2QDLA

Crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
154
structure length
154
Chain Sequence
KHHHHHHPMPKKIVVFSLAEELYGLDIFDVHEVVKDVSITKIPETPEFIEGIINLRGKIIPVIDLKKRFGIGKRGKSKDSRIIIVEILGQKAGLIVDAVHEVIPIDENSIEPPPPVTTIDTAFVEGIAKTDDKMIIIIKLHFLFEVNGKEMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis signal transduction protein
publication title Crystal structure of scaffolding protein CheW from thermoanaerobacter tengcongensis.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Signaling protein
total genus 25
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2qdlA01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2qdlA02
2EVRA 4RTWA 2KYBA 2LNHB 3VS0A 4CC2A 1H3HA 2W0ZA 2DYBA 4Z89A 4D8KA 2DL8A 3CQTA 2D8JA 1K1ZA 2DL3A 1WIEA 1U5SA 1W6XA 2GBQA 1GFDA 2W10A 1M27C 1KFZA 2X3WD 2EYZA 1E6HA 1G2BA 1IO6A 2RQWA 1UHFA 1SPKA 4K11A 1N5ZA 1UUEA 2KBTA 1WLPB 2YDLA 4J9GA 4WCIA 5FWBA 1NEGA 1JU5C 1NG2A 3SEMA 1MV0B 2D1XA 1AWOA 3I9QA 2M0YA 2ED0A 1QKWA 4IIOA 1KIKA 2EYYA 3O5ZA 4AG2C 2FG0A 2CUDA 4JPBW 2J06A 1UE9A 2E5KA 3U23A 2EW3A 2FRYA 2FRWA 2KR3A 1YN8A 1K76A 2YUOA 1A0NB 2FO0A 2FEIA 2QDLA 1T0HA 3QWYA 2JTEA 1T3LA 2RNAA 5IXBA 1K0SA 2O2OA 2C0OA 2DBMA 4KRTA 1RLQC 4RTXA 2JS0A 1SRLA 2F2XA 1I07A 3SHWA 2DF6A 4QT7A 3RBBB 2LJ1A 5L23A 2SRCA 2LZ6B 4J9FA 1JQQA 2OI3A 2J6KA 4GLMA 3I5SA 3NGPA 4DEYA 2EGCA 1Z9ZA 1AEYA 1B07A 1EFNA 4AFUC 5IHNA 2K3BA 1ABOA 2HBWA 2ECZA 2PZ1A 1Z9QA 3FJ5A 4JJDA 3KFVA 2F2VA 1UTIA 1YCSB 2GTOA 3TSZA 5IHKA 2KRMA 2CH4A 2YT6A 3PVLA 2DVJA 4D8DA 4RTYA 2JMCA 1WFWA 2EPDA 2DLPA 3M0PA 1B3QA 3NMZC 2L3SA 2KRNA 2MOXA 5EC7A 3JV3A 1SHFA 2H8HA 2L3QA 2V1QA 4LNPA 2DL4A 2EGEA 2O9SA 4JJBA 3EG2A 2VVKA 1TUDA 2YSQA 3VS2A 4HVUA 2DNUA 1OEBA 2DBKA 1MUZA 1X2QA 2YUQA 2D8HA 2HEQA 1X27A 1SRMA 4A63B 1WX6A 2KXDA 1AOJA 1M3CA 2ABLA 3M0UA 3UA7A 5HCKA 2LJ0A 2DA9A 2M51A 1V1CA 3UA6A 1WXTA 2P4RA 2K79A 3H41A 1OOTA 1VA7A 1X6GA 4DEXA 2I0NA 1W1FA 3VS1A 4CC4B 4RUGA 4JJCA 4ESRA 2DJQA 2AZVA 4E6RA 2MCNA 4Z88A 2PTKA 1JEGA 2O31A 2YUNA 2LQWA 1ZUUA 1BU1A 2MIOA 4CC3A 2RQRA 1OPLA 2JW4A 4HCKA 1BB9A 1M3BA 1HSQA 3VS4A 1UG1A 2LQNA 2K6DA 2EKHA 3C0CA 1K4US 2JM8A 4LUEA 1WI7A 3H0IA 1UJ0A 1SHGA 2L0AA 1X69A 1WA7A 3PVQA 3REBB 2JT4A 4LN2A 2AKKA 1AVZC 1GRIA 1QLYA 1HD3A 4OMLA 3UF4A 3REAB 4M4ZA 2CT3A 2KT8A 1U3OA 1UJYA 1I0CA 1GCQC 2A08A 2KRSA 1BBZA 2A28A 1RI9A 2IIMA 2VWFA 2X3XD 3A98A 5GJVB 2EYWA 2RQUA 5GJWB 1WXUA 2DE0X 1G83A 3M0SA 2KXCA 1T0JA 3NHNA 1NLPC 1PRMC 1QKXA 2FPFA 2LJ3A 4GBQA 1YNZA 2AKLA 1ZSGA 3M0TA 1ABQA 4LUDA 3THKA 4Z8AA 2FPEA 3EHRA 2RF0A 2RN8A 4J9IA 3GBQA 1SEMA 2FPDA 1ARKA 2C0IA 2BZXA 2HDAA 2G6FX 4Y92A 2KEAA 2HCKA 2A36A 2GNCA 4J9BA 1CKBA 1KJWA 1OPKA 2L3PA 1I1JA 1YWOA 1TUCA 1CKAA 2AZSA 3VS3A 1J3TA 2F2WA 3EHQA 4AFQC 1Y57A 2ENMA 1GBRA 1OV3A 2OJ2A 2J6FA 1S1NA 4RTTA 2KYMA 1UECA 4LE9A 2GTJA 4OMQA 3UATA 4R0KA 5FWCA 5IH2A 1AWWA 2ROLA 2J7IA 2JS2A 3IQLA 1PKTA 2V1RA 1JXOA 1NLOC 3VRYA 1JO8A 2CH4W 1ZUKA 2CDTA 2EBPA 2LCSA 4RTUA 1K0XA 4RTVA 1AWJA 4F17A 2C0TA 3QWXX 3VS6A 1PNJA 1LCKA 1QWFA 1GCPA 1M3AA 1SSHA 1PWTA 1ZBJA 1YP5A 2DILA 1PRLC 5IXFA 3H0HA 2K9GA 3VS5A 2AK5A 3I35A 2L2PA 4HXJA 1X43A 1HJDA 4EIKA 2KT1A 1NEBA 1ZX6A 4CC7A 1MV3A 2RQVA 4OMMA 2DRKA 3EG1A 4X1VA 1UFFA 2JMAA 2RQTA 3R6NA 4OMNA 2EYXA 1NYGA 4ORZA 1VYUA 3LH5A 1GFCA 2KGTA 1M30A 1PKSA 4F14A 1FYNA 1WYXA 5ECAA 3TSWA 1UGVA 2DRMA 2O9VA 2JM9A 4OMOA 3H0FA 1GCQA 1X6BA 1GBQA 3ZL7C 1VYVA 1E7OA 4HVWA 2PNIA 2LP5A 1H92A 2HSPA 1ZUYA 5FW9A 1E6GA 2JXBA 2LX7A 1QCFA 3EG0A 2B86A 2ESWA 2ED1A 1AWXA 1JXMA 2RMOA 3TVTA 3EGUA 4AFZC 1XOVA 1NM7A 2EGAA 2BZ8A 1RUWA 1M8MA 1BK2A 2NWMA 1QWEA 5IHIA 3NPFA 2NUZA 2RPNA 1Y0MA 1WDXA 3M0RA 4JZ3A 1FMKA 4IIMA 4J9CA 2K2MA 1GL5A 2D0NA 2DL5A 2EQIA 1UDLA 3ULRB 1UHCA 4HVVA 2VKNA 1VYTA 3EG3A 3I5RA 4JZ4A 4F16A 2BZYA 4ZNXA 2GGRA 4J9DA 2ROTA 3M0QA 1AZEA 3RNJA 2A37A 2DMOA 1X2KA 1NYFA 4AFSC 2CREA 2DL7A 1TG0A 5I11A 1K9AA 2XMFA 2KNBB 2CUBA 2CSQA 1CSKA 1RLPC 1PHTA 5I22A 2BTTA 2O88A 1U06A 3VRZA 2DM1A 1H8KA 1T3SA 3VS7A 1YWPA 2DX1A 4RTZA 2SEMA 4AG1C 1ZLMA 2LMJA 2J6OA 4OMPA 2CT4A 1WXBA 2CSIA 1AZGB 1KSWA 1W70A 4FSSA 2YUPA 4J9EA 2KROA 2J05A 4J9HA 1AD5A 2OAWA 2K7AA 2GQIA 2KE9A 3PE0A
chains in the Genus database with same CATH superfamily
2FZGB 4RTWA 1VQLQ 1W2BP 4PMCA 5M5YB 2LNHB 1QVCA 1J5EQ 4JI6Q 4BS9A 1N32L 1G3YA 2W0ZA 1EIGA 3E9FA 4YWMA 4OB3B 1G2SA 2QQ9A 2D8JA 2P0PA 1WIEA 4DNTB 1S5FD 1TU2B 2DVEA 1RABB 4XQ3A 1TWBA 2DNCA 1OZ3A 2ZTCA 4LJZC 1XPUA 3S14B 1RJTA 2D5DA 1YZ6A 1X75C 2JXMB 2K5WA 1PH2A 1RADB 1X3PA 2L9HA 3A74A 4A3GH 5ISRA 1JOOA 5TSSA 4XTYA 1G2BA 4MTKA 4L5SA 4OMFB 2B8AA 3F8TA 3D3RA 2DFUA 1A8VA 5C44H 4DBQA 2VQEL 1XXGA 2PUKB 4DV1Q 1JMCA 1G5VA 2A73B 1WLPB 2L4NA 1BBUA 4BBRH 4J9GA 1VQPT 1VQNT 3BS1A 4WCIA 2BE5C 1NEGA 1YIJT 1SYBA 1YIJA 2K1BA 1XNQL 4QQDA 2NYZD 1NCVA 4X9CA 3J80i 2QGGA 2KCTA 1U1TA 3SK5A 4PJOF 3TBIB 1EYGA 2HHHQ 5C0MA 3CCST 4DK0A 3TCJA 4BE1A 3CCSA 2ED0A 3CF5A 4LF9Q 4K8JA 3AFPA 3VYHB 2RA2A 1D1IA 2J4XA 1KIKA 5CCAA 5C6SA 2RCFA 3O5ZA 4OELB 3STBC 2FG0A 2PI2E 2PVGB 4JPBW 1BI1A 1HPCA 2J06A 2FHDA 4FYYB 3CC2Q 1ENFA 2JN4A 1QCNA 3CQZH 4MZPA 3EA6A 4BBRB 4UP7A 4M7AD 1XNRL 3GTMH 2FRWA 5FLXL 4BA2I 3UT1A 2KR3A 5C6AA 2PZUA 3GDEA 1M8VA 2YUOA 3EGXA 3LX0A 1B3AA 3EGXB 4OHJA 1VQGA 5DLQE 4D6WA 2CQAA 2XDPA 2CP7A 2X6LA 5FO7B 3ICEA 2RNAA 3FEOA 3VKIA 2E4HA 4JRQA 2K6AA 3R93A 3TN2A 2WV6D 2O2OA 1RLQC 3HHTB 4RTXA 1SRLA 2F2XA 1I07A 2L5QA 3SHWA 1R4PB 2F03A 2DF6A 2PPBC 3CQZB 1N33Q 1SNMA 2OXPA 1PSEA 1BI2A 3J7A5 2LZ6B 3BFMA 1K73U 1PYSB 3X25B 2K50A 1G3TA 4PJNA 1NY4A 4C8QC 2Y0SG 2J6KA 4R9WA 4JYAL 1JT8A 4C8QA 5DM73 1B07A 1O78A 4C8QB 5HGTA 4AFUC 5FO8B 4HCCA 3AHUA 5IHNA 1HA6A 3PIOA 2FMCA 4K2KA 1ABOA 3JAMi 1R8OB 2Q8TA 2ECZA 4GKKL 2F1MA 2E6NA 2N3SA 2PZ1A 1W3SA 5JJLA 3I7FA 5IYBG 3I8ZA 2R92B 4B3SL 2RK2A 2HDLA 2F2VA 1WJJA 4KHPL 4M7AF 1IYVA 4N4GA 2K3XA 3OY9A 4GOPC 1M1KU 2JA5G 2Z6KC 2KRMA 1XQHA 4GOPA 2NVXB 5C4JH 4GOPB 2Z6KA 3PVLA 4A4KA 4NMZA 3CC4T 1F77A 4RTYA 3CC7Q 4HCZA 2XIWA 3CC4A 4F8MA 3PQIA 3PIO3 1FGUA 3J80E 4KJOA 2L11A 2EPDA 3M0PA 4DR4Q 3B6YA 4OWTB 4YIJA 1EQVA 3HG9A 3RNUA 1GUNA 1H95A 1PH3A 3DUZA 1U0LA 1U1SA 3JV3A 3RN5A 2HQEA 1SHFA 2Y90A 4ZGEB 1F9QA 1BYMA 1ONLA 2WP8J 3FPUB 3IRBA 4Z9CB 2V1QA 2VUBA 4LNPA 1D5XC 4XT3B 4DK6C 1SE4A 2M1HA 2O9SA 5LMNW 5C4JB 1H3ZA 1QZGA 3F70A 3IL8A 3EG2A 2VVKA 1TUDA 4DR7L 2XHCA 2YSQA 3VS2A 5GAMf 4MN3A 3KDFA 2K01A 1OEBA 2DBKA 2O01E 3KDFB 1HNXQ 2HL5C 4NL2A 3I73A 1U9RA 1BXTA 1ZXTA 3LWEA 1HR0W 3CCMT 4HJ9A 4FYDA 3CCMA 3T56B 2QEXQ 3LW5E 2E74C 1ZBXA 2HMAA 3P75A 1D0YA 1UE1A 2PZTA 2YXYA 3ONAB 2NN6I 1YNNC 1X55A 1OX8A 2DJFC 2M51A 4ZGDB 3QWNA 3D0FA 1V1CA 4CKCA 4LFAL 5LJ3d 4K2LA 2EOTA 1PZID 1IBML 1EY8A 1D1KA 2UUCQ 1SJHD 2EIFA 2B63H 2PQWA 1W1FA 3V8LA 1SRUA 1ENAA 1Q82R 1STAA 5C4XG 1A63A 4CC4B 4DV3Q 2XN9C 3JCMf 1MNDA 1YI2Q 4ESRA 1V1OA 1VQ4T 1R0BG 2AZVA 2DJQA 1ZEQX 4HJ8A 2PQAA 1BCOA 2HCCA 5GROA 2PQAB 3ER0A 4OGCA 1RCVD 1QNUA 3OYIA 1D5MC 2K52A 2MJ8A 4B08A 1EIYB 4LF5Q 1XYIA 4MZMA 4FDBA 1MMNA 4CC3A 1YHQQ 1GUWA 1KK7A 1SG5A 2RJDA 2HKQB 4C0DC 1OPLA 4F7UE 1UE5A 4M7DC 3F2UA 2B63B 1HUNA 4C0DB 4M7DA 3GD7A 2CZ0B 3N6RA 4M7DB 1BB9A 2OX7A 3OIQA 5LHY1 3A8HB 2JJQA 5NUCA 2JA8H 2D62A 3VR4A 1B44D 5K36G 2ZXPA 1RI0A 3NTIA 3AFQA 1X3QA 1EX4A 1Q81C 4C1NK 1NBEB 1G91A 5EPJA 1WI7A 4IPHA 2YTXA 1EWCA 5KYWA 1UJ0A 5CAIA 5KYWB 1S5DD 1F1BB 3UPUA 2ALYB 1AH9A 2F3WA 4DK1A 4E7HA 1KHCA 1T5EA 2DNEA 4FP5D 2Q8IB 4V190 3S2DH 2JA6H 4LF7Q 3GP7A 1GRIA 1QLYA 1JORA 4OMLA 3PGGA 4KD4A 2JA8B 2V8KA 4M4ZA 5KYUA 1KC8R 3NENA 3KF8B 1WTHA 1FX7A 1UJYA 4RCCA 1I3QB 1MJCA 2YTYA 4OIKA 2CGHA 1E3PA 2E5LL 2SNMA 4PJOE 4A3DG 2A08A 4C1NI 1IKLA 1TR5A 2G9HD 1Y69U 5JEAJ 4OF1A 4IFDJ 2IIMA 2QQRA 3OYFA 1FNWA 1QW1A 5KNCA 1R4QB 1ILPA 2M2LA 3P8DA 3N5BB 3L2VA 2FYKA 1KQ1A 2RQUA 4QQBX 3C46A 2HNIA 1II3A 2I2LA 2L55A 5GJWB 3TEHB 5LL6X 1Q86R 3OYNA 3GTJB 3PF4A 2TSSA 4I7ZC 1U4PA 4KH1B 8AT1B 4QUCA 2K5VA 1PRMC 1A62A 1A6XA 1SYEA 1B53A 2D0QB 3DM3A 2DYIA 1HCZA 1KAAA 1YNZA 1KHIA 2AQ2B 3IKJA 5GAOl 1RAAB 2Z0SA 3I72A 1ZSGA 3HOVH 3MEFA 2EAYA 2LY7A 3K7AH 4J1MA 3R6OA 3BDLA 4BY6C 3JCMQ 2ZTEA 2QGFB 3CMEA 4BY6B 4H13C 4KUIA 5F2DA 5D6XA 4X3SA 5CO7A 2RF0A 2HZYA 1V1PB 3W5OA 1FL0A 1HQRD 4G57A 4DR1Q 4JVZA 3X20B 4QL5A 5IP7H 4E7LA 1WFQA 3T53B 3EIVA 1LTID 1F9PA 1MSGA 2C0IA 3K58A 3CP0A 3OYLA 3E9HA 4GN5A 4WFN3 1Y1WG 4KUDK 1WOCA 3PO3B 4HT9A 2QASA 4OB1B 1K8OA 2NZ1D 3CXCS 4BXXH 3CPWS 2AT1B 2IX0A 4MZTA 3K7AB 3MTSA 2A36A 4M7AE 1VQOQ 2LDMA 1KJWA 2AHOB 3OSOA 4QY7A 3X26B 2Z0WA 2RBMA 2L3PA 4C2MH 1JR0D 3JCMb 3CCRQ 2QYZA 1WJRA 1PD0A 1TUCA 3DB4A 3PF5A 4QW2A 2MI6A 5FLMG 3HRZC 2K5NA 3GTPH 1IGQA 3P8BB 4XAXB 4JV5Q 4M75G 1BNZA 2XVSA 2EJGC 4POGA 3CBOA 2DTHA 3GNFB 1S72T 1GBRA 4A93G 4PJMA 1OV3A 2EJGA 2EYQA 1S72A 1EZ6A 4QIWE 4LW1A 3G4SA 1XMOQ 3DEOA 5JJKA 1R9TB 2OF1A 2GTJA 1DGSA 1TWAB 5GAHC 5CV9A 3A8GB 4FW1A 1X3GA 5D65A 4C2MB 5IH2A 1VQ7T 3ULPA 2ROLA 1RACB 2J7IA 1BI3A 1VQ7A 1PH4A 1DZ1A 3IQLA 4C56C 1G2TA 4X64L 5KYIA 1PKTA 2V1RA 2Y4XA 1YNXA 4PJLA 4QVDA 2FINB 3GTPB 1JXOA 1NLOC 2XG8D 3OS0A 4XU0A 3VRYA 2AUJD 2BUDA 3DWPA 3MJXA 4Z02A 1ICWA 4LUOA 2ENBA 1JO8A 3EAEA 2DETA 1VQ6Q 1ZUKA 2CDTA 1RAIB 2WSFE 5JJZA 1LTTD 5C0XJ 1K0XA 2ZJQA 4F17A 2C0TA 2WKDA 4A3KG 4KT0E 4ELZC 1LVKA 2PI2A 3CCJT 2F0TA 1VUBA 1PH7A 5EAYA 5DM7R 3CCJA 4RMFA 4BBSH 1Q7YC 2HSEB 5GAMj 1WTPA 4A54A 1ICFB 3C95A 1RHPA 2WB1G 1GCPA 1ZBJA 2XI9A 4PFZA 1DD2A 5I9PA 4PNOA 2F0SA 5IXFA 5I6YA 5I9OA 4M78G 3V8JA 2LT4A 2BH8A 2KUMA 1MJEA 1XTCD 4JI2L 3S3MA 1TSFA 2AK5A 3I35A 2L2PA 4OXPA 4JRIA 1KLGD 4A76A 2E3HA 1IZ6A 3E5SA 3J81c 1PH9A 4A3GB 2KT1A 4L6V5 1NEBA 1ZX6A 2QDYB 1I4HA 3E1SA 5GANe 2QGQA 4BBSB 2JMAA 3A7LA 1AN8A 4PFOA 2V8IA 8ATCB 2HDMA 2KEEA 3K80C 4C92C 3L2ZA 4DA4A 1D5ZC 1HZ9A 1SAPA 2KBNA 1NYGA 4C92A 2HQXA 2ZM6L 4C92B 1VYUA 4LD6A 1UWVA 4XQQA 1GFCA 2UUCL 1HNWL 3C12A 4Y91A 4PL6A 1QVGS 2E41A 4A4FA 4FT4A 4IFDI 1QZHA 1IW7C 3BVGA 3FDTA 