2QDLA

Crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
154
structure length
154
Chain Sequence
KHHHHHHPMPKKIVVFSLAEELYGLDIFDVHEVVKDVSITKIPETPEFIEGIINLRGKIIPVIDLKKRFGIGKRGKSKDSRIIIVEILGQKAGLIVDAVHEVIPIDENSIEPPPPVTTIDTAFVEGIAKTDDKMIIIIKLHFLFEVNGKEMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of scaffolding protein CheW from thermoanaerobacter tengcongensis.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Signaling protein
molecule keywords Chemotaxis signal transduction protein
total genus 25
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2qdlA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2qdlA02
1NG2A 3EG3A 3ULRB 2O88A 2LX7A 3VRYA 2CREA 1SRMA 4AFQC 2RQVA 1NLPC 1G2BA 2LJ1A 2VKNA 2LZ6B 1UECA 2PTKA 5IXFA 1H3HA 2ED0A 2DA9A 2OJ2A 2DF6A 2LCSA 1LCKA 3UA7A 1GBQA 1GCQC 1UHFA 1ZSGA 2JW4A 1M3CA 1PRLC 1T3LA 1U5SA 2KXDA 3NMZC 4J9IA 1WIEA 1MV3A 1JXMA 2DJQA 3I9QA 2MOXA 4J9HA 2JMAA 1GRIA 2O31A 2DRMA 5FWBA 4JPBW 1UJ0A 2D8JA 1ZUYA 2A37A 1SSHA 2KGTA 3NPFA 5EC7A 2JTEA 1T0HA 4JJDA 3RNJA 1AVZC 2AK5A 2KRNA 2K3BA 3NHNA 2F2VA 2BTTA 2EQIA 1OV3A 2A36A 2RPNA 3JV3A 2HBWA 2DM1A 4AFSC 1JO8A 1Y0MA 2VVKA 4JZ3A 2DRKA 2CT4A 2FG0A 1M27C 1WX6A 2AZSA 4GBQA 5HCKA 2DYBA 2LQWA 1SPKA 4IIOA 4D8DA 2KRSA 1RUWA 2ROTA 2DBMA 2DX1A 3EGUA 4OMMA 2GBQA 2V1QA 2K9GA 1N5ZA 4RTYA 2FPDA 3SEMA 1VYVA 3M0PA 1Z9QA 1KIKA 2SRCA 3R6NA 4DEYA 1PWTA 2GNCA 2RQUA 2HEQA 1K9AA 1UFFA 4HVVA 2L3PA 1WXTA 1E6HA 1ABOA 2FRYA 1VYUA 2CH4W 1AEYA 1ZUKA 1WLPB 1WYXA 3I35A 1ZBJA 1V1CA 5IH2A 5I22A 2AZVA 4F16A 4J9BA 1SHFA 1HJDA 3EG1A 4AG2C 1AWOA 1UUEA 2J7IA 2GQIA 1AD5A 3TSWA 1AWWA 1AZEA 2A28A 2JT4A 1I1JA 2A08A 2M51A 2E5KA 2G6FX 2W0ZA 2PZ1A 4X1VA 2OI3A 2EGEA 1UE9A 4M4ZA 3THKA 2DBKA 2J6KA 2EPDA 2ED1A 1GL5A 2C0IA 4R0KA 1ZLMA 1X6GA 1RLPC 2FO0A 2KROA 1UDLA 2CDTA 2MIOA 2JS0A 2D0NA 4AFZC 4J9CA 3U23A 1U06A 2KYBA 1ZUUA 3VRZA 2GTOA 2MCNA 5IHIA 1NLOC 1SEMA 1CKAA 2ESWA 2PNIA 2JM8A 4EIKA 1OPLA 1EFNA 1Z9ZA 2GTJA 2KYMA 2EYXA 1VA7A 1PNJA 2IIMA 1X2QA 2NWMA 2YUQA 1U3OA 3A98A 1H8KA 3EHQA 2GGRA 4HXJA 1TUCA 2JXBA 2O9SA 3I5SA 2K79A 2DL7A 2CUDA 1K4US 4F14A 3TSZA 4LUEA 3UF4A 2EYWA 4DEXA 4LE9A 1GCQA 2RMOA 5GJVB 3CQTA 2HDAA 4D8KA 3H0IA 1WFWA 3NGPA 3ZL7C 4F17A 1B3QA 1BB9A 1H92A 2SEMA 2LQNA 2YSQA 1T3SA 4OMOA 2F2XA 3VS7A 4E6RA 2DVJA 1UJYA 1GFCA 1NM7A 3VS0A 1W6XA 2KT1A 2X3WD 5GJWB 2NUZA 1KSWA 2LNHB 1UTIA 3I5RA 1ARKA 1WXBA 1M8MA 1IO6A 4Y92A 4AFUC 2YUNA 3O5ZA 3PVLA 2YDLA 4K11A 1GCPA 3VS6A 1M30A 3M0QA 3UATA 5IXBA 4J9FA 1FMKA 2DL5A 2CSQA 5FWCA 1QKWA 1T0JA 2RNAA 2EBPA 2L3QA 4ZNXA 1SHGA 1PKTA 2DMOA 1NEBA 2C0OA 4RUGA 2D8HA 3VS4A 2DL8A 1AWJA 2XMFA 1K76A 3REBB 2YUPA 1JXOA 2RN8A 1Y57A 2D1XA 3LH5A 2FEIA 1E7OA 3M0UA 2V1RA 3M0RA 1KJWA 1WDXA 4CC4B 4RTWA 2AKKA 3VS1A 1UG1A 2KXCA 2LP5A 4A63B 1QKXA 1RI9A 2J6FA 2O2OA 2EGAA 1XOVA 3QWYA 4LNPA 1E6GA 5IHNA 4GLMA 2B86A 2J06A 5FW9A 4Z8AA 1GBRA 4JJCA 1JEGA 5L23A 2DNUA 1YWOA 2CT3A 1A0NB 1QCFA 2YT6A 2FRWA 2KR3A 4CC3A 4RTXA 2J6OA 2JMCA 2C0TA 1OEBA 2L0AA 4CC2A 2OAWA 1AWXA 1BK2A 1QWFA 1NEGA 2L2PA 1OPKA 2FPFA 5I11A 1YN8A 2RF0A 1WA7A 4LUDA 1JU5C 1UHCA 4OMPA 1K0SA 2RQWA 2DL4A 2O9VA 1PHTA 3M0SA 4IIMA 2AKLA 1K0XA 2VWFA 2LMJA 1BU1A 2EW3A 4CC7A 3VS5A 2I0NA 4RTTA 4HCKA 3VS2A 3GBQA 1NYGA 2DLPA 2LJ3A 4OMQA 2ABLA 2BZXA 2EVRA 2F2WA 1QWEA 3KFVA 2QDLA 1BBZA 2EYYA 4OMNA 2J05A 3QWXX 1KFZA 1X27A 1W70A 1M3BA 2KE9A 2P4RA 1TG0A 5IHKA 1PRMC 4RTUA 2HSPA 4Z88A 1B07A 3VS3A 3RBBB 4OMLA 1OOTA 4J9GA 2ECZA 1ZX6A 2FPEA 1I0CA 3PE0A 2W10A 1M3AA 2ROLA 1HD3A 3H41A 1FYNA 1YCSB 1QLYA 2EKHA 2JS2A 1NYFA 1MUZA 2CH4A 2K6DA 2EYZA 2RQRA 3IQLA 1G83A 4JJBA 3FJ5A 5ECAA 1ABQA 1MV0B 3EG0A 1CKBA 1UGVA 4HVUA 1X6BA 2K7AA 1RLQC 1I07A 4HVWA 4Z89A 2HCKA 4J9EA 2L3SA 1YWPA 3REAB 1X69A 4ESRA 1YP5A 1X2KA 2K2MA 2RQTA 2BZ8A 3SHWA 2JM9A 3UA6A 1YNZA 2KBTA 2CSIA 1J3TA 1S1NA 4RTVA 1HSQA 2KRMA 2CUBA 1AOJA 3PVQA 1W1FA 1WXUA 3TVTA 1GFDA 1X43A 1VYTA 4ORZA 1AZGB 2ENMA 1SRLA 4QT7A 3H0HA 1PKSA 3H0FA 3EHRA 3EG2A 2YUOA 4WCIA 2DE0X 4JZ4A 4KRTA 4RTZA 2KNBB 4LN2A 1JQQA 1CSKA 4J9DA 1TUDA 2EGCA 2KEAA 4FSSA 2X3XD 2KT8A 2LJ0A 2H8HA 3M0TA 1WI7A 4AG1C 3C0CA 2DILA 1K1ZA 2BZYA 2M0YA 2DL3A
chains in the Genus database with same CATH superfamily
1NG2A 2ZCFB 3BE3A 1K9MC 1K3BC 3WOFA 3GTMB 1VQLQ 2Z0WA 2RQVA 4OIJA 4A3IH 3HOXH 2JVVA 2LZ6B 2D62A 4KGZB 4L5TA 2A6HC 2PTKA 4M7AD 2YRVA 2DA9A 1EY0A 1SFOH 3L2ZA 1BOSA 3EH2A 3MXNB 4H13C 1KD1U 3CCSA 2ZJRA 4A3DB 1GBQA 3CEYA 1TS5A 5KEEA 1GCQC 4JI2Q 4LF9Q 1PTOD 2WSCE 3DUZA 2EYOA 2RM4A 5GANh 2RBMA 3QDFA 4I65A 3L9AX 1NR4A 2VXFA 2XD0A 3MXPA 1U4PA 3AHUA 2EJGA 1G3WA 1M3CA 1KQ2A 2Q8TA 2QQBA 4ZTJA 1G3YA 1SKUB 3V2TA 1GO3E 2Y0SE 4JLGA 3NMZC 4QW2A 5LL6S 4V0BA 2HKQB 1N36Q 2FZGB 3AYHB 1WIEA 1F9SA 4UHVA 1WQWA 4J7IA 4WF2A 1N8RC 2IL8A 1MV3A 1MMDA 1HA5A 3EFOB 2MOXA 3C12A 2F0NA 4IFDJ 5CORA 1IBLQ 3C46A 2HT1A 1DD2A 2JMAA 1YHQT 2WKDA 2R93G 2DRMA 1VQ6T 4LAAA 2JZ2A 4JPBW 4L6TB 1UJ0A 1KD1C 4OGEA 3FIFA 4JI7Q 1ZUYA 2A37A 3VR4A 5LL6X 1VCIA 2HHHQ 2JSOA 5EC7A 2PYKA 2G5DA 1T0HA 5LJ5d 2BH8A 2KRNA 4C2MH 2DZCA 3MVVA 1YJNQ 1K8AC 1QB5D 2A68D 3EBEA 4X66L 2A8VA 2L89A 2BTTA 5IGEA 4A93B 4XDXA 1ZKOA 2XIDA 1GXIE 4A3FB 2D0QB 2CP5A 2PZWA 3AFQA 3VR2A 2UXCL 2KJXA 2NLUA 3DWQA 3PMIA 4NL2A 2VVKA 3RLOA 3E3XA 1XX8A 3K5LA 1NY4A 4DOVA 1SYGA 5GADC 3V8KA 1OX9A 4ALPA 2MWOA 2LQWA 1EY5A 1HZCA 4M77G 4YWLA 2MPMA 1JB3A 1M1KC 1WJQA 3L2RA 4K2LA 1EL0A 2KRSA 4AIMA 5M9OA 4NW2A 1I8FA 2FMCA 2MMPA 5J1ZA 3AT1B 4BWGB 2Z4HA 1TTHB 4OMMA 4IN3A 5M3FG 1WTOA 1JB0E 2GBQA 3ICEA 4N9PA 1KAAA 1N5ZA 5EG2A 4RTYA 2DVEA 4PJOA 3PT9A 2UXDL 2NVXB 2B8AA 3SEMA 2SEBD 1U1TA 4PNYA 2QCPX 3GV6A 2IT1A 2UU9Q 2R92B 3D7SB 5JJIA 2K1BA 2SRCA 1KDAA 1B2TA 4DUZQ 1OYXA 2GNCA 4JK1C 1XPOA 2PVOB 2RQUA 3QJYA 2NYSA 1UWVA 3J7AF 1W3SA 2PW5A 4A3IB 1BCMA 4L5QA 4POFA 1G8XA 2HDMA 2MI6A 4QQ6A 3FRPB 3GQBA 5T1GA 4DV4L 1AZQA 1VYUA 1RDPD 2EJMA 3EG9A 3MHXA 2CH4W 4FIBA 1T5EA 2C9OA 2WB1G 1ZUKA 3NXWA 3OSOA 3CCUA 2BE5D 1Q95G 1H3ZA 2JA6G 2CS7A 4XU3A 2P0QA 5C44B 5IH2A 3GTQH 3RLNA 1A2TA 3E0EA 5CV6A 2RSNA 2XDDA 1N9WA 2EY5A 3NTIA 2EJFA 1M9SA 2RH2A 3O8VA 4HSPA 4K6LA 4JYAQ 1B4OA 2KY9A 1UUEA 3OYBA 2PQWA 4M78F 2J7IA 3HRUA 4JRPA 1Q82U 1MI2A 4RG2A 4C3IG 5LJ5f 1Y1WG 3GIBA 1UEAB 3I4MB 4L5GA 2R7FA 5I21A 4ZTFA 2DYIA 1S3OA 2EYJA 2F3IA 3TBIB 3QO3A 1AZEA 4CJ0B 2K5WA 4DAVA 1N33L 2CKZB 2NZ1D 2JT4A 4MNOA 2M51A 3JAME 2L12A 4C92C 4CBVA 4JBMA 3L2VA 2IX1A 4FL6A 2IY5B 4X1VA 1G2SA 1Q3LA 2MJ8A 5CBEE 3FLGA 3JCMP 2EDGA 1I5FA 1PTOF 5IT9L 1SE3A 3K58A 1PG5B 1B7YB 4HR7B 2E41A 2YLBA 3LX7A 2F0VA 4LF5L 4JI8Q 2VB6A 1HQRD 3ITPA 2J6KA 2K28A 5IP7G 1OULA 2NZHA 4F7UF 4K5WA 3QSUA 2JP1A 3K81C 4AYBB 4LMQD 5EKKA 2VUMB 5CQYA 5I2SA 5C44G 3CHBD 3DWAA 1MIUA 3OY9A 4M77C 4BBSH 2FO0A 5I2MA 4GLVB 2CDTA 2CGHA 2MIOA 6AT1B 1WCMH 1X54A 3S17B 1O75A 1VUBA 4J9CA 2AHOB 1U06A 1YNND 3OOCA 2KYBA 5C0XJ 2HBPA 3K57A 3GTGH 2WIIB 1S5BD 4DV4Q 1Q1BA 2XGTA 1EOTA 5KYYB 2UUCL 2LDMA 3D6CA 5DM73 2KENA 4TSSA 4V190 2MCNA 5ISRA 2OWOA 3RUXA 2DZ9A 4KTAA 4RA8A 3V8JA 3JRZA 3TSSA 3W5OA 1JRIA 2ESWA 3BJUA 4J1MA 2E3IA 4XAXB 2JM8A 2L55A 4KUDK 1UNSA 1Z9ZA 5LJ5e 4BI8B 5GAMj 1LTID 2GTJA 2HL3A 2KYMA 4BDZA 2OTLT 2R6GA 1BI0A 1QCNA 2JA5B 4C3HB 2IIMA 2NWMA 3A0JA 3BYYB 2D9TA 3NBHB 1X9NA 4IPDA 5IWAQ 2YUQA 1Q8IA 2TMPA 4GKJL 5DM7R 1M8VA 3CCEQ 4FCYA 3G71T 3I5SA 2JXBA 4UC4A 2LMCB 2DL7A 2CUDA 3I4NG 5FU6B 2LQKA 4QUCA 3HKSA 5HGTA 5AJ3Q 5C4JH 1PA6A 5CKEA 4NXNQ 2HMAA 2BA0A 2RVLA 1GCQA 3X20B 5C4XH 2RMOA 2WV6D 4GLKA 2HDAA 1SMXA 1ZSZA 1EWHA 1YJ9Q 4D8KA 4DR2Q 2L15A 5C0XH 1ZSZB 1KD1R 1KHIA 2K5HA 3BVGA 3OS1A 3NWTA 1ET6A 4B6MA 1A6XA 4CJ1B 3NGPA 3GTMH 2ICEC 2R7ZB 3ZL7C 4HCEA 1DOMA 4XIGS 3P8BB 1P8LA 2F03A 2E2IB 2EY2A 3URYA 3OYDA 5A0LA 4GN5A 1CM9A 3UE0A 1YVCA 3HOXG 2KMTA 2EFIA 2Y0SB 1B3AA 1T3SA 1OZ2A 2OCEA 5LMNL 2P0PA 3G6EA 2RCNA 1BCPF 2N49A 4OIKA 5GAMf 4Y7NH 4Q5VA 3B6YA 4A4GA 3D31A 3J7AV 1UJYA 2A7YA 3VV0A 1NM7A 2NVYH 8AT1B 3EVQA 5FJ8G 3T1HL 1W6XA 2KT1A 5C3WA 3NBHA 2N78A 4PK4A 4FF2A 3D6WA 2RHQB 4M7DE 1ARKA 3CC4T 1NE3A 5FU6C 1HTLD 1SYEA 3NFCA 1PH7A 4AFUC 4M7DF 1V1PB 3BZDB 1TWGB 1WJRA 1R0BG 3FJPA 4GN3B 4XU0A 5E1FA 2NVTB 4R56A 3M4QA 2M2LA 4JI1Q 2OTJT 3VS6A 2E12A 2VGMA 5GANe 1QNKA 3PO2H 1K8GA 5BR8L 5IXBA 3HOZB 2PI2A 4J9FA 1WCMB 3S17H 1HCZA 2FZKB 2NUTB 4A3IG 2RNAA 2L3QA 1I5LA 3E2UA 3JCMJ 3C3LA 1SHGA 2E2JB 4B08A 2C0OA 4C2MB 3LX0A 1YITA 1EOVA 1D2BA 1G6ZA 4CKCA 1CSQA 3OYIA 2XMFA 1I3QH 1X32A 4FYWB 1VQAA 3OS0A 2OT2A 5ELFA 3FRNA 3REBB 3PO3B 4GOPB 3QOJA 3CCQQ 1NPPA 5JAVA 4LWCA 2RN8A 1I50H 2MGSA 4O5VA 1Y57A 3OYFA 2DUDA 5EJWA 1KC8U 3TN2A 2JA5H 3QIIA 3OS5A 3P8DA 1WTQA 1I94L 2FEIA 3CD6Q 1AZPA 1K3RA 3IL8A 4A3BH 2LXKA 3BZKA 1I81A 2EYQA 2K33A 1TWFH 2HHHL 2KK4A 4PKCC 5DAUA 3S15H 1TWAB 1OQKA 4DV6L 1JICA 4RTWA 5IAYA 4EQNA 3VS1A 1PTOB 1O78A 2A6EC 2KCNA 3K8AA 5ELDA 1WTRA 2KXCA 3FDTA 3X24B 4A3CG 3FDRA 4L59A 2FMMA 2UXCQ 1MSGA 4G4KA 3CCST 4HAEA 2KSSA 4OX9L 5FLMG 3QWYA 1EY4A 4GLMA 1VQMQ 5FW9A 4DUYL 3PIPA 1YJWA 4ME5A 5C0XG 3PGZA 2P0KA 4JJCA 1PFMA 2QTXA 2PW7A 4IPGA 2DD5A 4A3LG 3A54A 5M3FH 4B9WA 2WINB 4A3KG 4C8QA 1RTNA 3S3OA 2COWA 2R93H 2PQEA 2GA4B 3HL8A 3CXCP 4A53A 3HSBA 1FGBD 2J6OA 2JMCA 2O01E 2CZ6B 1VQ9Q 1JJ2P 5C0XI 2ATWA 3HOXB 4I7ZC 4KGXB 5E4WC 1AWXA 1ILQA 1XJVA 3A8JE 2NVYB 2UU9L 2XG8D 1TWCB 3CBPA 3RKXA 4KK7A 4E6IA 5JJKA 2A3LA 4GNXA 1WGSA 4XQQA 1CZGA 2GCXA 1FJGQ 2HIVA 2RKSA 1XJWB 1IBKL 1IKMA 4IUTA 1H9KA 3PQIA 2RF0A 1WA7A 1E2VA 4LUOA 4LUDA 2RK2A 4F88A 5FRNA 1N8RR 4EX5A 2UXBQ 3JCMe 4RCNA 2RQWA 3MP6A 2DL4A 2O9VA 4DNRB 1SNCA 3M0SA 1TY2A 1UUPA 1M1FA 2ZJQA 4II1A 1KC8R 2PUOB 4ZGJB 2QEXA 1DCZA 4KN4C 3VYRA 4XTXA 1VQ9T 4A3DH 1HTPA 1IL2A 4NP5A 3RMQA 1LM0A 2LKVA 5KH6A 1IYUA 4PJJA 3ZFJA 2B2YC 2C5CA 4F8MA 2EW3A 2YLCA 3VS5A 4GLXA 5C4XB 1BVSA 4O2DA 3OTOQ 3HTRA 4BY7G 4C92E 2B8GA 2DLPA 4OMQA 2LX9A 1QVFP 9ATCB 1BBUA 2MO0A 3J81E 2F0DA 1EYGA 1QWEA 4U68A 4AT1B 2OEOA 2A69C 4HIMA 4ULLA 2EYYA 2PNHA 4OMNA 3PV0A 1FJGL 4KY7A 5GQOA 1X27A 3CCSQ 3QDRB 2E2IH 1R8OB 3LWUA 3CCEA 1YI2T 2CWPA 3T1YL 5G3LF 5IHKA 2PVGB 3Q1JA 1PRMC 3D4WA 2MUYA 4HIKA 4RTUA 1G291 3DLMA 3VS3A 1B07A 1JJ2S 3PF5A 2XU8A 1E22A 1HR0Q 2R58A 1AFPA 2XRQD 1SSFA 2FZCB 4BBSG 1OOTA 4N0AA 4C8QD 1BCPD 2FPEA 3PE0A 4JBWA 2DK3A 1VQOT 4A93G 1PZJD 3PFSA 2YTVA 1JE4A 4J6XA 2YTXA 4A3CH 1YCSB 2EKHA 1S72T 1PDQA 3RMSA 2CP7A 1CKNB 1J5EQ 2UUCQ 2JS2A 1TY0A 5LJ5j 5J22A 3UDGA 1L1OC 2DIGA 2H3EB 2RQRA 4DBQA 4E7KA 1Q7YU 3X26B 3A8MB 4F7UB 1K0RA 2RCFA 2X6LA 3EGDA 4KKUA 2EJGC 4JI5L 3GTPB 4P75A 3E9HA 4A4EA 1DYQA 3JCMh 1M2VB 2XKOC 2K7AA 5LJ5g 1VQ4A 2OX7A 5LJ3f 2ICIA 4C0DB 1EIGA 1QOHA 4WJWA 5FKAC 4QUFA 4FYVB 4J9EA 1B50A 1ESFA 2QEXT 2JEAI 4PZ8A 1NTGA 1KL9A 5LMUL 3SHWA 1RADB 1CQFA 4O1NA 4I7AA 1RAIB 4XQJA 3LGFA 3CC4Q 2CSIA 4QF4A 3U4VA 3KJPA 3E5SA 4NOYA 1HSQA 2CUBA 2NVXH 4JI4Q 1KDCA 1SROA 1AOJA 4KUIA 1WXUA 2KEEA 3HOVB 4J5YA 2B2UA 4ORZA 2QQRA 3URGA 2GN5A 1VQ5T 2JYOA 4RCOA 4MMKA 2KHJA 3G6JB 4PJOG 1W2BP 3OBWA 1BQQT 1PYSB 2MQHA 4BBRB 1SRLA 1S5ED 4PMCA 1UGQB 3H9NA 2FINB 3T9NA 