  3U50 C;  5IGG A;  5E4W C;  3S1Q B;  1LT6 D;  4A3F B;  2A08 A;  2A8V A;  4JI6 Q;  4FYX B;  4G7Z C;  3NBI A;  2CT4 A;  4C8Q C;  2GBQ A;  2J06 A;  2V8I A;  4LDV A;  2AMC B;  3QHS A;  3V7C A;  3MEA A;  2JA5 H;  2F0I A;  2KDS A;  4AMC A;  1HZA A;  1HTP A;  1ESR A;  2VB2 X;  1GFC A;  5T1I A;  3T16 A;  1QCF A;  2E74 C;  3A7L A;  3NUC A;  2COW A;  2BH2 A;  2L5T A;  2KEA A;  2RN8 A;  1UUP A;  1D8L A;  2CQA A;  4J8Q A;  3K57 A;  4M78 A;  1I6H B;  5GAN d;  1QVP A;  2BZX A;  5IH2 A;  5CYU A;  4RKL A;  3GTK B;  2ZPG B;  4M77 F;  3HG9 A;  4RG8 A;  3L2P A;  4JK1 C;  3K7A H;  3JSC A;  4FYW B;  4FSX A;  5DLO A;  2N55 A;  4PJO A;  4GN3 B;  2I0Q A;  4AYB G;  4L8J A;  3A74 A;  1AW7 A;  4ZKC B;  1YFN A;  2KJX A;  4GNX B;  4JVZ A;  2XID A;  3A1P A;  4KKT A;  5GAM e;  3F2B A;  2EQJ A;  5L23 A;  4X66 L;  3PNW C;  3TP6 A;  1NG2 A;  1NPP A;  2WB1 E;  2EAY A;  5KYW B;  4GOP A;  1VQD A;  1BCP C;  1STH A;  1JOO A;  4V0B A;  3CCS Q;  4POF A;  5J1Z A;  2F0H A;  3FPU B;  4OB2 B;  1VQF A;  3FVQ A;  1VMP A;  2B3G A;  1X3P A;  2B2T A;  4L5R C;  4FXD A;  2YLC A;  5CAI A;  3TP5 A;  4A3E H;  1Q86 U;  3UA7 A;  3BZC A;  4RG1 A;  4J6Y A;  4DXF A;  2ROT A;  4AYB B;  1TS4 A;  4PMC A;  1IW7 D;  4C1N K;  2FVU A;  5CK9 A;  5FK9 C;  5GQO A;  1EY0 A;  4MNO A;  2DJG C;  2ECZ A;  4ZYS A;  3HOZ H;  3R6N A;  3GBQ A;  4M75 G;  1M1F A;  1KQS S;  1O80 A;  1VQ8 A;  2YTY A;  4LF4 L;  1JIC A;  2F0N A;  3VA7 A;  4C3H G;  2E3H A;  4DUZ Q;  1OTC A;  2KVQ G;  1Q82 R;  5CV8 A;  2IVW A;  5GAN g;  4P73 A;  1Y69 U;  1V8Q A;  3S9W A;  1WHK A;  1I0C A;  4OIJ A;  1PH7 A;  5EC7 A;  2E5Q A;  3OS1 A;  3OIQ A;  4JS5 A;  3TME A;  3C2P A;  4DR1 L;  3CCM T;  1RL2 A;  5LMN W;  2JQO A;  4MML A;  1OPK A;  3TZU A;  5GAM f;  1SXT A;  3NWT A;  1NPR A;  1BBU A;  4C3H B;  1XPR A;  2B63 B;  1S5B D;  1YCS B;  5KYX A;  2ZJQ A;  4RCB A;  5LJ3 d;  4KV6 A;  1JOK A;  3G1J A;  1QUQ B;  4FSS A;  1CM9 A;  5I6W A;  1PXU A;  2D9T A;  1TWH H;  2K5I A;  4RUG A;  2M02 A;  4RCN A;  4GS3 A;  2WAC