4RG2A 4I65A 4DFAA 4A3JH 3ITPA 4OO1H 3CCVT 4J5YA 2AHJB 2UU9Q 4L6TB 5GAOp 3H8ZA 4II1A 3G1JA 1AP0A 2O9VA 2JE6I 2XWBB 3EFXD 3SVMA 3EGDA 4LF5L 3D8GA 4BY7B 1X6BA 3CBPA 3CCLT 3CCLA 4EDUA 4BD3A 2F0NA 2M0OA 3DM1A 5I6WA 3HOYG 3MKDA 1UUPA 1SXTA 3I4MH 3U4VA 3OYJA 1E6GA 2BA1A 1LT3D 1PYWD 2JXBA 1Y07A 4J6XA 2K3YA 3OYYA 3G6EQ 2C5CA 2EE1A 4A3JB 2P0QA 4VUBA 1BCPD 2B86A 2MYSA 2ESWA 3VV0A 3CAMA 1BI0A 4XXEA 4DV7L 1AWXA 3M59A 1JXMA 1VMPA 3QKJA 1IHWA 5A0GA 1VQ9Q 3K8AA 3CCEQ 3VUZA 5EBDA 1A2UA 3HOZH 1NM7A 3VYUA 4JI4Q 1G291 2BZ8A 5KYYA 2XDDA 4ZLTF 1M8MA 1BK2A 1M5Q1 5KYYB 4ZTJA 2WINB 3AU7A 5GAOq 4RCOA 3BW1A 3QPHA 4X66L 1IYUA 1Y0MA 5DY9A 4AQYL 1HK9A 1WDXA 4F88A 3X3NA 4EMKC 4RGMA 1HUMA 2DZ9A 4EMKA 3RR5A 1NR4A 4EMKB 2DXTA 1YHAA 4Y28E 2EQIA 3QIIA 4ZK9B 4IPDA 4DV2Q 4MNOA 1QUQA 3EG3A 1QUQB 1WI5A 3LH0A 1E0BA 3G71T 4PLLA 1STHA 1WHLA 3G71A 3PUZA 4DPGA 2F0QA 4DR2L 3LGJA 3TP6A 2VZAA 1QOHA 5FK9C 4DK3C 5FROA 4AFSC 2DL7A 4A3LH 3GQBA 5IYCG 1BCPF 5I11A 1CT1D 1JICA 3L1AA 2WAQG 2RHQB 4BY1G 3V05A 1K9AA 4DU9A 1K8MA 1EY4A 5KRUA 3Q23A 3A7AB 4UY8C 1RLPC 2YYZA 4BDYA 3IFDA 4PZ7A 1WYDA 3HZXA 2DTIA 2MUYA 1O7LA 1IRXA 4ZTFA 3CRKC 1K9MU 4ME7A 3GO5A 1FMVA 3PMFA 3T1YL 1FJGL 5IGBA 1EU3A 2DM1A 1I4PA 2ASBA 2YRDA 1NPPA 1M4ZA 2F1LA 1UEBA 2XD0A 1H9RA 1LV9A 3VR2A 4F7UA 1NMGA 2HCIA 1OXSC 3HKZG 4K8IA 3J81i 3AT1B 3J7AF 2MHVA 4J15A 1EZZB 4CDEC 1JQYD 1SBBB 1JJ2S 3URYA 3LX7A 1WHJA 1J6QA 2E1HA 4OB2B 3V8KA 3I2ZA 2CSIA 3UI2A 4C3IH 1L1OC 1AZGB 2EJ9A 1FXXA 2H3JA 3BZCA 1X3FA 3PO2G 1L1OA 4E7JA 5D6YA 1L1OB 3OS2A 2L5TA 1OXXK 1AE3A 1SNPA 4DAPA 3FLGA 1ZQ1A 2YUPA 4J9EA 3A8IE 2JEAI 5LMUQ 3C2PA 3QDFA 3C1FA 2MK5A 2OEOA 4GLAC 4ILWA 3U50C 4FO2A 4G7OC 1PFNA 4R4QA 1AD5A 4CJ0B 1E1OA 1GUGA 4FXDA 3FKIH 2K7VA 4NW2A 5E7NA 2H4OA 4DR3Q 4LDVA 2LQKA 2FJ2A 5HY6A 1NPRA 2EVRA 2KYBA 3OS5A 1ILQA 2NVYH 3NE5B 4AYBG 5JVH3 3JCMP 2KVQG 3BDUA 4B3ML 4KN4C 3S1RB 4C3IB 1N8RU 2DYBA 4JS5A 4Z89A 4PJOA 3H9NA 4XU2A 3VU3C 4I7AA 1ESRA 4A4EA 3A8LB 1LUZA 3SGIA 1U5SA 1W6XA 3RR6A 2L8DA 1PZKD 2L0CA 4HMJA 3VR5A 2JA7B 2RO0A 4KY5A 2K14A 3C3LA 2I0QA 1Q95G 5IGGA 3FKIB 5JEAG 1K8AC 1YJWT 4LFCQ 4IFDG 4IUQA 3H0GG 3AQQA 1YJWA 4ALPA 1IO6A 3MWYW 2NVYB 2SNSA 2LC4A 5LJ3h 3TP8A 2F5TX 2X9HA 2E76C 4E7KA 2EQJA 1OO9B 1UUEA 3TREA 2CZ1B 4JOIC 1CSQA 1D1AA 2YDLA 5GAN7 5E4WC 2BIVA 2OTJA 1ZYRC 4A3MH 2MF2A 5EKLA 4EQ5A 2KAFA 3ERSX 2EXDA 4GS3A 4C0ZA 1MV0B 1TXYA 3KK7A 3QIAA 4NB3A 1QKWA 3PIPA 2D6FA 4QVZA 1DYQA 1GOZA 2YHTA 1WTXA 3FP9A 2VNUD 1N34L 5AFWA 1Q82C 1UE9A 5M3MG 3U23A 2DIGA 1V43A 2EW3A 2NUCA 2ZXRA 4KHZA 1V29B 4C92F 1RL2A 4HKEA 1CSPA 5GAMe 1PM3A 1TIID 4JRKA 1G6ZA 3JB9D 1H9MA 3M7NA 1VOMA 2MGSA 3WOEA 4JG2A 3PIP3 4M7DE 1UE7A 5CV6A 4M7AA 3L3OC 1BKBA 2OQ0A 3I56Q 4TVRA 4A3GG 2DBMA 2JS0A 2F0DA 1X65A 3M3YH 4QMGA 2O5IC 1EOTA 5C44G 2D0OA 4C3JH 2R5AA 4QT7A 3RBBB 1KQ2A 2LJ1A 2UUAQ 2VXWA 1RF2D 4BBRG 3NHHA 2M02A 4DV0Q 1WVLA 4J9FA 1JQQA 4LF4L 5KE2A 2I5MX 3E2UA 4GLMA 1T5XD 4QIWB 5CYUA 4DEYA 5FJ8H 1Z9ZA 1EFNA 5GANf 1AEXA 2E2JH 2A19A 5CKFA 7AT1B 1E22A 2ZXOA 4WF2A 3A54A 3SR1A 1VIFA 2K05A 4A3FB 4H44C 2WSEE 3Q24A 5LMNQ 5ELBA 1VQFA 3L2PA 3FJ5A 4JJDA 3JCMe 4JBJA 3RLNA 4P5NA 4GN4B 3LNNA 1IBKL 3M3YB 1Q82U 2GTOA 4LDXA 3S17B 1IL8A 2BH2A 2JOYA 4XTWA 3J80L 2MWPA 3JB9F 3KF6A 2YT6A 3KF6B 2EPBA 1Q7YR 1ZHIA 1PH5A 5EBCA 2RJEA 3SK4A 2JMCA 4NL3A 3PUVA 2E2JB 2B2YC 2DLPA 1B3QA 1IL2A 3NMZC 5LL6S 4NXNQ 5CBEE 2QEJC 2DXUA 5FU7C 4E7ZA 5M5XH 2FVUA 2KRNA 2NUPA 1NE3A 3C1EA 5C0XG 4JRPA 1NTGA 5FU7B 1M90R 1EYCA 1KRSA 2K33A 4A3BH 4PLIA 3NP8A 4IUUA 1B8AA 1SYCA 1P92A 4DR5L 4LDWA 3EQLC 3GTGH 4ELYC 1CZGA 1Q86C 4S3SA 2QA4T 3HOWH 2QA4A 5C5LA 5IT9c 3O13A 4EVOA 2E5QA 4HVUA 3RMQA 5KYNA 4IURA 3OWFA 1BDOA 4DV5L 4BDZA 5M5YH 4IZ8A 4KMUC 2XK0A 4EQOA 2HEQA 4A3BB 1X27A 1EY6A 3TMEA 2EYLA 4A63B 2DJGC 4WTOB 4CHTB 1WX6A 2ZJRA 2BDOA 5M3FH 1AOJA 4HCBA 3GTGB 3UA7A 3M0UA 2H3EB 3S14H 3E0JA 2A6HD 2LSSA 4BWGB 5LJ5d 1KC8U 2OT2A 3K6OA 5E3FA 3JAML 1VQLT 3HOWB 2FL7A 4OX9Q 1VQLA 1R77A 5AYFA 2UXBQ 4TVAB 1W6JA 4KKSA 4X9DA 1O7IA 4KI0A 4KN7C 2VQFQ 1NJIU 2Z4IA 1V8QA 4DEXA 2R7FA 1L0YB 3I4OA 2CQOA 4NXMQ 4N9PA 5J39A 1JB0E 4JI8Q 4M1UB 3VS1A 3M85A 4JI0L 2A0FB 5CKEA 5M3FB 1VQIA 4O0AA 1MMGA 2Y4YA 1Q86U 1GUOA 2O4XA 1JEGA 2O31A 2KCNA 2O4XB 1KTKA 2XNAC 1HNZL 5EJWA 1VQKQ 2PYKA 3T13A 3URGA 3P8HA 4JI3L 1JWSD 2RI3A 1ZUUA 4LFBQ 1IXRA 5GAMg 4UP8A 5FKAC 1KDBA 1ZYRD 3MHBA 1CKMA 4K0KL 4MIUA 4GZYC 1X6OA 3DLMA 2X4JA 1WCMH 1TS5A 2MPXC 2OTLQ 1A3TA 1VQPA 1VQNA 5CV8A 3VS4A 5GAN3 5C3EH 4ZKBB 3S1NH 4DR6Q 2LQNA 4BE2A 1KQSS 2UUBQ 1N9WA 3C0CA 2KMTA 1K4US 1LTBD 2JM8A 4LUEA 1PYBA 1ACMB 2AUKA 2MWOA 2BDNA 1B2TA 2HUGA 4UAIA 4CDCC 4GKJQ 2L0AA 4HIKA 1STGA 2XRQD 1Y8PB 1X69A 1GXDC 3PVQA 3CC2T 3REBB 3CC2A 2V1CC 4OO1G 2B8FA 5CBAE 2XKOC 2B63G 3UDFA 1WCMB 3BDCA 1AVZC 3MEAA 2EJMA 2M00A 4U68A 5K5PA 2NVQH 2P5ZX 1J8IA 5C3EB 3S1NB 3REAB 3M4GA 3SWNC 4BI3A 5FLXc 2G3RA 4IO9A 2CT3A 2V8JA 3L42A 3SWNB 3JCMg 3H6ZA 2B2TC 2FZKB 3FHWA 1I0CA 4E47A 4M77D 3OYHA 1Z9FA 3OQ5A 4LUVA 1HYOA 1PV4A 3CCUQ 2NB0A 4O5VA 1GCQC 1ZA2B 2KRSA 3D4WA 1W2BS 1QQJA 1SNQA 2A28A 4C0FA 2JZ2A 2R92H 2WSCE 2VWFA 3A98A 4GLKA 4Q0FA 3BVMA 3I70A 3QOLA 2HKNA 4L5RC 1GD7A 2NVQB 3MO8A 1SSFA 4JBKA 4DV4Q 4O2DA 3FDRA 3RUZA 4GNXC 4FL6A 4A3EH 2DE0X 3FB9A 1G83A 4C92E 3SD4A 4GNXA 4GNXB 1LTSD 5D6WA 1DOMA 1EY7A 3EG9A 2IHFA 2IY5B 4E7IA 3EG9B 3ULJA 3HOUH 4A4HA 1NLPC 2VC8A 1F2LA 4KLKA 2FPFA 2LX9A 2LJ3A 5BR8L 4GBQA 2E8GA 1CHQD 2AKLA 2LKVA 1RD9D 6AT1B 1ABQA 2QCPX 4J8OA 2PO4A 3THKA 4E2FB 3BG3A 4H7BA 2JA6G 3OHXC 3OW2S 3CC7T 4WRDA 2GFUA 3CC7A 1EU4A 1OXVA 2FPEA 4A3EB 4IKFA 4M77F 5ELEA 3X28B 1SE2A 3T4AC 5CR3A 4RG1A 3HOUB 3CMAQ 3GBQA 5CIUA 2CWPA 4X3TA 4KK7A 2CVRA 2FPDA 2A69D 1D0ZA 1PSFA 5IGEA 2BZXA 1MHWC 1UNSA 3SXHA 2KEAA 2R5MA 2HCKA 4A4GA 1A15A 4JC0A 2ICIA 3MFGA 4JI7Q 2GNCA 4J9BA 5I2SA 2QKIC 3RZOB 4DBFA 5COYA 4DV0L 3HPWA 1I1JA 1E24A 2K5HA 5IYDH 5GANj 4DUYQ 1KNAA 1K8AR 4F04B 1GXIE 2E10A 3EHQA 1Y57A 3QYHB 3MA2B 2QEXT 3VYRA 2YWWA 4WJ4A 2QEXA 3Q1JA 2J6FA 2QAZA 2F0UA 1S1NA 1YITQ 4ZYSA 2GVBA 1HZAA 3HOVG 4LE9A 1W4SA 3S24A 2KECA 3S6WA 3M9BA 3GTQH 4UC4A 3UATA 4MMKA 4R0KA 1Q1BA 2I07B 5FWCA 2RHXA 4FF4A 4IN3A 3PCOB 1AWWA 4OL7A 2EJFC 1TH7A 3E9GA 2C35B 1I94Q 2EJFA 3X3MA 3UDCA 4E6IA 5A2QL 2XWJB 3T1HQ 1HQMC 2NZHA 2EQMA 3JAME 1SYFA 5IP7G 1ASYA 1GUTA 1CA5A 1YI2T 5CKHA 2LCSA 1YI2A 4FU6A 1EY0A 2A74C 3SHLA 1D8LA 1AWJA 1MNEA 2QG9B 3GTQB 1VQ4A 1OI1A 3AMUA 2QTVA 1CQVA 5DM63 4C5IA 3VYSA 2CS7A 3VS6A 1VQ8Q 1YHQT 3A8JE 2KCMA 4DAMA 2E12A 1YHQA 1VIEA 4A3IH 1LCKA 5JJIA 1BIAA 4KY6A 4UP9A 1YP5A 2DILA 1TS9A 3H91A 3JC66 4PNYA 3H09A 2PNRC 4HAEA 1OX9A 2K9GA 2MQHA 3RUXA 4LF6Q 5GMKl 1JE5A 1X43A 2YU9H 1NZ9A 2WFWA 4EIKA 4EMGA 3ERQA 3FVQA 1TTHB 3A56A 5CQXA 1BOSA 2B29A 2MO0A 3NSWA 2RQVA 3A1PA 2DRKA 2JVVA 1I3QH 1QG7A 1SEBD 3K59A 4J6WA 1KD1R 4X65L 3S1QB 4CKBA 3T9NA 1VCIA 3TS2A 1WQWA 5IAYA 3QZ9B 2V26A 1RTOA 1N6AA 4OMNA 1H9SA 2HIXA 2X69A 5IWAQ 5DLOA 1H9SB 4ID6A 3BDOA 2JK8A 4XYOA 5HKCA 5KE3A 2RVLA 2ES2A 2PU9B 1J5EL 4R4IA 1NMFA 4JI6L 5LJ3f 4DAYA 4DAYB 1LOJA 1PKSA 1CUKA 1DOLA 4F14A 2YU9B 1C1AA 1FYNA 1TXQA 1WYXA 2GCXA 3QJ6A 4RGOS 3GTJH 2F4IA 3KF8A 4ZCKA 3CD6Q 3D6WA 2X6GA 2HD0A 4QJFA 4TQUS 5KH6A 2JM9A 3EFOA 3EFOB 1LABA 1KRTA 3F2BA 4ZN1A 2UXDQ 4J7IA 3DKMA 2CYZB 3LLRA 1B4OA 3OS1A 4PV1C 4A3MB 5IYBH 5DNFA 4L8JA 3SK6A 4OWXB 1I50H 4X62Q 5HGQA 2QXFA 1UGQB 4DV1L 1ZUYA 3CKIB 3CXCP 1X32A 4N9TA 1I5LA 2K5LA 4LXCA 2YLBA 1QCFA 3EG0A 2Y0SB 3MP8A 1Q81U 4JI1Q 1V76A 2COYA 1ZKOA 4A3CG 2UXCQ 4MMLA 1LLRD 2RMOA 1CQFA 4UDUC 4DAVA 1TY2A 2HHHL 1BCPC 3M9QA 4AFZC 4LF9L 1WHKA 1VQ5Q 3ME9A 1BCPB 3OMCA 3MZ5A 1RUWA 3OWEB 3PO3H 4GLVB 2CP5A 3NQTA 1EZ8A 4J8QA 1I50B 3RIRA 4JI5Q 2NUZA 5JOBA 2ID0A 2KQ3A 1F9SA 4EPCA 3NXWA 3M0RA 3OYDA 1V1PA 1OXUA 1QVFS 4JJNK 5HK0A 3OYCA 2JYOA 3HKSA 4JZ4A 5IY0A 4PK4A 3PMIA 3S9WA 4J9DA 3BU2A 3OPOA 2ROTA 1VQOT 3LYIA 4CRIA 2EVBA 1R9TH 2A37A 3MXNB 3J81j 1HHVA 1TWAH 1MSHA 3I4MG 3CCRT 1N33L 1O9SA 3CCRA 1N27A 3UWNA 2NVTH 2CUBA 3CMEQ 4M77E 1CKNA 1KIXA 5H1SE 1QVPA 3PMTA 1CKNB 1PRTD 2KEDA 1HRJA 4XT1B 2D2CC 4XTUA 2NWGA 3ND9A 2KI7A 4DUZQ 1U06A 3C4SA 3HOZG 1N36Q 4B3TQ 1AE2A 1XJVA 1SF9A 4IJHA 2KHJA 2NN6G 5IE8A 4E7SA 4TKOB 1T3SA 1RAFB 3GIBA 2IWHA 1AW7A 1YWPA 1GKHA 9ATCB 4RKBA 2DX1A 2NVTB 3K0YA 2NTSA 2LMJA 2J6OA 1D6EC 5KNBA 1O80A 4DR4L 2P4TA 1NSNS 2CT4A 3HTRA 1VF5C 1VQ6T 4L59A 1QB5D 1Y1VG 1VQ6A 3QB3A 4P2CB 5C3WA 4NS5A 5A2QE 3OYGA 1B50A 1XTDA 4R8IA 3MEVA 4QGUA 2CP0A 4C3HH 3G4SQ 4BA1I 4CJ2C 2K32A 2HD3A 1K73R 2P84A 2J05A 3GTKH 2F0LA 2F0JA 4F7UG 1KLUD 1EQRA 1C8CA 1PRTF 2H5XA 4K5XA 2K7AA 1M8AA 1F2MA 2KE9A 2F0GA 3RMHA 5GAOn 1HNXL 5IGDA 2VB6A 3E0EA 4LMQD 4KH0B 1M90C 4MDXA 1I6HH 4D8KA 5GAN2 2D9UA 1UGSB 3CQTA 1CFMA 3EH2A 5CGKA 1M1KR 3E3XA 4C3HB 1DJ7B 2GBQA 1VQCA 3GTKB 2IPKD 5GAGC 2HIVA 2VB3X 4POFA 2CKKA 2X3WD 1EY5A 4BY7H 4YHHQ 2DZCA 5LJ5h 4KD3A 1BIBA 4YY3Q 1E6HA 1VQMQ 2RQWA 2IG0A 4XTCS 5IGFA 1SROA 4BACA 3A5ZB 1UHFA 2RHIA 3KYHC 2JUFA 1PLFA 3CW2C 1I6HB 2KBTA 2IL8A 3JSCA 4DN4M 4PJOG 3J81L 4DV3L 1JU5C 1M2OA 3R3OA 3DWQA 5KGUA 3CCVA 4LNQA 1UAPA 1NG2A 5JPMC 1OTCA 1Q7YU 3SEMA 4C0GA 3H15A 1AWOA 3I9QA 2M0YA 3FKIG 1PH1A 4KY7A 4IIOA 2P0KA 3PNWC 4LK1C 1SSOA 2EYYA 4J83A 3HL8A 3JB9H 4ZKCB 4HTHA 4HSPA 1OZ2A 4R4TA 3G6ET 4ZN3A 2NVXH 3G6EA 3ULLA 4NPSA 1WGSA 2FRYA 2K4YA 2KJXA 3NK9A 2R93G 2H1EA 3I55Q 2RQXA 1K76A 3V7CA 1VQ9T 1PZJD 5C3XA 2SOBA 3CCET 1VQ9A 1A0NB 1GO3E 1VS0A 2FO0A 3CCEA 2F0HA 2FEIA 4QKUA 1U4MA 1STEA 2JTEA 3HEJA 1VDZA 4JBMA 1FNUA 1PFMA 3G48A 3OMGA 2ICEC 4DV6Q 1MIUA 2C0OA 4KRTA 1QCBD 4K6LA 2BOSA 3PSIA 5LJ3j 3MC0B 3GTOH 1Y71A 3A8MB 1TWCB 1X54A 1ET6A 4JUVA 3P1HA 4LF7L 3OBYA 1C6VX 5L23A 3GP8A 2SRCA 1SLJA 5CKBA 4RWSC 1IXDA 5D14A 4C5EA 1H9KA 4Q5VA 2KVMA 2Q2IA 5GAEC 2DY7A 3I5SA 1A2TA 1AEYA 5FLMH 3RESA 3S2HH 4PJJA 1F2YA 2E64A 2K3BA 1KABA 1IREB 3F1ZA 4M7AG 3M56A 2B3GA 2R7ZH 4IPCA 3OW7A 1Y1WB 1EWIA 1Z9QA 2R6GA 3KFVA 1C7YA 1UTIA 3GTOB 