1AHJB 1EX4A 1VQCA 5I2XA 2B3GA 3H8ZA 1N33Q 4C5EA 2Z0SA 4FXGC 3CU7A 1JQQA 4ID6A 2RI2A 2EGCA 3MAQA 3A8OB 2CFMA 2KT8A 2M00A 3OYEA 4CKEA 5H1SE 2E65A 2NUPB 1RD9D 2K50A 1KRSA 1IRXA 3S2DB 3MXGA 3LW5E 3V7RA 4NKLA 1IBKQ 4HT9A 5D6WA 1HPCA 1O7IA 1JOQA 1BCOA 5KCOA 1BNZA 1WJSA 4JI5Q 5LJ3j 4O6JA 1MMNA 1X56A 4POGA 1YJ9T 3OMGA 3MKDA 5GAGC 2D2CC 4IFDI 4ODGA 2MP1A 3F2DA 3CCVA 4M7DC 2DAQA 2L5QA 2Q2IA 5COYA 3KUFA 1NLPC 4ZRZA 2LJ1A 4X9DA 3CCLT 2P84A 5IXFA 1BBWA 1GOZA 1OXSC 1H3HA 4FM4B 4X62Q 2F0EA 3SK5A 4R8NA 4F7XA 1SYDA 3AU7A 4LFCQ 2LCSA 3U4ZA 2Z1CA 1PSFA 1JB7A 5GANg 1NMGA 3UA7A 3RNUA 2F52A 5E4XA 5HKCA 3C94A 1W2BS 3OHXC 3GP8A 1CK1A 3HFZB 5KGUA 3VYUA 1F2ZA 1DJ7B 1ZSGA 1WD0A 1C0MA 2LNVA 3ONAB 3HOUG 3OSVA 4XYOA 1N32Q 4OX9Q 3EGXA 2OQKA 1U5SA 3CCRA 1T3LA 3L2QA 4CKBA 4A4KA 5KE2A 1QNUA 3HS0C 2PNRC 4J9IA 4C3HH 4A3FH 2BIVA 4D6WA 1YHQA 3CMEA 5K36G 2DTIA 1OU9A 4LFBL 3TP6A 3I9QA 1YIJQ 3I7FA 2A69D 3C1EA 3KXTA 1QVGA 4NL3A 5EPJA 1VQLT 1JOOA 1O7LA 4MDXA 2WFWA 4LDYA 1PVOA 3CCMT 1N36L 2EWNA 2PQAA 2BH2A 3HOWG 2DEUA 3OA6A 1SEBD 1CHPD 1TH7A 2K52A 4DN4M 2JNGA 4K0KL 1LTAD 1BXTA 3KF6B 1RODA 2JTEA 2EQKA 1Y1VG 1XXGA 5M3FB 1WPYA 5D14A 2ZPHB 4G7ZC 4DK3C 3NHNA 2F2VA 5A2QE 3MHBA 1I6HB 1EFWA 4JI7L 2JTFA 2EVBA 2A36A 2RPNA 1VQGA 4BY6C 5CCAA 2WP8J 1WCMG 4LF6Q 4M75G 3HOVG 2HBWA 1FNVA 1TVXA 1YJ9A 1YNNC 1ONLA 2VY3A 4QJFA 1PYBA 4M77B 4HA8A 5IT9E 1V76A 2DO3A 3UWNA 4JZ3A 2CVRA 3JCMd 2FG0A 3SWNB 1WX6A 2KHSA 4X62L 4K8IA 5IP7H 1T9HA 4JI2L 5ELNA 1HRJA 1SPKA 4IIOA 2MK5A 4DR5Q 2XN9C 4RMOA 4Y28E 5CBAE 1M90U 1QVFA 1H9SB 4OELB 4XTUA 4EGVA 5JVH3 4A76A 1N32L 3WVDB 3SXHA 4EMKC 2RDHA 3S2HH 1QUQA 2LFNA 2Y0SG 1B9MA 3J81c 2BA1A 1VYVA 3M0PA 1Z9QA 3S1QB 2QEXQ 1OXVA 1PH8A 4DEYA 2VUBA 2WB1E 5FOBB 1YHAA 2ZPFB 1HQMC 1QP2A 5FJ8H 4A3JH 5LMNQ 2OQ0A 2LQ8A 2IVWA 1DOKA 2L3PA 1WXTA 3JCMg 1ABOA 2HQHA 4DV2Q 5KYIA 1EYCA 1NNXA 3KYHC 1HZAA 3HPWA 1G51A 3HP9A 1PH3A 1M4VA 3V96A 1E3PA 3V7CA 1JT8A 4ME7A 1V29B 5A35A 1UE7A 2E6NA 2C06A 1RAFB 5I22A 1PV4A 3I4NB 1C8CA 4XTCS 4DU9A 1LO5D 2F4IA 4K5VA 1ASYA 2K7VA 4A3DG 3I2ZA 4PZ6A 1U8RA 4MTKA 4OEMB 4X65L 1NUCA 3GOXA 2CWAA 5DLQE 2KA7A 3H0GB 3MEHA 1AD5A 2AIRB 3P7JA 4X3TA 4APVA 1BBXC 1HNXQ 5C3EB 1M1KR 1VQKQ 1AWWA 1EWCA 4DR3Q 3I91A 5TSSA 1SNOA 3GTGB 4M77A 1YJNT 3EG9B 2M9VA 2JTMA 3LYIA 1VQOA 2IX0A 3MZ5A 1BYMA 4P2CB 4XTWA 5GAOp 3HEJA 5FROA 1SJHD 3NENA 3CPWP 2QA4A 1B70B 4LF8L 2DBKA 3STBD 2RA4A 1D1IA 3HRTA 3GTPH 1G2TA 3GTLH 2EPDA 3CCMQ 1Q81U 1U9RA 3CCVQ 3P8HA 1TWAH 3L42A 4FYDA 2NVQB 4XU1A 5C4ZA 2QW7A 4OGQC 1KG1A 3RN2A 1D5XC 1S5FD 4H0LC 2Q2TA 2F0FA 2JS0A 1J5EL 1FMWA 3U23A 2KQWA 2VS1A 1C9OA 4Q5WA 2JA8H 4A3EG 1WHGA 4DV2L 1HA6A 1K9MU 2NN6H 1KLUD 1PH5A 1JORA 2NZOA 4HJ8A 2FXQA 4HCSA 5FU7B 1SAPA 4B3SL 3CD6A 1VQKA 5IHIA 1YBYA 4R1JA 5FLMH 4N4GA 1KRTA 1RI0A 2OTLA 2K5DA 2FL7A 4X3SA 4EIKA 3S1NB 1OPLA 1EFNA 2ZM6Q 4M78A 3PUZA 2LTOA 2ZTDA 4HJ9A 3N52A 2O5JC 1VA7A 2WACA 1PNJA 1YITQ 1B1ZA 2K04A 4J6YA 4OB2B 4C3IB 3C95A 2RHYA 2PMZE 3AB9A 4C92G 2J0TD 3INZA 1EZ8A 4JI1L 5M5YB 2GGRA 4DR6Q 3Q8DA 1TUCA 3KF8A 3BFMA 3OYYA 4A3GH 2VQEL 1K4US 3HFNA 4HSVA 4F14A 3TSZA 2R7DA 3N5BB 4UAIA 4OP0A 1LV9A 4BY1H 1D1AA 2FYKA 2M02A 4LE9A 5CKHA 1D6EC 3NSWA 3QKJA 5GJVB 3R2IA 4LF8Q 3F2BA 1G8ZD 5GAOn 1Y96A 2XK0A 5IYDH 2ZAEA 1H9RA 3WWVA 2YV5A 4X64Q 1WFWA 1STGA 1IGQA 2JN4A 3OWEB 1M90C 1Q86R 3A55A 3LNNA 4YWMA 3BS1A 4M7AC 4IJHA 1K8AR 2XICA 2DTHA 4BDYA 2FJ2A 3HKZB 4ZAIA 2KAFA 3QXEB 2TSSA 4DBFA 1DOLA 1JBMA 1QUQB 1CI3M 1TS2A 2JA6H 4C8QB 1H92A 2H3JA 4BY6B 4JI3Q 2LQNA 2H4OA 3NPPA 2YSQA 4TKOB 5JEAJ 2NVTH 5FO7B 2F2XA 1KNAA 1ICFB 3PO2B 1DZ1A 3NUCA 1LTSD 4E6RA 3FHWA 2QGFB 1ZEQX 4R8IA 2F1LA 1QVGP 1WHKA 1GFCA 1A2UA 3E9GA 1VQ6A 2EYLA 3D8GA 3H0GG 2X3WD 3IRBA 4LFAQ 4C56C 1C7YA 4A3JG 3PO3G 1PRTF 4R55A 1JQYD 1TS3A 4C5IA 4PJOC 1Q90A 2KOLA 1EY8A 3G4SA 1B34A 1V1OA 1M1KU 2Z6BA 3G4SQ 3MPUB 4CI0C 2XNAC 1WXBA 3BZCA 1K9MR 4FO2A 1M8MA 4QY7A 1W2BA 1IO6A 1SMYD 5AYFA 2CQAA 3M57A 2EYPA 2N55A 5GAEC 3PVLA 1KNEA 5DEHA 4H7BA 3U9OA 1E1TA 3NTKA 4C3JB 1V1PA 3CCRT 1GCPA 1TU0B 4YHHL 5AJ3L 5E3FA 1PSEA 3UATA 4PL6A 1SYBA 1ZBXA 1KQSS 2PMZB 1WFQA 2DL5A 4XT1B 5FWCA 2AQ1B 1T0JA 5K36H 4ZN1A 2JA8B 1JR0D 4PJOE 4BA1I 3K0YA 5IGFA 1PD1A 2K5QA 4DV0L 2YRDA 3FP9A 4JI6L 4YCVA 1YI2Q 2DL8A 2WB1B 1AWJA 2VC8A 4TVRA 5EPLA 2D0OA 3VYTA 5IT9c 1K76A 1O7YA 4K14A 4LFBQ 2F0SA 2YUPA 3HOYH 5IOCA 5CMDA 1BIBA 4L5SA 2YTYA 2PQAB 3EROA 1HR0W 1JWMD 3K80C 1ENAA 4DK1A 3LH5A 4KH0B 3D3RA 3HOVH 5DLOA 1EZ6A 1U5KA 1E7OA 3MFGA 2NB0A 1R77A 5C5LA 2IG0A 4PLLA 4M7AE 2B2TA 2Q2HA 3QWNA 4GOPC 3QYGB 1KJWA 1VQ8A 2G9HD 5M5YH 1ML0D 1CA6A 2K3XA 1X65A 1BDOA 2K6AA 2QQ9A 1PRTD 4Q0FA 3NELA 2RJDA 2O5IC 4M7AG 3WDNA 4E7ZA 3OIPA 3MTSA 1ET9A 3I73A 4B3TL 4BY7B 2LP5A 5AT1B 3V8LA 1X6OA 1C48A 2ENBA 1RI9A 3KF8B 4LF6L 1SFOB 4ILWA 4C3JG 3PNWC 2J6FA 2KEDA 3RN5A 3NTHA 1IW7D 5CV4A 3K5NA 3BDCA 4DV6Q 1L2FA 5DM63 4C3HG 1IHWA 1OXXK 3MP8A 2B39A 1CKOA 2DNUA 4KULA 3KK7A 4QIWB 3L2WA 4YHHQ 4C1NI 3CMAQ 1JOKA 1PRTB 1QCFA 2YT6A 3OYAA 4KHPL 1AN8A 3KOJA 1QWYA 2FRWA 4RTXA 2CP0A 4OO1G 3A1PA 1OEBA 5KNBA 4A54A 4OVAA 3QUIA 1PCXA 3SE0A 1C1AA 1U0LA 2L5TA 3G6ET 1CZWA 4KN7C 4BS9A 1D3BA 3CF5A 2RHIA 2M0OA 2F0PA 3CCUQ 1CFMA 1WOCA 4KD4A 4FF3A 4PMBA 4RHRA 1RAAB 5I11A 5J3BA 5L8RE 3FEWX 1E24A 1VQ4T 3D0FA 1YN8A 5D7UA 3DHQA 1VQPA 4RMFA 5CC4A 1XPUA 1VQ7T 1S5CD 2PO4A 3TDQA 2PVDB 5IYBH 5C3EH 1XMOL 3JB9G 4R4IA 3JCMf 4JI3L 1QZHA 4IO9A 1PHTA 4PFOA 1OX8A 3RLFA 1Y1WH 2AKLA 3A8KE 2VWFA 4M78G 5JJLA 3CC4A 2DTOA 2RB6A 4A3GB 2RDFA 4C8QC 1X3FA 3HP3A 4KV6A 2A68C 3T13A 4RKUE 4B3TQ 4BY1B 2DXBA 3PIOA 5L37A 5LMUQ 3OYJA 1AT1B 3GTOB 4KT0E 2XTIA 2K75A 4HCKA 4RAUC 1BKBA 2QA4Q 4RCBA 2F0KA 4XYQA 2B2WA 2EVRA 2QA4T 1VQ8Q 3PF4A 4YTLA 3KFVA 1VQMT 2QDLA 4TVAB 2J7ZA 1UB4A 3MEWA 1PFBA 2J05A 3IFDA 1MGQA 4F87A 1KFZA 2YYZA 3FKIG 4TQUS 3VUZA 4PZ7A 2LC4A 3LH0A 4M78C 3RD4A 4L6V5 4Z02A 2R61A 2B2TC 4DR4Q 4PJLA 4FXDA 1JJGA 1PTOH 2KE9A 2QXFA 5IGDA 4DR1L 2ZGWA 4JOIA 2QILA 4MZTA 5IYCG 1Q12A 4LUVA 1Y71A 1HFGA 2LY7A 3CW2C 5IP9G 3SR1A 5GMKe 1TWGH 1G6PA 4Z9CB 3TREA 2GFAA 4B9XA 2ECZA 2YHTA 3UE1A 5M5WB 1ZX6A 4P72A 3VDYA 2PPBC 3R2TA 5EKIA 4P5NA 1K83B 2ZPEB 3N6RA 4ELYC 1M3AA 3T1YQ 1HD3A 3H41A 4OXPA 4JI0L 2RK1A 3PUYA 4CDDC 2Q8IB 2EPBA 1I4GA 1ESRA 1V9PA 4BE2A 4PJOB 1NYFA 1AE2A 2B2WC 2K5NA 4BBRG 1HUNA 2CH4A 4B3SQ 2EYZA 1Y96B 1F1BB 4JJBA 1G83A 5C0MA 4WJ4A 2F1MA 3S9WA 5ECAA 1VQPT 4KY5A 4C92B 3HRSA 1MHWC 4HVUA 1K8AU 4M7AF 1VQ7Q 2N88A 3GNGA 2I5MX 1RLQC 1WHLA 1TKWB 1YZ6A 4YWKA 3AMUA 2YWWA 2F0JA 1YWPA 1X69A 4ESRA 4N4IA 1X2KA 2K2MA 1U4MA 2EYHA 2MHVA 2V1CC 4OWXB 3K7UC 2JM9A 3UA6A 2L1BA 1YNZA 3H09A 3HOUB 2KBTA 4FNFA 1X3GA 4PJNA 1J3TA 3CPWA 4LFCL 1I50B 2KRMA 3AQQA 4LF7L 2N8NA 2A19A 3VKIA 1O7ZA 3EJIA 4GLAC 3PVQA 3SGIA 1W1FA 3UDCA 1RAEB 2A6HD 3DB4A 1II3A 3DEOA 1NPRA 1VYTA 3X25B 5C6SA 2K5LA 3S1QH 2COYA 1AZGB 2DJGC 4C0FA 2B63G 1B34B 2ENMA 4BI3A 2E10A 1IB8A 2K5VA 1HNXL 4QT7A 1J6QA 2YU9H 1N27A 3H0HA 1K28A 1JC7A 4O42A 5LJ3e 3I4OA 3EG2A 1ZQ1A 2RJFA 4JZ4A 4RTZA 2DE0X 2YUOA 2KNBB 1YIJA 1Q46A 1RABB 1GKHA 3DWPA 3OWFA 3I4MH 1BI1A 2R5AA 3J81i 1CSKA 3PCOB 2EYMA 1M2OA 3G71Q 1HNZL 2KEAA 4FSSA 4PMWA 1XNQL 4QQBX 3CBOA 1TWHB 2LJ0A 2H8HA 2G3RA 2Y90A 4E7SA 1A8VA 5CV7A 4CGYB 4ZCKA 3Q22A 1WI7A 3M9QA 1WTVA 4HN7A 4HTHA 1HK9A 2G9DA 4IALA 3VUBA 3A74A 1C0AA 3MXUA 4UP7A 3NE5B 2B2VC 4XXEA 4JW0A 4ZUIA 2X4YA 1EY7A 1VQ5Q 3T16A 2JA8G 4PJMA 1IBMQ 4AQYQ 5FU7C 2V4DA 3W3AA 1GUNA 3KLSA 2M0YA 3TU4K 2EE1A 4LFAL 1PM3A 2O88A 3ULRB 2D5DA 2LX7A 3OQ5A 3VRYA 2CREA 1SRMA 5LJ3d 1YHQQ 1PXUA 1LVKA 5KNCA 3JB9D 1Q81R 4M7DD 5IODA 3UDFA 3EFRA 2I07B 3LGLA 3LLRA 3RR6A 3BW1A 3SDZA 2K4YA 5GAOl 1IYJB 5GAMd 1RTOA 3GTLB 4N8X1 4M75D 2DF6A 5EPKA 1UGPB 2K05A 3OYGA 3TP8A 3GTJB 1VF7A 1K83H 1NMFA 2HSEB 3SEBA 1NJIU 2XI9A 2JJQA 1WJJA 3H15A 4FYXB 4M78B 1TXQA 2JW4A 1VMCA 2B2VA 1S72A 2K03A 4KKTA 1PRLC 3RKWA 3OW7A 4HJ5A 4A3LH 5BN4A 2DETA 4J6HA 3Q23A 5JOBA 1DM0B 3OYMA 4F7UE 1WI5A 3CCMA 3S1NH 1JXMA 2DJQA 1R9TH 4IOAA 1I4XA 2JJ9A 1D0ZA 5A0GA 1LACA 1GD7A 3FKIH 1MSHA 4CDEC 4NB3A 3CXCA 2P5ZX 4F7UG 2O31A 2WAQB 5FWBA 1STEA 3GTKH 4XTYA 1XTCD 2D8JA 1VDZA 3DMUA 5LHY1 4JI0Q 2KGTA 1SSHA 3NPFA 4JJDA 2VUMH 1AVZC 5J39A 4J15A 1F9QA 3SK4A 4DV5Q 3Q24A 1FMVA 3EIVA 3JB9I 1EEFD 2Y4XA 1QMCA 2BE7D 2EQIA 1MNDA 1OV3A 4QIWE 1GUSA 2D0PA 3DXJC 3CCQA 3F8TA 1PH2A 3A56A 3JV3A 1DJRD 5LJ5h 2DM1A 1D1BA 4AFSC 3QHSA 1JO8A 1Y0MA 4BUGA 3M7GA 1DONA 4UDUC 4WJ3M 4FDBA 2WSEE 2LS01 4R4CA 2B63B 3ER0A 2YRCA 1M27C 3G7ZA 4GBQA 2QGQA 4BE0A 1PH9A 1YITT 1H9JA 2DYBA 3G6EQ 1HUMA 3E9IA 3J81L 4X3KA 1TR5A 4A4FA 3O13A 1SXTA 1RAGB 1TWHH 1AH9A 2JUFA 4OB1B 5GMKj 3LGJA 3M85A 2K01A 3QR8A 2XHCA 3KDFB 2ROTA 4IUUA 1LYLA 3VR3A 4RHSA 1ICWA 3EGDB 3PO2G 4FT4A 5GANf 4QVZA 2GVAA 1FR3A 1K73U 2K9GA 4NXML 1QVGS 5G3LD 1UE6A 1PD0A 3CRLC 1KIKA 3QG1A 3J80E 1W6JA 3R6NA 3I3CA 1LTLA 2ZTEA 2HEQA 1XQHA 1UFFA 5FRMA 4DNTB 4ZLTF 1B9NA 3H3VC 2RHUA 1E6HA 2O4XA 3NP8A 2EQJA 2FRYA 2EOTA 5J26A 5K5PA 3EGXB 2EQMA 1I3QB 4M7DA 1AEYA 3QOLA 3HHTB 4C3JH 3G48A 4EVOA 2HZYA 1WLPB 4DUZL 2F5TX 4LF4L 1WYXA 3L7ZC 3CC7A 4OL7A 1IBML 3MCAB 3UDXA 1CHQD 4O0AA 4J9BA 1SHFA 2F0UA 1HJDA 2PZTA 4JJNK 4YCUA 4DOWA 1AWOA 1KAWA 2AHJB 1SR3A 4K6DA 1LJOA 2GQIA 2MF2A 1WHJA 5HK3A 1E0BA 1KDBA 5GROA 2PI2E 1IHZA 3F70A 1X01A 2YXYA 1JJ2A 4PFZA 3I8ZA 4ZQ3A 2W0ZA 3FPPA 1E7ZA 1EQTA 4KBMB 2VB3X 2EY1A 2OI3A 3I4MG 2EGEA 2QASA 1UE9A 4M4ZA 3MEVA 3ZEHA 1SN8A 2F0WA 5KRUA 4DUYQ 2AWNA 3THKA 2EXDA 3I4NH 3V7SA 1EWIA 5IY0A 2K5IA 2R7ZG 4JI4L 2DN8A 2ED1A 4WFN3 1GL5A 4ATOA 2C0IA 1VQLA 2D6FA 1GVPA 1D1CA 2B63H 1W6KA 2RI5A 2F0IA 3TEEA 1RIPA 4C8QG 1RLPC 5GAOq 2KROA 1RHPA 3LWEA 4J8OA 2HD0A 3PUVA 2L11A 2D0NA 3SWNC 4AFZC 1SF9A 1A3TA 2VNUD 1VIEA 1ZUUA 4LJZC 4RKBA 1CKMA 3HZXA 1Q7YC 3KBXA 4GNXB 2JA7B 4MDWA 1TU2B 1TOVA 1CKAA 2NUTA 1A0IA 1EIFA 4CRIA 1GUGA 1WTXA 3MO8A 2HAXA 5FLXE 3SK6A 2J4XA 1VQHA 3OPOA 2JE6I 3CPFA 2N3SA 2GVBA 1QVFS 4P71A 1IHVA 2HNIA 4DV3L 3GF5A 1RCVD 3PMTA 3P75A 4X65Q 4BXXH 1X2QA 1L1OA 5I2YA 5KYWB 4HIOA 2F3VA 4C92F 1TWFB 5C3XA 4OGCA 3A7LA 4DR3L 1U3OA 3PSIA 3F2CA 3S15B 1H8KA 3L0OA 1R0CB 3BDUA 2SNSA 5JPMC 5BN5A 3SK8A 1WD1A 3PIP3 2EYWA 1O80A 3SB2A 4C0GA 4L63B 2QK0A 4IUQA 5KNDA 1Y1VB 1SE4A 2MFIA 5LJ3g 4PV1C 4DK6C 4UY8C 3I4LA 3EFSA 4DV7Q 3CQTA 4JC0A 5GMKm 2IPKD 3K6OA 5D6XA 2LCLA 2DXTA 3GTOH 1MKHA 5GAN8 1K8MA 1Q86C 5D3IB 4DR6L 2AT1B 3H0IA 2KCMA 3DM3A 5HURA 4DR7Q 2I5LX 1HXDA 2HD3A 4AYBG 2O4XB 4NXMQ 2VUMG 3H0GH 2A73B 1I5OB 5KE3A 1S72Q 1YHBA 3UI2A 3ULPA 2E6ZA 2DPPB 2CQOA 4KJOA 3ULLA 1VQOQ 4DR2L 1MJEA 4AYBE 1NBEB 4DV7L 2V8KA 2SEMA 4BB7A 1PC0A 4OMOA 1D5ZC 1GHKA 5M5XB 3OSSC 2I0QA 2I46A 4QB4A 5GAMg 2Q2UA 2MWPA 5CVIA 2B2UC 8ATCB 5EQ0A 4GOPA 1STNA 3CC2A 1QCBD 2RD1A 2VGNA 3K5OA 4R4OA 4E47A 4RG1A 1L1OB 4MN3A 3VR6A 1LLRD 4KLKA 5GJWB 3RIRA 4M75F 3WVEB 2LNHB 1UTIA 4NS5A 3I5RA 3S3NA 1Z7TA 3F2UA 1N9RA 4GN4B 2OTJQ 2F0GA 3DLLA 3S2HB 4CJ2C 4Y92A 4K2KA 1STBA 2EZVA 1OTCA 5KIXA 3WXMB 3M9BA 2YDLA 1WNLA 1QG7A 2JA6B 2H5XA 3QYHB 4K11A 3KJOA 5M5WH 1UGSB 3BYTB 