A;  4F88 A;  2A3L A;  2YU9 B;  1WIE A;  2HSP A;  3EGU A;  1MGS A;  3IFT A;  2M0O A;  2HZY A;  4F7U G;  3CCU T;  1SND A;  2K7A A;  1D1K A;  2MPX C;  1TOV A;  3CAM A;  1Y8N B;  1VQ6 Q;  2XRQ D;  2ZGW A;  3HL8 A;  3Q6S A;  3GTG B;  1JU5 C;  2K3X A;  1L0W A;  4P5N A;  3AT1 B;  1EIH A;  1WJQ A;  4PK4 A;  1PKS A;  1G3T A;  2X51 A;  1ZBJ A;  2XKO C;  3C0C A;  2I46 A;  2NYZ D;  4XYQ A;  1HR0 Q;  1M1G A;  3G6E T;  1U4R A;  4U68 A;  2F0S A;  1Z6H A;  4ALP A;  1NAP A;  3X28 B;  3JCM J;  3K7U C;  3QDR B;  1UUE A;  4BBR H;  3REA B;  2I5L X;  2ZM6 Q;  4RTV A;  4X64 Q;  3MXP A;  4K2L A;  2OQK A;  5C6A A;  3PGZ A;  1X27 A;  2QAS A;  2GF7 A;  4UY8 C;  3A8J E;  1RKN A;  1T3S A;  1TS9 A;  2RNA A;  1I4G A;  3T4A C;  1C9O A;  3PGG A;  1M2V A;  3RDV A;  2DPP B;  1H9M A;  3GTM H;  2EYL A;  1R77 A;  2QGQ A;  1I5O B;  4DBH A;  3S14 B;  5EG2 A;  1SAP A;  4I65 A;  3HGB A;  4C0D C;  3O13 A;  3CCS T;  3SFM A;  1K76 A;  3VR5 A;  5C0X J;  3PE0 A;  1AZP A;  3MXN A;  5K36 G;  3SB2 A;  1OUL A;  4RTW A;  4MHE A;  2H4O A;  4TRD A;  4BD3 A;  1IYJ B;  2A6E D;  2XWB B;  3MWY W;  4A3B H;  4XAX B;  1YIT Q;  4DF7 A;  3R6O A;  3C1E A;  4J9B A;  3PIO A;  1V29 B;  1QKW A;  1VQ7 Q;  1GUT A;  1QVF P;  1D1B A;  4OMQ A;  2Q8T A;  4EMK C;  2NUP B;  2Q2I A;  4JJB A;  1Q81 R;  3JB9 D;  3HRZ C;  5GMK h;  3TEE A;  4F7U E;  1PRT F;  2F0T A;  2DIL A;  1V76 A;  2ZPE B;  2A6E C;  2RQX A;  4C92 C;  3BW1 A;  1OU9 A;  2VZA A;  1RLQ C;  2PVG B;  5M5X H;  1UTI A;  4YHH Q;  1VQN Q;  4GKK Q;  3OYC A;  4EDU A;  2VXW A;  1MMN A;  2K79 A;  1I4X A;  4G4K A;  2ZZD A;  1I1J A;  1XWE A;  2OT2 A;  4O2D A;  5GAD C;  2P4T A;  1B4O A;  1QZG A;  3PT9 A;  4F17 A;  1G6P A;  1YJN A;  2DO3 A;  2M9V A;  1Q82 U;  4M7A D;  2K32 A;  3PCO B;  4BA2 I;  4M78 B;  1GVP A;  4ZQ3 A;  4JI2 Q;  4Z02 A;  4EX5 A;  4LFB Q;  3L2V A;  1GD7 A;  4L6V 5;  4GLM A;  2EJG C;  1UHC A;  1LT4 D;  4K6D A;  3G4S A;  3ERO A;  4C92 F;  4DN4 M;  1WLP B;  3JB9 I;  4PJO B;  5GMK m;  3E19 A;  1CSQ A;  3H0G B;  3QXE