1C9OA 1I5FA 1YCSB 2EKOA 3TSZA 1IBLQ 3LGLA 4PZ8A 2E70A 2CZ7B 3L0OA 1E2VA 3EFRA 2K28A 2CH4A 1PDQA 4EQPA 2DVJA 3INZA 2WIIB 4D8DA 3OYMA 2UXCL 1SFOH 4XU3A 3S2HB 1F2ZA 5GMKh 2YRVA 2LFNA 3FC3A 1D7QA 3M57A 2L3SA 4A93B 2QTXA 2R7ZB 4JCVE 5EGTA 5ELFA 2PMZE 2MOXA 4P72A 2CKZB 4C5GA 5AJ3Q 1HJPA 3A55A 2H8HA 2B8GA 1WTWA 2L3QA 4JI5L 3I4LA 4C3JG 2EDGA 1WHHA 1TT2A 2DL4A 1B9NA 5D7UA 4B3RQ 2R58A 4PG3A 1AZQA 3ND8A 4HT8A 3CCQQ 1DM0B 3VR6A 1BR9A 5ELNA 5FJ8G 1WQ7A 3J7ZC 4QB4A 1SFOB 1CKOA 2DNUA 3JCMW 4DR1L 1K3BC 1BQQT 1MUZA 3META 1X2QA 5GANg 1N32Q 4LAAA 3S1RH 4RCBA 2WKCA 1V9PA 2JJ9A 1VMCA 1RODA 2KXDA 5ELOA 1YHBA 2X35A 2PW5A 2JA7H 2A3LA 2K5FA 2LJ0A 2DA9A 1B34B 4AMCA 2PZWA 3UA6A 1FD7D 1WXTA 1EYAA 2EZVA 2K79A 2A6HC 4O6JA 1LO5D 3OB9A 4P73A 4JV5L 1OOTA 1VA7A 3MAQA 3Q8DA 4NOYA 3DWAA 3I4NH 1B1ZA 3LWUA 2I0NA 1PFBA 3EJIA 1XMOL 4RCNA 4KBMB 2MMPA 5GAOm 1CK1A 5J1ZA 2VUMH 3OOCA 2QQSA 4KJNA 1XNQQ 4E6RA 1DOKA 5I21A 2MCNA 1MGQA 2PTKA 1N9RA 3MEWA 1TS4A 4XK8E 4NDXA 2YUNA 1K3RA 1ET9A 2GA4B 2A68D 2MIOA 2HBPA 4B9XA 2PQEA 3HOYH 4EMHA 2RQRA 3I4NB 4HCKA 4XTZA 5GMKi 1I81A 2EYMA 4H0LC 5HK3A 2N78A 3ZYYX 4JOIA 2RHZA 1JCKB 1D1BA 1HSQA 1KNEA 1WHMA 2A6EC 1NAPA 2VUMB 1UG1A 4JDSA 2K6DA 5M3FG 2A8VA 1Q8IA 2VL6A 4PMWA 4P74A 3J81E 2BE9B 1M4VA 2RF4A 2KA7A 3GLXA 1TS2A 1RTNA 2NTTA 1QILA 1SHGA 1TQOA 2GN5A 2LXKA 1WA7A 1BCMA 4OGQC 2YLCA 2E2DC 3HOYB 5CQYA 2ZPEB 1PD1A 4RMOA 3OYEA 4OONA 3M4PA 2JT4A 2QK0A 4LN2A 1WTRA 1WNLA 3MFYA 4R56A 1O7ZA 2ATWA 1HD3A 3HOXH 3UF4A 4JS4A 2L1BA 3E6ZX 1B7TA 1Y96A 4JYAQ 1Y96B 5T1GA 1SMYD 4V2SA 2KT8A 2OTJQ 1U3OA 2F4VQ 1OU8A 3OA6A 3I56T 1FR3A 1IHVA 3I56A 1K8AU 4AT1B 2ZT9C 4GKKQ 1JWMD 4A3FH 1BBZA 3GV3A 1G6PA 3TS0A 4M77C 5I2MA 2RM4A 1U8RA 1ML0D 4M77A 2BCOA 4OEMB 4YCVA 4M77B 4B3SQ 4KHPQ 2MAMA 1RKNA 2EYWA 3RZDB 4OIJA 5FOBB 3S17H 3HGBA 5IYCH 3BZKA 2NLUA 3HOXB 1OU9A 1LYLA 2E2HH 4ABNA 3L2RA 5KYLA 2F0OA 3SDZA 5E4XA 1TY0A 2KXCA 1T0JA 3NHNA 1YJ9Q 1KD1C 2DERA 4FM4B 2KY9A 4MTNA 1FNVA 3T16A 3TSSA 4IUTA 2RSOA 3KJOA 1AT1B 3H6MA 2SEBD 3S16H 1YVCA 1MI2A 3M0TA 3R2TA 4LUDA 4M75D 2VXEA 3WVDB 5FRNA 3J80c 3KJPA 3JCMV 1HR0Q 2E2HB 1YJNQ 4DR7Q 5GAOr 3EN2A 2DJZA 5KIXA 1U5KA 3TQYA 2RN8A 4IUVA 4J9IA 4C8QG 4DOVA 1STNA 1SEMA 3EFSA 1VQBA 2DKGA 2B2YA 1EYDA 1O7YA 2ZTDA 3RKXA 2Y0SE 3PO2H 2QI2A 4FVMA 4JI4L 3S16B 2OCEA 1VQDA 2G6FX 2R92G 4Y92A 2A69C 4IUNA 2MO1A 4L63B 1PTOD 3TZDA 4DNIA 3L2QA 3U9SA 1OPKA 2RD1A 4DF7A 3F2DA 3VJPA 2CW0D 2F0WA 2G9DA 1PG5B 4A3EG 3MCAB 3PUWA 5KCHA 4LFAQ 1KD1U 1CKAA 2N8NA 1X01A 2AZSA 3EBEA 2A7YA 2J0TD 4PMBA 4AIMA 4DV2L 2DUDA 1G8XA 1IBMQ 4EGVA 4AFQC 1CI3M 5LJ3e 2VGMA 1Q1EA 3NBHB 2CWAA 3PO2B 4FF1A 5HURA 1XNIA 5T1IA 4M75F 2TMPA 1UECA 4U673 2GF7A 4FCYA 3HS0C 3JB9J 1BBWA 4RAUC 3O8VA 4CKEA 4OMQA 2M16A 3CXCA 3CPWA 1ESFA 1SNCA 2M9UA 4M78D 1RAEB 1KQSP 1W6KA 2PCFB 5IP9H 1D09B 4HJ7A 1JOKA 3BYYB 5IT9L 2NUTA 5KEEA 2I46A 3S15B 2NUTB 4KKUA 3A5UA 1K83B 2Z9HA 2LS01 2LT1A 2RDGA 4MZ9A 4AYBB 2N49A 2VV5A 2LTOA 4XQJA 2F0VA 3SFMA 2CH4W 3BYTB 3I90A 1PTOF 2JSOA 2KK4A 2AWOA 4RTUA 4R1JA 3TQ7P 2X4YA 5CK9A 3WOFA 3KBGA 3RDVA 5I4DA 4MHEA 4DXFA 1VQKT 4YCWA 1VQKA 3QWXX 4B3RL 2F0KA 1TUGB 1Y8OB 1Z6HA 5IYDG 2N88A 3H3VH 2YRCA 3MPUB 5IIFA 4RHSA 1PNJA 3W1GA 1QWFA 3MP1A 1M3AA 1SSHA 1PWTA 2A6ED 3DMUA 5A35A 3WWVA 5A0LA 1KDCA 3KXTA 1PRLC 2OTLT 3MVVA 4ZUIA 2OTLA 3A0JA 3SEBA 1WD1A 3VS5A 5M3MH 1MBYA 3FMCA 4N8FA 3R8BA 3UDXA 2DXCA 3F2CA 1I4QA 4A53A 5BN5A 4M78F 4NKLA 4FF2A 4CC7A 1KAWA 1PH8A 1MV3A 4X1VA 4OMMA 5LMUL 1U4LA 4HSVA 1UFFA 2E5LQ 2COWA 2RQTA 3H3VC 1KDAA 3V2TA 4DR3L 5EG2A 2K03A 1SMXA 4O1NA 5LJ5f 2EYXA 1JWUD 2QW7A 1XMQQ 1K9MR 4ORZA 3MXGA 4FT2A 1M2VA 3LH5A 3TDQA 1M2VB 2KGTA 2PVDB 3K0XA 5GAN8 1M30A 4M7DG 1KL9A 4J6YA 5M3MB 3OYBA 1MD2D 3A8KE 3OW2P 5ECAA 2HAXA 1CHPD 1K73C 2IX1A 3SWNA 3CCUT 3TSWA 4IOAA 1UGVA 3CCUA 1VQPQ 1VQNQ 2DRMA 2AWNA 2B2TA 1XWEA 2HL3A 1YIJQ 1HXDA 2BE7D 3RMSA 4OMOA 3U4ZA 3H0FA 2RI2A 2UU9L 1GCQA 4LFCL 2FB7A 4A3IG 3CCSQ 1ZA1B 3VYGA 1LT6D 3D6CA 4HVWA 4RFBA 4RA8A 1FMWA 2Q8RE 3CHBD 5C44B 2VGNA 1H92A 2HSPA 1HA5A 3VYTA 2EYPA 1QVGA 3C94A 1WJSA 1M1KC 3MEHA 2JA8G 1PC0A 1NBWA 5CR2A 2EQUA 2D0PA 2PMZB 2BKDN 3W3AA 2Z4HA 1DXMA 2EY2A 1PCXA 1S40A 3TEEA 1OXTA 1VQAA 1QP3A 2K57A 1I6VC 3ASKA 3TVTA 2KHIA 4L5QA 3EGUA 4R4CA 1XOVA 2E3IA 5C0XH 1WTOA 2EGAA 3LWHA 4A3MG 1S5ED 1QE6A 4WJ3M 1N8RR 1QWEA 4PZ6A 5IHIA 3M7GA 3E19A 2RPNA 1SKUB 4OVAA 3GF5A 2GFAA 4PKCC 4ZAIA 3RZOH 2JTMA 5J26A 5GAMd 5LJ3g 3DEPA 3GTMB 4XTXA 4IIMA 3CMAT 4J9CA 4RGNA 3CMAA 4J6HA 2L89A 1GL5A 2F5KA 2D0NA 2DL5A 4ANJA 3ULRB 4LD9K 4G4KA 2F0PA 2F4VL 3GOXA 1K0RA 2RDHA 4N4HA 2DEUA 4ZNXA 2MPMA 2GGRA 4A4IA 1HZBA 3H94A 3M0QA 3UDGA 4HEDA 2CP3A 3UDIA 1X2KA 2CREA 3HFNA 1TG0A 4DOWA 4WJWA 2UUAL 3TP5A 3JB9I 4CBVA 2XMFA 2KNBB 3HRSA 2ZPGB 1CSKA 1O75A 2ATCB 2ZZDA 2FHTA 4DBHA 4BI8B 1I4K1 4X64Q 5I22A 2BTTA 3CC4Q 2JP1A 4Q5WA 1YITT 2O88A 4X6AH 1YITA 5DAUA 3PFSA 4CI0C 3JCMd 1A3UA 1PRTC 4OP0A 5LMNL 2J7ZA 2LNVA 5L8RE 3PO3G 1PRTB 1YEZA 4JW0A 1H8KA 2EXZA 2DN8A 3VS7A 3HRUA 4DA2A 1GHKA 1B7YB 4RTZA 1BBXC 4AG1C 3JRZA 1ZLMA 1HR0L 4DKAC 2BA0A 3QYGB 4K6DA 4ULLA 1TU0B 3EH1A 4BUGA 5M9OA 1K28A 4OMPA 4M8AA 2AKWB 4NXNL 1MHNA 5IT9E 1WXBA 2QQAA 4TRDA 3QSUA 4N4IA 3KUPA 4JI2Q 1KSWA 2R61A 1UE6A 1PH6A 2IVWA 3CCMQ 5BN3A 1TOVA 4BXXG 3BJUA 4M75E 2D9TA 2NYSA 4FSSA 1TS3A 1LJOA 4RGTA 1QWYA 1UB4A 1VQ8T 4CJ1B 1VQ8A 2RDFA 4J9HA 2ZPIB 3S1QH 2FMMA 2GQIA 2LCCA 4B6MA 2XICA 1EFWA 1WJQA 2ZM6Q 1JJ2A 3VS0A 4CC2A 2MNAA 1H3HA 5JVG3 2OAUA 4JBWA 4MDWA 3GPLA 2RJFA 3MHXA 1HNWQ 2DL8A 2KENA 1CZWA 1WTVA 1K1ZA 2DO3A 2DL3A 1G3WA 1GVPA 4FYXB 3UE0A 1LACA 4N8X1 2R93H 4X3KA 3JCMX 1GFDA 2HQLA 3FIFA 3PUXA 2W10A 2V4DA 1P8LA 3DLLA 1VQ4Q 1CA6A 2JNGA 1M27C 1KFZA 4OX9L 1KXLA 3Q0AA 2EYZA 2PUOB 2UXBL 2JA9A 5C5MA 4KV6A 1SPKA 2BE5D 4K11A 3SK8A 2VQFL 1N5ZA 2GVAA 1EIFA 2KSSA 2O2LD 4NXML 2DGYA 1PHJA 3CD6T 1U4RA 4JI8L 5FWBA 2DAQA 3CD6A 2WB1E 4C3HG 1D0XA 3ZEHA 2QF7A 3L9AX 1JB7A 4AH6A 2COZA 3M58A 4M78E 1SYDA 4DV7Q 4F87A 1QVFP 2R93B 1WTQA 3AB9A 4QVCA 4BBSG 3STBD 2D1XA 3PUYA 2RJCA 4DNRB 3DXJC 1EOVA 3NEMA 3UE1A 4LFBL 1Z47A 4AG2C 1STYA 3VA7A 3U9OA 2CUDA 4C92G 4G7ZC 1EQQA 1SYGA 2C9OA 2EFIA 3MXUA 4X66Q 3OTOQ 1PFSA 2JA5H 4AQYQ 2E5KA 3MEUA 3QXEB 3CPWP 2C06A 5EKKA 5GQOA 3M4QA 4JK1C 2IW3A 1YN8A 4DR6L 1E7ZA 2UUBL 3KLSX 2IJ0A 3S3NA 4Y7NH 1AHJB 3RN2A 5KYUB 1PMRA 1VQ5T 1LTAD 5FLXE 2QDLA 1T0HA 3X24B 3QWYA 1VQ5A 2B39A 3D4RA 1T3LA 5IXBA 4GKJL 4BY7G 2ZPBB 5LJ5j 1K0SA 2AMCB 5I2XA 5EPKA 4DR2Q 1XMQL 1NJIR 3VA5A 2RHUA 2EY1A 3S2DB 3ZBDA 4C8QD 1NUCA 1SN8A 2JA6B 1NNXA 1MMAA 3PV0A 4HA8A 1XJWB 4GLXA 2JA5B 1H641 2K04A 2K2VA 3NFCA 2OI3A 2X4WA 4A3JG 3KOJA 2Q2TA 3NGPA 1EY9A 2EGCA 5GANh 2IT1A 2K4KA 2MFIA 4Y7NB 1PXUA 3QDRB 2N55A 2CP2A 2JN0A 2HBWA 2YTVA 3T1YQ 1FJGQ 1M1FA 2G5DA 3PTAA 2VW9A 4IALA 5CV4A 3MXNA 3JB9G 2DD5A 1VQOA 1Q90A 2AIRB 2EWNA 5E1FA 1CM9A 1UGRB 5IHKA 2AQ1B 3FPPA 5CV7A 3OYAA 1G3SA 1M9SA 3LGFA 3CMET 5KNDA 4DV4L 2XU8A 1EEFD 2E2IH 1SNOA 1OULA 2L3RA 4LDUA 3HP9A 1WFWA 1SE3A 2B2VC 2IX3A 2B2VA 3L2UA 1ENCA 3CEYA 5CV5A 1RAHB 1Q12A 2X51A 3K5NA 2SDFA 4C8QF 1E1TA 5EC7A 2CHBD 3TU4K 2EY6A 3KLSA 5C4XH 4IOCA 3RERA 3HOVB 2Q2UA 1FGBD 3Q6SA 3RD4A 4ATOA 4WORA 4LWCA 3EVQA 2KHSA 2LQ8A 2EGEA 1Y8NB 4JJBA 2F0MA 4QQGA 2E2IB 1WD0A 1X9NA 4GY5A 2K75A 2VY3A 5EKIA 3IFTA 2R3ZA 5CVIA 2WAQE 3OIPA 1F9RA 5IN1A 4B3MQ 2YUQA 3KLWA 4R4OA 2D8HA 1SE8A 2R7ZG 1JJGA 2EYJA 1CTMA 3G4ST 1D1CA 5C4XB 1SRMA 1QVGP 2PVOB 3MXPA 3R2IA 3S3OA 5I2YA 1S72Q 2B2WC 1YNND 5K36H 2RSNA 1EIHA 2B2WA 4A3LG 2JTFA 1SNDA 1M3CA 1Q46A 4YWKA 2ABLA 1TWHH 4JI7L 5HCKA 3AEVA 1SDFA 3WVEB 2VASA 3P20A 4DUYL 2DD4A 2GQVA 2P4RA 5GMKj 1S3OA 1OYXA 1VQ7Q 3H41A 3HKZE 3NPPA 4XU1A 4BE0A 1T9HA 3NUCA 5GAN4 2NBFA 1X6GA 5GADC 4BI4A 1PA6A 4KGVB 1FVIA 3ZJYC 4RUGA 3RLOA 5ELCA 2IPOB 4JJCA 2EY5A 3G7ZA 1TWHB 4Z88A 3VDYA 1UEAB 1S5CD 4QUFA 4KGXB 4FSXA 2Z1CA 2A5HA 1VQMT 4O42A 2F52A 4P75A 1K8GA 4A3DH 1VQMA 2CZ6B 4M7DD 3CCJQ 3KLRA 1LTLA 2LQWA 1I94L 3NBIA 2DIQA 1JE4A 1BU1A 3T1HL 1BVSA 3OSSC 5FU6C 4LDYA 3GTLH 1N34Q 2JW4A 4C3IG 5CMDA 5FU6B 3D31A 2A68C 1M3BA 2DPPB 4V0BA 4YTLA 2PW7A 2Z8LA 1Q8KA 3NELA 3CBMA 3G6JB 2K5IA 4R55A 4AYBE 4JLGA 4A3CH 3ZFJA 2EKHA 4J7FA 3CPFA 3DHQA 2JA7G 4HCEA 3QOJA 2ZGWA 2LCLA 4A3DB 3NTKA 3H0IA 1MKHA 2X4XA 1WHGA 4FNFA 3TRZA 4OWWB 1SJED 4XDXA 1M90U 4LF8Q 3GTLB 1TWCH 4KULA 4XIGS 5CKDA 3NQIA 2AKKA 2ZAEA 1TKWB 3GV6A 3I4NG 3I55T 1V1QA 4LF6L 1GUSA 3L2WA 3I55A 2QILA 4K5VA 1QJOA 3FRPB 1TWFH 3W2DA 4LF4Q 3BVZA 5M5WH 2CCZA 2VUMG 1L2FA 2F0FA 1IKMA 5FRMA 1L0XB 2FXQA 4HMIA 4M7DF 5GAN6 1KQSA 2XTIA 2JQOA 1G8ZD 3CCVQ 3WXMB 1SMYC 4K14A 2PNHA 3QBYA 2OWOA 4ZGJB 3EGDB 2Z6BA 1LNXA 5IWAL 1Y1WH 4HJAA 1RI9A 4RG8A 1Z7TA 2VXFA 2X3XD 1IBKQ 5GJVB 1S4ZA 3CCLQ 3H3VI 1QMCA 2DTOA 3HRTA 1JRIA 1YCYA 3RKWA 2DEQA 4GN3B 1TWFB 1RDPD 1WXUA 5M5WB 2DXBA 4N0AC 3M0SA 3HSBA 4RH6A 3HP3A 4N0AA 3GNGA 1NE8A 2DY8A 1QKXA 1JJ2P 4A93H 4HJ5A 4KGZB 2UXDL 5IOCA 1LTRD 1K9MC 2K5DA 1OQKA 1W2BA 2VS1A 2NN6H 4XTVA 2YV5A 4M77G 2VYTA 1J9OA 4X62L 3OTOL 4Z8AA 4DR5Q 1BF4A 3I4MB 3HOXG 2WACA 3EHRA 5GMKm 1RIPA 2KQWA 2RH2A 1A3VA 3HFZB 1S5BD 4ME5A 4JI1L 3D4DA 1JBMA 4M75C 4DV5Q 4X34A 4M75A 1PTOH 3T51B 5BN4A 4M75B 4HIMA 2KDSA 4B9WA 4HR7B 1Y1VH 5D3IB 1ARKA 1JB3A 1L0WA 3CRLC 4A3FG 1QCOA 2F3VA 3PGZA 3HOZB 5G3LD 3I91A 2HDAA 1IB8A 4LUZA 1VQEA 3G71Q 2NZOA 3M5AA 2K5QA 2KOLA 1HZCA 4A3KH 1IGUA 2RB6A 2EYHA 1EUJA 3CCQT 2F0IA 1CKBA 4IUPA 2VB2X 4CDDC 3JCMc 3CCQA 1MMDA 1LTGD 2AQ3B 3OW2A 1YWOA 4RKUE 4DQ2A 5EPLA 5GAMh 1PTOC 2RKSA 5LJ5e 4Y52H 3VS3A 1JJCB 1PTOB 1AFPA 2CP6A 2CW0C 1J3TA 2F2WA 1Y1VB 2RA4A 2ENMA 4FIBA 2MP1A 3LWIA 1FWZA 1YNJC 2OJ2A 3M54A 4UHVA 4RTTA 1N8RC 3K5OA 2KYMA 4C8QE 2IHEA 4JI0Q 5J22A 4A3KB 3EROA 1WZOA 5C0XI 4L5TA 1ASZA 3JCMJ 4G7HC 1WPYA 4OGEA 4F7UB 4ZQ3A 1Q81R 3CU7A 2HQHA 1B34A 4ZUJA 1HNZQ 2LRQA 2ZPHB 2XDBA 3K81C 4BB7A 1M1GA 4JI3Q 2JS2A 3V7RA 5GAN5 2WB1B 4M78C 3I3CA 5G3LF 4M78A 4K0KQ 2QDBA 4M78B 2VQEQ 