4LD9K 2IPOB 1LOJA 1YNJC 2AKWB 3TEHB 2XDBA 2ES2A 2L3RA 1KTKA 1NBWA 1M30A 5I9PA 2A5HA 3K7AB 4IUNA 4ZN3A 3PIO3 1WYDA 1LTBD 2VXWA 4A3JB 1CUKA 2K32A 1FMKA 2AUJD 2ASBA 1QKWA 1HJPA 4ANJA 4LF7Q 4ZNXA 3W1GA 2QKIC 3NEMA 2ZPBB 5DY9A 1PKTA 2DMOA 5GMKl 2CW0C 2KCTA 3G71A 4LD6A 5EBDA 3NK9A 3EA6A 1RKNA 4DR7L 1PH6A 1XNRL 4YIJA 1D3BB 4QVDA 4QVCA 3HOUH 4KHVA 3K5MA 2UUBQ 2JOYA 3H3VI 3SD4A 3QZ9B 3X3NA 1VQKT 3M3YB 2FVUA 3J7ZC 4JI6Q 3OS2A 5I6YA 2D1XA 2M1HA 2WSFE 1WTHA 4JG2A 1LNXA 1JWSD 1SE2A 2RHZA 1SYCA 5M3MH 1BCPC 3RZDB 1S40A 4DV0Q 1VS0A 3S14H 1M5Q1 2SOBA 4DBRA 4K5XA 3M0RA 1VF5C 1BIAA 4CC4B 4ME3A 3CCVT 1FXXA 1SNDA 2AKKA 4Y91A 2DD4A 3ME9A 4UP9A 4S3SA 1BI2A 4J83A 4M75A 4NPSA 1Y8OB 3DB3A 1QKXA 4N4HA 1Z6HA 4B3MQ 2IWHA 2O2OA 4BD3A 2F4VL 2CP3A 5KYXA 1E6GA 4HMIA 4FU6A 2B86A 5KYXB 3F1ZA 4M7DB 1Y14B 4Z8AA 2K14A 2R92H 3JC66 3JAML 1E2ZA 2BCOA 2NTTA 2X69A 3OW2P 3EQLC 3WOEA 1JEGA 4A4IA 4FF1A 3RR5A 1OXUA 3FMCA 5IN1A 3HOYG 2DIQA 1YWOA 4HIDA 4E7LA 4HEDA 3LWIA 2KR3A 2DY7A 2EXZA 2MO1A 4L8JA 5D3DA 4R4QA 2LVMA 3CKIB 4M77F 1VQBA 3D4RA 2RSOA 4OONA 2L0AA 4F04B 4DAMA 1IGUA 1NE8A 5JEAG 1Q1EA 1QWFA 1VQNT 2L2PA 1FNWA 3M54A 3G7LA 2JA9A 4ZUJA 4IKFA 3H6ZA 2E2HB 1VQNQ 1N34L 1LUZA 3CC2Q 5CYUA 2FPFA 1MJCA 3C2PA 1F9RA 2A74C 3E19A 1SYFA 5LMNW 3S3MA 1JU5C 3CC2T 3Q0AA 3GP7A 1UHCA 4OMPA 5CV9A 5JPNC 1PTOC 2E74C 1VQPQ 5LJ3h 3OYCA 1EY9A 4IIMA 3G4ST 3FC3A 2F69A 2R92G 1EEID 3GTJH 2RDGA 4K0KQ 3H3VH 2NUCA 2E64A 1BU1A 1RJTA 4NMZA 4N9TA 4DAYA 4CC7A 4BBSB 3EAEA 5C3EG 1CT1D 3MP1A 1Y1VH 4HJ7A 3A7AB 4DV1L 2E5LL 2I0NA 4WTOB 4RTTA 3OYHA 1PZID 3KUPA 3M59A 4JLIA 3J80i 3QO2A 5GANd 1FYCA 4HT8A 1XTDA 2ABLA 3CAMA 2K5FA 2F2WA 1SG5A 3S1RH 4JRKA 4BACA 4LDXA 1BBZA 2F0TA 3M3YH 2R7ZH 3QWXX 1IREB 1W70A 5FLXc 3AFPA 1M3BA 1EZZB 4DV3Q 4RGTA 3FPUB 5E7NA 4A93H 2QDYB 4M1UB 4EQPA 3GTKB 5M3MG 2WAQG 4DKAC 4A3BB 2ZPIB 1SSOA 4OF1A 2HSPA 1PMRA 3L2PA 4A3MG 2HL5C 4KGVB 3RBBB 1Q81C 2WKCA 1WZOA 3BDLA 4PJOD 4J9GA 4JS5A 4LUZA 1OU8A 2XDPA 1I0CA 4A3GG 2VQEQ 3QZ5B 3RMHA 4B3RL 1I4K1 2E1HA 3JB9H 2X4XA 2ROLA 1L0XB 3NQTA 1G5VA 1B7TA 4J8QA 4WRDA 1SRUA 2IJ0A 1HR0L 2MAMA 3PUXA 4AMCA 1MUZA 5CAIA 3MFYA 2A6ED 1V1QA 2K6DA 1ZXTA 3DM1A 4DA4A 5FO9B 2CP2A 4A3MB 3L3OC 3FJ5A 1ABQA 2JN0A 2M16A 4DXGA 1MV0B 1CKBA 1Y07A 3KBGA 1GUTA 1EFID 1HZ9A 2OXPA 1I4RA 4QGUA 4HVWA 1I07A 2E3HA 2HCKA 2ZXOA 4JVZA 3REAB 1HFNA 3M4YA 1YP5A 2RHSB 3CCJQ 1WTWA 1FNUA 2BZ8A 3PTAA 1S5DD 1BF4A 2E2JH 3AEVA 1XWEA 2X6GA 2HKNA 1GJXA 4JI8L 2I5HA 3I56A 1VQ5A 1S1NA 3H6MA 2V8IA 5C4XG 3IAYA 2NWGA 1SLJA 3DEPA 1LPLA 1FWZA 3TVTA 1PH4A 4DR4L 2CW0D 5FK9C 4DR1Q 2HCCA 1F77A 2QG9B 2CZ1B 4KD3A 1D8LA 1FD7D 1UAPA 4WCIA 3H0FA 1PKSA 2VV5A 3NQIA 4RWSC 3G1JA 4FP5D 4KI0A 1YCYA 2CCZA 3I55Q 4HJAA 2Z4IA 1PFSA 3EN2A 1TIID 1QCOA 2DXUA 4J9DA 1PRTC 4C8QF 3TRZA 3CD6T 4QQDA 2R5MA 1C6VX 1VQ7A 4P73A 1VQ6Q 2VW9A 4A3KH 3J7A5 3M0TA 4WORA 3CCQT 3PMFA 5CKDA 2R3ZA 4DA2A 4EQOA 5IYCH 4KHZA 5GAN2 2M9UA 1KLGD 3OIQA 1HNZQ 3S6WA 1PFNA 2V8JA 3RZOB 5GAMe 5IWAL 4A4HA 3HKZG 2AQ3B 3L2UA 1ASZA 1SDFA 1ZYRC 4IFDG 2BZYA 2ZT9C 2KDSA 1CSPA 4M8AA 5EAYA 5I4DA 4MHEA 3EG3A 2F0HA 2ZZDA 4DAPA 2ZXPA 4XTVA 4AFQC 3KFUA 2BKDN 1A63A 4FYYB 3H94A 1G2BA 1P16A 1VQ8T 4GNXC 4IFDH 2VKNA 1NCVA 3JAMc 1UECA 1X3EA 2KBNA 2QYZA 3SFMA 1MD2D 3J81j 1R9TB 4DPGA 2ED0A 1QVPA 1TS9A 1ENCA 4LDVA 2OJ2A 2EQSA 2HIXA 1RACB 4NDXA 4X6AH 1U4LA 1LCKA 3ERQA 2RF4A 2IHFA 2QF7A 2Y4YA 3I72A 5HY6A 4RGNA 4B3ML 1UHFA 3T56B 2K4KA 1SNMA 1H9MA 5T1IA 2COZA 3I56Q 1PZKD 3Q6SA 2KHIA 3M4OH 4C5HA 4CDCC 3JCMQ 4N8FA 4C3IH 3OYNA 2OTJA 3OW2A 2KXDA 1SBBB 3MWYW 5FO8B 3CMEQ 2E76C 1XNRQ 1AW7A 4PJOF 1BUVT 1WTPA 1BO0A 2UUBL 4JCVE 1LT5D 3FVQA 1KC8C 4J9HA 4ELZC 2ID0A 1GRIA 3OMCA 1D0YA 1HXYD 1C4QA 4A75A 3TP7A 4C5GA 1H9SA 3RUZA 2F0OA 4CHTB 1PH1A 4RGOS 3CC7T 3ZBDA 3RNJA 1WHMA 2AK5A 2P4TA 4R4TA 4ZKCB 3D4DA 1JE5A 2BUDA 2K3BA 3R6OA 1NJIR 1N34Q 2NVQH 1AE3A 2XWJB 4BI4A 2FB7A 4OHJA 1WHHA 2X4JA 4FW2A 3E9FA 3M4GA 2OF1A 3R3OA 4DGZA 5C4JB 4OMFB 1DGSA 3J7YW 2K2VA 3ND9A 4BY1G 2PCFB 2KQ3A 1D5MC 2CHBD 1X3QA 5GAN3 4Y52H 2DRKA 4IOCA 4DR5L 2CT4A 4OB3B 1TQOA 2AZSA 5IIFA 4YY3Q 5HCKA 1GHJA 3GLXA 2UUAQ 1K73C 4LNQA 1BI3A 2HQLA 1VIFA 4AH6A 3VR5A 4HKEA 1KIXA 1KQ1A 3W1BA 4D8DA 1I4PA 3S2DH 1RUWA 1KHCA 1TS4A 3QIAA 5EGTA 5ELCA 3OW2S 2DBMA 4M77E 2JA7G 2DX1A 3EGUA 4C92D 4LF5Q 2EYFA 3KF6A 5M5XH 1EYAA 1OI1A 2HQEA 2V1QA 1VOMA 5JJZA 1D09B 3GTQB 2QQAA 4N0AC 2FPDA 1QE6A 1KQSA 2NBFA 5CR3A 3CCJT 1M4ZA 3RDVA 3EFOA 3MEAA 1PWTA 3OYLA 3QPHA 1AEXA 4JRIA 3CMAA 1R4QB 2YU9B 3JAMi 1K9AA 3HOZH 2LT1A 1Y8PB 3CQZH 3VA5A 3S1RB 4HVVA 2V26A 1X75C 2DY8A 1T5XD 2LCCA 3GV3A 1EUJA 2EQUA 2BE9B 3BY7A 4LDUA 2DERA 3TCJA 1SNPA 2XRSD 3PGGA 4FXKC 4EPCA 4GKKQ 2RJCA 4R9WA 3GD7A 2C35B 3I35A 1ZBJA 1V1CA 1YJWT 2DJFC 2AZVA 2QEJC 1Z9FA 4RG8A 4F16A 2F0LA 3STBC 5CIUA 2OAUA 1B44D 3X3MA 2DFUA 2BOSA 3EG1A 4AG2C 2X51A 4M75B 1F2LA 1EQQA 4FW1A 4M78E 3VYHB 4V2SA 5M3MB 4QCLA 1SJED 1OZ3A 1CTMA 1YJNA 2AWOA 3M53A 1PYWD 4JBJA 4YY3L 1EY6A 1EIYB 1LT4D 2UUAL 3TSWA 3ASKA 4LK1C 2QTVA 5CGKA 2A28A 5I6WA 4U673 5CK9A 1I1JA 2A08A 1Y69U 2E5KA 2G6FX 1I6HH 3A8GB 5IP9H 2PZ1A 4DK0A 1E1OA 3CRKC 3RKYA 1VQFA 1CKNA 1QP3A 5C44H 2B29A 1D7QA 5CO7A 1NJIC 3MEFA 2QI2A 4XQ3A 4C8QE 4QL5A 2Z8LA 1WQ7A 1CA5A 3HFOA 4R0KA 1ZLMA 1X6GA 4DBHA 1D0XA 2AMCB 1YI2A 1ZYRD 4KKSA 2RQXA 3CC7Q 1V8QA 1HH2P 1IKLA 1UDLA 1VQEA 1XMQQ 1X55A 3BVMA 1A3VA 3ULJA 4MMLA 4IZ8A 3H91A 2QDBA 5GAOm 1ZHIA 4XU2A 3GPLA 1S4ZA 4DF7A 2PUKB 2ZM6L 4E2FB 2CZ7B 1F2MA 3T51B 5JVG3 3VRZA 1IYVA 2GTOA 3I70A 1XNIA 1HZBA 2VQFQ 1ACMB 3K7AH 1NLOC 1SEMA 2ATCB 3QB3A 4EQ5A 1N6AA 4ZGEB 2PNIA 1TXYA 3SHLA 1XMOQ 1OO9B 3FKIB 1JMCA 4KY6A 1KXLA 1L0YB 4BA2I 2EJFC 3CCUT 3M5AA 2EYXA 5GMKi 3C1FA 4DFAA 2DGYA 3M4OB 3IFTA 4JYAL 4XT3B 1VQDA 3MXNA 5D65A 2E70A 5KCHA 3NWSA 4NXNL 5GAN7 1Y1WB 4AQYL 1GM5A 3A98A 1G3SA 4A3KB 3EHQA 3TS2A 1G91A 4HXJA 2O9SA 4C92A 4YCWA 1Q86U 4LDWA 2K79A 1I4HA 2Z9HA 2JA5G 5EKLA 3JB9J 2NN6I 1AP0A 3JCMX 3OBYA 4DEXA 4LUEA 3UF4A 2XSCA 5BR8Q 4A3FG 4L5RC 3S14B 4A3EB 3E1SA 2GQVA 1HNWL 1M2VA 2BDOA 3EFXD 2NN6G 3CQZB 1IBLL 2A0FB 1D1KA 5HGQA 1HHVA 1J9OA 1Q8KA 2B8FA 1LTTD 4RKLA 4DAYB 1TT2A 4QMGA 4ZK9B 4X3UA 4PLIA 1I6VC 2FHTA 2CKKA 1MMGA 2JXMB 3BVZA 3ND8A 4HCCA 5GAHC 4F17A 2EIFA 2R57A 1UE1A 7AT1B 1QILA 5BN3A 1HNWQ 1B3QA 3HOYB 4IURA 3I55T 5EBCA 2SDFA 4X64L 1BB9A 3QBYA 2EAYA 1MNEA 1ZA1B 1SNQA 2AUKA 3BDOA 2DNEA 1Z47A 2KECA 3GO5A 2FFKB 1QVCA 3JCMb 5F2DA 3HOWB 2VASA 5CKBA 1L0WA 3VS7A 5KYUB 1W4SA 1KABA 1O9SA 2D9UA 5IE8A 2VYTA 1A15A 4KMUC 2DVJA 3A5UA 4OWTB 4KJNA 4M7AA 3VS0A 3L1AA 4J7FA 2XIWA 4JOIC 3U9SA 3R8BA 3HOZG 2JK8A 2E5LQ 1LTGD 5NUCA 3KLRA 2NUZA 1KSWA 1E2WA 5DNFA 2L0CA 3U58A 3META 4IUPA 1K73R 4CDFC 1STHA 3TP5A 2VXEA 4JS4A 2YUNA 3O5ZA 1CQVA 4M7DG 1MBYA 4DV5L 2OTLQ 4RGMA 5D6YA 5GAMh 2ALYB 2ZXRA 5GAN4 4LW1A 2PU9B 2KVQG 2RHXA 4M77D 2JA7H 3S1MH 3M0QA 1RL2A 1LT3D 2L4NA 2DJZA 3SVMA 3CCLA 1TSFA 2CSQA 2HQXA 4EMKB 2LXJA 3MC0B 2EBPA 3OB9A 4MZMA 5C5MA 2RA2A 2LSSA 3A5ZB 1IL8A 1NEBA 1VQNA 5HK0A 4RUGA 2D8HA 3VS4A 3KLSX 2NUPA 2E5QA 2H1EA 2L9HA 5IGGA 2QAZA 3FB9A 4RFBA 1B8AA 2E75C 1QZGA 3CCET 1TUGB 1R4PB 4JV5L 1JXOA 3A8LB 1EYDA 4FF4A 5KYUA 1SE8A 5ELOA 2F0QA 3NBIA 1RAHB 1YNXA 1STAA 1XMQL 1N8RU 3CP0A 3FEOA 5GAN6 3PUWA 2O2LD 4HMJA 4MIUA 1YEZA 1K8OA 3M0UA 2V1RA 3LWHA 2E4HA 3TZDA 1WDXA 1EU4A 4M75E 4ZGDB 3E0JA 4BXXG 3U50C 5IGCA 4OO1I 3VYSA 1UG1A 4M78D 3HKZE 4C0ZA 2BE5C 5IGBA 1PLFA 1TWBA 1A62A 4ZYSA 4FSXA 4A63B 1U1SA 1FVIA 5AFWA 1IXRA 3BG3A 3V05A 1NAPA 4XK8E 4A3BG 1VQ4Q 1ZA2B 4M7AB 2EGAA 1IZ6A 1XOVA 2I2LA 4LNPA 4QKUA 1F2YA 1OXTA 5IHNA 3UPUA 2KVMA 3OTOL 2EY6A 2J06A 4GKKL 4EMKA 2F3WA 3X28B 1GBRA 1EU3A 1JCKB 4OWWB 1UGRB 5L23A 1X3PA 4H02A 4Y7NB 1YFNA 2CT3A 4X34A 1Q82C 2Q8RE 1A0NB 1GUWA 1LTRD 1HYOA 4BE1A 1A3UA 4CC3A 2F4VQ 1P92A 5FLXL 3HOWH 2X9HA 4JDSA 1LABA 2C0TA 4H44C 2CZ0B 4ZKBB 3CMAT 3T4AC 4CC2A 2OAWA 1Q7YR 2X4WA 2JEBI 2EKOA 1BK2A 3I55A 3J80L 4KHPQ 1NEGA 2DKGA 1OPKA 3RESA 2HUGA 2UXBL 1QJOA 2HDLA 2Z6KA 4X66Q 1ZSZC 4G7OC 4OO1H 1MGSA 3J80c 1GXDC 4IPCA 4HCZA 5KYYA 1G3TA 4C1NK 1XYIA 3R93A 5KYNA 2MYSA 3BU2A 2QGGA 2E8GA 3ZYYX 4GS3A 2RO0A 3NHHA 3ZJYC 1K0SA 1STYA 4RH6A 2DNCA 1QW1A 2ZJPA 1K0XA 1DXMA 1F9PA 1QQJA 3E6ZX 5IYBG 2LMJA 2LT4A 2IX3A 4GKJQ 2BDNA 3T1HQ 2AQ2B 2VB2X 4G57A 5I9OA 3JCMV 3S16H 2CP6A 3MJXA 2F0MA 4A3EH 1TWCH 3UDIA 3SWNA 1LT6D 5GAOr 1VQ9A 4TRDA 1M1GA 4PNOA 3I90A 3TMEA 1FGUA 3VS2A 5GMKh 3GBQA 1NYGA 3UT1A 1BR9A 2ZTCA 3M58A 2LJ3A 3TQYA 1IXDA 2BZXA 2JQOA 5GAN5 1EQVA 5CV8A 4DXFA 3VU3C 3C4SA 4EMHA 1YIJT 1EQRA 2F5KA 2XWBB 4GY5A 1YNJD 1NSNS 2A1AA 1VMPA 4BY7H 2B2YA 1KQSP 1YJWQ 4QQGA 2P4RA 1TG0A 1VQMA 4F7UA 4OB0B 2EJ9A 1KK7A 3QJ6A 1FL0A 4Z88A 3EH1A 2VL6A 1XPRA 1NZ9A 3HG9A 4OMLA 1MHNA 3CCJA 1NR2A 1VQIA 1RF2D 3JCMc 3MEUA 4MZPA 1PHJA 1IW7C 3CCRQ 3P1HA 5CV5A 4JV5Q 3ERSX 2NTSA 2RI3A 2W10A 4FVMA 4JBKA 1FYNA 1QLYA 3CMET 2XVSA 3TS0A 1M90R 3CCLQ 1BCPB 4C0DC 1UEBA 2CYZB 2HCIA 5ELBA 2GF7A 2K3YA 3VYGA 4E7IA 4K8JA 1I94Q 2E2DC 4G7HC 3IQLA 1H641 2VQFL 3W2DA 3MA2B 3CBMA 1Y8NB 4B3RQ 3EG0A 2SNMA 4BBRH 1UGVA 4MZ9A 3KLWA 4E7JA 2RJEA 3S24A 1X6BA 3S1MB 3KDFA 4IUVA 4VUBA 5CR2A 3RERA 4Z89A 3CPWS 3JB9F 4X9CA 3I56T 3HRZC 4DV1Q 2DEQA 2L3SA 3JCMW 1JJCB 1V43A 2KCCA 5CQXA 2RQTA 2E2HH 2IHEA 3VA7A 3GDEA 2MNAA 5GANj 2IW3A 4LF4Q 3OYKA 3PO3H 4XTZA 5KYWA 4HCBA 4M75C 1GUOA 4RTVA 1Q82R 3A8HB 4ABNA 3K0XA 4A3MH 1GFDA 3RZDH 1X43A 4P74A 1JWUD 4IJLA 1WVLA 2VZAA 3K59A 3TQ7P 3S16B 3M56A 5C4HA 4JRQA 1I4QA 3M4PA 4LXCA 3HGBA 5JEAH 4LF9L 1J8IA 1VQJA 3RZOH 3DKMA 3JSCA 1B53A 4PFPA 3EHRA 3GNFB 2QQSA 1U4RA 4KRTA 2Z6KC 2L8DA 3A8IE 4UP8A 2DXCA 2WAQE 1EIHA 4J6WA 2UXDQ 4LN2A 1M8AA 4UPAA 3VJPA 3IKJA 3M55A 2NYZD 2LRQA 3T53B 1TUDA 2PZUA 5KYLA 2X3XD 1ENFA 4GZYC 1SMYC 5IYDG 2FHDA 1MMAA 1FX7A 4E7HA 3TZUA 5A0DA 4EMGA 2K57A 4XQNA 2KI7A 1UE5A 4AG1C 1N9SA 4JUVA 3C0CA 1H95A 4FT2A 4DQ2A 5CKFA 3CXCS 2KUMA 5A2QL 5C6AA 3M7NA 2GFUA 4PG3A 1XNQQ 2MPXC 2DILA 1ILPA 1Y7XA 5ELEA 2ZPGB 2X35A 4KH1B 4RCCA 1K1ZA 4PQXA 4EDUA 4MTNA 4DNIA 4IPHA 2R93B 3P20A 4IQZA 2DL3A
chains in the Genus database with same CATH topology