B;  5BN3 A;  3PO2 G;  3I5R A;  4JZ4 A;  4M7A C;  3M7G A;  1VQ5 T;  1K8A R;  2CKK A;  3MFG A;  4DUY L;  3BDU A;  2X4X A;  4FYV B;  1U3O A;  1OXV A;  1ZA2 B;  2EY2 A;  3I72 A;  3HOX G;  1OXS C;  2FIN B;  2YXY A;  4DR2 Q;  1ABO A;  1LNX A;  5HY6 A;  1YJ9 A;  2E10 A;  4BI8 B;  2ZPF B;  4JI7 Q;  4GOP B;  1R4P B;  4OGE A;  5C3W A;  2RBM A;  1VQ6 T;  2MNA A;  1XJV A;  2DXU A;  2Q8I B;  1SEM A;  1O7Z A;  4ZLT F;  2B2W C;  2K5Q A;  4QQD A;  3GTJ H;  1XX8 A;  1WTX A;  4DQ2 A;  4KLK A;  1SJE D;  1NBE B;  5GAM h;  1X3E A;  2EYJ A;  4J9F A;  2K6A A;  1PTO F;  4N0A A;  2QEJ C;  2I2L A;  4JI4 L;  1I8F A;  4JRQ A;  2VVK A;  2PZT A;  5TSS A;  1I6V C;  4C3I G;  4KH1 B;  3JCM X;  1M8A A;  5C4H A;  4DV7 L;  1YNN C;  4BA1 I;  1YJW A;  4J9C A;  5C3E G;  2MGS A;  3M4Q A;  2L89 A;  1HR0 W; 
#chains in the Genus database with same CATH homology
 1VYT A;  2EYW A;  4D8D A;  2LNH B;  1ZLM A;  2J6F A;  1JXM A;  1NYG A;  2D1X A;  1PWT A;  2ESW A;  2O9S A;  4LE9 A;  2A28 A;  1GCP A;  2KR3 A;  1QWE A;  3SHW A;  4E6R A;  4J9H A;  5ECA A;  1QWF A;  1GFD A;  3ULR B;  3EG2 A;  4F16 A;  3UF4 A;  1TG0 A;  3NMZ C;  4AFQ C;  1UE9 A;  4J9E A;  2DRK A;  3PVQ A;  1SPK A;  2IIM A;  3M0Q A;  1I07 A;  1B07 A;  2OI3 A;  2KRO A;  4OMM A;  2KT1 A;  2CUD A;  4RTX A;  2K9G A;  2AK5 A;  2AZS A;  3VS1 A;  2A36 A;  2H8H A;  2ABL A;  2KBT A;  4HCK A;  2X3X D;  1ZUK A;  1SHG A;  1TUC A;  2AZV A;  1RLP C;  2CUB A;  2LP5 A;  2FRW A;  2PNI A;  3EG1 A;  3VRY A;  1T0J A;  1UJY A;  3REB B;  1PRM C;  2OJ2 A;  5GJW B;  2J6O A;  1H3H A;  2SEM A;  2EBP A;  3VS5 A;  1X6G A;  1GL5 A;  2MCN A;  4JJD A;  3UAT A;  2KGT A;  4AG2 C;  3I9Q A;  1U06 A;  2L3Q A;  1VYV A;  1OOT A;  4AG1 C;  1MV0 B;  2VWF A;  2CH4 W;  1BK2 A;  2HEQ A;  3VS7 A;  2D8J A;  2FPD A;  2XMF A;  3VS2 A;  4OMN A;  1RI9 A;  2JMC A;  1K0S A;  1BU1 A;  2DYB A;  3FJ5 A;  2RQW A;  2LMJ A;  2JW4 A;  1A0N B;  5FW9 A;  1HSQ A;  1RUW A;  1VA7 A;  1XOV A;  3EHR A;  1WX6 A;  4GBQ A;  1AOJ A;  3VS3 A;  2YSQ A;  1UJ0 