3FEWX 3QO3A 1PVOA 2FFKB 1I4XA 4DUZL 4HN7A 1N36L 4B3TL 4FYVB 4JLIA 2EBPA 1EEID 3QG1A 4A3BG 3JCMh 2F3IA 2F0EA 4RTVA 3FJPA 5C4HA 1Y14B 1H9JA 3QZ5B 4CDFC 2XRSD 3HOWG 3V7SA 5CC4A 4DXGA 2E65A 2XGTA 1FYCA 3QUIA 4EX5A 5IGCA 4FXGC 3NWTA 4QF4A 2ZCFB 2A1AA 4C5HA 3QR8A 3KUFA 3H0HA 3PT9A 4PJOC 1Q3LA 2RHYA 5AT1B 4HXJA 3K7UC 1XNRQ 4IJLA 4PJOB 2ZJPA 4R8NA 1HJDA 4ZRZA 3K5MA 1TVXA 2R7DA 3EG1A 4C92D 2L12A 2LMCB 4TSSA 5IP9G 5JAVA 3R6NA 3RKYA 4QQ6A 5DEHA 3D7SB 2EQKA 5D3DA 1IW7D 1BUVT 3BZDB 3HFOA 1B9MA 1YJWQ 4L5GA 3RZDH 1ZSZC 4HIOA 4DBRA 2O5JC 1ZSZA 1LPLA 1ZSZB 3MP6A 2RI5A 5GANd 2L15A 3M4YA 2OTJT 4KHVA 5ELDA 3U58A 4KTAA 1UGPB 1I4GA 1HTLD 1NR2A 1XPRA 4PQXA 1LT5D 1G51A 1E2WA 5GMKe 1KG1A 3TP7A 1C0AA 5BR8Q 2DK3A 3BY7A 4YHHL 1STBA 1GBQA 3VR3A 4YY3L 1XPOA 1HXYD 1VQHA 3M4OH 4QCLA 3ZL7C 3WDNA 1VYVA 1E7OA 1YFNA 2E75C 2PNIA 1BO0A 2LP5A 2OQKA 4RKLA 1IYJB 1QP2A 3OSVA 3J7YW 1WCMG 1AZPA 5FW9A 3A8OB 1C48A 4BY1H 2LXJA 2M9VA 1YJ9T 2Q2HA 5C4ZA 5C3EG 2LX7A 3NWSA 1YJ9A 4FYWB 4F7XA 4OO1I 2ED1A 3AYHB 1HH2P 1X3EA 4M7AC 1HFGA 1LM0A 1HFNA 4M7AB 2FZCB 1HTPA 4FF3A 3M4OB 1XX8A 1N9SA 2EQSA 3QHSA 2NWMA 3OYKA 4CGYB 3K57A 3QJYA 5LJ5g 4LF8L 3NPFA 1IHZA 3N52A 3SB2A 1QNKA 1I5OB 4RHRA 3RLFA 2HT1A 2KCCA 1YJNT 1MGSA 2WAQB 3VUBA 1YJNA 4BY1B 4JZ3A 2JEBI 1GJXA 1FMKA 3OBWA 4HIDA 2K2MA 3S1MH 1UDLA 3L7ZC 1UHCA 4HVVA 3BE3A 2RCNA 2VKNA 1VYTA 3I5RA 1C0MA 1JC7A 4F16A 2BZYA 4IQZA 1EWHA 1SR3A 4DV6L 3NTHA 4YWLA 4HCSA 1AZEA 1LT4D 3RNJA 2DMOA 1NYFA 1R0CB 4C3JB 1TWGH 3HKZB 1B70B 3J7AV 2EYFA 3E9IA 4ME3A 3IAYA 3S15H 2R57A 2CSQA 3S1MB 1KC8C 2ZPFB 1PHTA 1YNJD 3M53A 1QVFA 3KBXA 1K83H 3HOUG 3P7JA 3FRNA 4NP5A 4APVA 4EQNA 3NBHA 4FXKC 1I8FA 4IPGA 1YBYA 4X3UA 3SE0A 2NUPB 2QQBA 2CFMA 4K5WA 3M55A 1NJIC 3VRZA 1EL0A 2LVMA 1D3BA 4A75A 1D3BB 1DCZA 3TZUA 5L37A 3KFUA 1GHJA 1IBLL 1RAGB 1TWGB 1C4QA 4A3IB 2SEMA 5J3BA 5JEAH 5KYXA 3JAMc 3DB3A 5A0DA 5KYXB 2F69A 1X56A 3K5LA 4PFPA 4IFDH 3Q22A 3H0GH 5EQ0A 2QA4Q 5FO9B 1P16A 4XYQA 5IODA 1EQTA 5KCOA 1VF7A 2I5LX 3V96A 1GM5A 5M5XB 4XQNA 1DONA 4H02A 1JOQA 3G7LA 4OB0B 1VQJA 5JPNC 1I4RA 5AJ3L 2I5HA 4UPAA 2XSCA 1W70A 2RHSB 2RK1A 4DGZA 1DJRD 4KKTA 2E6ZA 2KROA 1E2ZA 4ODGA 4FW2A 1EFID 4YCUA 2XIDA 4P71A 4X65Q 5CORA 2B2UC 1D2BA 2OAWA 2EYOA 2B2UA 3W1BA 3PE0A 4PJOD 3H0GB 1A0IA 1Y7XA 4F7UF 3QO2A
chains in the Genus database with same CATH topology
2EVRA 4RTWA 2KYBA 2LNHB 3VS0A 4CC2A 1H3HA 2W0ZA 2DYBA 4Z89A 4D8KA 2DL8A 3CQTA 2D8JA 1K1ZA 2DL3A 1WIEA 1U5SA 1W6XA 2GBQA 1GFDA 2W10A 1M27C 1KFZA 2X3WD 2EYZA 1E6HA 1G2BA 1IO6A 2RQWA 1UHFA 1SPKA 4K11A 1N5ZA 1UUEA 2KBTA 1WLPB 2YDLA 4J9GA 4WCIA 5FWBA 1NEGA 1JU5C 1NG2A 3SEMA 1MV0B 2D1XA 1AWOA 3I9QA 2M0YA 2ED0A 1QKWA 4IIOA 1KIKA 2EYYA 3O5ZA 4AG2C 2FG0A 2CUDA 4JPBW 2J06A 1UE9A 2E5KA 3U23A 2EW3A 2FRYA 2FRWA 2KR3A 1YN8A 1K76A 2YUOA 1A0NB 2FO0A 2FEIA 2QDLA 1T0HA 3QWYA 2JTEA 1T3LA 2RNAA 5IXBA 1K0SA 2O2OA 2C0OA 2DBMA 4KRTA 1RLQC 4RTXA 2JS0A 1SRLA 2F2XA 1I07A 3SHWA 2DF6A 4QT7A 3RBBB 2LJ1A 5L23A 2SRCA 2LZ6B 4J9FA 1JQQA 2OI3A 2J6KA 4GLMA 3I5SA 3NGPA 4DEYA 2EGCA 1Z9ZA 1AEYA 1B07A 1EFNA 4AFUC 5IHNA 2K3BA 1ABOA 2HBWA 2ECZA 2PZ1A 1Z9QA 3FJ5A 4JJDA 3KFVA 2F2VA 1UTIA 1YCSB 2GTOA 3TSZA 5IHKA 2KRMA 2CH4A 2YT6A 3PVLA 2DVJA 4D8DA 4RTYA 2JMCA 1WFWA 2EPDA 2DLPA 3M0PA 1B3QA 3NMZC 2L3SA 2KRNA 2MOXA 5EC7A 3JV3A 1SHFA 2H8HA 2L3QA 2V1QA 4LNPA 2DL4A 2EGEA 2O9SA 4JJBA 3EG2A 2VVKA 1TUDA 2YSQA 3VS2A 4HVUA 2DNUA 1OEBA 2DBKA 1MUZA 1X2QA 2YUQA 2D8HA 2HEQA 1X27A 1SRMA 4A63B 1WX6A 2KXDA 1AOJA 1M3CA 2ABLA 3M0UA 3UA7A 5HCKA 2LJ0A 2DA9A 2M51A 1V1CA 3UA6A 1WXTA 2P4RA 2K79A 3H41A 1OOTA 1VA7A 1X6GA 4DEXA 2I0NA 1W1FA 3VS1A 4CC4B 4RUGA 4JJCA 4ESRA 2DJQA 2AZVA 4E6RA 2MCNA 4Z88A 2PTKA 1JEGA 2O31A 2YUNA 2LQWA 1ZUUA 1BU1A 2MIOA 4CC3A 2RQRA 1OPLA 2JW4A 4HCKA 1BB9A 1M3BA 1HSQA 3VS4A 1UG1A 2LQNA 2K6DA 2EKHA 3C0CA 1K4US 2JM8A 4LUEA 1WI7A 3H0IA 1UJ0A 1SHGA 2L0AA 1X69A 1WA7A 3PVQA 3REBB 2JT4A 4LN2A 2AKKA 1AVZC 1GRIA 1QLYA 1HD3A 4OMLA 3UF4A 3REAB 4M4ZA 2CT3A 2KT8A 1U3OA 1UJYA 1I0CA 1GCQC 2A08A 2KRSA 1BBZA 2A28A 1RI9A 2IIMA 2VWFA 2X3XD 3A98A 5GJVB 2EYWA 2RQUA 5GJWB 1WXUA 2DE0X 1G83A 3M0SA 2KXCA 1T0JA 3NHNA 1NLPC 1PRMC 1QKXA 2FPFA 2LJ3A 4GBQA 1YNZA 2AKLA 1ZSGA 3M0TA 1ABQA 4LUDA 3THKA 4Z8AA 2FPEA 3EHRA 2RF0A 2RN8A 4J9IA 3GBQA 1SEMA 2FPDA 1ARKA 2C0IA 2BZXA 2HDAA 2G6FX 4Y92A 2KEAA 2HCKA 2A36A 2GNCA 4J9BA 1CKBA 1KJWA 1OPKA 2L3PA 1I1JA 1YWOA 1TUCA 1CKAA 2AZSA 3VS3A 1J3TA 2F2WA 3EHQA 4AFQC 1Y57A 2ENMA 1GBRA 1OV3A 2OJ2A 2J6FA 1S1NA 4RTTA 2KYMA 1UECA 4LE9A 2GTJA 4OMQA 3UATA 4R0KA 5FWCA 5IH2A 1AWWA 2ROLA 2J7IA 2JS2A 3IQLA 1PKTA 2V1RA 1JXOA 1NLOC 3VRYA 1JO8A 2CH4W 1ZUKA 2CDTA 2EBPA 2LCSA 4RTUA 1K0XA 4RTVA 1AWJA 4F17A 2C0TA 3QWXX 3VS6A 1PNJA 1LCKA 1QWFA 1GCPA 1M3AA 1SSHA 1PWTA 1ZBJA 1YP5A 2DILA 1PRLC 5IXFA 3H0HA 2K9GA 3VS5A 2AK5A 3I35A 2L2PA 4HXJA 1X43A 1HJDA 4EIKA 2KT1A 1NEBA 1ZX6A 4CC7A 1MV3A 2RQVA 4OMMA 2DRKA 3EG1A 4X1VA 1UFFA 2JMAA 2RQTA 3R6NA 4OMNA 2EYXA 1NYGA 4ORZA 1VYUA 3LH5A 1GFCA 2KGTA 1M30A 1PKSA 4F14A 1FYNA 1WYXA 5ECAA 3TSWA 1UGVA 2DRMA 2O9VA 2JM9A 4OMOA 3H0FA 1GCQA 1X6BA 1GBQA 3ZL7C 1VYVA 1E7OA 4HVWA 2PNIA 2LP5A 1H92A 2HSPA 1ZUYA 5FW9A 1E6GA 2JXBA 2LX7A 1QCFA 3EG0A 2B86A 2ESWA 2ED1A 1AWXA 1JXMA 2RMOA 3TVTA 3EGUA 4AFZC 1XOVA 1NM7A 2EGAA 2BZ8A 1RUWA 1M8MA 1BK2A 2NWMA 1QWEA 5IHIA 3NPFA 2NUZA 2RPNA 1Y0MA 1WDXA 3M0RA 4JZ3A 1FMKA 4IIMA 4J9CA 2K2MA 1GL5A 2D0NA 2DL5A 2EQIA 1UDLA 3ULRB 1UHCA 4HVVA 2VKNA 1VYTA 3EG3A 3I5RA 4JZ4A 4F16A 2BZYA 4ZNXA 2GGRA 4J9DA 2ROTA 3M0QA 1AZEA 3RNJA 2A37A 2DMOA 1X2KA 1NYFA 4AFSC 2CREA 2DL7A 1TG0A 5I11A 1K9AA 2XMFA 2KNBB 2CUBA 2CSQA 1CSKA 1RLPC 1PHTA 5I22A 2BTTA 2O88A 1U06A 3VRZA 2DM1A 1H8KA 1T3SA 3VS7A 1YWPA 2DX1A 4RTZA 2SEMA 4AG1C 1ZLMA 2LMJA 2J6OA 4OMPA 2CT4A 1WXBA 2CSIA 1AZGB 1KSWA 1W70A 4FSSA 2YUPA 4J9EA 2KROA 2J05A 4J9HA 1AD5A 2OAWA 2K7AA 2GQIA 2KE9A 3PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVR A;  4RTW A;  2KYB A;  2LNH B;  3VS0 A;  4CC2 A;  1H3H A;  2W0Z A;  2DYB A;  4Z89 A;  4D8K A;  2DL8 A;  3CQT A;  2D8J A;  1K1Z A;  2DL3 A;  1WIE A;  1U5S A;  1W6X A;  2GBQ A;  1GFD A;  2W10 A;  1M27 C;  1KFZ A;  2X3W D;  2EYZ A;  1E6H A;  1G2B A;  1IO6 A;  2RQW A;  1UHF A;  1SPK A;  4K11 A;  1N5Z A;  1UUE A;  2KBT A;  1WLP B;  2YDL A;  4J9G A;  4WCI A;  5FWB A;  1NEG A;  1JU5 C;  1NG2 A;  3SEM A;  1MV0 B;  2D1X A;  1AWO A;  3I9Q A;  2M0Y A;  2ED0 A;  1QKW A;  4IIO A;  1KIK A;  2EYY A;  3O5Z A;  4AG2 C;  2FG0 A;  2CUD A;  4JPB W;  2J06 A;  1UE9 A;  2E5K A;  3U23 A;  2EW3 A;  2FRY A;  2FRW A;  2KR3 A;  1YN8 A;  1K76 A;  2YUO A;  1A0N B;  2FO0 A;  2FEI A;  2QDL A;  1T0H A;  3QWY A;  2JTE A;  1T3L A;  2RNA A;  5IXB A;  1K0S A;  2O2O A;  2C0O A;  2DBM A;  4KRT A;  1RLQ C;  4RTX A;  2JS0 A;  1SRL A;  2F2X A;  1I07 A;  3SHW A;  2DF6 A;  4QT7 A;  3RBB B;  2LJ1 A;  5L23 A;  2SRC A;  2LZ6 B;  4J9F A;  1JQQ A;  2OI3 A;  2J6K A;  4GLM A;  3I5S A;  3NGP A;  4DEY A;  2EGC A;  1Z9Z A;  1AEY A;  1B07 A;  1EFN A;  4AFU C;  5IHN A;  2K3B A;  1ABO A;  2HBW A;  2ECZ A;  2PZ1 A;  1Z9Q A;  3FJ5 A;  4JJD A;  3KFV A;  2F2V A;  1UTI A;  1YCS B;  2GTO A;  3TSZ A;  5IHK A;  2KRM A;  2CH4 A;  2YT6 A;  3PVL A;  2DVJ A;  4D8D A;  4RTY A;  2JMC A;  1WFW A;  2EPD A;  2DLP A;  3M0P A;  1B3Q A;  3NMZ C;  2L3S A;  2KRN A;  2MOX A;  5EC7 A;  3JV3 A;  1SHF A;  2H8H A;  2L3Q A;  2V1Q A;  4LNP A;  2DL4 A;  2EGE A;  2O9S A;  4JJB A;  3EG2 A;  2VVK A;  1TUD A;  2YSQ A;  3VS2 A;  4HVU A;  2DNU A;  1OEB A;  2DBK A;  1MUZ A;  1X2Q A;  2YUQ A;  2D8H A;  2HEQ A;  1X27 A;  1SRM A;  4A63 B;  1WX6 A;  2KXD A;  1AOJ A;  1M3C A;  2ABL A;  3M0U A;  3UA7 A;  5HCK A;  2LJ0 A;  2DA9 A;  2M51 A;  1V1C A;  3UA6 A;  1WXT A;  2P4R A;  2K79 A;  3H41 A;  1OOT A;  1VA7 A;  1X6G A;  4DEX A;  2I0N A;  1W1F A;  3VS1 A;  4CC4 B;  4RUG A;  4JJC A;  4ESR A;  2DJQ A;  2AZV A;  4E6R A;  2MCN A;  4Z88 A;  2PTK A;  1JEG A;  2O31 A;  2YUN A;  2LQW A;  1ZUU A;  1BU1 A;  2MIO A;  4CC3 A;  2RQR A;  1OPL A;  2JW4 A;  4HCK A;  1BB9 A;  1M3B A;  1HSQ A;  3VS4 A;  1UG1 A;  2LQN A;  2K6D A;  2EKH A;  3C0C A;  1K4U S;  2JM8 A;  4LUE A;  1WI7 A;  3H0I A;  1UJ0 A;  1SHG A;  2L0A A;  1X69 A;  1WA7 A;  3PVQ A;  3REB B;  2JT4 A;  4LN2 A;  2AKK A;  1AVZ C;  1GRI A;  1QLY A;  1HD3 A;  4OML A;  3UF4 A;  3REA B;  4M4Z A;  2CT3 A;  2KT8 A;  1U3O A;  1UJY A;  1I0C A;  1GCQ C;  2A08 A;  2KRS A;  1BBZ A;  2A28 A;  1RI9 A;  2IIM A;  2VWF A;  2X3X D;  3A98 A;  5GJV B;  2EYW A;  2RQU A;  5GJW B;  1WXU A;  2DE0 X;  1G83 A;  3M0S A;  2KXC A;  1T0J A;  3NHN A;  1NLP C;  1PRM C;  1QKX A;  2FPF A;  2LJ3 A;  4GBQ A;  1YNZ A;  2AKL A;  1ZSG A;  3M0T A;  1ABQ A;  4LUD A;  3THK A;  4Z8A A;  2FPE A;  3EHR A;  2RF0 A;  2RN8 A;  4J9I A;  3GBQ A;  1SEM A;  2FPD A;  1ARK A;  2C0I A;  2BZX A;  2HDA A;  2G6F X;  4Y92 A;  2KEA A;  2HCK A;  2A36 A;  2GNC A;  4J9B A;  1CKB A;  1KJW A;  1OPK A;  2L3P A;  1I1J A;  1YWO A;  1TUC A;  1CKA A;  2AZS A;  3VS3 A;  1J3T A;  2F2W A;  3EHQ A;  4AFQ C;  1Y57 A;  2ENM A;  1GBR A;  1OV3 A;  2OJ2 A;  2J6F A;  1S1N A;  4RTT A;  2KYM A;  1UEC A;  4LE9 A;  2GTJ A;  4OMQ A;  3UAT A;  4R0K A;  5FWC A;  5IH2 A;  1AWW A;  2ROL A;  2J7I A;  2JS2 A;  3IQL A;  1PKT A;  2V1R A;  1JXO A;  1NLO C;  3VRY A;  1JO8 A;  2CH4 W;  1ZUK A;  2CDT A;  2EBP A;  2LCS A;  4RTU A;  1K0X A;  4RTV A;  1AWJ A;  4F17 A;  2C0T A;  3QWX X;  3VS6 A;  1PNJ A;  1LCK A;  1QWF A;  1GCP A;  1M3A A;  1SSH A;  1PWT A;  1ZBJ A;  1YP5 A;  2DIL A;  1PRL C;  5IXF A;  3H0H A;  2K9G A;  3VS5 A;  2AK5 A;  3I35 A;  2L2P A;  4HXJ A;  1X43 A;  1HJD A;  4EIK A;  2KT1 A;  1NEB A;  1ZX6 A;  4CC7 A;  1MV3 A;  2RQV A;  4OMM A;  2DRK A;  3EG1 A;  4X1V A;  1UFF A;  2JMA A;  2RQT A;  3R6N A;  4OMN A;  2EYX A;  1NYG A;  4ORZ A;  1VYU A;  3LH5 A;  1GFC A;  2KGT A;  1M30 A;  1PKS A;  4F14 A;  1FYN A;  1WYX A;  5ECA A;  3TSW A;  1UGV A;  2DRM A;  2O9V A;  2JM9 A;  4OMO A;  3H0F A;  1GCQ A;  1X6B A;  1GBQ A;  3ZL7 C;  1VYV A;  1E7O A;  4HVW A;  2PNI A;  2LP5 A;  1H92 A;  2HSP A;  1ZUY A;  5FW9 A;  1E6G A;  2JXB A;  2LX7 A;  1QCF A;  3EG0 A;  2B86 A;  2ESW A;  2ED1 A;  1AWX A;  1JXM A;  2RMO A;  3TVT A;  3EGU A;  4AFZ C;  1XOV A;  1NM7 A;  2EGA A;  2BZ8 A;  1RUW A;  1M8M A;  1BK2 A;  2NWM A;  1QWE A;  5IHI A;  3NPF A;  2NUZ A;  2RPN A;  1Y0M A;  1WDX A;  3M0R A;  4JZ3 A;  1FMK A;  4IIM A;  4J9C A;  2K2M A;  1GL5 A;  2D0N A;  2DL5 A;  2EQI A;  1UDL A;  3ULR B;  1UHC A;  4HVV A;  2VKN A;  1VYT A;  3EG3 A;  3I5R A;  4JZ4 A;  4F16 A;  2BZY A;  4ZNX A;  2GGR A;  4J9D A;  2ROT A;  3M0Q A;  1AZE A;  3RNJ A;  2A37 A;  2DMO A;  1X2K A;  1NYF A;  4AFS C;  2CRE A;  2DL7 A;  1TG0 A;  5I11 A;  1K9A A;  2XMF A;  2KNB B;  2CUB A;  2CSQ A;  1CSK A;  1RLP C;  1PHT A;  5I22 A;  2BTT A;  2O88 A;  1U06 A;  3VRZ A;  2DM1 A;  1H8K A;  1T3S A;  3VS7 A;  1YWP A;  2DX1 A;  4RTZ A;  2SEM A;  4AG1 C;  1ZLM A;  2LMJ A;  2J6O A;  4OMP A;  2CT4 A;  1WXB A;  2CSI A;  1AZG B;  1KSW A;  1W70 A;  4FSS A;  2YUP A;  4J9E A;  2KRO A;  2J05 A;  4J9H A;  1AD5 A;  2OAW A;  2K7A A;  2GQI A;  2KE9 A;  3PE0 A; 