1NG2A 3EG3A 3ULRB 2O88A 2LX7A 3VRYA 2CREA 1SRMA 4AFQC 2RQVA 1NLPC 1G2BA 2LJ1A 2VKNA 2LZ6B 1UECA 2PTKA 5IXFA 1H3HA 2ED0A 2DA9A 2OJ2A 2DF6A 2LCSA 1LCKA 3UA7A 1GBQA 1GCQC 1UHFA 1ZSGA 2JW4A 1M3CA 1PRLC 1T3LA 1U5SA 2KXDA 3NMZC 4J9IA 1WIEA 1MV3A 1JXMA 2DJQA 3I9QA 2MOXA 4J9HA 2JMAA 1GRIA 2O31A 2DRMA 5FWBA 4JPBW 1UJ0A 2D8JA 1ZUYA 2A37A 1SSHA 2KGTA 3NPFA 5EC7A 2JTEA 1T0HA 4JJDA 3RNJA 1AVZC 2AK5A 2KRNA 2K3BA 3NHNA 2F2VA 2BTTA 2EQIA 1OV3A 2A36A 2RPNA 3JV3A 2HBWA 2DM1A 4AFSC 1JO8A 1Y0MA 2VVKA 4JZ3A 2DRKA 2CT4A 2FG0A 1M27C 1WX6A 2AZSA 4GBQA 5HCKA 2DYBA 2LQWA 1SPKA 4IIOA 4D8DA 2KRSA 1RUWA 2ROTA 2DBMA 2DX1A 3EGUA 4OMMA 2GBQA 2V1QA 2K9GA 1N5ZA 4RTYA 2FPDA 3SEMA 1VYVA 3M0PA 1Z9QA 1KIKA 2SRCA 3R6NA 4DEYA 1PWTA 2GNCA 2RQUA 2HEQA 1K9AA 1UFFA 4HVVA 2L3PA 1WXTA 1E6HA 1ABOA 2FRYA 1VYUA 2CH4W 1AEYA 1ZUKA 1WLPB 1WYXA 3I35A 1ZBJA 1V1CA 5IH2A 5I22A 2AZVA 4F16A 4J9BA 1SHFA 1HJDA 3EG1A 4AG2C 1AWOA 1UUEA 2J7IA 2GQIA 1AD5A 3TSWA 1AWWA 1AZEA 2A28A 2JT4A 1I1JA 2A08A 2M51A 2E5KA 2G6FX 2W0ZA 2PZ1A 4X1VA 2OI3A 2EGEA 1UE9A 4M4ZA 3THKA 2DBKA 2J6KA 2EPDA 2ED1A 1GL5A 2C0IA 4R0KA 1ZLMA 1X6GA 1RLPC 2FO0A 2KROA 1UDLA 2CDTA 2MIOA 2JS0A 2D0NA 4AFZC 4J9CA 3U23A 1U06A 2KYBA 1ZUUA 3VRZA 2GTOA 2MCNA 5IHIA 1NLOC 1SEMA 1CKAA 2ESWA 2PNIA 2JM8A 4EIKA 1OPLA 1EFNA 1Z9ZA 2GTJA 2KYMA 2EYXA 1VA7A 1PNJA 2IIMA 1X2QA 2NWMA 2YUQA 1U3OA 3A98A 1H8KA 3EHQA 2GGRA 4HXJA 1TUCA 2JXBA 2O9SA 3I5SA 2K79A 2DL7A 2CUDA 1K4US 4F14A 3TSZA 4LUEA 3UF4A 2EYWA 4DEXA 4LE9A 1GCQA 2RMOA 5GJVB 3CQTA 2HDAA 4D8KA 3H0IA 1WFWA 3NGPA 3ZL7C 4F17A 1B3QA 1BB9A 1H92A 2SEMA 2LQNA 2YSQA 1T3SA 4OMOA 2F2XA 3VS7A 4E6RA 2DVJA 1UJYA 1GFCA 1NM7A 3VS0A 1W6XA 2KT1A 2X3WD 5GJWB 2NUZA 1KSWA 2LNHB 1UTIA 3I5RA 1ARKA 1WXBA 1M8MA 1IO6A 4Y92A 4AFUC 2YUNA 3O5ZA 3PVLA 2YDLA 4K11A 1GCPA 3VS6A 1M30A 3M0QA 3UATA 5IXBA 4J9FA 1FMKA 2DL5A 2CSQA 5FWCA 1QKWA 1T0JA 2RNAA 2EBPA 2L3QA 4ZNXA 1SHGA 1PKTA 2DMOA 1NEBA 2C0OA 4RUGA 2D8HA 3VS4A 2DL8A 1AWJA 2XMFA 1K76A 3REBB 2YUPA 1JXOA 2RN8A 1Y57A 2D1XA 3LH5A 2FEIA 1E7OA 3M0UA 2V1RA 3M0RA 1KJWA 1WDXA 4CC4B 4RTWA 2AKKA 3VS1A 1UG1A 2KXCA 2LP5A 4A63B 1QKXA 1RI9A 2J6FA 2O2OA 2EGAA 1XOVA 3QWYA 4LNPA 1E6GA 5IHNA 4GLMA 2B86A 2J06A 5FW9A 4Z8AA 1GBRA 4JJCA 1JEGA 5L23A 2DNUA 1YWOA 2CT3A 1A0NB 1QCFA 2YT6A 2FRWA 2KR3A 4CC3A 4RTXA 2J6OA 2JMCA 2C0TA 1OEBA 2L0AA 4CC2A 2OAWA 1AWXA 1BK2A 1QWFA 1NEGA 2L2PA 1OPKA 2FPFA 5I11A 1YN8A 2RF0A 1WA7A 4LUDA 1JU5C 1UHCA 4OMPA 1K0SA 2RQWA 2DL4A 2O9VA 1PHTA 3M0SA 4IIMA 2AKLA 1K0XA 2VWFA 2LMJA 1BU1A 2EW3A 4CC7A 3VS5A 2I0NA 4RTTA 4HCKA 3VS2A 3GBQA 1NYGA 2DLPA 2LJ3A 4OMQA 2ABLA 2BZXA 2EVRA 2F2WA 1QWEA 3KFVA 2QDLA 1BBZA 2EYYA 4OMNA 2J05A 3QWXX 1KFZA 1X27A 1W70A 1M3BA 2KE9A 2P4RA 1TG0A 5IHKA 1PRMC 4RTUA 2HSPA 4Z88A 1B07A 3VS3A 3RBBB 4OMLA 1OOTA 4J9GA 2ECZA 1ZX6A 2FPEA 1I0CA 3PE0A 2W10A 1M3AA 2ROLA 1HD3A 3H41A 1FYNA 1YCSB 1QLYA 2EKHA 2JS2A 1NYFA 1MUZA 2CH4A 2K6DA 2EYZA 2RQRA 3IQLA 1G83A 4JJBA 3FJ5A 5ECAA 1ABQA 1MV0B 3EG0A 1CKBA 1UGVA 4HVUA 1X6BA 2K7AA 1RLQC 1I07A 4HVWA 4Z89A 2HCKA 4J9EA 2L3SA 1YWPA 3REAB 1X69A 4ESRA 1YP5A 1X2KA 2K2MA 2RQTA 2BZ8A 3SHWA 2JM9A 3UA6A 1YNZA 2KBTA 2CSIA 1J3TA 1S1NA 4RTVA 1HSQA 2KRMA 2CUBA 1AOJA 3PVQA 1W1FA 1WXUA 3TVTA 1GFDA 1X43A 1VYTA 4ORZA 1AZGB 2ENMA 1SRLA 4QT7A 3H0HA 1PKSA 3H0FA 3EHRA 3EG2A 2YUOA 4WCIA 2DE0X 4JZ4A 4KRTA 4RTZA 2KNBB 4LN2A 1JQQA 1CSKA 4J9DA 1TUDA 2EGCA 2KEAA 4FSSA 2X3XD 2KT8A 2LJ0A 2H8HA 3M0TA 1WI7A 4AG1C 3C0CA 2DILA 1K1ZA 2BZYA 2M0YA 2DL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG2 A;  3EG3 A;  3ULR B;  2O88 A;  2LX7 A;  3VRY A;  2CRE A;  1SRM A;  4AFQ C;  2RQV A;  1NLP C;  1G2B A;  2LJ1 A;  2VKN A;  2LZ6 B;  1UEC A;  2PTK A;  5IXF A;  1H3H A;  2ED0 A;  2DA9 A;  2OJ2 A;  2DF6 A;  2LCS A;  1LCK A;  3UA7 A;  1GBQ A;  1GCQ C;  1UHF A;  1ZSG A;  2JW4 A;  1M3C A;  1PRL C;  1T3L A;  1U5S A;  2KXD A;  3NMZ C;  4J9I A;  1WIE A;  1MV3 A;  1JXM A;  2DJQ A;  3I9Q A;  2MOX A;  4J9H A;  2JMA A;  1GRI A;  2O31 A;  2DRM A;  5FWB A;  4JPB W;  1UJ0 A;  2D8J A;  1ZUY A;  2A37 A;  1SSH A;  2KGT A;  3NPF A;  5EC7 A;  2JTE A;  1T0H A;  4JJD A;  3RNJ A;  1AVZ C;  2AK5 A;  2KRN A;  2K3B A;  3NHN A;  2F2V A;  2BTT A;  2EQI A;  1OV3 A;  2A36 A;  2RPN A;  3JV3 A;  2HBW A;  2DM1 A;  4AFS C;  1JO8 A;  1Y0M A;  2VVK A;  4JZ3 A;  2DRK A;  2CT4 A;  2FG0 A;  1M27 C;  1WX6 A;  2AZS A;  4GBQ A;  5HCK A;  2DYB A;  2LQW A;  1SPK A;  4IIO A;  4D8D A;  2KRS A;  1RUW A;  2ROT A;  2DBM A;  2DX1 A;  3EGU A;  4OMM A;  2GBQ A;  2V1Q A;  2K9G A;  1N5Z A;  4RTY A;  2FPD A;  3SEM A;  1VYV A;  3M0P A;  1Z9Q A;  1KIK A;  2SRC A;  3R6N A;  4DEY A;  1PWT A;  2GNC A;  2RQU A;  2HEQ A;  1K9A A;  1UFF A;  4HVV A;  2L3P A;  1WXT A;  1E6H A;  1ABO A;  2FRY A;  1VYU A;  2CH4 W;  1AEY A;  1ZUK A;  1WLP B;  1WYX A;  3I35 A;  1ZBJ A;  1V1C A;  5IH2 A;  5I22 A;  2AZV A;  4F16 A;  4J9B A;  1SHF A;  1HJD A;  3EG1 A;  4AG2 C;  1AWO A;  1UUE A;  2J7I A;  2GQI A;  1AD5 A;  3TSW A;  1AWW A;  1AZE A;  2A28 A;  2JT4 A;  1I1J A;  2A08 A;  2M51 A;  2E5K A;  2G6F X;  2W0Z A;  2PZ1 A;  4X1V A;  2OI3 A;  2EGE A;  1UE9 A;  4M4Z A;  3THK A;  2DBK A;  2J6K A;  2EPD A;  2ED1 A;  1GL5 A;  2C0I A;  4R0K A;  1ZLM A;  1X6G A;  1RLP C;  2FO0 A;  2KRO A;  1UDL A;  2CDT A;  2MIO A;  2JS0 A;  2D0N A;  4AFZ C;  4J9C A;  3U23 A;  1U06 A;  2KYB A;  1ZUU A;  3VRZ A;  2GTO A;  2MCN A;  5IHI A;  1NLO C;  1SEM A;  1CKA A;  2ESW A;  2PNI A;  2JM8 A;  4EIK A;  1OPL A;  1EFN A;  1Z9Z A;  2GTJ A;  2KYM A;  2EYX A;  1VA7 A;  1PNJ A;  2IIM A;  1X2Q A;  2NWM A;  2YUQ A;  1U3O A;  3A98 A;  1H8K A;  3EHQ A;  2GGR A;  4HXJ A;  1TUC A;  2JXB A;  2O9S A;  3I5S A;  2K79 A;  2DL7 A;  2CUD A;  1K4U S;  4F14 A;  3TSZ A;  4LUE A;  3UF4 A;  2EYW A;  4DEX A;  4LE9 A;  1GCQ A;  2RMO A;  5GJV B;  3CQT A;  2HDA A;  4D8K A;  3H0I A;  1WFW A;  3NGP A;  3ZL7 C;  4F17 A;  1B3Q A;  1BB9 A;  1H92 A;  2SEM A;  2LQN A;  2YSQ A;  1T3S A;  4OMO A;  2F2X A;  3VS7 A;  4E6R A;  2DVJ A;  1UJY A;  1GFC A;  1NM7 A;  3VS0 A;  1W6X A;  2KT1 A;  2X3W D;  5GJW B;  2NUZ A;  1KSW A;  2LNH B;  1UTI A;  3I5R A;  1ARK A;  1WXB A;  1M8M A;  1IO6 A;  4Y92 A;  4AFU C;  2YUN A;  3O5Z A;  3PVL A;  2YDL A;  4K11 A;  1GCP A;  3VS6 A;  1M30 A;  3M0Q A;  3UAT A;  5IXB A;  4J9F A;  1FMK A;  2DL5 A;  2CSQ A;  5FWC A;  1QKW A;  1T0J A;  2RNA A;  2EBP A;  2L3Q A;  4ZNX A;  1SHG A;  1PKT A;  2DMO A;  1NEB A;  2C0O A;  4RUG A;  2D8H A;  3VS4 A;  2DL8 A;  1AWJ A;  2XMF A;  1K76 A;  3REB B;  2YUP A;  1JXO A;  2RN8 A;  1Y57 A;  2D1X A;  3LH5 A;  2FEI A;  1E7O A;  3M0U A;  2V1R A;  3M0R A;  1KJW A;  1WDX A;  4CC4 B;  4RTW A;  2AKK A;  3VS1 A;  1UG1 A;  2KXC A;  2LP5 A;  4A63 B;  1QKX A;  1RI9 A;  2J6F A;  2O2O A;  2EGA A;  1XOV A;  3QWY A;  4LNP A;  1E6G A;  5IHN A;  4GLM A;  2B86 A;  2J06 A;  5FW9 A;  4Z8A A;  1GBR A;  4JJC A;  1JEG A;  5L23 A;  2DNU A;  1YWO A;  2CT3 A;  1A0N B;  1QCF A;  2YT6 A;  2FRW A;  2KR3 A;  4CC3 A;  4RTX A;  2J6O A;  2JMC A;  2C0T A;  1OEB A;  2L0A A;  4CC2 A;  2OAW A;  1AWX A;  1BK2 A;  1QWF A;  1NEG A;  2L2P A;  1OPK A;  2FPF A;  5I11 A;  1YN8 A;  2RF0 A;  1WA7 A;  4LUD A;  1JU5 C;  1UHC A;  4OMP A;  1K0S A;  2RQW A;  2DL4 A;  2O9V A;  1PHT A;  3M0S A;  4IIM A;  2AKL A;  1K0X A;  2VWF A;  2LMJ A;  1BU1 A;  2EW3 A;  4CC7 A;  3VS5 A;  2I0N A;  4RTT A;  4HCK A;  3VS2 A;  3GBQ A;  1NYG A;  2DLP A;  2LJ3 A;  4OMQ A;  2ABL A;  2BZX A;  2EVR A;  2F2W A;  1QWE A;  3KFV A;  2QDL A;  1BBZ A;  2EYY A;  4OMN A;  2J05 A;  3QWX X;  1KFZ A;  1X27 A;  1W70 A;  1M3B A;  2KE9 A;  2P4R A;  1TG0 A;  5IHK A;  1PRM C;  4RTU A;  2HSP A;  4Z88 A;  1B07 A;  3VS3 A;  3RBB B;  4OML A;  1OOT A;  4J9G A;  2ECZ A;  1ZX6 A;  2FPE A;  1I0C A;  3PE0 A;  2W10 A;  1M3A A;  2ROL A;  1HD3 A;  3H41 A;  1FYN A;  1YCS B;  1QLY A;  2EKH A;  2JS2 A;  1NYF A;  1MUZ A;  2CH4 A;  2K6D A;  2EYZ A;  2RQR A;  3IQL A;  1G83 A;  4JJB A;  3FJ5 A;  5ECA A;  1ABQ A;  1MV0 B;  3EG0 A;  1CKB A;  1UGV A;  4HVU A;  1X6B A;  2K7A A;  1RLQ C;  1I07 A;  4HVW A;  4Z89 A;  2HCK A;  4J9E A;  2L3S A;  1YWP A;  3REA B;  1X69 A;  4ESR A;  1YP5 A;  1X2K A;  2K2M A;  2RQT A;  2BZ8 A;  3SHW A;  2JM9 A;  3UA6 A;  1YNZ A;  2KBT A;  2CSI A;  1J3T A;  1S1N A;  4RTV A;  1HSQ A;  2KRM A;  2CUB A;  1AOJ A;  3PVQ A;  1W1F A;  1WXU A;  3TVT A;  1GFD A;  1X43 A;  1VYT A;  4ORZ A;  1AZG B;  2ENM A;  1SRL A;  4QT7 A;  3H0H A;  1PKS A;  3H0F A;  3EHR A;  3EG2 A;  2YUO A;  4WCI A;  2DE0 X;  4JZ4 A;  4KRT A;  4RTZ A;  2KNB B;  4LN2 A;  1JQQ A;  1CSK A;  4J9D A;  1TUD A;  2EGC A;  2KEA A;  4FSS A;  2X3X D;  2KT8 A;  2LJ0 A;  2H8H A;  3M0T A;  1WI7 A;  4AG1 C;  3C0C A;  2DIL A;  1K1Z A;  2BZY A;  2M0Y A;  2DL3 A; 
#chains in the Genus database with same CATH topology
 1NG2 A;  2ZCF B;  3BE3 A;  1K9M C;  1K3B C;  3WOF A;  3GTM B;  1VQL Q;  2Z0W A;  2RQV A;  4OIJ A;  4A3I H;  3HOX H;  2JVV A;  2LZ6 B;  2D62 A;  4KGZ B;  4L5T A;  2A6H C;  2PTK A;  4M7A D;  2YRV A;  2DA9 A;  1EY0 A;  1SFO H;  3L2Z A;  1BOS A;  3EH2 A;  3MXN B;  4H13 C;  1KD1 U;  3CCS A;  2ZJR A;  4A3D B;  1GBQ A;  3CEY A;  1TS5 A;  5KEE A;  1GCQ C;  4JI2 Q;  4LF9 Q;  1PTO D;  2WSC E;  3DUZ A;  2EYO A;  2RM4 A;  5GAN h;  2RBM A;  3QDF A;  4I65 A;  3L9A X;  1NR4 A;  2VXF A;  2XD0 A;  3MXP A;  1U4P A;  3AHU A;  2EJG A;  1G3W A;  1M3C A;  1KQ2 A;  2Q8T A;  2QQB A;  4ZTJ A;  1G3Y A;  1SKU B;  3V2T A;  1GO3 E;  2Y0S E;  4JLG A;  3NMZ C;  4QW2 A;  5LL6 S;  4V0B A;  2HKQ B;  1N36 Q;  2FZG B;  3AYH B;  1WIE A;  1F9S A;  4UHV A;  1WQW A;  4J7I A;  4WF2 A;  1N8R C;  2IL8 A;  1MV3 A;  1MMD A;  1HA5 A;  3EFO B;  2MOX A;  3C12 A;  2F0N A;  4IFD J;  5COR A;  1IBL Q;  3C46 A;  2HT1 A;  1DD2 A;  2JMA A;  1YHQ T;  2WKD A;  2R93 G;  2DRM A;  1VQ6 T;  4LAA A;  2JZ2 A;  4JPB W;  4L6T B;  1UJ0 A;  1KD1 C;  4OGE A;  3FIF A;  4JI7 Q;  1ZUY A;  2A37 A;  3VR4 A;  5LL6 X;  1VCI A;  2HHH Q;  2JSO A;  5EC7 A;  2PYK A;  2G5D A;  1T0H A;  5LJ5 d;  2BH8 A;  2KRN A;  4C2M H;  2DZC A;  3MVV A;  1YJN Q;  1K8A C;  1QB5 D;  2A68 D;  3EBE A;  4X66 L;  2A8V A;  2L89 A;  2BTT A;  5IGE A;  4A93 B;  4XDX A;  1ZKO A;  2XID A;  1GXI E;  4A3F B;  2D0Q B;  2CP5 A;  2PZW A;  3AFQ A;  3VR2 A;  2UXC L;  2KJX A;  2NLU A;  3DWQ A;  3PMI A;  4NL2 A;  2VVK A;  3RLO A;  3E3X A;  1XX8 A;  3K5L A;  1NY4 A;  4DOV A;  1SYG A;  5GAD C;  3V8K A;  1OX9 A;  4ALP A;  2MWO A;  2LQW A;  1EY5 A;  1HZC A;  4M77 G;  4YWL A;  2MPM A;  1JB3 A;  1M1K C;  1WJQ A;  3L2R A;  4K2L A;  1EL0 A;  2KRS A;  4AIM A;  5M9O A;  4NW2 A;  1I8F A;  2FMC A;  2MMP A;  5J1Z A;  3AT1 B;  4BWG B;  2Z4H A;  1TTH B;  4OMM A;  4IN3 A;  5M3F G;  1WTO A;  1JB0 E;  2GBQ A;  3ICE A;  4N9P A;  1KAA A;  1N5Z A;  5EG2 A;  4RTY A;  2DVE A;  4PJO A;  3PT9 A;  2UXD L;  2NVX B;  2B8A A;  3SEM A;  2SEB D;  1U1T A;  4PNY A;  2QCP X;  3GV6 A;  2IT1 A;  2UU9 Q;  2R92 B;  3D7S B;  5JJI A;  2K1B A;  2SRC A;  1KDA A;  1B2T A;  4DUZ Q;  1OYX A;  2GNC A;  4JK1 C;  1XPO A;  2PVO B;  2RQU A;  3QJY A;  2NYS A;  1UWV A;  3J7A F;  1W3S A;  2PW5 A;  4A3I B;  1BCM A;  4L5Q A;  4POF A;  1G8X A;  2HDM A;  2MI6 A;  4QQ6 A;  3FRP B;  3GQB A;  5T1G A;  4DV4 L;  1AZQ A;  1VYU A;  1RDP D;  2EJM A;  3EG9 A;  3MHX A;  2CH4 W;  4FIB A;  1T5E A;  2C9O A;  2WB1 G;  1ZUK A;  3NXW A;  3OSO A;  3CCU A;  2BE5 D;  1Q95 G;  1H3Z A;  2JA6 G;  2CS7 A;  4XU3 A;  2P0Q A;  5C44 B;  5IH2 A;  3GTQ H;  3RLN A;  1A2T A;  3E0E A;  5CV6 A;  2RSN A;  2XDD A;  1N9W A;  2EY5 A;  3NTI A;  2EJF A;  1M9S A;  2RH2 A;  3O8V A;  4HSP A;  4K6L A;  4JYA Q;  1B4O A;  2KY9 A;  1UUE A;  3OYB A;  2PQW A;  4M78 F;  2J7I A;  3HRU A;  4JRP A;  1Q82 U;  1MI2 A;  4RG2 A;  4C3I G;  5LJ5 f;  1Y1W G;  3GIB A;  1UEA B;  3I4M B;  4L5G A;  2R7F A;  5I21 A;  4ZTF