A;  4Z88 A;  2FPF A;  1YP5 A;  1SSH A;  2DJQ A;  1NEB A;  2DRM A;  4LN2 A;  5GJV B;  4CC2 A;  2JS2 A;  2JTE A;  2CSI A;  1UDL A;  4Y92 A;  2HDA A;  1OEB A;  3O5Z A;  3KFV A;  4WCI A;  1M8M A;  2DVJ A;  2J6K A;  1YWP A;  3EHQ A;  1ZSG A;  2LQN A;  1UGV A;  1W70 A;  3NPF A;  3PVL A;  1KFZ A;  2JT4 A;  1K4U S;  2M51 A;  1M30 A;  1QKX A;  2DBK A;  1ARK A;  1GBQ A;  2PTK A;  1JEG A;  2YUQ A;  2JS0 A;  4J9G A;  1YWO A;  1X43 A;  3EG0 A;  2L3S A;  1MUZ A;  1AZE A;  2NWM A;  2O9V A;  4R0K A;  4A63 B;  2FPE A;  3ZL7 C;  4Z89 A;  2V1R A;  2KT8 A;  2KRM A;  1ZUY A;  1T0H A;  4ORZ A;  2CSQ A;  2L3P A;  3M0U A;  1YNZ A;  1BBZ A;  2GGR A;  2DBM A;  2EGE A;  4LUE A;  3U23 A;  3TSW A;  2K3B A;  3VS4 A;  1T3L A;  1X69 A;  3M0R A;  4D8K A;  2I0N A;  2W10 A;  1V1C A;  2DNU A;  1E7O A;  1UG1 A;  2CT3 A;  3A98 A;  3M0T A;  1FYN A;  3H0I A;  2F2V A;  1SRL A;  2EGA A;  1AWX A;  2O2O A;  2VKN A;  4M4Z A;  1PNJ A;  2NUZ A;  2GTJ A;  1HD3 A;  1WXT A;  1K1Z A;  2DX1 A;  1PRL C;  2LJ3 A;  2YUN A;  1PHT A;  2L2P A;  2AKL A;  1AWW A;  1ABQ A;  3VRZ A;  4HVU A;  5FWC A;  1WA7 A;  1EFN A;  1UHF A;  1M27 C;  2EGC A;  4CC7 A;  3VS0 A;  2QDL A;  3H0H A;  1W1F A;  3THK A;  2RQV A;  2YDL A;  1GRI A;  1M3B A;  1JXO A;  1OPL A;  1B3Q A;  4KRT A;  2KYM A;  1N5Z A;  1BB9 A;  1ZUU A;  1UFF A;  1NLO C;  2J05 A;  2FRY A;  4ZNX A;  1UEC A;  2DL3 A;  5FWB A;  2RMO A;  4HXJ A;  4J9D A;  4OMP A;  1SRM A;  2YUO A;  2JM8 A;  4LNP A;  1G83 A;  1CKB A;  1Y0M A;  1TUD A;  1PKT A;  2RQR A;  1GBR A;  1KSW A;  2V1Q A;  4RTY A;  2KYB A;  4JZ3 A;  1SHF A;  2F2W A;  4Z8A A;  4RTU A;  1K9A A;  1J3T A;  2B86 A;  2K2M A;  1M3A A;  2LJ1 A;  1KJW A;  1X6B A;  1IO6 A;  1NEG A;  1GCQ C;  1Z9Z A;  1AVZ C;  3VS6 A;  2KRN A;  2EKH A;  4EIK A;  2X3W D;  2YT6 A;  2A08 A;  2EVR A;  4CC4 B;  5I22 A;  2CT4 A;  2GBQ A;  2J06 A;  2YUP A;  3JV3 A;  4JJC A;  1GFC A;  1QCF A;  2W0Z A;  2EYZ A;  1K0X A;  1S1N A;  2GTO A;  3CQT A;  3I35 A;  2KEA A;  3H0F A;  2RN8 A;  2BZ8 A;  2BZX