#chains in the Genus database with same CATH topology
 2FZG B;  4RTW A;  1VQL Q;  1W2B P;  4PMC A;  5M5Y B;  2LNH B;  1QVC A;  1J5E Q;  4JI6 Q;  4BS9 A;  1N32 L;  1G3Y A;  2W0Z A;  1EIG A;  3E9F A;  4YWM A;  4OB3 B;  1G2S A;  2QQ9 A;  2D8J A;  2P0P A;  1WIE A;  4DNT B;  1S5F D;  1TU2 B;  2DVE A;  1RAB B;  4XQ3 A;  1TWB A;  2DNC A;  1OZ3 A;  2ZTC A;  4LJZ C;  1XPU A;  3S14 B;  1RJT A;  2D5D A;  1YZ6 A;  1X75 C;  2JXM B;  2K5W A;  1PH2 A;  1RAD B;  1X3P A;  2L9H A;  3A74 A;  4A3G H;  5ISR A;  1JOO A;  5TSS A;  4XTY A;  1G2B A;  4MTK A;  4L5S A;  4OMF B;  2B8A A;  3F8T A;  3D3R A;  2DFU A;  1A8V A;  5C44 H;  4DBQ A;  2VQE L;  1XXG A;  2PUK B;  4DV1 Q;  1JMC A;  1G5V A;  2A73 B;  1WLP B;  2L4N A;  1BBU A;  4BBR H;  4J9G A;  1VQP T;  1VQN T;  3BS1 A;  4WCI A;  2BE5 C;  1NEG A;  1YIJ T;  1SYB A;  1YIJ A;  2K1B A;  1XNQ L;  4QQD A;  2NYZ D;  1NCV A;  4X9C A;  3J80 i;  2QGG A;  2KCT A;  1U1T A;  3SK5 A;  4PJO F;  3TBI B;  1EYG A;  2HHH Q;  5C0M A;  3CCS T;  4DK0 A;  3TCJ A;  4BE1 A;  3CCS A;  2ED0 A;  3CF5 A;  4LF9 Q;  4K8J A;  3AFP A;  3VYH B;  2RA2 A;  1D1I A;  2J4X A;  1KIK A;  5CCA A;  5C6S A;  2RCF A;  3O5Z A;  4OEL B;  3STB C;  2FG0 A;  2PI2 E;  2PVG B;  4JPB W;  1BI1 A;  1HPC A;  2J06 A;  2FHD A;  4FYY B;  3CC2 Q;  1ENF A;  2JN4 A;  1QCN A;  3CQZ H;  4MZP A;  3EA6 A;  4BBR B;  4UP7 A;  4M7A D;  1XNR L;  3GTM H;  2FRW A;  5FLX L;  4BA2 I;  3UT1 A;  2KR3 A;  5C6A A;  2PZU A;  3GDE A;  1M8V A;  2YUO A;  3EGX A;  3LX0 A;  1B3A A;  3EGX B;  4OHJ A;  1VQG A;  5DLQ E;  4D6W A;  2CQA A;  2XDP A;  2CP7 A;  2X6L A;  5FO7 B;  3ICE A;  2RNA A;  3FEO A;  3VKI A;  2E4H A;  4JRQ A;  2K6A A;  3R93 A;  3TN2 A;  2WV6 D;  2O2O A;  1RLQ C;  3HHT B;  4RTX A;  1SRL A;  2F2X A;  1I07 A;  2L5Q A;  3SHW A;  1R4P B;  2F03 A;  2DF6 A;  2PPB C;  3CQZ B;  1N33 Q;  1SNM A;  2OXP A;  1PSE A;  1BI2 A;  3J7A 5;  2LZ6 B;  3BFM A;  1K73 U;  1PYS B;  3X25 B;  2K50 A;  1G3T A;  4PJN A;  1NY4 A;  4C8Q C;  2Y0S G;  2J6K A;  4R9W A;  4JYA L;  1JT8 A;  4C8Q A;  5DM7 3;  1B07 A;  1O78 A;  4C8Q B;  5HGT A;  4AFU C;  5FO8 B;  4HCC A;  3AHU A;  5IHN A;  1HA6 A;  3PIO A;  2FMC A;  4K2K A;  1ABO A;  3JAM i;  1R8O B;  2Q8T A;  2ECZ A;  4GKK L;  2F1M A;  2E6N A;  2N3S A;  2PZ1 A;  1W3S A;  5JJL A;  3I7F A;  5IYB G;  3I8Z A;  2R92 B;  4B3S L;  2RK2 A;  2HDL A;  2F2V A;  1WJJ A;  4KHP L;  4M7A F;  1IYV A;  4N4G A;  2K3X A;  3OY9 A;  4GOP C;  1M1K U;  2JA5 G;  2Z6K C;  2KRM A;  1XQH A;  4GOP A;  2NVX B;  5C4J H;  4GOP B;  2Z6K A;  3PVL A;  4A4K A;  4NMZ A;  3CC4 T;  1F77 A;  4RTY A;  3CC7 Q;  4HCZ A;  2XIW A;  3CC4 A;  4F8M A;  3PQI A;  3PIO 3;  1FGU A;  3J80 E;  4KJO A;  2L11 A;  2EPD A;  3M0P A;  4DR4 Q;  3B6Y A;  4OWT B;  4YIJ A;  1EQV A;  3HG9 A;  3RNU A;  1GUN A;  1H95 A;  1PH3 A;  3DUZ A;  1U0L A;  1U1S A;  3JV3 A;  3RN5 A;  2HQE A;  1SHF A;  2Y90 A;  4ZGE B;  1F9Q A;  1BYM A;  1ONL A;  2WP8 J;  3FPU B;  3IRB A;  4Z9C B;  2V1Q A;  2VUB A;  4LNP A;  1D5X C;  4XT3 B;  4DK6 C;  1SE4 A;  2M1H A;  2O9S A;  5LMN W;  5C4J B;  1H3Z A;  1QZG A;  3F70 A;  3IL8 A;  3EG2 A;  2VVK A;  1TUD A;  4DR7 L;  2XHC A;  2YSQ A;  3VS2 A;  5GAM f;  4MN3 A;  3KDF A;  2K01 A;  1OEB A;  2DBK A;  2O01 E;  3KDF B;  1HNX Q;  2HL5 C;  4NL2 A;  3I73 A;  1U9R A;  1BXT A;  1ZXT A;  3LWE A;  1HR0 W;  3CCM T;  4HJ9 A;  4FYD A;  3CCM A;  3T56 B;  2QEX Q;  3LW5 E;  2E74 C;  1ZBX A;  2HMA A;  3P75 A;  1D0Y A;  1UE1 A;  2PZT A;  2YXY A;  3ONA B;  2NN6 I;  1YNN C;  1X55 A;  1OX8 A;  2DJF C;  2M51 A;  4ZGD B;  3QWN A;  3D0F A;  1V1C A;  4CKC A;  4LFA L;  5LJ3 d;  4K2L A;  2EOT A;  1PZI D;  1IBM L;  1EY8 A;  1D1K A;  2UUC Q;  1SJH D;  2EIF A;  2B63 H;  2PQW A;  1W1F A;  3V8L A;  1SRU A;  1ENA A;  1Q82 R;  1STA A;  5C4X G;  1A63 A;  4CC4 B;  4DV3 Q;  2XN9 C;  3JCM f;  1MND A;  1YI2 Q;  4ESR A;  1V1O A;  1VQ4 T;  1R0B G;  2AZV A;  2DJQ A;  1ZEQ X;  4HJ8 A;  2PQA A;  1BCO A;  2HCC A;  5GRO A;  2PQA B;  3ER0 A;  4OGC A;  1RCV D;  1QNU A;  3OYI A;  1D5M C;  2K52 A;  2MJ8 A;  4B08 A;  1EIY B;  4LF5 Q;  1XYI A;  4MZM A;  4FDB A;  1MMN A;  4CC3 A;  1YHQ Q;  1GUW A;  1KK7 A;  1SG5 A;  2RJD A;  2HKQ B;  4C0D C;  1OPL A;  4F7U E;  1UE5 A;  4M7D C;  3F2U A;  2B63 B;  1HUN A;  4C0D B;  4M7D A;  3GD7 A;  2CZ0 B;  3N6R A;  4M7D B;  1BB9 A;  2OX7 A;  3OIQ A;  5LHY 1;  3A8H B;  2JJQ A;  5NUC A;  2JA8 H;  2D62 A;  3VR4 A;  1B44 D;  5K36 G;  2ZXP A;  1RI0 A;  3NTI A;  3AFQ A;  1X3Q A;  1EX4 A;  1Q81 C;  4C1N K;  1NBE B;  1G91 A;  5EPJ A;  1WI7 A;  4IPH A;  2YTX A;  1EWC A;  5KYW A;  1UJ0 A;  5CAI A;  5KYW B;  1S5D D;  1F1B B;  3UPU A;  2ALY B;  1AH9 A;  2F3W A;  4DK1 A;  4E7H A;  1KHC A;  1T5E A;  2DNE A;  4FP5 D;  2Q8I B;  4V19 0;  3S2D H;  2JA6 H;  4LF7 Q;  3GP7 A;  1GRI A;  1QLY A;  1JOR A;  4OML A;  3PGG A;  4KD4 A;  2JA8 B;  2V8K A;  4M4Z A;  5KYU A;  1KC8 R;  3NEN A;  3KF8 B;  1WTH A;  1FX7 A;  1UJY A;  4RCC A;  1I3Q B;  1MJC A;  2YTY A;  4OIK A;  2CGH A;  1E3P A;  2E5L L;  2SNM A;  4PJO E;  4A3D G;  2A08 A;  4C1N I;  1IKL A;  1TR5 A;  2G9H D;  1Y69 U;  5JEA J;  4OF1 A;  4IFD J;  2IIM A;  2QQR A;  3OYF A;  1FNW A;  1QW1 A;  5KNC A;  1R4Q B;  1ILP A;  2M2L A;  3P8D A;  3N5B B;  3L2V A;  2FYK A;  1KQ1 A;  2RQU A;  4QQB X;  3C46 A;  2HNI A;  1II3 A;  2I2L A;  2L55 A;  5GJW B;  3TEH B;  5LL6 X;  1Q86 R;  3OYN A;  3GTJ B;  3PF4 A;  2TSS A;  4I7Z C;  1U4P A;  4KH1 B;  8AT1 B;  4QUC A;  2K5V A;  1PRM C;  1A62 A;  1A6X A;  1SYE A;  1B53 A;  2D0Q B;  3DM3 A;  2DYI A;  1HCZ A;  1KAA A;  1YNZ A;  1KHI A;  2AQ2 B;  3IKJ A;  5GAO l;  1RAA B;  2Z0S A;  3I72 A;  1ZSG A;  3HOV H;  3MEF A;  2EAY A;  2LY7 A;  3K7A H;  4J1M A;  3R6O A;  3BDL A;  4BY6 C;  3JCM Q;  2ZTE A;  2QGF B;  3CME A;  4BY6 B;  4H13 C;  4KUI A;  5F2D A;  5D6X A;  4X3S A;  5CO7 A;  2RF0 A;  2HZY A;  1V1P B;  3W5O A;  1FL0 A;  1HQR D;  4G57 A;  4DR1 Q;  4JVZ A;  3X20 B;  4QL5 A;  5IP7 H;  4E7L A;  1WFQ A;  3T53 B;  3EIV A;  1LTI D;  1F9P A;  1MSG A;  2C0I A;  3K58 A;  3CP0 A;  3OYL A;  3E9H A;  4GN5 A;  4WFN 3;  1Y1W G;  4KUD K;  1WOC A;  3PO3 B;  4HT9 A;  2QAS A;  4OB1 B;  1K8O A;  2NZ1 D;  3CXC S;  4BXX H;  3CPW S;  2AT1 B;  2IX0 A;  4MZT A;  3K7A B;  3MTS A;  2A36 A;  4M7A E;  1VQO Q;  2LDM A;  1KJW A;  2AHO B;  3OSO A;  4QY7 A;  3X26 B;  2Z0W A;  2RBM A;  2L3P A;  4C2M H;  1JR0 D;  3JCM b;  3CCR Q;  2QYZ A;  1WJR A;  1PD0 A;  1TUC A;  3DB4 A;  3PF5 A;  4QW2 A;  2MI6 A;  5FLM G;  3HRZ C;  2K5N A;  3GTP H;  1IGQ A;  3P8B B;  4XAX B;  4JV5 Q;  4M75 G;  1BNZ A;  2XVS A;  2EJG C;  4POG A;  3CBO A;  2DTH A;  3GNF B;  1S72 T;  1GBR A;  4A93 G;  4PJM A;  1OV3 A;  2EJG A;  2EYQ A;  1S72 A;  1EZ6 A;  4QIW E;  4LW1 A;  3G4S A;  1XMO Q;  3DEO A;  5JJK A;  1R9T B;  2OF1 A;  2GTJ A;  1DGS A;  1TWA B;  5GAH C;  5CV9 A;  3A8G B;  4FW1 A;  1X3G A;  5D65 A;  4C2M B;  5IH2 A;  1VQ7 T;  3ULP A;  2ROL A;  1RAC B;  2J7I A;  1BI3 A;  1VQ7 A;  1PH4 A;  1DZ1 A;  3IQL A;  4C56 C;  1G2T A;  4X64 L;  5KYI A;  1PKT A;  2V1R A;  2Y4X A;  1YNX A;  4PJL A;  4QVD A;  2FIN B;  3GTP B;  1JXO A;  1NLO C;  2XG8 D;  3OS0 A;  4XU0 A;  3VRY A;  2AUJ D;  2BUD A;  3DWP A;  3MJX A;  4Z02 A;  1ICW A;  4LUO A;  2ENB A;  1JO8 A;  3EAE A;  2DET A;  1VQ6 Q;  1ZUK A;  2CDT A;  1RAI B;  2WSF E;  5JJZ A;  1LTT D;  5C0X J;  1K0X A;  2ZJQ A;  4F17 A;  2C0T A;  2WKD A;  4A3K G;  4KT0 E;  4ELZ C;  1LVK A;  2PI2 A;  3CCJ T;  2F0T A;  1VUB A;  1PH7 A;  5EAY A;  5DM7 R;  3CCJ A;  4RMF A;  4BBS H;  1Q7Y C;  2HSE B;  5GAM j;  1WTP A;  4A54 A;  1ICF B;  3C95 A;  1RHP A;  2WB1 G;  1GCP A;  1ZBJ A;  2XI9 A;  4PFZ A;  1DD2 A;  5I9P A;  4PNO A;  2F0S A;  5IXF A;  5I6Y A;  5I9O A;  4M78 G;  3V8J A;  2LT4 A;  2BH8 A;  2KUM A;  1MJE A;  1XTC D;  4JI2 L;  3S3M A;  1TSF A;  2AK5 A;  3I35 A;  2L2P A;  4OXP A;  4JRI A;  1KLG D;  4A76 A;  2E3H A;  1IZ6 A;  3E5S A;  3J81 c;  1PH9 A;  4A3G B;  2KT1 A;  4L6V 5;  1NEB A;  1ZX6 A;  2QDY B;  1I4H A;  3E1S A;  5GAN e;  2QGQ A;  4BBS B;  2JMA A;  3A7L A;  1AN8 A;  4PFO A;  2V8I A;  8ATC B;  2HDM A;  2KEE A;  3K80 C;  4C92 C;  3L2Z A;  4DA4 A;  1D5Z C;  1HZ9 A;  1SAP A;  2KBN A;  1NYG A;  4C92 A;  2HQX A;  2ZM6 L;  4C92 B;  1VYU A;  4LD6 A;  1UWV A;  4XQQ A;  1GFC A;  2UUC L;  1HNW L;  3C12 A;  4Y91 A;  4PL6 A;  1QVG S;  2E41 A;  4A4F A;  4FT4 A;  4IFD I;  1QZH A;  1IW7 C;  3BVG A;  3FDT A;  4RG2 A;  4I65 A;  4DFA A;  4A3J H;  3ITP A;  4OO1 H;  3CCV T;  4J5Y A;  2AHJ B;  