A;  2DYI A;  1S3O A;  2EYJ A;  2F3I A;  3TBI B;  3QO3 A;  1AZE A;  4CJ0 B;  2K5W A;  4DAV A;  1N33 L;  2CKZ B;  2NZ1 D;  2JT4 A;  4MNO A;  2M51 A;  3JAM E;  2L12 A;  4C92 C;  4CBV A;  4JBM A;  3L2V A;  2IX1 A;  4FL6 A;  2IY5 B;  4X1V A;  1G2S A;  1Q3L A;  2MJ8 A;  5CBE E;  3FLG A;  3JCM P;  2EDG A;  1I5F A;  1PTO F;  5IT9 L;  1SE3 A;  3K58 A;  1PG5 B;  1B7Y B;  4HR7 B;  2E41 A;  2YLB A;  3LX7 A;  2F0V A;  4LF5 L;  4JI8 Q;  2VB6 A;  1HQR D;  3ITP A;  2J6K A;  2K28 A;  5IP7 G;  1OUL A;  2NZH A;  4F7U F;  4K5W A;  3QSU A;  2JP1 A;  3K81 C;  4AYB B;  4LMQ D;  5EKK A;  2VUM B;  5CQY A;  5I2S A;  5C44 G;  3CHB D;  3DWA A;  1MIU A;  3OY9 A;  4M77 C;  4BBS H;  2FO0 A;  5I2M A;  4GLV B;  2CDT A;  2CGH A;  2MIO A;  6AT1 B;  1WCM H;  1X54 A;  3S17 B;  1O75 A;  1VUB A;  4J9C A;  2AHO B;  1U06 A;  1YNN D;  3OOC A;  2KYB A;  5C0X J;  2HBP A;  3K57 A;  3GTG H;  2WII B;  1S5B D;  4DV4 Q;  1Q1B A;  2XGT A;  1EOT A;  5KYY B;  2UUC L;  2LDM A;  3D6C A;  5DM7 3;  2KEN A;  4TSS A;  4V19 0;  2MCN A;  5ISR A;  2OWO A;  3RUX A;  2DZ9 A;  4KTA A;  4RA8 A;  3V8J A;  3JRZ A;  3TSS A;  3W5O A;  1JRI A;  2ESW A;  3BJU A;  4J1M A;  2E3I A;  4XAX B;  2JM8 A;  2L55 A;  4KUD K;  1UNS A;  1Z9Z A;  5LJ5 e;  4BI8 B;  5GAM j;  1LTI D;  2GTJ A;  2HL3 A;  2KYM A;  4BDZ A;  2OTL T;  2R6G A;  1BI0 A;  1QCN A;  2JA5 B;  4C3H B;  2IIM A;  2NWM A;  3A0J A;  3BYY B;  2D9T A;  3NBH B;  1X9N A;  4IPD A;  5IWA Q;  2YUQ A;  1Q8I A;  2TMP A;  4GKJ L;  5DM7 R;  1M8V A;  3CCE Q;  4FCY A;  3G71 T;  3I5S A;  2JXB A;  4UC4 A;  2LMC B;  2DL7 A;  2CUD A;  3I4N G;  5FU6 B;  2LQK A;  4QUC A;  3HKS A;  5HGT A;  5AJ3 Q;  5C4J H;  1PA6 A;  5CKE A;  4NXN Q;  2HMA A;  2BA0 A;  2RVL A;  1GCQ A;  3X20 B;  5C4X H;  2RMO A;  2WV6 D;  4GLK A;  2HDA A;  1SMX A;  1ZSZ A;  1EWH A;  1YJ9 Q;  4D8K A;  4DR2 Q;  2L15 A;  5C0X H;  1ZSZ B;  1KD1 R;  1KHI A;  2K5H A;  3BVG A;  3OS1 A;  3NWT A;  1ET6 A;  4B6M A;  1A6X A;  4CJ1 B;  3NGP A;  3GTM H;  2ICE C;  2R7Z B;  3ZL7 C;  4HCE A;  1DOM A;  4XIG S;  3P8B B;  1P8L A;  2F03 A;  2E2I B;  2EY2 A;  3URY A;  3OYD A;  5A0L A;  4GN5 A;  1CM9 A;  3UE0 A;  1YVC A;  3HOX G;  2KMT A;  2EFI A;  2Y0S B;  1B3A A;  1T3S A;  1OZ2 A;  2OCE A;  5LMN L;  2P0P A;  3G6E A;  2RCN A;  1BCP F;  2N49 A;  4OIK A;  5GAM f;  4Y7N H;  4Q5V A;  3B6Y A;  4A4G A;  3D31 A;  3J7A V;  1UJY A;  2A7Y A;  3VV0 A;  1NM7 A;  2NVY H;  8AT1 B;  3EVQ A;  5FJ8 G;  3T1H L;  1W6X A;  2KT1 A;  5C3W A;  3NBH A;  2N78 A;  4PK4 A;  4FF2 A;  3D6W A;  2RHQ B;  4M7D E;  1ARK A;  3CC4 T;  1NE3 A;  5FU6 C;  1HTL D;  1SYE A;  3NFC A;  1PH7 A;  4AFU C;  4M7D F;  1V1P B;  3BZD B;  1TWG B;  1WJR A;  1R0B G;  3FJP A;  4GN3 B;  4XU0 A;  5E1F A;  2NVT B;  4R56 A;  3M4Q A;  2M2L A;  4JI1 Q;  2OTJ T;  3VS6 A;  2E12 A;  2VGM A;  5GAN e;  1QNK A;  3PO2 H;  1K8G A;  5BR8 L;  5IXB A;  3HOZ B;  2PI2 A;  4J9F A;  1WCM B;  3S17 H;  1HCZ A;  2FZK B;  2NUT B;  4A3I G;  2RNA A;  2L3Q A;  1I5L A;  3E2U A;  3JCM J;  3C3L A;  1SHG A;  2E2J B;  4B08 A;  2C0O A;  4C2M B;  3LX0 A;  1YIT A;  1EOV A;  1D2B A;  1G6Z A;  4CKC A;  1CSQ A;  3OYI A;  2XMF A;  1I3Q H;  1X32 A;  4FYW B;  1VQA A;  3OS0 A;  2OT2 A;  5ELF A;  3FRN A;  3REB B;  3PO3 B;  4GOP B;  3QOJ A;  3CCQ Q;  1NPP A;  5JAV A;  4LWC A;  2RN8 A;  1I50 H;  2MGS A;  4O5V A;  1Y57 A;  3OYF A;  2DUD A;  5EJW A;  1KC8 U;  3TN2 A;  2JA5 H;  3QII A;  3OS5 A;  3P8D A;  1WTQ A;  1I94 L;  2FEI A;  3CD6 Q;  1AZP A;  1K3R A;  3IL8 A;  4A3B H;  2LXK A;  3BZK A;  1I81 A;  2EYQ A;  2K33 A;  1TWF H;  2HHH L;  2KK4 A;  4PKC C;  5DAU A;  3S15 H;  1TWA B;  1OQK A;  4DV6 L;  1JIC A;  4RTW A;  5IAY A;  4EQN A;  3VS1 A;  1PTO B;  1O78 A;  2A6E C;  2KCN A;  3K8A A;  5ELD A;  1WTR A;  2KXC A;  3FDT A;  3X24 B;  4A3C G;  3FDR A;  4L59 A;  2FMM A;  2UXC Q;  1MSG A;  4G4K A;  3CCS T;  4HAE A;  2KSS A;  4OX9 L;  5FLM G;  3QWY A;  1EY4 A;  4GLM A;  1VQM Q;  5FW9 A;  4DUY L;  3PIP A;  1YJW A;  4ME5 A;  5C0X G;  3PGZ A;  2P0K A;  4JJC A;  1PFM A;  2QTX A;  2PW7 A;  4IPG A;  2DD5 A;  4A3L G;  3A54 A;  5M3F H;  4B9W A;  2WIN B;  4A3K G;  4C8Q A;  1RTN A;  3S3O A;  2COW A;  2R93 H;  2PQE A;  2GA4 B;  3HL8 A;  3CXC P;  4A53 A;  3HSB A;  1FGB D;  2J6O A;  2JMC A;  2O01 E;  2CZ6 B;  1VQ9 Q;  1JJ2 P;  5C0X I;  2ATW A;  3HOX B;  4I7Z C;  4KGX B;  5E4W C;  1AWX A;  1ILQ A;  1XJV A;  3A8J E;  2NVY B;  2UU9 L;  2XG8 D;  1TWC B;  3CBP A;  3RKX A;  4KK7 A;  4E6I A;  5JJK A;  2A3L A;  4GNX A;  1WGS A;  4XQQ A;  1CZG A;  2GCX A;  1FJG Q;  2HIV A;  2RKS A;  1XJW B;  1IBK L;  1IKM A;  4IUT A;  1H9K A;  3PQI A;  2RF0 A;  1WA7 A;  1E2V A;  4LUO A;  4LUD A;  2RK2 A;  4F88 A;  5FRN A;  1N8R R;  4EX5 A;  2UXB Q;  3JCM e;  4RCN A;  2RQW A;  3MP6 A;  2DL4 A;  2O9V A;  4DNR B;  1SNC A;  3M0S A;  1TY2 A;  1UUP A;  1M1F A;  2ZJQ A;  4II1 A;  1KC8 R;  2PUO B;  4ZGJ B;  2QEX A;  1DCZ A;  4KN4 C;  3VYR A;  4XTX A;  1VQ9 T;  4A3D H;  1HTP A;  1IL2 A;  4NP5 A;  3RMQ A;  1LM0 A;  2LKV A;  5KH6 A;  1IYU A;  4PJJ A;  3ZFJ A;  2B2Y C;  2C5C A;  4F8M A;  2EW3 A;  2YLC A;  3VS5 A;  4GLX A;  5C4X B;  1BVS A;  4O2D A;  3OTO Q;  3HTR A;  4BY7 G;  4C92 E;  2B8G A;  2DLP A;  4OMQ A;  2LX9 A;  1QVF P;  9ATC B;  1BBU A;  2MO0 A;  3J81 E;  2F0D A;  1EYG A;  1QWE A;  4U68 A;  4AT1 B;  2OEO A;  2A69 C;  4HIM A;  4ULL A;  2EYY A;  2PNH A;  4OMN A;  3PV0 A;  1FJG L;  4KY7 A;  5GQO A;  1X27 A;  3CCS Q;  3QDR B;  2E2I H;  1R8O B;  3LWU A;  3CCE A;  1YI2 T;  2CWP A;  3T1Y L;  5G3L F;  5IHK A;  2PVG B;  3Q1J A;  1PRM C;  3D4W A;  2MUY A;  4HIK A;  4RTU A;  1G29 1;  3DLM A;  3VS3 A;  1B07 A;  1JJ2 S;  3PF5 A;  2XU8 A;  1E22 A;  1HR0 Q;  2R58 A;  1AFP A;  2XRQ D;  1SSF A;  2FZC B;  4BBS G;  1OOT A;  4N0A A;  4C8Q D;  1BCP D;  2FPE A;  3PE0 A;  4JBW A;  2DK3 A;  1VQO T;  4A93 G;  1PZJ D;  3PFS A;  2YTV A;  1JE4 A;  4J6X A;  2YTX A;  4A3C H;  1YCS B;  2EKH A;  1S72 T;  1PDQ A;  3RMS A;  2CP7 A;  1CKN B;  1J5E Q;  2UUC Q;  2JS2 A;  1TY0 A;  5LJ5 j;  5J22 A;  3UDG A;  1L1O C;  2DIG A;  2H3E B;  2RQR A;  4DBQ A;  4E7K A;  1Q7Y U;  3X26 B;  3A8M B;  4F7U B;  1K0R A;  2RCF A;  2X6L A;  3EGD A;  4KKU A;  2EJG C;  4JI5 L;  3GTP B;  4P75 A;  3E9H A;  4A4E A;  1DYQ A;  3JCM h;  1M2V B;  2XKO C;  2K7A A;  5LJ5 g;  1VQ4 A;  2OX7 A;  5LJ3 f;  2ICI A;  4C0D B;  1EIG A;  1QOH A;  4WJW A;  5FKA C;  4QUF A;  4FYV B;  4J9E A;  1B50 A;  1ESF A;  2QEX T;  2JEA I;  4PZ8 A;  1NTG A;  1KL9 A;  5LMU L;  3SHW A;  1RAD B;  1CQF A;  4O1N A;  4I7A A;  1RAI B;  4XQJ A;  3LGF A;  3CC4 Q;  2CSI A;  4QF4 A;  3U4V A;  3KJP A;  3E5S A;  4NOY A;  1HSQ A;  2CUB A;  2NVX H;  4JI4 Q;  1KDC A;  1SRO A;  1AOJ A;  4KUI A;  1WXU A;  2KEE A;  3HOV B;  4J5Y A;  2B2U A;  4ORZ A;  2QQR A;  3URG A;  2GN5 A;  1VQ5 T;  2JYO A;  4RCO A;  4MMK A;  2KHJ A;  3G6J B;  4PJO G;  1W2B P;  3OBW A;  1BQQ T;  1PYS B;  2MQH A;  4BBR B;  1SRL A;  1S5E D;  4PMC A;  1UGQ B;  3H9N A;  2FIN B;  3T9N A;  1AHJ B;  1EX4 A;  1VQC A;  5I2X A;  2B3G A;  3H8Z A;  1N33 Q;  4C5E A;  2Z0S A;  4FXG C;  3CU7 A;  1JQQ A;  4ID6 A;  2RI2 A;  2EGC A;  3MAQ A;  3A8O B;  2CFM A;  2KT8 A;  2M00 A;  3OYE A;  4CKE A;  5H1S E;  2E65 A;  2NUP B;  1RD9 D;  2K50 A;  1KRS A;  1IRX A;  3S2D B;  3MXG A;  3LW5 E;  3V7R A;  4NKL A;  1IBK Q;  4HT9 A;  5D6W A;  1HPC A;  1O7I A;  1JOQ A;  1BCO A;  5KCO A;  1BNZ A;  1WJS A;  4JI5 Q;  5LJ3 j;  4O6J A;  1MMN A;  1X56 A;  4POG A;  1YJ9 T;  3OMG A;  3MKD A;  5GAG C;  2D2C C;  4IFD I;  4ODG A;  2MP1 A;  3F2D A;  3CCV A;  4M7D C;  2DAQ A;  2L5Q A;  2Q2I A;  5COY A;  3KUF A;  1NLP C;  4ZRZ A;  2LJ1 A;  4X9D A;  3CCL T;  2P84 A;  5IXF A;  1BBW A;  1GOZ A;  1OXS C;  1H3H A;  4FM4 B;  4X62 Q;  2F0E A;  3SK5 A;  4R8N A;  4F7X A;  1SYD A;  3AU7 A;  4LFC Q;  2LCS A;  3U4Z A;  2Z1C A;  1PSF A;  1JB7 A;  5GAN g;  1NMG A;  3UA7 A;  3RNU A;  2F52 A;  5E4X A;  5HKC A;  3C94 A;  1W2B S;  3OHX C;  3GP8 A;  1CK1 A;  3HFZ B;  5KGU A;  3VYU A;  1F2Z A;  1DJ7 B;  1ZSG A;  1WD0 A;  1C0M A;  2LNV A;  3ONA B;  3HOU G;  3OSV A;  4XYO A;  1N32 Q;  4OX9 Q;  3EGX A;  2OQK A;  1U5S A;  3CCR A;  1T3L A;  3L2Q A;  4CKB A;  4A4K A;  5KE2 A;  1QNU A;  3HS0 C;  2PNR C;  4J9I A;  4C3H H;  4A3F H;  2BIV A;  4D6W A;  1YHQ A;  3CME A;  5K36 G;  2DTI A;  1OU9 A;  4LFB L;  3TP6 A;  3I9Q A;  1YIJ Q;  3I7F A;  2A69 D;  3C1E A;  3KXT A;  1QVG A;  4NL3 A;  5EPJ A;  1VQL T;  1JOO A;  1O7L A;  4MDX A;  2WFW A;  4LDY A;  1PVO A;  3CCM T;  1N36 L;  2EWN A;  2PQA A;  2BH2 A;  3HOW G;  2DEU A;  3OA6 A;  1SEB D;  1CHP D;  1TH7 A;  2K52 A;  4DN4 M;  2JNG A;  4K0K L;  1LTA D;  1BXT A;  3KF6 B;  1ROD A;  2JTE A;  2EQK A;  1Y1V G;  1XXG A;  5M3F B;  1WPY A;  5D14 A;  2ZPH B;  4G7Z C;  4DK3 C;  3NHN A;  2F2V A;  5A2Q E;  3MHB A;  1I6H B;  1EFW A;  4JI7 L;  2JTF A;  2EVB A;  2A36 A;  2RPN A;  1VQG A;  4BY6 C;  5CCA A;  2WP8 J;  1WCM G;  4LF6 Q;  4M75 G;  3HOV G;  2HBW A;  1FNV A;  1TVX A;  1YJ9 A;  1YNN C;  1ONL A;  2VY3 A;  4QJF A;  1PYB A;  4M77 B;  4HA8 A;  5IT9 E;  1V76 A;  2DO3 A;  3UWN A;  4JZ3 A;  2CVR A;  3JCM d;  2FG0 A;  3SWN B;  1WX6 A;  2KHS A;  4X62 L;  4K8I A;  5IP7 H;  1T9H A;  4JI2 L;  5ELN A;  1HRJ A;  1SPK A;  4IIO A;  2MK5 A;  4DR5 Q;  2XN9 C;  4RMO A;  4Y28 E;  5CBA E;  1M90 U;  1QVF A;  1H9S B;  4OEL B;  4XTU A;  4EGV A;  5JVH 3;  4A76 A;  1N32 L;  3WVD B;  3SXH A;  4EMK C;  2RDH A;  3S2H H;  1QUQ A;  2LFN A;  2Y0S G;  1B9M A;  3J81 c;  2BA1 A;  1VYV A;  3M0P A;  1Z9Q A;  3S1Q B;  2QEX Q;  1OXV A;  1PH8 A;  4DEY A;  2VUB A;  2WB1 E;  5FOB B;  1YHA A;  2ZPF B;  1HQM C;  1QP2 A;  5FJ8 H;  4A3J H;  5LMN Q;  2OQ0 A;  2LQ8 A;  2IVW A;  1DOK A;  2L3P A;  1WXT A;  3JCM g;  1ABO A;  2HQH A;  4DV2 Q;  5KYI A;  1EYC A;  1NNX A;  3KYH C;  1HZA A;  3HPW A;  1G51 A;  3HP9 A;  1PH3 A;  1M4V A;  3V96 A;  1E3P A;  3V7C A;  1JT8 A;  4ME7 A;  1V29 B;  5A35 A;  1UE7 A;  2E6N A;  2C06 A;  1RAF B;  5I22 A;  1PV4 A;  3I4N B;  1C8C A;  4XTC S;  4DU9 A;  1LO5 D;  2F4I A;  4K5V A;  1ASY A;  2K7V A;  4A3D G;  3I2Z A;  4PZ6 A;  1U8R A;  4MTK A;  4OEM B;  4X65 L;  1NUC A;  3GOX A;  2CWA A;  5DLQ E;  2KA7 A;  3H0G B;  3MEH A;  1AD5 A;  2AIR B;  3P7J A;  4X3T A;  4APV A;  1BBX C;  1HNX Q;  5C3E B;  1M1K R;  1VQK Q;  1AWW A;  1EWC A;  4DR3 Q;  3I91 A;  5TSS A;  1SNO A;  3GTG B;  4M77 A;  1YJN T;  3EG9 B;  2M9V A;  2JTM A;  3LYI A;  1VQO A;  2IX0 A;  3MZ5 A;  1BYM A;  4P2C B;  4XTW A;  5GAO p;  3HEJ A;  5FRO A;  1SJH D;  3NEN A;  3CPW P;  2QA4 A;  1B70 B;  4LF8 L;  2DBK A;  3STB D;  2RA4 A;  1D1I A;  3HRT A;  3GTP H;  1G2T A;  3GTL H;  2EPD A;  3CCM Q;  1Q81 U;  1U9R A;  3CCV Q;  3P8H A;  1TWA H;  3L42 A;  4FYD A;  2NVQ B;  4XU1 A;  5C4Z A;  2QW7 A;  4OGQ C;  1KG1 A;  3RN2 A;  1D5X C;  1S5F D;  4H0L C;  2Q2T A;  2F0F A;  2JS0 A;  1J5E L;  