A;  2CH4 A;  3SEM A;  5IH2 A;  2PZ1 A;  2LZ6 B;  2GQI A;  1E6G A;  3H41 A;  4HVW A;  2DA9 A;  1AWO A;  2KXC A;  2RQU A;  3QWX X;  3M0P A;  2SRC A;  1LCK A;  1X2Q A;  5L23 A;  5I11 A;  1CSK A;  1E6H A;  2EYX A;  3UA6 A;  1NG2 A;  2FO0 A;  2D0N A;  1FMK A;  2CRE A;  2J7I A;  4RTZ A;  2GNC A;  2EW3 A;  2DL7 A;  5IXF A;  2MOX A;  3UA7 A;  2ROT A;  2ED1 A;  2ECZ A;  2FEI A;  2O88 A;  3TSZ A;  2O31 A;  3R6N A;  3GBQ A;  2M0Y A;  2FG0 A;  2F2X A;  5IHI A;  2P4R A;  2HBW A;  1VYU A;  2DLP A;  2RQT A;  1U5S A;  3TVT A;  1WFW A;  1H8K A;  1I0C A;  2C0T A;  5EC7 A;  1ZX6 A;  4AFU C;  4F14 A;  2DM1 A;  1OPK A;  2K6D A;  4OML A;  2E5K A;  4DEY A;  1YCS B;  3I5S A;  4FSS A;  1WXB A;  4RUG A;  1WIE A;  2HSP A;  3EGU A;  2BZY A;  1GCQ A;  2K7A A;  3M0S A;  5IXB A;  2CDT A;  2C0O A;  1YN8 A;  3NHN A;  1JU5 C;  2KNB B;  4HVV A;  1AD5 A;  5IHN A;  4OMO A;  1PKS A;  1ZBJ A;  3C0C A;  2KXD A;  2LCS A;  4LUD A;  4CC3 A;  2KRS A;  1JO8 A;  1UUE A;  3REA B;  4IIO A;  4RTV A;  4DEX A;  1X27 A;  2D8H A;  2A37 A;  1AWJ A;  2JM9 A;  2DL8 A;  1WYX A;  1T3S A;  2KE9 A;  2RNA A;  1AEY A;  2DL4 A;  3NGP A;  2OAW A;  2EPD A;  4IIM A;  4AFS C;  2ENM A;  1K76 A;  2ED0 A;  1H92 A;  2RF0 A;  1NLP C;  3PE0 A;  4AFZ C;  5IHK A;  1CKA A;  4RTW A;  2C0I A;  2DMO A;  2EYY A;  4J9B A;  1QKW A;  3RBB B;  4OMQ A;  4X1V A;  4K11 A;  4JJB A;  3EG3 A;  4QT7 A;  2DIL A;  4JPB W;  2RPN A;  2JMA A;  1WI7 A;  1RLQ C;  4ESR A;  3RNJ A;  1UTI A;  3IQL A;  2JXB A;  2ROL A;  1X2K A;  2K79 A;  1I1J A;  5HCK A;  1OV3 A;  1AZG B;  4F17 A;  2MIO A;  2L0A A;  1HJD A;  1QLY A;  2DF6 A;  1Y57 A;  1UHC A;  1JQQ A;  4GLM A;  4RTT A;  4J9I A;  1WLP B;  1Z9Q A;  3I5R A;  4JZ4 A;  1NM7 A;  2LJ0 A;  2LX7 A;  2DL5 A;  2LQW A;  1M3C A;  1U3O A;  3QWY A;  1ABO A;  2G6F X;  1MV3 A;  3LH5 A;  1WDX A;  2HCK A;  1SEM A;  1KIK A;  2AKK A;  4J9F A;  1NYF A;  1W6X A;  2VVK A;  2BTT A;  1WXU A;  2DE0 X;  4J9C A;  1G2B A;  2EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...