2UU9 Q;  4L6T B;  5GAO p;  3H8Z A;  4II1 A;  3G1J A;  1AP0 A;  2O9V A;  2JE6 I;  2XWB B;  3EFX D;  3SVM A;  3EGD A;  4LF5 L;  3D8G A;  4BY7 B;  1X6B A;  3CBP A;  3CCL T;  3CCL A;  4EDU A;  4BD3 A;  2F0N A;  2M0O A;  3DM1 A;  5I6W A;  3HOY G;  3MKD A;  1UUP A;  1SXT A;  3I4M H;  3U4V A;  3OYJ A;  1E6G A;  2BA1 A;  1LT3 D;  1PYW D;  2JXB A;  1Y07 A;  4J6X A;  2K3Y A;  3OYY A;  3G6E Q;  2C5C A;  2EE1 A;  4A3J B;  2P0Q A;  4VUB A;  1BCP D;  2B86 A;  2MYS A;  2ESW A;  3VV0 A;  3CAM A;  1BI0 A;  4XXE A;  4DV7 L;  1AWX A;  3M59 A;  1JXM A;  1VMP A;  3QKJ A;  1IHW A;  5A0G A;  1VQ9 Q;  3K8A A;  3CCE Q;  3VUZ A;  5EBD A;  1A2U A;  3HOZ H;  1NM7 A;  3VYU A;  4JI4 Q;  1G29 1;  2BZ8 A;  5KYY A;  2XDD A;  4ZLT F;  1M8M A;  1BK2 A;  1M5Q 1;  5KYY B;  4ZTJ A;  2WIN B;  3AU7 A;  5GAO q;  4RCO A;  3BW1 A;  3QPH A;  4X66 L;  1IYU A;  1Y0M A;  5DY9 A;  4AQY L;  1HK9 A;  1WDX A;  4F88 A;  3X3N A;  4EMK C;  4RGM A;  1HUM A;  2DZ9 A;  4EMK A;  3RR5 A;  1NR4 A;  4EMK B;  2DXT A;  1YHA A;  4Y28 E;  2EQI A;  3QII A;  4ZK9 B;  4IPD A;  4DV2 Q;  4MNO A;  1QUQ A;  3EG3 A;  1QUQ B;  1WI5 A;  3LH0 A;  1E0B A;  3G71 T;  4PLL A;  1STH A;  1WHL A;  3G71 A;  3PUZ A;  4DPG A;  2F0Q A;  4DR2 L;  3LGJ A;  3TP6 A;  2VZA A;  1QOH A;  5FK9 C;  4DK3 C;  5FRO A;  4AFS C;  2DL7 A;  4A3L H;  3GQB A;  5IYC G;  1BCP F;  5I11 A;  1CT1 D;  1JIC A;  3L1A A;  2WAQ G;  2RHQ B;  4BY1 G;  3V05 A;  1K9A A;  4DU9 A;  1K8M A;  1EY4 A;  5KRU A;  3Q23 A;  3A7A B;  4UY8 C;  1RLP C;  2YYZ A;  4BDY A;  3IFD A;  4PZ7 A;  1WYD A;  3HZX A;  2DTI A;  2MUY A;  1O7L A;  1IRX A;  4ZTF A;  3CRK C;  1K9M U;  4ME7 A;  3GO5 A;  1FMV A;  3PMF A;  3T1Y L;  1FJG L;  5IGB A;  1EU3 A;  2DM1 A;  1I4P A;  2ASB A;  2YRD A;  1NPP A;  1M4Z A;  2F1L A;  1UEB A;  2XD0 A;  1H9R A;  1LV9 A;  3VR2 A;  4F7U A;  1NMG A;  2HCI A;  1OXS C;  3HKZ G;  4K8I A;  3J81 i;  3AT1 B;  3J7A F;  2MHV A;  4J15 A;  1EZZ B;  4CDE C;  1JQY D;  1SBB B;  1JJ2 S;  3URY A;  3LX7 A;  1WHJ A;  1J6Q A;  2E1H A;  4OB2 B;  3V8K A;  3I2Z A;  2CSI A;  3UI2 A;  4C3I H;  1L1O C;  1AZG B;  2EJ9 A;  1FXX A;  2H3J A;  3BZC A;  1X3F A;  3PO2 G;  1L1O A;  4E7J A;  5D6Y A;  1L1O B;  3OS2 A;  2L5T A;  1OXX K;  1AE3 A;  1SNP A;  4DAP A;  3FLG A;  1ZQ1 A;  2YUP A;  4J9E A;  3A8I E;  2JEA I;  5LMU Q;  3C2P A;  3QDF A;  3C1F A;  2MK5 A;  2OEO A;  4GLA C;  4ILW A;  3U50 C;  4FO2 A;  4G7O C;  1PFN A;  4R4Q A;  1AD5 A;  4CJ0 B;  1E1O A;  1GUG A;  4FXD A;  3FKI H;  2K7V A;  4NW2 A;  5E7N A;  2H4O A;  4DR3 Q;  4LDV A;  2LQK A;  2FJ2 A;  5HY6 A;  1NPR A;  2EVR A;  2KYB A;  3OS5 A;  1ILQ A;  2NVY H;  3NE5 B;  4AYB G;  5JVH 3;  3JCM P;  2KVQ G;  3BDU A;  4B3M L;  4KN4 C;  3S1R B;  4C3I B;  1N8R U;  2DYB A;  4JS5 A;  4Z89 A;  4PJO A;  3H9N A;  4XU2 A;  3VU3 C;  4I7A A;  1ESR A;  4A4E A;  3A8L B;  1LUZ A;  3SGI A;  1U5S A;  1W6X A;  3RR6 A;  2L8D A;  1PZK D;  2L0C A;  4HMJ A;  3VR5 A;  2JA7 B;  2RO0 A;  4KY5 A;  2K14 A;  3C3L A;  2I0Q A;  1Q95 G;  5IGG A;  3FKI B;  5JEA G;  1K8A C;  1YJW T;  4LFC Q;  4IFD G;  4IUQ A;  3H0G G;  3AQQ A;  1YJW A;  4ALP A;  1IO6 A;  3MWY W;  2NVY B;  2SNS A;  2LC4 A;  5LJ3 h;  3TP8 A;  2F5T X;  2X9H A;  2E76 C;  4E7K A;  2EQJ A;  1OO9 B;  1UUE A;  3TRE A;  2CZ1 B;  4JOI C;  1CSQ A;  1D1A A;  2YDL A;  5GAN 7;  5E4W C;  2BIV A;  2OTJ A;  1ZYR C;  4A3M H;  2MF2 A;  5EKL A;  4EQ5 A;  2KAF A;  3ERS X;  2EXD A;  4GS3 A;  4C0Z A;  1MV0 B;  1TXY A;  3KK7 A;  3QIA A;  4NB3 A;  1QKW A;  3PIP A;  2D6F A;  4QVZ A;  1DYQ A;  1GOZ A;  2YHT A;  1WTX A;  3FP9 A;  2VNU D;  1N34 L;  5AFW A;  1Q82 C;  1UE9 A;  5M3M G;  3U23 A;  2DIG A;  1V43 A;  2EW3 A;  2NUC A;  2ZXR A;  4KHZ A;  1V29 B;  4C92 F;  1RL2 A;  4HKE A;  1CSP A;  5GAM e;  1PM3 A;  1TII D;  4JRK A;  1G6Z A;  3JB9 D;  1H9M A;  3M7N A;  1VOM A;  2MGS A;  3WOE A;  4JG2 A;  3PIP 3;  4M7D E;  1UE7 A;  5CV6 A;  4M7A A;  3L3O C;  1BKB A;  2OQ0 A;  3I56 Q;  4TVR A;  4A3G G;  2DBM A;  2JS0 A;  2F0D A;  1X65 A;  3M3Y H;  4QMG A;  2O5I C;  1EOT A;  5C44 G;  2D0O A;  4C3J H;  2R5A A;  4QT7 A;  3RBB B;  1KQ2 A;  2LJ1 A;  2UUA Q;  2VXW A;  1RF2 D;  4BBR G;  3NHH A;  2M02 A;  4DV0 Q;  1WVL A;  4J9F A;  1JQQ A;  4LF4 L;  5KE2 A;  2I5M X;  3E2U A;  4GLM A;  1T5X D;  4QIW B;  5CYU A;  4DEY A;  5FJ8 H;  1Z9Z A;  1EFN A;  5GAN f;  1AEX A;  2E2J H;  2A19 A;  5CKF A;  7AT1 B;  1E22 A;  2ZXO A;  4WF2 A;  3A54 A;  3SR1 A;  1VIF A;  2K05 A;  4A3F B;  4H44 C;  2WSE E;  3Q24 A;  5LMN Q;  5ELB A;  1VQF A;  3L2P A;  3FJ5 A;  4JJD A;  3JCM e;  4JBJ A;  3RLN A;  4P5N A;  4GN4 B;  3LNN A;  1IBK L;  3M3Y B;  1Q82 U;  2GTO A;  4LDX A;  3S17 B;  1IL8 A;  2BH2 A;  2JOY A;  4XTW A;  3J80 L;  2MWP A;  3JB9 F;  3KF6 A;  2YT6 A;  3KF6 B;  2EPB A;  1Q7Y R;  1ZHI A;  1PH5 A;  5EBC A;  2RJE A;  3SK4 A;  2JMC A;  4NL3 A;  3PUV A;  2E2J B;  2B2Y C;  2DLP A;  1B3Q A;  1IL2 A;  3NMZ C;  5LL6 S;  4NXN Q;  5CBE E;  2QEJ C;  2DXU A;  5FU7 C;  4E7Z A;  5M5X H;  2FVU A;  2KRN A;  2NUP A;  1NE3 A;  3C1E A;  5C0X G;  4JRP A;  1NTG A;  5FU7 B;  1M90 R;  1EYC A;  1KRS A;  2K33 A;  4A3B H;  4PLI A;  3NP8 A;  4IUU A;  1B8A A;  1SYC A;  1P92 A;  4DR5 L;  4LDW A;  3EQL C;  3GTG H;  4ELY C;  1CZG A;  1Q86 C;  4S3S A;  2QA4 T;  3HOW H;  2QA4 A;  5C5L A;  5IT9 c;  3O13 A;  4EVO A;  2E5Q A;  4HVU A;  3RMQ A;  5KYN A;  4IUR A;  3OWF A;  1BDO A;  4DV5 L;  4BDZ A;  5M5Y H;  4IZ8 A;  4KMU C;  2XK0 A;  4EQO A;  2HEQ A;  4A3B B;  1X27 A;  1EY6 A;  3TME A;  2EYL A;  4A63 B;  2DJG C;  4WTO B;  4CHT B;  1WX6 A;  2ZJR A;  2BDO A;  5M3F H;  1AOJ A;  4HCB A;  3GTG B;  3UA7 A;  3M0U A;  2H3E B;  3S14 H;  3E0J A;  2A6H D;  2LSS A;  4BWG B;  5LJ5 d;  1KC8 U;  2OT2 A;  3K6O A;  5E3F A;  3JAM L;  1VQL T;  3HOW B;  2FL7 A;  4OX9 Q;  1VQL A;  1R77 A;  5AYF A;  2UXB Q;  4TVA B;  1W6J A;  4KKS A;  4X9D A;  1O7I A;  4KI0 A;  4KN7 C;  2VQF Q;  1NJI U;  2Z4I A;  1V8Q A;  4DEX A;  2R7F A;  1L0Y B;  3I4O A;  2CQO A;  4NXM Q;  4N9P A;  5J39 A;  1JB0 E;  4JI8 Q;  4M1U B;  3VS1 A;  3M85 A;  4JI0 L;  2A0F B;  5CKE A;  5M3F B;  1VQI A;  4O0A A;  1MMG A;  2Y4Y A;  1Q86 U;  1GUO A;  2O4X A;  1JEG A;  2O31 A;  2KCN A;  2O4X B;  1KTK A;  2XNA C;  1HNZ L;  5EJW A;  1VQK Q;  2PYK A;  3T13 A;  3URG A;  3P8H A;  4JI3 L;  1JWS D;  2RI3 A;  1ZUU A;  4LFB Q;  1IXR A;  5GAM g;  4UP8 A;  5FKA C;  1KDB A;  1ZYR D;  3MHB A;  1CKM A;  4K0K L;  4MIU A;  4GZY C;  1X6O A;  3DLM A;  2X4J A;  1WCM H;  1TS5 A;  2MPX C;  2OTL Q;  1A3T A;  1VQP A;  1VQN A;  5CV8 A;  3VS4 A;  5GAN 3;  5C3E H;  4ZKB B;  3S1N H;  4DR6 Q;  2LQN A;  4BE2 A;  1KQS S;  2UUB Q;  1N9W A;  3C0C A;  2KMT A;  1K4U S;  1LTB D;  2JM8 A;  4LUE A;  1PYB A;  1ACM B;  2AUK A;  2MWO A;  2BDN A;  1B2T A;  2HUG A;  4UAI A;  4CDC C;  4GKJ Q;  2L0A A;  4HIK A;  1STG A;  2XRQ D;  1Y8P B;  1X69 A;  1GXD C;  3PVQ A;  3CC2 T;  3REB B;  3CC2 A;  2V1C C;  4OO1 G;  2B8F A;  5CBA E;  2XKO C;  2B63 G;  3UDF A;  1WCM B;  3BDC A;  1AVZ C;  3MEA A;  2EJM A;  2M00 A;  4U68 A;  5K5P A;  2NVQ H;  2P5Z X;  1J8I A;  5C3E B;  3S1N B;  3REA B;  3M4G A;  3SWN C;  4BI3 A;  5FLX c;  2G3R A;  4IO9 A;  2CT3 A;  2V8J A;  3L42 A;  3SWN B;  3JCM g;  3H6Z A;  2B2T C;  2FZK B;  3FHW A;  1I0C A;  4E47 A;  4M77 D;  3OYH A;  1Z9F A;  3OQ5 A;  4LUV A;  1HYO A;  1PV4 A;  3CCU Q;  2NB0 A;  4O5V A;  1GCQ C;  1ZA2 B;  2KRS A;  3D4W A;  1W2B S;  1QQJ A;  1SNQ A;  2A28 A;  4C0F A;  2JZ2 A;  2R92 H;  2WSC E;  2VWF A;  3A98 A;  4GLK A;  4Q0F A;  3BVM A;  3I70 A;  3QOL A;  2HKN A;  4L5R C;  1GD7 A;  2NVQ B;  3MO8 A;  1SSF A;  4JBK A;  4DV4 Q;  4O2D A;  3FDR A;  3RUZ A;  4GNX C;  4FL6 A;  4A3E H;  2DE0 X;  3FB9 A;  1G83 A;  4C92 E;  3SD4 A;  4GNX A;  4GNX B;  1LTS D;  5D6W A;  1DOM A;  1EY7 A;  3EG9 A;  2IHF A;  2IY5 B;  4E7I A;  3EG9 B;  3ULJ A;  3HOU H;  4A4H A;  1NLP C;  2VC8 A;  1F2L A;  4KLK A;  2FPF A;  2LX9 A;  2LJ3 A;  5BR8 L;  4GBQ A;  2E8G A;  1CHQ D;  2AKL A;  2LKV A;  1RD9 D;  6AT1 B;  1ABQ A;  2QCP X;  4J8O A;  2PO4 A;  3THK A;  4E2F B;  3BG3 A;  4H7B A;  2JA6 G;  3OHX C;  3OW2 S;  3CC7 T;  4WRD A;  2GFU A;  3CC7 A;  1EU4 A;  1OXV A;  2FPE A;  4A3E B;  4IKF A;  4M77 F;  5ELE A;  3X28 B;  1SE2 A;  3T4A C;  5CR3 A;  4RG1 A;  3HOU B;  3CMA Q;  3GBQ A;  5CIU A;  2CWP A;  4X3T A;  4KK7 A;  2CVR A;  2FPD A;  2A69 D;  1D0Z A;  1PSF A;  5IGE A;  2BZX A;  1MHW C;  1UNS A;  3SXH A;  2KEA A;  2R5M A;  2HCK A;  4A4G A;  1A15 A;  4JC0 A;  2ICI A;  3MFG A;  4JI7 Q;  2GNC A;  4J9B A;  5I2S A;  2QKI C;  3RZO B;  4DBF A;  5COY A;  4DV0 L;  3HPW A;  1I1J A;  1E24 A;  2K5H A;  5IYD H;  5GAN j;  4DUY Q;  1KNA A;  1K8A R;  4F04 B;  1GXI E;  2E10 A;  3EHQ A;  1Y57 A;  3QYH B;  3MA2 B;  2QEX T;  3VYR A;  2YWW A;  4WJ4 A;  2QEX A;  3Q1J A;  2J6F A;  2QAZ A;  2F0U A;  1S1N A;  1YIT Q;  4ZYS A;  2GVB A;  1HZA A;  3HOV G;  4LE9 A;  1W4S A;  3S24 A;  2KEC A;  3S6W A;  3M9B A;  3GTQ H;  4UC4 A;  3UAT A;  4MMK A;  4R0K A;  1Q1B A;  2I07 B;  5FWC A;  2RHX A;  4FF4 A;  4IN3 A;  3PCO B;  1AWW A;  4OL7 A;  2EJF C;  1TH7 A;  3E9G A;  2C35 B;  1I94 Q;  2EJF A;  3X3M A;  3UDC A;  4E6I A;  5A2Q L;  2XWJ B;  3T1H Q;  1HQM C;  2NZH A;  2EQM A;  3JAM E;  1SYF A;  5IP7 G;  1ASY A;  1GUT A;  1CA5 A;  1YI2 T;  5CKH A;  2LCS A;  1YI2 A;  4FU6 A;  1EY0 A;  2A74 C;  3SHL A;  1D8L A;  1AWJ A;  1MNE A;  2QG9 B;  3GTQ B;  1VQ4 A;  1OI1 A;  3AMU A;  2QTV A;  1CQV A;  5DM6 3;  4C5I A;  3VYS A;  2CS7 A;  3VS6 A;  1VQ8 Q;  1YHQ T;  3A8J E;  2KCM A;  4DAM A;  2E12 A;  1YHQ A;  1VIE A;  4A3I H;  1LCK A;  5JJI A;  1BIA A;  4KY6 A;  4UP9 A;  1YP5 A;  2DIL A;  1TS9 A;  3H91 A;  3JC6 6;  4PNY A;  3H09 A;  2PNR C;  4HAE A;  1OX9 A;  2K9G A;  2MQH A;  3RUX A;  4LF6 Q;  5GMK l;  1JE5 A;  1X43 A;  