1FMW A;  3U23 A;  2KQW A;  2VS1 A;  1C9O A;  4Q5W A;  2JA8 H;  4A3E G;  1WHG A;  4DV2 L;  1HA6 A;  1K9M U;  2NN6 H;  1KLU D;  1PH5 A;  1JOR A;  2NZO A;  4HJ8 A;  2FXQ A;  4HCS A;  5FU7 B;  1SAP A;  4B3S L;  3CD6 A;  1VQK A;  5IHI A;  1YBY A;  4R1J A;  5FLM H;  4N4G A;  1KRT A;  1RI0 A;  2OTL A;  2K5D A;  2FL7 A;  4X3S A;  4EIK A;  3S1N B;  1OPL A;  1EFN A;  2ZM6 Q;  4M78 A;  3PUZ A;  2LTO A;  2ZTD A;  4HJ9 A;  3N52 A;  2O5J C;  1VA7 A;  2WAC A;  1PNJ A;  1YIT Q;  1B1Z A;  2K04 A;  4J6Y A;  4OB2 B;  4C3I B;  3C95 A;  2RHY A;  2PMZ E;  3AB9 A;  4C92 G;  2J0T D;  3INZ A;  1EZ8 A;  4JI1 L;  5M5Y B;  2GGR A;  4DR6 Q;  3Q8D A;  1TUC A;  3KF8 A;  3BFM A;  3OYY A;  4A3G H;  2VQE L;  1K4U S;  3HFN A;  4HSV A;  4F14 A;  3TSZ A;  2R7D A;  3N5B B;  4UAI A;  4OP0 A;  1LV9 A;  4BY1 H;  1D1A A;  2FYK A;  2M02 A;  4LE9 A;  5CKH A;  1D6E C;  3NSW A;  3QKJ A;  5GJV B;  3R2I A;  4LF8 Q;  3F2B A;  1G8Z D;  5GAO n;  1Y96 A;  2XK0 A;  5IYD H;  2ZAE A;  1H9R A;  3WWV A;  2YV5 A;  4X64 Q;  1WFW A;  1STG A;  1IGQ A;  2JN4 A;  3OWE B;  1M90 C;  1Q86 R;  3A55 A;  3LNN A;  4YWM A;  3BS1 A;  4M7A C;  4IJH A;  1K8A R;  2XIC A;  2DTH A;  4BDY A;  2FJ2 A;  3HKZ B;  4ZAI A;  2KAF A;  3QXE B;  2TSS A;  4DBF A;  1DOL A;  1JBM A;  1QUQ B;  1CI3 M;  1TS2 A;  2JA6 H;  4C8Q B;  1H92 A;  2H3J A;  4BY6 B;  4JI3 Q;  2LQN A;  2H4O A;  3NPP A;  2YSQ A;  4TKO B;  5JEA J;  2NVT H;  5FO7 B;  2F2X A;  1KNA A;  1ICF B;  3PO2 B;  1DZ1 A;  3NUC A;  1LTS D;  4E6R A;  3FHW A;  2QGF B;  1ZEQ X;  4R8I A;  2F1L A;  1QVG P;  1WHK A;  1GFC A;  1A2U A;  3E9G A;  1VQ6 A;  2EYL A;  3D8G A;  3H0G G;  2X3W D;  3IRB A;  4LFA Q;  4C56 C;  1C7Y A;  4A3J G;  3PO3 G;  1PRT F;  4R55 A;  1JQY D;  1TS3 A;  4C5I A;  4PJO C;  1Q90 A;  2KOL A;  1EY8 A;  3G4S A;  1B34 A;  1V1O A;  1M1K U;  2Z6B A;  3G4S Q;  3MPU B;  4CI0 C;  2XNA C;  1WXB A;  3BZC A;  1K9M R;  4FO2 A;  1M8M A;  4QY7 A;  1W2B A;  1IO6 A;  1SMY D;  5AYF A;  2CQA A;  3M57 A;  2EYP A;  2N55 A;  5GAE C;  3PVL A;  1KNE A;  5DEH A;  4H7B A;  3U9O A;  1E1T A;  3NTK A;  4C3J B;  1V1P A;  3CCR T;  1GCP A;  1TU0 B;  4YHH L;  5AJ3 L;  5E3F A;  1PSE A;  3UAT A;  4PL6 A;  1SYB A;  1ZBX A;  1KQS S;  2PMZ B;  1WFQ A;  2DL5 A;  4XT1 B;  5FWC A;  2AQ1 B;  1T0J A;  5K36 H;  4ZN1 A;  2JA8 B;  1JR0 D;  4PJO E;  4BA1 I;  3K0Y A;  5IGF A;  1PD1 A;  2K5Q A;  4DV0 L;  2YRD A;  3FP9 A;  4JI6 L;  4YCV A;  1YI2 Q;  2DL8 A;  2WB1 B;  1AWJ A;  2VC8 A;  4TVR A;  5EPL A;  2D0O A;  3VYT A;  5IT9 c;  1K76 A;  1O7Y A;  4K14 A;  4LFB Q;  2F0S A;  2YUP A;  3HOY H;  5IOC A;  5CMD A;  1BIB A;  4L5S A;  2YTY A;  2PQA B;  3ERO A;  1HR0 W;  1JWM D;  3K80 C;  1ENA A;  4DK1 A;  3LH5 A;  4KH0 B;  3D3R A;  3HOV H;  5DLO A;  1EZ6 A;  1U5K A;  1E7O A;  3MFG A;  2NB0 A;  1R77 A;  5C5L A;  2IG0 A;  4PLL A;  4M7A E;  2B2T A;  2Q2H A;  3QWN A;  4GOP C;  3QYG B;  1KJW A;  1VQ8 A;  2G9H D;  5M5Y H;  1ML0 D;  1CA6 A;  2K3X A;  1X65 A;  1BDO A;  2K6A A;  2QQ9 A;  1PRT D;  4Q0F A;  3NEL A;  2RJD A;  2O5I C;  4M7A G;  3WDN A;  4E7Z A;  3OIP A;  3MTS A;  1ET9 A;  3I73 A;  4B3T L;  4BY7 B;  2LP5 A;  5AT1 B;  3V8L A;  1X6O A;  1C48 A;  2ENB A;  1RI9 A;  3KF8 B;  4LF6 L;  1SFO B;  4ILW A;  4C3J G;  3PNW C;  2J6F A;  2KED A;  3RN5 A;  3NTH A;  1IW7 D;  5CV4 A;  3K5N A;  3BDC A;  4DV6 Q;  1L2F A;  5DM6 3;  4C3H G;  1IHW A;  1OXX K;  3MP8 A;  2B39 A;  1CKO A;  2DNU A;  4KUL A;  3KK7 A;  4QIW B;  3L2W A;  4YHH Q;  4C1N I;  3CMA Q;  1JOK A;  1PRT B;  1QCF A;  2YT6 A;  3OYA A;  4KHP L;  1AN8 A;  3KOJ A;  1QWY A;  2FRW A;  4RTX A;  2CP0 A;  4OO1 G;  3A1P A;  1OEB A;  5KNB A;  4A54 A;  4OVA A;  3QUI A;  1PCX A;  3SE0 A;  1C1A A;  1U0L A;  2L5T A;  3G6E T;  1CZW A;  4KN7 C;  4BS9 A;  1D3B A;  3CF5 A;  2RHI A;  2M0O A;  2F0P A;  3CCU Q;  1CFM A;  1WOC A;  4KD4 A;  4FF3 A;  4PMB A;  4RHR A;  1RAA B;  5I11 A;  5J3B A;  5L8R E;  3FEW X;  1E24 A;  1VQ4 T;  3D0F A;  1YN8 A;  5D7U A;  3DHQ A;  1VQP A;  4RMF A;  5CC4 A;  1XPU A;  1VQ7 T;  1S5C D;  2PO4 A;  3TDQ A;  2PVD B;  5IYB H;  5C3E H;  1XMO L;  3JB9 G;  4R4I A;  3JCM f;  4JI3 L;  1QZH A;  4IO9 A;  1PHT A;  4PFO A;  1OX8 A;  3RLF A;  1Y1W H;  2AKL A;  3A8K E;  2VWF A;  4M78 G;  5JJL A;  3CC4 A;  2DTO A;  2RB6 A;  4A3G B;  2RDF A;  4C8Q C;  1X3F A;  3HP3 A;  4KV6 A;  2A68 C;  3T13 A;  4RKU E;  4B3T Q;  4BY1 B;  2DXB A;  3PIO A;  5L37 A;  5LMU Q;  3OYJ A;  1AT1 B;  3GTO B;  4KT0 E;  2XTI A;  2K75 A;  4HCK A;  4RAU C;  1BKB A;  2QA4 Q;  4RCB A;  2F0K A;  4XYQ A;  2B2W A;  2EVR A;  2QA4 T;  1VQ8 Q;  3PF4 A;  4YTL A;  3KFV A;  1VQM T;  2QDL A;  4TVA B;  2J7Z A;  1UB4 A;  3MEW A;  1PFB A;  2J05 A;  3IFD A;  1MGQ A;  4F87 A;  1KFZ A;  2YYZ A;  3FKI G;  4TQU S;  3VUZ A;  4PZ7 A;  2LC4 A;  3LH0 A;  4M78 C;  3RD4 A;  4L6V 5;  4Z02 A;  2R61 A;  2B2T C;  4DR4 Q;  4PJL A;  4FXD A;  1JJG A;  1PTO H;  2KE9 A;  2QXF A;  5IGD A;  4DR1 L;  2ZGW A;  4JOI A;  2QIL A;  4MZT A;  5IYC G;  1Q12 A;  4LUV A;  1Y71 A;  1HFG A;  2LY7 A;  3CW2 C;  5IP9 G;  3SR1 A;  5GMK e;  1TWG H;  1G6P A;  4Z9C B;  3TRE A;  2GFA A;  4B9X A;  2ECZ A;  2YHT A;  3UE1 A;  5M5W B;  1ZX6 A;  4P72 A;  3VDY A;  2PPB C;  3R2T A;  5EKI A;  4P5N A;  1K83 B;  2ZPE B;  3N6R A;  4ELY C;  1M3A A;  3T1Y Q;  1HD3 A;  3H41 A;  4OXP A;  4JI0 L;  2RK1 A;  3PUY A;  4CDD C;  2Q8I B;  2EPB A;  1I4G A;  1ESR A;  1V9P A;  4BE2 A;  4PJO B;  1NYF A;  1AE2 A;  2B2W C;  2K5N A;  4BBR G;  1HUN A;  2CH4 A;  4B3S Q;  2EYZ A;  1Y96 B;  1F1B B;  4JJB A;  1G83 A;  5C0M A;  4WJ4 A;  2F1M A;  3S9W A;  5ECA A;  1VQP T;  4KY5 A;  4C92 B;  3HRS A;  1MHW C;  4HVU A;  1K8A U;  4M7A F;  1VQ7 Q;  2N88 A;  3GNG A;  2I5M X;  1RLQ C;  1WHL A;  1TKW B;  1YZ6 A;  4YWK A;  3AMU A;  2YWW A;  2F0J A;  1YWP A;  1X69 A;  4ESR A;  4N4I A;  1X2K A;  2K2M A;  1U4M A;  2EYH A;  2MHV A;  2V1C C;  4OWX B;  3K7U C;  2JM9 A;  3UA6 A;  2L1B A;  1YNZ A;  3H09 A;  3HOU B;  2KBT A;  4FNF A;  1X3G A;  4PJN A;  1J3T A;  3CPW A;  4LFC L;  1I50 B;  2KRM A;  3AQQ A;  4LF7 L;  2N8N A;  2A19 A;  3VKI A;  1O7Z A;  3EJI A;  4GLA C;  3PVQ A;  3SGI A;  1W1F A;  3UDC A;  1RAE B;  2A6H D;  3DB4 A;  1II3 A;  3DEO A;  1NPR A;  1VYT A;  3X25 B;  5C6S A;  2K5L A;  3S1Q H;  2COY A;  1AZG B;  2DJG C;  4C0F A;  2B63 G;  1B34 B;  2ENM A;  4BI3 A;  2E10 A;  1IB8 A;  2K5V A;  1HNX L;  4QT7 A;  1J6Q A;  2YU9 H;  1N27 A;  3H0H A;  1K28 A;  1JC7 A;  4O42 A;  5LJ3 e;  3I4O A;  3EG2 A;  1ZQ1 A;  2RJF A;  4JZ4 A;  4RTZ A;  2DE0 X;  2YUO A;  2KNB B;  1YIJ A;  1Q46 A;  1RAB B;  1GKH A;  3DWP A;  3OWF A;  3I4M H;  1BI1 A;  2R5A A;  3J81 i;  1CSK A;  3PCO B;  2EYM A;  1M2O A;  3G71 Q;  1HNZ L;  2KEA A;  4FSS A;  4PMW A;  1XNQ L;  4QQB X;  3CBO A;  1TWH B;  2LJ0 A;  2H8H A;  2G3R A;  2Y90 A;  4E7S A;  1A8V A;  5CV7 A;  4CGY B;  4ZCK A;  3Q22 A;  1WI7 A;  3M9Q A;  1WTV A;  4HN7 A;  4HTH A;  1HK9 A;  2G9D A;  4IAL A;  3VUB A;  3A74 A;  1C0A A;  3MXU A;  4UP7 A;  3NE5 B;  2B2V C;  4XXE A;  4JW0 A;  4ZUI A;  2X4Y A;  1EY7 A;  1VQ5 Q;  3T16 A;  2JA8 G;  4PJM A;  1IBM Q;  4AQY Q;  5FU7 C;  2V4D A;  3W3A A;  1GUN A;  3KLS A;  2M0Y A;  3TU4 K;  2EE1 A;  4LFA L;  1PM3 A;  2O88 A;  3ULR B;  2D5D A;  2LX7 A;  3OQ5 A;  3VRY A;  2CRE A;  1SRM A;  5LJ3 d;  1YHQ Q;  1PXU A;  1LVK A;  5KNC A;  3JB9 D;  1Q81 R;  4M7D D;  5IOD A;  3UDF A;  3EFR A;  2I07 B;  3LGL A;  3LLR A;  3RR6 A;  3BW1 A;  3SDZ A;  2K4Y A;  5GAO l;  1IYJ B;  5GAM d;  1RTO A;  3GTL B;  4N8X 1;  4M75 D;  2DF6 A;  5EPK A;  1UGP B;  2K05 A;  3OYG A;  3TP8 A;  3GTJ B;  1VF7 A;  1K83 H;  1NMF A;  2HSE B;  3SEB A;  1NJI U;  2XI9 A;  2JJQ A;  1WJJ A;  3H15 A;  4FYX B;  4M78 B;  1TXQ A;  2JW4 A;  1VMC A;  2B2V A;  1S72 A;  2K03 A;  4KKT A;  1PRL C;  3RKW A;  3OW7 A;  4HJ5 A;  4A3L H;  5BN4 A;  2DET A;  4J6H A;  3Q23 A;  5JOB A;  1DM0 B;  3OYM A;  4F7U E;  1WI5 A;  3CCM A;  3S1N H;  1JXM A;  2DJQ A;  1R9T H;  4IOA A;  1I4X A;  2JJ9 A;  1D0Z A;  5A0G A;  1LAC A;  1GD7 A;  3FKI H;  1MSH A;  4CDE C;  4NB3 A;  3CXC A;  2P5Z X;  4F7U G;  2O31 A;  2WAQ B;  5FWB A;  1STE A;  3GTK H;  4XTY A;  1XTC D;  2D8J A;  1VDZ A;  3DMU A;  5LHY 1;  4JI0 Q;  2KGT A;  1SSH A;  3NPF A;  4JJD A;  2VUM H;  1AVZ C;  5J39 A;  4J15 A;  1F9Q A;  3SK4 A;  4DV5 Q;  3Q24 A;  1FMV A;  3EIV A;  3JB9 I;  1EEF D;  2Y4X A;  1QMC A;  2BE7 D;  2EQI A;  1MND A;  1OV3 A;  4QIW E;  1GUS A;  2D0P A;  3DXJ C;  3CCQ A;  3F8T A;  1PH2 A;  3A56 A;  3JV3 A;  1DJR D;  5LJ5 h;  2DM1 A;  1D1B A;  4AFS C;  3QHS A;  1JO8 A;  1Y0M A;  4BUG A;  3M7G A;  1DON A;  4UDU C;  4WJ3 M;  4FDB A;  2WSE E;  2LS0 1;  4R4C A;  2B63 B;  3ER0 A;  2YRC A;  1M27 C;  3G7Z A;  4GBQ A;  2QGQ A;  4BE0 A;  1PH9 A;  1YIT T;  1H9J A;  2DYB A;  3G6E Q;  1HUM A;  3E9I A;  3J81 L;  4X3K A;  1TR5 A;  4A4F A;  3O13 A;  1SXT A;  1RAG B;  1TWH H;  1AH9 A;  2JUF A;  4OB1 B;  5GMK j;  3LGJ A;  3M85 A;  2K01 A;  3QR8 A;  2XHC A;  3KDF B;  2ROT A;  4IUU A;  1LYL A;  3VR3 A;  4RHS A;  1ICW A;  3EGD B;  3PO2 G;  4FT4 A;  5GAN f;  4QVZ A;  2GVA A;  1FR3 A;  1K73 U;  2K9G A;  4NXM L;  1QVG S;  5G3L D;  1UE6 A;  1PD0 A;  3CRL C;  1KIK A;  3QG1 A;  3J80 E;  1W6J A;  3R6N A;  3I3C A;  1LTL A;  2ZTE A;  2HEQ A;  1XQH A;  1UFF A;  5FRM A;  4DNT B;  4ZLT F;  1B9N A;  3H3V C;  2RHU A;  1E6H A;  2O4X A;  3NP8 A;  2EQJ A;  2FRY A;  2EOT A;  5J26 A;  5K5P A;  3EGX B;  2EQM A;  1I3Q B;  4M7D A;  1AEY A;  3QOL A;  3HHT B;  4C3J H;  3G48 A;  4EVO A;  2HZY A;  1WLP B;  4DUZ L;  2F5T X;  4LF4 L;  1WYX A;  3L7Z C;  3CC7 A;  4OL7 A;  1IBM L;  3MCA B;  3UDX A;  1CHQ D;  4O0A A;  4J9B A;  1SHF A;  2F0U A;  1HJD A;  2PZT A;  4JJN K;  4YCU A;  4DOW A;  1AWO A;  1KAW A;  2AHJ B;  1SR3 A;  4K6D A;  1LJO A;  2GQI A;  2MF2 A;  1WHJ A;  5HK3 A;  1E0B A;  1KDB A;  5GRO A;  2PI2 E;  1IHZ A;  3F70 A;  1X01 A;  2YXY A;  1JJ2 A;  4PFZ A;  3I8Z A;  4ZQ3 A;  2W0Z A;  3FPP A;  1E7Z A;  1EQT A;  4KBM B;  2VB3 X;  2EY1 A;  2OI3 A;  3I4M G;  2EGE A;  2QAS A;  1UE9 A;  4M4Z A;  3MEV A;  3ZEH A;  1SN8 A;  2F0W A;  5KRU A;  4DUY Q;  2AWN A;  3THK A;  2EXD A;  3I4N H;  3V7S A;  1EWI A;  5IY0 A;  2K5I A;  2R7Z G;  4JI4 L;  2DN8 A;  2ED1 A;  4WFN 3;  1GL5 A;  4ATO A;  2C0I A;  1VQL A;  2D6F A;  1GVP A;  1D1C A;  2B63 H;  1W6K A;  2RI5 A;  2F0I A;  3TEE A;  1RIP A;  4C8Q G;  1RLP C;  5GAO q;  2KRO A;  1RHP A;  3LWE A;  4J8O A;  2HD0 A;  3PUV A;  2L11 A;  2D0N A;  3SWN C;  4AFZ C;  1SF9 A;  1A3T A;  2VNU D;  1VIE A;  1ZUU A;  4LJZ C;  4RKB A;  1CKM A;  3HZX A;  1Q7Y C;  3KBX A;  4GNX B;  2JA7 B;  4MDW A;  1TU2 B;  1TOV A;  1CKA A;  2NUT A;  1A0I A;  1EIF A;  4CRI A;  1GUG A;  1WTX A;  3MO8 A;  2HAX A;  5FLX E;  3SK6 A;  2J4X A;  1VQH A;  3OPO A;  2JE6 I;  3CPF A;  2N3S A;  2GVB A;  1QVF S;  4P71 A;  1IHV A;  2HNI A;  4DV3 L;  3GF5 A;  1RCV D;  3PMT A;  3P75 A;  4X65 Q;  4BXX H;  1X2Q A;  1L1O A;  5I2Y A;  5KYW B;  4HIO A;  2F3V A;  4C92 F;  1TWF B;  5C3X A;  4OGC A;  3A7L A;  4DR3 L;  1U3O A;  3PSI A;  3F2C A;  3S15 B;  1H8K A;  3L0O A;  1R0C B;  3BDU A;  2SNS A;  5JPM C;  5BN5 A;  3SK8 A;  1WD1 A;  3PIP 3;  2EYW A;  1O80 A;  3SB2 A;  4C0G A;  4L63 B;  2QK0 A;  4IUQ A;  5KND A;  1Y1V B;  1SE4 A;  2MFI A;  5LJ3 g;  4PV1 C;  4DK6 C;  4UY8 C;  3I4L A;  3EFS A;  4DV7 Q;  3CQT A;  4JC0 A;  5GMK m;  2IPK D;  3K6O A;  5D6X A;  2LCL A;  2DXT A;  3GTO H;  1MKH A;  5GAN 8;  1K8M A;  1Q86 C;  5D3I B;  4DR6 L;  2AT1 B;  3H0I A;  2KCM A;  3DM3 A;  5HUR A;  4DR7 Q;  2I5L X;  1HXD A;  2HD3 A;  4AYB G;  2O4X B;  4NXM Q;  2VUM G;  3H0G H;  2A73 B;  1I5O B;  5KE3 A;  1S72 Q;  1YHB A;  3UI2 A;  3ULP A;  2E6Z A;  2DPP B;  2CQO A;  4KJO A;  3ULL A;  1VQO Q;  4DR2 L;  1MJE A;  4AYB E;  1NBE B;  4DV7 L;  2V8K A;  2SEM A;  4BB7 A;  1PC0 A;  4OMO A;  1D5Z C;  1GHK A;  5M5X B;  3OSS C;  2I0Q A;  2I46 A;  4QB4 A;  5GAM g;  2Q2U A;  2MWP A;  5CVI A;  2B2U C;  8ATC B;  5EQ0 A;  4GOP A;  1STN A;  3CC2 A;  1QCB D;  2RD1 A;  2VGN A;  3K5O A;  4R4O A;  4E47 A;  4RG1 A;  1L1O B;  4MN3 A;  3VR6 A;  1LLR D;  4KLK A;  5GJW B;  3RIR A;  4M75 F;  3WVE B;  2LNH B;  1UTI A;  4NS5 A;  3I5R A;  3S3N A;  1Z7T A;  3F2U A;  1N9R A;  4GN4 B;  2OTJ Q;  2F0G A;  3DLL A;  3S2H B;  4CJ2 C;  4Y92 A;  4K2K A;  1STB A;  2EZV A;  1OTC A;  5KIX A;  3WXM B;  3M9B A;  2YDL A;  1WNL A;  1QG7 A;  2JA6 B;  2H5X A;  3QYH B;  4K11 A;  3KJO A;  5M5W H;  1UGS B;  3BYT B;  4LD9 K;  2IPO B;  1LOJ A;  1YNJ C;  2AKW B;  3TEH B;  2XDB A;  2ES2 A;  2L3R A;  1KTK A;  1NBW A;  1M30 A;  5I9P A;  2A5H A;  3K7A B;  4IUN A;  4ZN3 A;  3PIO 3;  1WYD A;  1LTB D;  2VXW A;  4A3J B;  1CUK A;  2K32 A;  1FMK A;  2AUJ D;  2ASB A;  1QKW A;  1HJP A;  4ANJ A;  4LF7 Q;  4ZNX A;  3W1G A;  2QKI C;  3NEM A;  2ZPB B;  5DY9 A;  1PKT A;  2DMO A;  5GMK l;  2CW0 C;  2KCT A;  3G71 A;  4LD6 A;  5EBD A;  3NK9 A;  3EA6 A;  1RKN A;  4DR7 L;  1PH6 A;  1XNR L;  4YIJ A;  1D3B B;  4QVD A;  4QVC A;  3HOU H;  4KHV A;  3K5M A;  2UUB Q;  2JOY A;  3H3V I;  3SD4 A;  3QZ9 B;  3X3N A;  1VQK T;  3M3Y B;  2FVU A;  3J7Z C;  4JI6 Q;  3OS2 A;  5I6Y A;  2D1X A;  2M1H A;  2WSF E;  1WTH A;  4JG2 A;  1LNX A;  1JWS D;  1SE2 A;  2RHZ A;  1SYC A;  5M3M H;  1BCP C;  3RZD B;  1S40 A;  4DV0 Q;  1VS0 A;  3S14 H;  1M5Q 1;  2SOB A;  4DBR A;  4K5X A;  3M0R A;  1VF5 C;  1BIA A;  4CC4 B;  4ME3 A;  3CCV T;  1FXX A;  1SND A;  2AKK A;  4Y91 A;  2DD4 A;  3ME9 A;  4UP9 A;  4S3S A;  1BI2 A;  4J83 A;  4M75 A;  4NPS A;  1Y8O B;  3DB3 A;  1QKX A;  4N4H A;  1Z6H A;  4B3M Q;  2IWH A;  2O2O A;  4BD3 A;  2F4V L;  2CP3 A;  5KYX A;  1E6G A;  4HMI A;  4FU6 A;  2B86 A;  5KYX B;  3F1Z A;  4M7D B;  1Y14 B;  4Z8A A;  2K14 A;  2R92 H;  3JC6 6;  3JAM L;  1E2Z A;  2BCO A;  2NTT A;  2X69 A;  3OW2 P;  3EQL C;  3WOE A;  1JEG A;  4A4I A;  4FF1 A;  3RR5 A;  1OXU A;  3FMC A;  5IN1 A;  3HOY G;  2DIQ A;  1YWO A;  4HID A;  4E7L A;  4HED A;  3LWI A;  2KR3 A;  2DY7 A;  2EXZ A;  2MO1 A;  4L8J A;  5D3D A;  4R4Q A;  2LVM A;  3CKI B;  4M77 F;  1VQB A;  3D4R A;  2RSO A;  4OON A;  2L0A A;  4F04 B;  4DAM A;  1IGU A;  1NE8 A;  5JEA G;  1Q1E A;  1QWF A;  1VQN T;  2L2P A;  1FNW A;  3M54 A;  3G7L A;  2JA9 A;  4ZUJ A;  4IKF A;  3H6Z A;  2E2H B;  1VQN Q;  1N34 L;  1LUZ A;  3CC2 Q;  5CYU A;  2FPF A;  1MJC A;  3C2P A;  1F9R A;  2A74 C;  3E19 A;  1SYF A;  5LMN W;  3S3M A;  1JU5 C;  3CC2 T;  3Q0A A;  3GP7 A;  1UHC A;  4OMP A;  5CV9 A;  5JPN C;  1PTO C;  2E74 C;  1VQP Q;  5LJ3 h;  3OYC A;  1EY9 A;  4IIM A;  3G4S T;  3FC3 A;  2F69 A;  2R92 G;  1EEI D;  3GTJ H;  2RDG A;  4K0K Q;  3H3V H;  2NUC A;  2E64 A;  1BU1 A;  1RJT A;  4NMZ A;  4N9T A;  4DAY A;  4CC7 A;  4BBS B;  3EAE A;  5C3E G;  1CT1 D;  3MP1 A;  1Y1V H;  4HJ7 A;  3A7A B;  4DV1 L;  2E5L L;  2I0N A;  4WTO B;  4RTT A;  3OYH A;  1PZI D;  3KUP A;  3M59 A;  4JLI A;  3J80 i;  3QO2 A;  5GAN d;  1FYC A;  4HT8 A;  1XTD A;  2ABL A;  3CAM A;  2K5F A;  2F2W A;  1SG5 A;  3S1R H;  4JRK A;  4BAC A;  4LDX A;  1BBZ A;  2F0T A;  3M3Y H;  2R7Z H;  3QWX X;  1IRE B;  1W70 A;  5FLX c;  3AFP A;  1M3B A;  1EZZ B;  4DV3 Q;  4RGT A;  3FPU B;  5E7N A;  4A93 H;  2QDY B;  4M1U B;  4EQP A;  3GTK B;  5M3M G;  2WAQ G;  4DKA C;  4A3B B;  2ZPI B;  1SSO A;  4OF1 A;  2HSP A;  1PMR A;  3L2P A;  4A3M G;  2HL5 C;  4KGV B;  3RBB B;  1Q81 C;  2WKC A;  1WZO A;  3BDL A;  4PJO D;  4J9G A;  4JS5 A;  4LUZ A;  1OU8 A;  2XDP A;  1I0C A;  4A3G G;  2VQE Q;  3QZ5 B;  3RMH A;  4B3R L;  1I4K 1;  2E1H A;  3JB9 H;  2X4X A;  2ROL A;  1L0X B;  3NQT A;  1G5V A;  1B7T A;  4J8Q A;  4WRD A;  1SRU A;  2IJ0 A;  1HR0 L;  2MAM A;  3PUX A;  4AMC A;  1MUZ A;  5CAI A;  3MFY A;  2A6E D;  1V1Q A;  2K6D A;  1ZXT A;  3DM1 A;  4DA4 A;  5FO9 B;  2CP2 A;  4A3M B;  3L3O C;  3FJ5 A;  1ABQ A;  2JN0 A;  2M16 A;  4DXG A;  1MV0 B;  1CKB A;  1Y07 A;  3KBG A;  1GUT A;  1EFI D;  1HZ9 A;  2OXP A;  1I4R A;  4QGU A;  4HVW A;  1I07 A;  2E3H A;  2HCK A;  2ZXO A;  4JVZ A;  3REA B;  1HFN A;  3M4Y A;  1YP5 A;  2RHS B;  3CCJ Q;  1WTW A;  1FNU A;  2BZ8 A;  3PTA A;  1S5D D;  1BF4 A;  2E2J H;  3AEV A;  1XWE A;  2X6G A;  2HKN A;  1GJX A;  4JI8 L;  2I5H A;  3I56 A;  1VQ5 A;  1S1N A;  3H6M A;  2V8I A;  5C4X G;  3IAY A;  2NWG A;  1SLJ A;  3DEP A;  1LPL A;  1FWZ A;  3TVT A;  1PH4 A;  4DR4 L;  2CW0 D;  5FK9 C;  4DR1 Q;  2HCC A;  1F77 A;  2QG9 B;  2CZ1 B;  4KD3 A;  1D8L A;  1FD7 D;  1UAP A;  4WCI A;  3H0F A;  1PKS A;  2VV5 A;  3NQI A;  4RWS C;  3G1J A;  4FP5 D;  4KI0 A;  1YCY A;  2CCZ A;  3I55 Q;  4HJA A;  2Z4I A;  1PFS A;  3EN2 A;  1TII D;  1QCO A;  2DXU A;  4J9D A;  1PRT C;  4C8Q F;  3TRZ A;  3CD6 T;  4QQD A;  2R5M A;  1C6V X;  1VQ7 A;  4P73 A;  1VQ6 Q;  2VW9 A;  4A3K H;  3J7A 5;  3M0T A;  4WOR A;  3CCQ T;  3PMF A;  5CKD A;  2R3Z A;  4DA2 A;  4EQO A;  5IYC H;  4KHZ A;  5GAN 2;  2M9U A;  1KLG D;  3OIQ A;  1HNZ Q;  3S6W A;  1PFN A;  2V8J A;  3RZO B;  5GAM e;  5IWA L;  4A4H A;  3HKZ G;  2AQ3 B;  3L2U A;  1ASZ A;  1SDF A;  1ZYR C;  4IFD G;  2BZY A;  2ZT9 C;  2KDS A;  1CSP A;  4M8A A;  5EAY A;  5I4D A;  4MHE A;  3EG3 A;  2F0H A;  2ZZD A;  4DAP A;  2ZXP A;  4XTV A;  4AFQ C;  3KFU A;  2BKD N;  1A63 A;  4FYY B;  3H94 A;  1G2B A;  1P16 A;  1VQ8 T;  4GNX C;  4IFD H;  2VKN A;  1NCV A;  3JAM c;  1UEC A;  1X3E A;  2KBN A;  2QYZ A;  3SFM A;  1MD2 D;  3J81 j;  1R9T B;  4DPG A;  2ED0 A;  1QVP A;  1TS9 A;  1ENC A;  4LDV A;  2OJ2 A;  2EQS A;  2HIX A;  1RAC B;  4NDX A;  4X6A H;  1U4L A;  1LCK A;  3ERQ A;  2RF4 A;  2IHF A;  2QF7 A;  2Y4Y A;  3I72 A;  5HY6 A;  4RGN A;  4B3M L;  1UHF A;  3T56 B;  2K4K A;  1SNM A;  1H9M A;  5T1I A;  2COZ A;  3I56 Q;  1PZK D;  3Q6S A;  2KHI A;  3M4O H;  4C5H A;  4CDC C;  3JCM Q;  4N8F A;  4C3I H;  3OYN A;  2OTJ A;  3OW2 A;  2KXD A;  1SBB B;  3MWY W;  5FO8 B;  3CME Q;  2E76 C;  1XNR Q;  1AW7 A;  4PJO F;  1BUV T;  1WTP A;  1BO0 A;  2UUB L;  4JCV E;  1LT5 D;  3FVQ A;  1KC8 C;  4J9H A;  4ELZ C;  2ID0 A;  1GRI A;  3OMC A;  1D0Y A;  1HXY D;  1C4Q A;  4A75 A;  3TP7 A;  4C5G A;  1H9S A;  3RUZ A;  2F0O A;  4CHT B;  1PH1 A;  4RGO S;  3CC7 T;  3ZBD A;  3RNJ A;  1WHM A;  2AK5 A;  2P4T A;  4R4T A;  4ZKC B;  3D4D A;  1JE5 A;  2BUD A;  2K3B A;  3R6O A;  1NJI R;  1N34 Q;  2NVQ H;  1AE3 A;  2XWJ B;  4BI4 A;  2FB7 A;  4OHJ A;  1WHH A;  2X4J A;  4FW2 A;  3E9F A;  3M4G A;  2OF1 A;  3R3O A;  4DGZ A;  5C4J B;  4OMF B;  1DGS A;  3J7Y W;  2K2V A;  3ND9 A;  4BY1 G;  2PCF B;  2KQ3 A;  1D5M C;  2CHB D;  1X3Q A;  5GAN 3;  4Y52 H;  2DRK A;  4IOC A;  4DR5 L;  2CT4 A;  4OB3 B;  1TQO A;  2AZS A;  5IIF A;  4YY3 Q;  5HCK A;  1GHJ A;  3GLX A;  2UUA Q;  1K73 C;  4LNQ A;  1BI3 A;  2HQL A;  1VIF A;  4AH6 A;  3VR5 A;  4HKE A;  1KIX A;  1KQ1 A;  3W1B A;  4D8D A;  1I4P A;  3S2D H;  1RUW A;  1KHC A;  1TS4 A;  3QIA A;  5EGT A;  5ELC A;  3OW2 S;  2DBM A;  4M77 E;  2JA7 G;  2DX1 A;  3EGU A;  4C92 D;  4LF5 Q;  2EYF A;  3KF6 A;  5M5X H;  1EYA A;  1OI1 A;  2HQE A;  2V1Q A;  1VOM A;  5JJZ A;  1D09 B;  3GTQ B;  2QQA A;  4N0A C;  2FPD A;  1QE6 A;  1KQS A;  2NBF A;  5CR3 A;  3CCJ T;  1M4Z A;  3RDV A;  3EFO A;  3MEA A;  1PWT A;  3OYL A;  3QPH A;  1AEX A;  4JRI A;  3CMA A;  1R4Q B;  2YU9 B;  3JAM i;  1K9A A;  3HOZ H;  2LT1 A;  1Y8P B;  3CQZ H;  3VA5 A;  3S1R B;  4HVV A;  2V26 A;  1X75 C;  2DY8 A;  1T5X D;  2LCC A;  3GV3 A;  1EUJ A;  2EQU A;  2BE9 B;  3BY7 A;  4LDU A;  2DER A;  3TCJ A;  1SNP A;  2XRS D;  3PGG A;  4FXK C;  4EPC A;  4GKK Q;  2RJC A;  4R9W A;  3GD7 A;  2C35 B;  3I35 A;  1ZBJ A;  1V1C A;  1YJW T;  2DJF C;  2AZV A;  2QEJ C;  1Z9F A;  4RG8 A;  4F16 A;  2F0L A;  3STB C;  5CIU A;  2OAU A;  1B44 D;  3X3M A;  2DFU A;  2BOS A;  3EG1 A;  4AG2 C;  2X51 A;  4M75 B;  1F2L A;  1EQQ A;  4FW1 A;  4M78 E;  3VYH B;  4V2S A;  5M3M B;  4QCL A;  1SJE D;  1OZ3 A;  1CTM A;  1YJN A;  2AWO A;  3M53 A;  1PYW D;  4JBJ A;  4YY3 L;  1EY6 A;  1EIY B;  1LT4 D;  2UUA L;  3TSW A;  3ASK A;  4LK1 C;  2QTV A;  5CGK A;  2A28 A;  5I6W A;  4U67 3;  5CK9 A;  1I1J A;  2A08 A;  1Y69 U;  2E5K A;  2G6F X;  1I6H H;  3A8G B;  5IP9 H;  2PZ1 A;  4DK0 A;  1E1O A;  3CRK C;  3RKY A;  1VQF A;  1CKN A;  1QP3 A;  5C44 H;  2B29 A;  1D7Q A;  5CO7 A;  1NJI C;  3MEF A;  2QI2 A;  4XQ3 A;  4C8Q E;  4QL5 A;  2Z8L A;  1WQ7 A;  1CA5 A;  3HFO A;  4R0K A;  1ZLM A;  1X6G A;  4DBH A;  1D0X A;  2AMC B;  1YI2 A;  1ZYR D;  4KKS A;  2RQX A;  3CC7 Q;  1V8Q A;  1HH2 P;  1IKL A;  1UDL A;  1VQE A;  1XMQ Q;  1X55 A;  3BVM A;  1A3V A;  3ULJ A;  4MML A;  4IZ8 A;  3H91 A;  2QDB A;  5GAO m;  1ZHI A;  4XU2 A;  3GPL A;  1S4Z A;  4DF7 A;  2PUK B;  2ZM6 L;  4E2F B;  2CZ7 B;  1F2M A;  3T51 B;  5JVG 3;  3VRZ A;  1IYV A;  2GTO A;  3I70 A;  1XNI A;  1HZB A;  2VQF Q;  1ACM B;  3K7A H;  1NLO C;  1SEM A;  2ATC B;  3QB3 A;  4EQ5 A;  1N6A A;  4ZGE B;  2PNI A;  1TXY A;  3SHL A;  1XMO Q;  1OO9 B;  3FKI B;  1JMC A;  4KY6 A;  1KXL A;  1L0Y B;  4BA2 I;  2EJF C;  3CCU T;  3M5A A;  2EYX A;  5GMK i;  3C1F A;  4DFA A;  2DGY A;  3M4O B;  3IFT A;  4JYA L;  4XT3 B;  1VQD A;  3MXN A;  5D65 A;  2E70 A;  5KCH A;  3NWS A;  4NXN L;  5GAN 7;  1Y1W B;  4AQY L;  1GM5 A;  3A98 A;  1G3S A;  4A3K B;  3EHQ A;  3TS2 A;  1G91 A;  4HXJ A;  2O9S A;  4C92 A;  4YCW A;  1Q86 U;  4LDW A;  2K79 A;  1I4H A;  2Z9H A;  2JA5 G;  5EKL A;  3JB9 J;  2NN6 I;  1AP0 A;  3JCM X;  3OBY A;  4DEX A;  4LUE A;  3UF4 A;  2XSC A;  5BR8 Q;  4A3F G;  4L5R C;  3S14 B;  4A3E B;  3E1S A;  2GQV A;  1HNW L;  1M2V A;  2BDO A;  3EFX D;  2NN6 G;  3CQZ B;  1IBL L;  2A0F B;  1D1K A;  5HGQ A;  1HHV A;  1J9O A;  1Q8K A;  2B8F A;  1LTT D;  4RKL A;  4DAY B;  1TT2 A;  4QMG A;  4ZK9 B;  4X3U A;  4PLI A;  1I6V C;  2FHT A;  2CKK A;  1MMG A;  2JXM B;  3BVZ A;  3ND8 A;  4HCC A;  5GAH C;  4F17 A;  2EIF A;  2R57 A;  1UE1 A;  7AT1 B;  1QIL A;  5BN3 A;  1HNW Q;  