2YU9 H;  1NZ9 A;  2WFW A;  4EIK A;  4EMG A;  3ERQ A;  3FVQ A;  1TTH B;  3A56 A;  5CQX A;  1BOS A;  2B29 A;  2MO0 A;  3NSW A;  2RQV A;  3A1P A;  2DRK A;  2JVV A;  1I3Q H;  1QG7 A;  1SEB D;  3K59 A;  4J6W A;  1KD1 R;  4X65 L;  3S1Q B;  4CKB A;  3T9N A;  1VCI A;  3TS2 A;  1WQW A;  5IAY A;  3QZ9 B;  2V26 A;  1RTO A;  1N6A A;  4OMN A;  1H9S A;  2HIX A;  2X69 A;  5IWA Q;  5DLO A;  1H9S B;  4ID6 A;  3BDO A;  2JK8 A;  4XYO A;  5HKC A;  5KE3 A;  2RVL A;  2ES2 A;  2PU9 B;  1J5E L;  4R4I A;  1NMF A;  4JI6 L;  5LJ3 f;  4DAY A;  4DAY B;  1LOJ A;  1PKS A;  1CUK A;  1DOL A;  4F14 A;  2YU9 B;  1C1A A;  1FYN A;  1TXQ A;  1WYX A;  2GCX A;  3QJ6 A;  4RGO S;  3GTJ H;  2F4I A;  3KF8 A;  4ZCK A;  3CD6 Q;  3D6W A;  2X6G A;  2HD0 A;  4QJF A;  4TQU S;  5KH6 A;  2JM9 A;  3EFO A;  3EFO B;  1LAB A;  1KRT A;  3F2B A;  4ZN1 A;  2UXD Q;  4J7I A;  3DKM A;  2CYZ B;  3LLR A;  1B4O A;  3OS1 A;  4PV1 C;  4A3M B;  5IYB H;  5DNF A;  4L8J A;  3SK6 A;  4OWX B;  1I50 H;  4X62 Q;  5HGQ A;  2QXF A;  1UGQ B;  4DV1 L;  1ZUY A;  3CKI B;  3CXC P;  1X32 A;  4N9T A;  1I5L A;  2K5L A;  4LXC A;  2YLB A;  1QCF A;  3EG0 A;  2Y0S B;  3MP8 A;  1Q81 U;  4JI1 Q;  1V76 A;  2COY A;  1ZKO A;  4A3C G;  2UXC Q;  4MML A;  1LLR D;  2RMO A;  1CQF A;  4UDU C;  4DAV A;  1TY2 A;  2HHH L;  1BCP C;  3M9Q A;  4AFZ C;  4LF9 L;  1WHK A;  1VQ5 Q;  3ME9 A;  1BCP B;  3OMC A;  3MZ5 A;  1RUW A;  3OWE B;  3PO3 H;  4GLV B;  2CP5 A;  3NQT A;  1EZ8 A;  4J8Q A;  1I50 B;  3RIR A;  4JI5 Q;  2NUZ A;  5JOB A;  2ID0 A;  2KQ3 A;  1F9S A;  4EPC A;  3NXW A;  3M0R A;  3OYD A;  1V1P A;  1OXU A;  1QVF S;  4JJN K;  5HK0 A;  3OYC A;  2JYO A;  3HKS A;  4JZ4 A;  5IY0 A;  4PK4 A;  3PMI A;  3S9W A;  4J9D A;  3BU2 A;  3OPO A;  2ROT A;  1VQO T;  3LYI A;  4CRI A;  2EVB A;  1R9T H;  2A37 A;  3MXN B;  3J81 j;  1HHV A;  1TWA H;  1MSH A;  3I4M G;  3CCR T;  1N33 L;  1O9S A;  3CCR A;  1N27 A;  3UWN A;  2NVT H;  2CUB A;  3CME Q;  4M77 E;  1CKN A;  1KIX A;  5H1S E;  1QVP A;  3PMT A;  1CKN B;  1PRT D;  2KED A;  1HRJ A;  4XT1 B;  2D2C C;  4XTU A;  2NWG A;  3ND9 A;  2KI7 A;  4DUZ Q;  1U06 A;  3C4S A;  3HOZ G;  1N36 Q;  4B3T Q;  1AE2 A;  1XJV A;  1SF9 A;  4IJH A;  2KHJ A;  2NN6 G;  5IE8 A;  4E7S A;  4TKO B;  1T3S A;  1RAF B;  3GIB A;  2IWH A;  1AW7 A;  1YWP A;  1GKH A;  9ATC B;  4RKB A;  2DX1 A;  2NVT B;  3K0Y A;  2NTS A;  2LMJ A;  2J6O A;  1D6E C;  5KNB A;  1O80 A;  4DR4 L;  2P4T A;  1NSN S;  2CT4 A;  3HTR A;  1VF5 C;  1VQ6 T;  4L59 A;  1QB5 D;  1Y1V G;  1VQ6 A;  3QB3 A;  4P2C B;  5C3W A;  4NS5 A;  5A2Q E;  3OYG A;  1B50 A;  1XTD A;  4R8I A;  3MEV A;  4QGU A;  2CP0 A;  4C3H H;  3G4S Q;  4BA1 I;  4CJ2 C;  2K32 A;  2HD3 A;  1K73 R;  2P84 A;  2J05 A;  3GTK H;  2F0L A;  2F0J A;  4F7U G;  1KLU D;  1EQR A;  1C8C A;  1PRT F;  2H5X A;  4K5X A;  2K7A A;  1M8A A;  1F2M A;  2KE9 A;  2F0G A;  3RMH A;  5GAO n;  1HNX L;  5IGD A;  2VB6 A;  3E0E A;  4LMQ D;  4KH0 B;  1M90 C;  4MDX A;  1I6H H;  4D8K A;  5GAN 2;  2D9U A;  1UGS B;  3CQT A;  1CFM A;  3EH2 A;  5CGK A;  1M1K R;  3E3X A;  4C3H B;  1DJ7 B;  2GBQ A;  1VQC A;  3GTK B;  2IPK D;  5GAG C;  2HIV A;  2VB3 X;  4POF A;  2CKK A;  2X3W D;  1EY5 A;  4BY7 H;  4YHH Q;  2DZC A;  5LJ5 h;  4KD3 A;  1BIB A;  4YY3 Q;  1E6H A;  1VQM Q;  2RQW A;  2IG0 A;  4XTC S;  5IGF A;  1SRO A;  4BAC A;  3A5Z B;  1UHF A;  2RHI A;  3KYH C;  2JUF A;  1PLF A;  3CW2 C;  1I6H B;  2KBT A;  2IL8 A;  3JSC A;  4DN4 M;  4PJO G;  3J81 L;  4DV3 L;  1JU5 C;  1M2O A;  3R3O A;  3DWQ A;  5KGU A;  3CCV A;  4LNQ A;  1UAP A;  1NG2 A;  5JPM C;  1OTC A;  1Q7Y U;  3SEM A;  4C0G A;  3H15 A;  1AWO A;  3I9Q A;  2M0Y A;  3FKI G;  1PH1 A;  4KY7 A;  4IIO A;  2P0K A;  3PNW C;  4LK1 C;  1SSO A;  2EYY A;  4J83 A;  3HL8 A;  3JB9 H;  4ZKC B;  4HTH A;  4HSP A;  1OZ2 A;  4R4T A;  3G6E T;  4ZN3 A;  2NVX H;  3G6E A;  3ULL A;  4NPS A;  1WGS A;  2FRY A;  2K4Y A;  2KJX A;  3NK9 A;  2R93 G;  2H1E A;  3I55 Q;  2RQX A;  1K76 A;  3V7C A;  1VQ9 T;  1PZJ D;  5C3X A;  2SOB A;  3CCE T;  1VQ9 A;  1A0N B;  1GO3 E;  1VS0 A;  2FO0 A;  3CCE A;  2F0H A;  2FEI A;  4QKU A;  1U4M A;  1STE A;  2JTE A;  3HEJ A;  1VDZ A;  4JBM A;  1FNU A;  1PFM A;  3G48 A;  3OMG A;  2ICE C;  4DV6 Q;  1MIU A;  2C0O A;  4KRT A;  1QCB D;  4K6L A;  2BOS A;  3PSI A;  5LJ3 j;  3MC0 B;  3GTO H;  1Y71 A;  3A8M B;  1TWC B;  1X54 A;  1ET6 A;  4JUV A;  3P1H A;  4LF7 L;  3OBY A;  1C6V X;  5L23 A;  3GP8 A;  2SRC A;  1SLJ A;  5CKB A;  4RWS C;  1IXD A;  5D14 A;  4C5E A;  1H9K A;  4Q5V A;  2KVM A;  2Q2I A;  5GAE C;  2DY7 A;  3I5S A;  1A2T A;  1AEY A;  5FLM H;  3RES A;  3S2H H;  4PJJ A;  1F2Y A;  2E64 A;  2K3B A;  1KAB A;  1IRE B;  3F1Z A;  4M7A G;  3M56 A;  2B3G A;  2R7Z H;  4IPC A;  3OW7 A;  1Y1W B;  1EWI A;  1Z9Q A;  2R6G A;  3KFV A;  1C7Y A;  1UTI A;  3GTO B;  1C9O A;  1I5F A;  1YCS B;  2EKO A;  3TSZ A;  1IBL Q;  3LGL A;  4PZ8 A;  2E70 A;  2CZ7 B;  3L0O A;  1E2V A;  3EFR A;  2K28 A;  2CH4 A;  1PDQ A;  4EQP A;  2DVJ A;  3INZ A;  2WII B;  4D8D A;  3OYM A;  2UXC L;  1SFO H;  4XU3 A;  3S2H B;  1F2Z A;  5GMK h;  2YRV A;  2LFN A;  3FC3 A;  1D7Q A;  3M57 A;  2L3S A;  4A93 B;  2QTX A;  2R7Z B;  4JCV E;  5EGT A;  5ELF A;  2PMZ E;  2MOX A;  4P72 A;  2CKZ B;  4C5G A;  5AJ3 Q;  1HJP A;  3A55 A;  2H8H A;  2B8G A;  1WTW A;  2L3Q A;  4JI5 L;  3I4L A;  4C3J G;  2EDG A;  1WHH A;  1TT2 A;  2DL4 A;  1B9N A;  5D7U A;  4B3R Q;  2R58 A;  4PG3 A;  1AZQ A;  3ND8 A;  4HT8 A;  3CCQ Q;  1DM0 B;  3VR6 A;  1BR9 A;  5ELN A;  5FJ8 G;  1WQ7 A;  3J7Z C;  4QB4 A;  1SFO B;  1CKO A;  2DNU A;  3JCM W;  4DR1 L;  1K3B C;  1BQQ T;  1MUZ A;  3MET A;  1X2Q A;  5GAN g;  1N32 Q;  4LAA A;  3S1R H;  4RCB A;  2WKC A;  1V9P A;  2JJ9 A;  1VMC A;  1ROD A;  2KXD A;  5ELO A;  1YHB A;  2X35 A;  2PW5 A;  2JA7 H;  2A3L A;  2K5F A;  2LJ0 A;  2DA9 A;  1B34 B;  4AMC A;  2PZW A;  3UA6 A;  1FD7 D;  1WXT A;  1EYA A;  2EZV A;  2K79 A;  2A6H C;  4O6J A;  1LO5 D;  3OB9 A;  4P73 A;  4JV5 L;  1OOT A;  1VA7 A;  3MAQ A;  3Q8D A;  4NOY A;  3DWA A;  3I4N H;  1B1Z A;  3LWU A;  2I0N A;  1PFB A;  3EJI A;  1XMO L;  4RCN A;  4KBM B;  2MMP A;  5GAO m;  1CK1 A;  5J1Z A;  2VUM H;  3OOC A;  2QQS A;  4KJN A;  1XNQ Q;  4E6R A;  1DOK A;  5I21 A;  2MCN A;  1MGQ A;  2PTK A;  1N9R A;  3MEW A;  1TS4 A;  4XK8 E;  4NDX A;  2YUN A;  1K3R A;  1ET9 A;  2GA4 B;  2A68 D;  2MIO A;  2HBP A;  4B9X A;  2PQE A;  3HOY H;  4EMH A;  2RQR A;  3I4N B;  4HCK A;  4XTZ A;  5GMK i;  1I81 A;  2EYM A;  4H0L C;  5HK3 A;  2N78 A;  3ZYY X;  4JOI A;  2RHZ A;  1JCK B;  1D1B A;  1HSQ A;  1KNE A;  1WHM A;  2A6E C;  1NAP A;  2VUM B;  1UG1 A;  4JDS A;  2K6D A;  5M3F G;  2A8V A;  1Q8I A;  2VL6 A;  4PMW A;  4P74 A;  3J81 E;  2BE9 B;  1M4V A;  2RF4 A;  2KA7 A;  3GLX A;  1TS2 A;  1RTN A;  2NTT A;  1QIL A;  1SHG A;  1TQO A;  2GN5 A;  2LXK A;  1WA7 A;  1BCM A;  4OGQ C;  2YLC A;  2E2D C;  3HOY B;  5CQY A;  2ZPE B;  1PD1 A;  4RMO A;  3OYE A;  4OON A;  3M4P A;  2JT4 A;  2QK0 A;  4LN2 A;  1WTR A;  1WNL A;  3MFY A;  4R56 A;  1O7Z A;  2ATW A;  1HD3 A;  3HOX H;  3UF4 A;  4JS4 A;  2L1B A;  3E6Z X;  1B7T A;  1Y96 A;  4JYA Q;  1Y96 B;  5T1G A;  1SMY D;  4V2S A;  2KT8 A;  2OTJ Q;  1U3O A;  2F4V Q;  1OU8 A;  3OA6 A;  3I56 T;  1FR3 A;  1IHV A;  3I56 A;  1K8A U;  4AT1 B;  2ZT9 C;  4GKK Q;  1JWM D;  4A3F H;  1BBZ A;  3GV3 A;  1G6P A;  3TS0 A;  4M77 C;  5I2M A;  2RM4 A;  1U8R A;  1ML0 D;  4M77 A;  2BCO A;  4OEM B;  4YCV A;  4M77 B;  4B3S Q;  4KHP Q;  2MAM A;  1RKN A;  2EYW A;  3RZD B;  4OIJ A;  5FOB B;  3S17 H;  3HGB A;  5IYC H;  3BZK A;  2NLU A;  3HOX B;  1OU9 A;  1LYL A;  2E2H H;  4ABN A;  3L2R A;  5KYL A;  2F0O A;  3SDZ A;  5E4X A;  1TY0 A;  2KXC A;  1T0J A;  3NHN A;  1YJ9 Q;  1KD1 C;  2DER A;  4FM4 B;  2KY9 A;  4MTN A;  1FNV A;  3T16 A;  3TSS A;  4IUT A;  2RSO A;  3KJO A;  1AT1 B;  3H6M A;  2SEB D;  3S16 H;  1YVC A;  1MI2 A;  3M0T A;  3R2T A;  4LUD A;  4M75 D;  2VXE A;  3WVD B;  5FRN A;  3J80 c;  3KJP A;  3JCM V;  1HR0 Q;  2E2H B;  1YJN Q;  4DR7 Q;  5GAO r;  3EN2 A;  2DJZ A;  5KIX A;  1U5K A;  3TQY A;  2RN8 A;  4IUV A;  4J9I A;  4C8Q G;  4DOV A;  1STN A;  1SEM A;  3EFS A;  1VQB A;  2DKG A;  2B2Y A;  1EYD A;  1O7Y A;  2ZTD A;  3RKX A;  2Y0S E;  3PO2 H;  2QI2 A;  4FVM A;  4JI4 L;  3S16 B;  2OCE A;  1VQD A;  2G6F X;  2R92 G;  4Y92 A;  2A69 C;  4IUN A;  2MO1 A;  4L63 B;  1PTO D;  3TZD A;  4DNI A;  3L2Q A;  3U9S A;  1OPK A;  2RD1 A;  4DF7 A;  3F2D A;  3VJP A;  2CW0 D;  2F0W A;  2G9D A;  1PG5 B;  4A3E G;  3MCA B;  3PUW A;  5KCH A;  4LFA Q;  1KD1 U;  1CKA A;  2N8N A;  1X01 A;  2AZS A;  3EBE A;  2A7Y A;  2J0T D;  4PMB A;  4AIM A;  4DV2 L;  2DUD A;  1G8X A;  1IBM Q;  4EGV A;  4AFQ C;  1CI3 M;  5LJ3 e;  2VGM A;  1Q1E A;  3NBH B;  2CWA A;  3PO2 B;  4FF1 A;  5HUR A;  1XNI A;  5T1I A;  4M75 F;  2TMP A;  1UEC A;  4U67 3;  2GF7 A;  4FCY A;  3HS0 C;  3JB9 J;  1BBW A;  4RAU C;  3O8V A;  4CKE A;  4OMQ A;  2M16 A;  3CXC A;  3CPW A;  1ESF A;  1SNC A;  2M9U A;  4M78 D;  1RAE B;  1KQS P;  1W6K A;  2PCF B;  5IP9 H;  1D09 B;  4HJ7 A;  1JOK A;  3BYY B;  5IT9 L;  2NUT A;  5KEE A;  2I46 A;  3S15 B;  2NUT B;  4KKU A;  3A5U A;  1K83 B;  2Z9H A;  2LS0 1;  2LT1 A;  2RDG A;  4MZ9 A;  4AYB B;  2N49 A;  2VV5 A;  2LTO A;  4XQJ A;  2F0V A;  3SFM A;  2CH4 W;  3BYT B;  3I90 A;  1PTO F;  2JSO A;  2KK4 A;  2AWO A;  4RTU A;  4R1J A;  3TQ7 P;  2X4Y A;  5CK9 A;  3WOF A;  3KBG A;  3RDV A;  5I4D A;  4MHE A;  4DXF A;  1VQK T;  4YCW A;  1VQK A;  3QWX X;  4B3R L;  2F0K A;  1TUG B;  1Y8O B;  1Z6H A;  5IYD G;  2N88 A;  3H3V H;  2YRC A;  3MPU B;  5IIF A;  4RHS A;  1PNJ A;  3W1G A;  1QWF A;  3MP1 A;  1M3A A;  1SSH A;  1PWT A;  2A6E D;  3DMU A;  5A35 A;  3WWV A;  5A0L A;  1KDC A;  3KXT A;  1PRL C;  2OTL T;  3MVV A;  4ZUI A;  2OTL A;  3A0J A;  3SEB A;  1WD1 A;  3VS5 