1B3Q A;  3HOY B;  4IUR A;  3I55 T;  5EBC A;  2SDF A;  4X64 L;  1BB9 A;  3QBY A;  2EAY A;  1MNE A;  1ZA1 B;  1SNQ A;  2AUK A;  3BDO A;  2DNE A;  1Z47 A;  2KEC A;  3GO5 A;  2FFK B;  1QVC A;  3JCM b;  5F2D A;  3HOW B;  2VAS A;  5CKB A;  1L0W A;  3VS7 A;  5KYU B;  1W4S A;  1KAB A;  1O9S A;  2D9U A;  5IE8 A;  2VYT A;  1A15 A;  4KMU C;  2DVJ A;  3A5U A;  4OWT B;  4KJN A;  4M7A A;  3VS0 A;  3L1A A;  4J7F A;  2XIW A;  4JOI C;  3U9S A;  3R8B A;  3HOZ G;  2JK8 A;  2E5L Q;  1LTG D;  5NUC A;  3KLR A;  2NUZ A;  1KSW A;  1E2W A;  5DNF A;  2L0C A;  3U58 A;  3MET A;  4IUP A;  1K73 R;  4CDF C;  1STH A;  3TP5 A;  2VXE A;  4JS4 A;  2YUN A;  3O5Z A;  1CQV A;  4M7D G;  1MBY A;  4DV5 L;  2OTL Q;  4RGM A;  5D6Y A;  5GAM h;  2ALY B;  2ZXR A;  5GAN 4;  4LW1 A;  2PU9 B;  2KVQ G;  2RHX A;  4M77 D;  2JA7 H;  3S1M H;  3M0Q A;  1RL2 A;  1LT3 D;  2L4N A;  2DJZ A;  3SVM A;  3CCL A;  1TSF A;  2CSQ A;  2HQX A;  4EMK B;  2LXJ A;  3MC0 B;  2EBP A;  3OB9 A;  4MZM A;  5C5M A;  2RA2 A;  2LSS A;  3A5Z B;  1IL8 A;  1NEB A;  1VQN A;  5HK0 A;  4RUG A;  2D8H A;  3VS4 A;  3KLS X;  2NUP A;  2E5Q A;  2H1E A;  2L9H A;  5IGG A;  2QAZ A;  3FB9 A;  4RFB A;  1B8A A;  2E75 C;  1QZG A;  3CCE T;  1TUG B;  1R4P B;  4JV5 L;  1JXO A;  3A8L B;  1EYD A;  4FF4 A;  5KYU A;  1SE8 A;  5ELO A;  2F0Q A;  3NBI A;  1RAH B;  1YNX A;  1STA A;  1XMQ L;  1N8R U;  3CP0 A;  3FEO A;  5GAN 6;  3PUW A;  2O2L D;  4HMJ A;  4MIU A;  1YEZ A;  1K8O A;  3M0U A;  2V1R A;  3LWH A;  2E4H A;  3TZD A;  1WDX A;  1EU4 A;  4M75 E;  4ZGD B;  3E0J A;  4BXX G;  3U50 C;  5IGC A;  4OO1 I;  3VYS A;  1UG1 A;  4M78 D;  3HKZ E;  4C0Z A;  2BE5 C;  5IGB A;  1PLF A;  1TWB A;  1A62 A;  4ZYS A;  4FSX A;  4A63 B;  1U1S A;  1FVI A;  5AFW A;  1IXR A;  3BG3 A;  3V05 A;  1NAP A;  4XK8 E;  4A3B G;  1VQ4 Q;  1ZA2 B;  4M7A B;  2EGA A;  1IZ6 A;  1XOV A;  2I2L A;  4LNP A;  4QKU A;  1F2Y A;  1OXT A;  5IHN A;  3UPU A;  2KVM A;  3OTO L;  2EY6 A;  2J06 A;  4GKK L;  4EMK A;  2F3W A;  3X28 B;  1GBR A;  1EU3 A;  1JCK B;  4OWW B;  1UGR B;  5L23 A;  1X3P A;  4H02 A;  4Y7N B;  1YFN A;  2CT3 A;  4X34 A;  1Q82 C;  2Q8R E;  1A0N B;  1GUW A;  1LTR D;  1HYO A;  4BE1 A;  1A3U A;  4CC3 A;  2F4V Q;  1P92 A;  5FLX L;  3HOW H;  2X9H A;  4JDS A;  1LAB A;  2C0T A;  4H44 C;  2CZ0 B;  4ZKB B;  3CMA T;  3T4A C;  4CC2 A;  2OAW A;  1Q7Y R;  2X4W A;  2JEB I;  2EKO A;  1BK2 A;  3I55 A;  3J80 L;  4KHP Q;  1NEG A;  2DKG A;  1OPK A;  3RES A;  2HUG A;  2UXB L;  1QJO A;  2HDL A;  2Z6K A;  4X66 Q;  1ZSZ C;  4G7O C;  4OO1 H;  1MGS A;  3J80 c;  1GXD C;  4IPC A;  4HCZ A;  5KYY A;  1G3T A;  4C1N K;  1XYI A;  3R93 A;  5KYN A;  2MYS A;  3BU2 A;  2QGG A;  2E8G A;  3ZYY X;  4GS3 A;  2RO0 A;  3NHH A;  3ZJY C;  1K0S A;  1STY A;  4RH6 A;  2DNC A;  1QW1 A;  2ZJP A;  1K0X A;  1DXM A;  1F9P A;  1QQJ A;  3E6Z X;  5IYB G;  2LMJ A;  2LT4 A;  2IX3 A;  4GKJ Q;  2BDN A;  3T1H Q;  2AQ2 B;  2VB2 X;  4G57 A;  5I9O A;  3JCM V;  3S16 H;  2CP6 A;  3MJX A;  2F0M A;  4A3E H;  1TWC H;  3UDI A;  3SWN A;  1LT6 D;  5GAO r;  1VQ9 A;  4TRD A;  1M1G A;  4PNO A;  3I90 A;  3TME A;  1FGU A;  3VS2 A;  5GMK h;  3GBQ A;  1NYG A;  3UT1 A;  1BR9 A;  2ZTC A;  3M58 A;  2LJ3 A;  3TQY A;  1IXD A;  2BZX A;  2JQO A;  5GAN 5;  1EQV A;  5CV8 A;  4DXF A;  3VU3 C;  3C4S A;  4EMH A;  1YIJ T;  1EQR A;  2F5K A;  2XWB B;  4GY5 A;  1YNJ D;  1NSN S;  2A1A A;  1VMP A;  4BY7 H;  2B2Y A;  1KQS P;  1YJW Q;  4QQG A;  2P4R A;  1TG0 A;  1VQM A;  4F7U A;  4OB0 B;  2EJ9 A;  1KK7 A;  3QJ6 A;  1FL0 A;  4Z88 A;  3EH1 A;  2VL6 A;  1XPR A;  1NZ9 A;  3HG9 A;  4OML A;  1MHN A;  3CCJ A;  1NR2 A;  1VQI A;  1RF2 D;  3JCM c;  3MEU A;  4MZP A;  1PHJ A;  1IW7 C;  3CCR Q;  3P1H A;  5CV5 A;  4JV5 Q;  3ERS X;  2NTS A;  2RI3 A;  2W10 A;  4FVM A;  4JBK A;  1FYN A;  1QLY A;  3CME T;  2XVS A;  3TS0 A;  1M90 R;  3CCL Q;  1BCP B;  4C0D C;  1UEB A;  2CYZ B;  2HCI A;  5ELB A;  2GF7 A;  2K3Y A;  3VYG A;  4E7I A;  4K8J A;  1I94 Q;  2E2D C;  4G7H C;  3IQL A;  1H64 1;  2VQF L;  3W2D A;  3MA2 B;  3CBM A;  1Y8N B;  4B3R Q;  3EG0 A;  2SNM A;  4BBR H;  1UGV A;  4MZ9 A;  3KLW A;  4E7J A;  2RJE A;  3S24 A;  1X6B A;  3S1M B;  3KDF A;  4IUV A;  4VUB A;  5CR2 A;  3RER A;  4Z89 A;  3CPW S;  3JB9 F;  4X9C A;  3I56 T;  3HRZ C;  4DV1 Q;  2DEQ A;  2L3S A;  3JCM W;  1JJC B;  1V43 A;  2KCC A;  5CQX A;  2RQT A;  2E2H H;  2IHE A;  3VA7 A;  3GDE A;  2MNA A;  5GAN j;  2IW3 A;  4LF4 Q;  3OYK A;  3PO3 H;  4XTZ A;  5KYW A;  4HCB A;  4M75 C;  1GUO A;  4RTV A;  1Q82 R;  3A8H B;  4ABN A;  3K0X A;  4A3M H;  1GFD A;  3RZD H;  1X43 A;  4P74 A;  1JWU D;  4IJL A;  1WVL A;  2VZA A;  3K59 A;  3TQ7 P;  3S16 B;  3M56 A;  5C4H A;  4JRQ A;  1I4Q A;  3M4P A;  4LXC A;  3HGB A;  5JEA H;  4LF9 L;  1J8I A;  1VQJ A;  3RZO H;  3DKM A;  3JSC A;  1B53 A;  4PFP A;  3EHR A;  3GNF B;  2QQS A;  1U4R A;  4KRT A;  2Z6K C;  2L8D A;  3A8I E;  4UP8 A;  2DXC A;  2WAQ E;  1EIH A;  4J6W A;  2UXD Q;  4LN2 A;  1M8A A;  4UPA A;  3VJP A;  3IKJ A;  3M55 A;  2NYZ D;  2LRQ A;  3T53 B;  1TUD A;  2PZU A;  5KYL A;  2X3X D;  1ENF A;  4GZY C;  1SMY C;  5IYD G;  2FHD A;  1MMA A;  1FX7 A;  4E7H A;  3TZU A;  5A0D A;  4EMG A;  2K57 A;  4XQN A;  2KI7 A;  1UE5 A;  4AG1 C;  1N9S A;  4JUV A;  3C0C A;  1H95 A;  4FT2 A;  4DQ2 A;  5CKF A;  3CXC S;  2KUM A;  5A2Q L;  5C6A A;  3M7N A;  2GFU A;  4PG3 A;  1XNQ Q;  2MPX C;  2DIL A;  1ILP A;  1Y7X A;  5ELE A;  2ZPG B;  2X35 A;  4KH1 B;  4RCC A;  1K1Z A;  4PQX A;  4EDU A;  4MTN A;  4DNI A;  4IPH A;  2R93 B;  3P20 A;  4IQZ A;  2DL3 A; 
#chains in the Genus database with same CATH homology
 1NG2 A;  3EG3 A;  3ULR B;  2O88 A;  2LX7 A;  3VRY A;  2CRE A;  1SRM A;  4AFQ C;  2RQV A;  1NLP C;  1G2B A;  2LJ1 A;  2VKN A;  2LZ6 B;  1UEC A;  2PTK A;  5IXF A;  1H3H A;  2ED0 A;  2DA9 A;  2OJ2 A;  2DF6 A;  2LCS A;  1LCK A;  3UA7 A;  1GBQ A;  1GCQ C;  1UHF A;  1ZSG A;  2JW4 A;  1M3C A;  1PRL C;  1T3L A;  1U5S A;  2KXD A;  3NMZ C;  4J9I A;  1WIE A;  1MV3 A;  1JXM A;  2DJQ A;  3I9Q A;  2MOX A;  4J9H A;  2JMA A;  1GRI A;  2O31 A;  2DRM A;  5FWB A;  4JPB W;  1UJ0 A;  2D8J A;  1ZUY A;  2A37 A;  1SSH A;  2KGT A;  3NPF A;  5EC7 A;  2JTE A;  1T0H A;  4JJD A;  3RNJ A;  1AVZ C;  2AK5 A;  2KRN A;  2K3B A;  3NHN A;  2F2V A;  2BTT A;  2EQI A;  1OV3 A;  2A36 A;  2RPN A;  3JV3 A;  2HBW A;  2DM1 A;  4AFS C;  1JO8 A;  1Y0M A;  2VVK A;  4JZ3 A;  2DRK A;  2CT4 A;  2FG0 A;  1M27 C;  1WX6 A;  2AZS A;  4GBQ A;  5HCK A;  2DYB A;  2LQW A;  1SPK A;  4IIO A;  4D8D A;  2KRS A;  1RUW A;  2ROT A;  2DBM A;  2DX1 A;  3EGU A;  4OMM A;  2GBQ A;  2V1Q A;  2K9G A;  1N5Z A;  4RTY A;  2FPD A;  3SEM A;  1VYV A;  3M0P A;  1Z9Q A;  1KIK A;  2SRC A;  3R6N A;  4DEY A;  1PWT A;  2GNC A;  2RQU A;  2HEQ A;  1K9A A;  1UFF A;  4HVV A;  2L3P A;  1WXT A;  1E6H A;  1ABO A;  2FRY A;  1VYU A;  2CH4 W;  1AEY A;  1ZUK A;  1WLP B;  1WYX A;  3I35 A;  1ZBJ A;  1V1C A;  5IH2 A;  5I22 A;  2AZV A;  4F16 A;  4J9B A;  1SHF A;  1HJD A;  3EG1 A;  4AG2 C;  1AWO A;  1UUE A;  2J7I A;  2GQI A;  1AD5 A;  3TSW A;  1AWW A;  1AZE A;  2A28 A;  2JT4 A;  1I1J A;  2A08 A;  2M51 A;  2E5K A;  2G6F X;  2W0Z A;  2PZ1 A;  4X1V A;  2OI3 A;  2EGE A;  1UE9 A;  4M4Z A;  3THK A;  2DBK A;  2J6K A;  2EPD A;  2ED1 A;  1GL5 A;  2C0I A;  4R0K A;  1ZLM A;  1X6G A;  1RLP C;  2FO0 A;  2KRO A;  1UDL A;  2CDT A;  2MIO A;  2JS0 A;  2D0N A;  4AFZ C;  4J9C A;  3U23 A;  1U06 A;  2KYB A;  1ZUU A;  3VRZ A;  2GTO A;  2MCN A;  5IHI A;  1NLO C;  1SEM A;  1CKA A;  2ESW A;  2PNI A;  2JM8 A;  4EIK A;  1OPL A;  1EFN A;  1Z9Z A;  2GTJ A;  2KYM A;  2EYX A;  1VA7 A;  1PNJ A;  2IIM A;  1X2Q A;  2NWM A;  2YUQ A;  1U3O A;  3A98 A;  1H8K A;  3EHQ A;  2GGR A;  4HXJ A;  1TUC A;  2JXB A;  2O9S A;  3I5S A;  2K79 A;  2DL7 A;  2CUD A;  1K4U S;  4F14 A;  3TSZ A;  4LUE A;  3UF4 A;  2EYW A;  4DEX A;  4LE9 A;  1GCQ A;  2RMO A;  5GJV B;  3CQT A;  2HDA A;  4D8K A;  3H0I A;  1WFW A;  3NGP A;  3ZL7 C;  4F17 A;  1B3Q A;  1BB9 A;  1H92 A;  2SEM A;  2LQN A;  2YSQ A;  1T3S A;  4OMO A;  2F2X A;  3VS7 A;  4E6R A;  2DVJ A;  1UJY A;  1GFC A;  1NM7 A;  3VS0 A;  1W6X A;  2KT1 A;  2X3W D;  5GJW B;  2NUZ A;  1KSW A;  2LNH B;  1UTI A;  3I5R A;  1ARK A;  1WXB A;  1M8M A;  1IO6 A;  4Y92 A;  4AFU C;  2YUN A;  3O5Z A;  3PVL A;  2YDL A;  4K11 A;  1GCP A;  3VS6 A;  1M30 A;  3M0Q A;  3UAT A;  5IXB A;  4J9F A;  1FMK A;  2DL5 A;  2CSQ A;  5FWC A;  1QKW A;  1T0J A;  2RNA A;  2EBP A;  2L3Q A;  4ZNX A;  1SHG A;  1PKT A;  2DMO A;  1NEB A;  2C0O A;  4RUG A;  2D8H A;  3VS4 A;  2DL8 A;  1AWJ A;  2XMF A;  1K76 A;  3REB B;  2YUP A;  1JXO A;  2RN8 A;  1Y57 A;  2D1X A;  3LH5 A;  2FEI A;  1E7O A;  3M0U A;  2V1R A;  3M0R A;  1KJW A;  1WDX A;  4CC4 B;  4RTW A;  2AKK A;  3VS1 A;  1UG1 A;  2KXC A;  2LP5 A;  4A63 B;  1QKX A;  1RI9 A;  2J6F A;  2O2O A;  2EGA A;  1XOV A;  3QWY A;  4LNP A;  1E6G A;  5IHN A;  4GLM A;  2B86 A;  2J06 A;  5FW9 A;  4Z8A A;  1GBR A;  4JJC A;  1JEG A;  5L23 A;  2DNU A;  1YWO A;  2CT3 A;  1A0N B;  1QCF A;  2YT6 A;  2FRW A;  2KR3 A;  4CC3 A;  4RTX A;  2J6O A;  2JMC A;  2C0T A;  1OEB A;  2L0A A;  4CC2 A;  2OAW A;  1AWX A;  1BK2 A;  1QWF A;  1NEG A;  2L2P A;  1OPK A;  2FPF A;  5I11 A;  1YN8 A;  2RF0 A;  1WA7 A;  4LUD A;  1JU5 C;  1UHC A;  4OMP A;  1K0S A;  2RQW A;  2DL4 A;  2O9V A;  1PHT A;  3M0S A;  4IIM A;  2AKL A;  1K0X A;  2VWF A;  2LMJ A;  1BU1 A;  2EW3 A;  4CC7 A;  3VS5 A;  2I0N A;  4RTT A;  4HCK A;  3VS2 A;  3GBQ A;  1NYG A;  2DLP A;  2LJ3 A;  4OMQ A;  2ABL A;  2BZX A;  2EVR A;  2F2W A;  1QWE A;  3KFV A;  2QDL A;  1BBZ A;  2EYY A;  4OMN A;  2J05 A;  3QWX X;  1KFZ A;  1X27 A;  1W70 A;  1M3B A;  2KE9 A;  2P4R A;  1TG0 A;  5IHK A;  1PRM C;  4RTU A;  2HSP A;  4Z88 A;  1B07 A;  3VS3 A;  3RBB B;  4OML A;  1OOT A;  4J9G A;  2ECZ A;  1ZX6 A;  2FPE A;  1I0C A;  3PE0 A;  2W10 A;  1M3A A;  2ROL A;  1HD3 A;  3H41 A;  1FYN A;  1YCS B;  1QLY A;  2EKH A;  2JS2 A;  1NYF A;  1MUZ A;  2CH4 A;  2K6D A;  2EYZ A;  2RQR A;  3IQL A;  1G83 A;  4JJB A;  3FJ5 A;  5ECA A;  1ABQ A;  1MV0 B;  3EG0 A;  1CKB A;  1UGV A;  4HVU A;  1X6B A;  2K7A A;  1RLQ C;  1I07 A;  4HVW A;  4Z89 A;  2HCK A;  4J9E A;  2L3S A;  1YWP A;  3REA B;  1X69 A;  4ESR A;  1YP5 A;  1X2K A;  2K2M A;  2RQT A;  2BZ8 A;  3SHW A;  2JM9 A;  3UA6 A;  1YNZ A;  2KBT A;  2CSI A;  1J3T A;  1S1N A;  4RTV A;  1HSQ A;  2KRM A;  2CUB A;  1AOJ A;  3PVQ A;  1W1F A;  1WXU A;  3TVT A;  1GFD A;  1X43 A;  1VYT A;  4ORZ A;  1AZG B;  2ENM A;  1SRL A;  4QT7 A;  3H0H A;  1PKS A;  3H0F A;  3EHR A;  3EG2 A;  2YUO A;  4WCI A;  2DE0 X;  4JZ4 A;  4KRT A;  4RTZ A;  2KNB B;  4LN2 A;  1JQQ A;  1CSK A;  4J9D A;  1TUD A;  2EGC A;  2KEA A;  4FSS A;  2X3X D;  2KT8 A;  2LJ0 A;  2H8H A;  3M0T A;  1WI7 A;  4AG1 C;  3C0C A;  2DIL A;  1K1Z A;  2BZY A;  2M0Y A;  2DL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...