A;  5M3M H;  1MBY A;  3FMC A;  4N8F A;  3R8B A;  3UDX A;  2DXC A;  3F2C A;  1I4Q A;  4A53 A;  5BN5 A;  4M78 F;  4NKL A;  4FF2 A;  4CC7 A;  1KAW A;  1PH8 A;  1MV3 A;  4X1V A;  4OMM A;  5LMU L;  1U4L A;  4HSV A;  1UFF A;  2E5L Q;  2COW A;  2RQT A;  3H3V C;  1KDA A;  3V2T A;  4DR3 L;  5EG2 A;  2K03 A;  1SMX A;  4O1N A;  5LJ5 f;  2EYX A;  1JWU D;  2QW7 A;  1XMQ Q;  1K9M R;  4ORZ A;  3MXG A;  4FT2 A;  1M2V A;  3LH5 A;  3TDQ A;  1M2V B;  2KGT A;  2PVD B;  3K0X A;  5GAN 8;  1M30 A;  4M7D G;  1KL9 A;  4J6Y A;  5M3M B;  3OYB A;  1MD2 D;  3A8K E;  3OW2 P;  5ECA A;  2HAX A;  1CHP D;  1K73 C;  2IX1 A;  3SWN A;  3CCU T;  3TSW A;  4IOA A;  1UGV A;  3CCU A;  1VQP Q;  1VQN Q;  2DRM A;  2AWN A;  2B2T A;  1XWE A;  2HL3 A;  1YIJ Q;  1HXD A;  2BE7 D;  3RMS A;  4OMO A;  3U4Z A;  3H0F A;  2RI2 A;  2UU9 L;  1GCQ A;  4LFC L;  2FB7 A;  4A3I G;  3CCS Q;  1ZA1 B;  3VYG A;  1LT6 D;  3D6C A;  4HVW A;  4RFB A;  4RA8 A;  1FMW A;  2Q8R E;  3CHB D;  5C44 B;  2VGN A;  1H92 A;  2HSP A;  1HA5 A;  3VYT A;  2EYP A;  1QVG A;  3C94 A;  1WJS A;  1M1K C;  3MEH A;  2JA8 G;  1PC0 A;  1NBW A;  5CR2 A;  2EQU A;  2D0P A;  2PMZ B;  2BKD N;  3W3A A;  2Z4H A;  1DXM A;  2EY2 A;  1PCX A;  1S40 A;  3TEE A;  1OXT A;  1VQA A;  1QP3 A;  2K57 A;  1I6V C;  3ASK A;  3TVT A;  2KHI A;  4L5Q A;  3EGU A;  4R4C A;  1XOV A;  2E3I A;  5C0X H;  1WTO A;  2EGA A;  3LWH A;  4A3M G;  1S5E D;  1QE6 A;  4WJ3 M;  1N8R R;  1QWE A;  4PZ6 A;  5IHI A;  3M7G A;  3E19 A;  2RPN A;  1SKU B;  4OVA A;  3GF5 A;  2GFA A;  4PKC C;  4ZAI A;  3RZO H;  2JTM A;  5J26 A;  5GAM d;  5LJ3 g;  3DEP A;  3GTM B;  4XTX A;  4IIM A;  3CMA T;  4J9C A;  4RGN A;  3CMA A;  4J6H A;  2L89 A;  1GL5 A;  2F5K A;  2D0N A;  2DL5 A;  4ANJ A;  3ULR B;  4LD9 K;  4G4K A;  2F0P A;  2F4V L;  3GOX A;  1K0R A;  2RDH A;  4N4H A;  2DEU A;  4ZNX A;  2MPM A;  2GGR A;  4A4I A;  1HZB A;  3H94 A;  3M0Q A;  3UDG A;  4HED A;  2CP3 A;  3UDI A;  1X2K A;  2CRE A;  3HFN A;  1TG0 A;  4DOW A;  4WJW A;  2UUA L;  3TP5 A;  3JB9 I;  4CBV A;  2XMF A;  2KNB B;  3HRS A;  2ZPG B;  1CSK A;  1O75 A;  2ATC B;  2ZZD A;  2FHT A;  4DBH A;  4BI8 B;  1I4K 1;  4X64 Q;  5I22 A;  2BTT A;  3CC4 Q;  2JP1 A;  4Q5W A;  1YIT T;  2O88 A;  4X6A H;  1YIT A;  5DAU A;  3PFS A;  4CI0 C;  3JCM d;  1A3U A;  1PRT C;  4OP0 A;  5LMN L;  2J7Z A;  2LNV A;  5L8R E;  3PO3 G;  1PRT B;  1YEZ A;  4JW0 A;  1H8K A;  2EXZ A;  2DN8 A;  3VS7 A;  3HRU A;  4DA2 A;  1GHK A;  1B7Y B;  4RTZ A;  1BBX C;  4AG1 C;  3JRZ A;  1ZLM A;  1HR0 L;  4DKA C;  2BA0 A;  3QYG B;  4K6D A;  4ULL A;  1TU0 B;  3EH1 A;  4BUG A;  5M9O A;  1K28 A;  4OMP A;  4M8A A;  2AKW B;  4NXN L;  1MHN A;  5IT9 E;  1WXB A;  2QQA A;  4TRD A;  3QSU A;  4N4I A;  3KUP A;  4JI2 Q;  1KSW A;  2R61 A;  1UE6 A;  1PH6 A;  2IVW A;  3CCM Q;  5BN3 A;  1TOV A;  4BXX G;  3BJU A;  4M75 E;  2D9T A;  2NYS A;  4FSS A;  1TS3 A;  1LJO A;  4RGT A;  1QWY A;  1UB4 A;  1VQ8 T;  4CJ1 B;  1VQ8 A;  2RDF A;  4J9H A;  2ZPI B;  3S1Q H;  2FMM A;  2GQI A;  2LCC A;  4B6M A;  2XIC A;  1EFW A;  1WJQ A;  2ZM6 Q;  1JJ2 A;  3VS0 A;  4CC2 A;  2MNA A;  1H3H A;  5JVG 3;  2OAU A;  4JBW A;  4MDW A;  3GPL A;  2RJF A;  3MHX A;  1HNW Q;  2DL8 A;  2KEN A;  1CZW A;  1WTV A;  1K1Z A;  2DO3 A;  2DL3 A;  1G3W A;  1GVP A;  4FYX B;  3UE0 A;  1LAC A;  4N8X 1;  2R93 H;  4X3K A;  3JCM X;  1GFD A;  2HQL A;  3FIF A;  3PUX A;  2W10 A;  2V4D A;  1P8L A;  3DLL A;  1VQ4 Q;  1CA6 A;  2JNG A;  1M27 C;  1KFZ A;  4OX9 L;  1KXL A;  3Q0A A;  2EYZ A;  2PUO B;  2UXB L;  2JA9 A;  5C5M A;  4KV6 A;  1SPK A;  2BE5 D;  4K11 A;  3SK8 A;  2VQF L;  1N5Z A;  2GVA A;  1EIF A;  2KSS A;  2O2L D;  4NXM L;  2DGY A;  1PHJ A;  3CD6 T;  1U4R A;  4JI8 L;  5FWB A;  2DAQ A;  3CD6 A;  2WB1 E;  4C3H G;  1D0X A;  3ZEH A;  2QF7 A;  3L9A X;  1JB7 A;  4AH6 A;  2COZ A;  3M58 A;  4M78 E;  1SYD A;  4DV7 Q;  4F87 A;  1QVF P;  2R93 B;  1WTQ A;  3AB9 A;  4QVC A;  4BBS G;  3STB D;  2D1X A;  3PUY A;  2RJC A;  4DNR B;  3DXJ C;  1EOV A;  3NEM A;  3UE1 A;  4LFB L;  1Z47 A;  4AG2 C;  1STY A;  3VA7 A;  3U9O A;  2CUD A;  4C92 G;  4G7Z C;  1EQQ A;  1SYG A;  2C9O A;  2EFI A;  3MXU A;  4X66 Q;  3OTO Q;  1PFS A;  2JA5 H;  4AQY Q;  2E5K A;  3MEU A;  3QXE B;  3CPW P;  2C06 A;  5EKK A;  5GQO A;  3M4Q A;  4JK1 C;  2IW3 A;  1YN8 A;  4DR6 L;  1E7Z A;  2UUB L;  3KLS X;  2IJ0 A;  3S3N A;  4Y7N H;  1AHJ B;  3RN2 A;  5KYU B;  1PMR A;  1VQ5 T;  1LTA D;  5FLX E;  2QDL A;  1T0H A;  3X24 B;  3QWY A;  1VQ5 A;  2B39 A;  3D4R A;  1T3L A;  5IXB A;  4GKJ L;  4BY7 G;  2ZPB B;  5LJ5 j;  1K0S A;  2AMC B;  5I2X A;  5EPK A;  4DR2 Q;  1XMQ L;  1NJI R;  3VA5 A;  2RHU A;  2EY1 A;  3S2D B;  3ZBD A;  4C8Q D;  1NUC A;  1SN8 A;  2JA6 B;  1NNX A;  1MMA A;  3PV0 A;  4HA8 A;  1XJW B;  4GLX A;  2JA5 B;  1H64 1;  2K04 A;  2K2V A;  3NFC A;  2OI3 A;  2X4W A;  4A3J G;  3KOJ A;  2Q2T A;  3NGP A;  1EY9 A;  2EGC A;  5GAN h;  2IT1 A;  2K4K A;  2MFI A;  4Y7N B;  1PXU A;  3QDR B;  2N55 A;  2CP2 A;  2JN0 A;  2HBW A;  2YTV A;  3T1Y Q;  1FJG Q;  1M1F A;  2G5D A;  3PTA A;  2VW9 A;  4IAL A;  5CV4 A;  3MXN A;  3JB9 G;  2DD5 A;  1VQO A;  1Q90 A;  2AIR B;  2EWN A;  5E1F A;  1CM9 A;  1UGR B;  5IHK A;  2AQ1 B;  3FPP A;  5CV7 A;  3OYA A;  1G3S A;  1M9S A;  3LGF A;  3CME T;  5KND A;  4DV4 L;  2XU8 A;  1EEF D;  2E2I H;  1SNO A;  1OUL A;  2L3R A;  4LDU A;  3HP9 A;  1WFW A;  1SE3 A;  2B2V C;  2IX3 A;  2B2V A;  3L2U A;  1ENC A;  3CEY A;  5CV5 A;  1RAH B;  1Q12 A;  2X51 A;  3K5N A;  2SDF A;  4C8Q F;  1E1T A;  5EC7 A;  2CHB D;  3TU4 K;  2EY6 A;  3KLS A;  5C4X H;  4IOC A;  3RER A;  3HOV B;  2Q2U A;  1FGB D;  3Q6S A;  3RD4 A;  4ATO A;  4WOR A;  4LWC A;  3EVQ A;  2KHS A;  2LQ8 A;  2EGE A;  1Y8N B;  4JJB A;  2F0M A;  4QQG A;  2E2I B;  1WD0 A;  1X9N A;  4GY5 A;  2K75 A;  2VY3 A;  5EKI A;  3IFT A;  2R3Z A;  5CVI A;  2WAQ E;  3OIP A;  1F9R A;  5IN1 A;  4B3M Q;  2YUQ A;  3KLW A;  4R4O A;  2D8H A;  1SE8 A;  2R7Z G;  1JJG A;  2EYJ A;  1CTM A;  3G4S T;  1D1C A;  5C4X B;  1SRM A;  1QVG P;  2PVO B;  3MXP A;  3R2I A;  3S3O A;  5I2Y A;  1S72 Q;  2B2W C;  1YNN D;  5K36 H;  2RSN A;  1EIH A;  2B2W A;  4A3L G;  2JTF A;  1SND A;  1M3C A;  1Q46 A;  4YWK A;  2ABL A;  1TWH H;  4JI7 L;  5HCK A;  3AEV A;  1SDF A;  3WVE B;  2VAS A;  3P20 A;  4DUY L;  2DD4 A;  2GQV A;  2P4R A;  5GMK j;  1S3O A;  1OYX A;  1VQ7 Q;  3H41 A;  3HKZ E;  3NPP A;  4XU1 A;  4BE0 A;  1T9H A;  3NUC A;  5GAN 4;  2NBF A;  1X6G A;  5GAD C;  4BI4 A;  1PA6 A;  4KGV B;  1FVI A;  3ZJY C;  4RUG A;  3RLO A;  5ELC A;  2IPO B;  4JJC A;  2EY5 A;  3G7Z A;  1TWH B;  4Z88 A;  3VDY A;  1UEA B;  1S5C D;  4QUF A;  4KGX B;  4FSX A;  2Z1C A;  2A5H A;  1VQM T;  4O42 A;  2F52 A;  4P75 A;  1K8G A;  4A3D H;  1VQM A;  2CZ6 B;  4M7D D;  3CCJ Q;  3KLR A;  1LTL A;  2LQW A;  1I94 L;  3NBI A;  2DIQ A;  1JE4 A;  1BU1 A;  3T1H L;  1BVS A;  3OSS C;  5FU6 C;  4LDY A;  3GTL H;  1N34 Q;  2JW4 A;  4C3I G;  5CMD A;  5FU6 B;  3D31 A;  2A68 C;  1M3B A;  2DPP B;  4V0B A;  4YTL A;  2PW7 A;  2Z8L A;  1Q8K A;  3NEL A;  3CBM A;  3G6J B;  2K5I A;  4R55 A;  4AYB E;  4JLG A;  4A3C H;  3ZFJ A;  2EKH A;  4J7F A;  3CPF A;  3DHQ A;  2JA7 G;  4HCE A;  3QOJ A;  2ZGW A;  2LCL A;  4A3D B;  3NTK A;  3H0I A;  1MKH A;  2X4X A;  1WHG A;  4FNF A;  3TRZ A;  4OWW B;  1SJE D;  4XDX A;  1M90 U;  4LF8 Q;  3GTL B;  1TWC H;  4KUL A;  4XIG S;  5CKD A;  3NQI A;  2AKK A;  2ZAE A;  1TKW B;  3GV6 A;  3I4N G;  3I55 T;  1V1Q A;  4LF6 L;  1GUS A;  3L2W A;  3I55 A;  2QIL A;  4K5V A;  1QJO A;  3FRP B;  1TWF H;  3W2D A;  4LF4 Q;  3BVZ A;  5M5W H;  2CCZ A;  2VUM G;  1L2F A;  2F0F A;  1IKM A;  5FRM A;  1L0X B;  2FXQ A;  4HMI A;  4M7D F;  5GAN 6;  1KQS A;  2XTI A;  2JQO A;  1G8Z D;  3CCV Q;  3WXM B;  1SMY C;  4K14 A;  2PNH A;  3QBY A;  2OWO A;  4ZGJ B;  3EGD B;  2Z6B A;  1LNX A;  5IWA L;  1Y1W H;  4HJA A;  1RI9 A;  4RG8 A;  1Z7T A;  2VXF A;  2X3X D;  1IBK Q;  5GJV B;  1S4Z A;  3CCL Q;  3H3V I;  1QMC A;  2DTO A;  3HRT A;  1JRI A;  1YCY A;  3RKW A;  2DEQ A;  4GN3 B;  1TWF B;  1RDP D;  1WXU A;  5M5W B;  2DXB A;  4N0A C;  3M0S A;  3HSB A;  4RH6 A;  3HP3 A;  4N0A A;  3GNG A;  1NE8 A;  2DY8 A;  1QKX A;  1JJ2 P;  4A93 H;  4HJ5 A;  4KGZ B;  2UXD L;  5IOC A;  1LTR D;  1K9M C;  2K5D A;  1OQK A;  1W2B A;  2VS1 A;  2NN6 H;  4XTV A;  2YV5 A;  4M77 G;  2VYT A;  1J9O A;  4X62 L;  3OTO L;  4Z8A A;  4DR5 Q;  1BF4 A;  3I4M B;  3HOX G;  2WAC A;  3EHR A;  5GMK m;  1RIP A;  2KQW A;  2RH2 A;  1A3V A;  3HFZ B;  1S5B D;  4ME5 A;  4JI1 L;  3D4D A;  1JBM A;  4M75 C;  4DV5 Q;  4X34 A;  4M75 A;  1PTO H;  3T51 B;  5BN4 A;  4M75 B;  4HIM A;  2KDS A;  4B9W A;  4HR7 B;  1Y1V H;  5D3I B;  1ARK A;  1JB3 A;  1L0W A;  3CRL C;  4A3F G;  1QCO A;  2F3V A;  3PGZ A;  3HOZ B;  5G3L D;  3I91 A;  2HDA A;  1IB8 A;  4LUZ A;  1VQE A;  3G71 Q;  2NZO A;  3M5A A;  2K5Q A;  2KOL A;  1HZC A;  4A3K H;  1IGU A;  2RB6 A;  2EYH A;  1EUJ A;  3CCQ T;  2F0I A;  1CKB A;  4IUP A;  2VB2 X;  4CDD C;  3JCM c;  3CCQ A;  1MMD A;  1LTG D;  2AQ3 B;  3OW2 A;  1YWO A;  4RKU E;  4DQ2 A;  5EPL A;  5GAM h;  1PTO C;  2RKS A;  5LJ5 e;  4Y52 H;  3VS3 A;  1JJC B;  1PTO B;  1AFP A;  2CP6 A;  2CW0 C;  1J3T A;  2F2W A;  1Y1V B;  2RA4 A;  2ENM A;  4FIB A;  2MP1 A;  3LWI A;  1FWZ A;  1YNJ C;  2OJ2 A;  3M54 A;  4UHV A;  4RTT A;  1N8R C;  3K5O A;  2KYM A;  4C8Q E;  2IHE A;  4JI0 Q;  5J22 A;  4A3K B;  3ERO A;  1WZO A;  5C0X I;  4L5T A;  1ASZ A;  3JCM J;  4G7H C;  1WPY A;  4OGE A;  4F7U B;  4ZQ3 A;  1Q81 R;  3CU7 A;  2HQH A;  1B34 A;  4ZUJ A;  1HNZ Q;  2LRQ A;  2ZPH B;  2XDB A;  3K81 C;  4BB7 A;  1M1G A;  4JI3 Q;  2JS2 A;  3V7R A;  5GAN 5;  2WB1 B;  4M78 C;  3I3C A;  5G3L F;  4M78 A;  4K0K Q;  2QDB A;  4M78 B;  2VQE Q;  3FEW X;  3QO3 A;  1PVO A;  2FFK B;  1I4X A;  4DUZ L;  4HN7 A;  1N36 L;  4B3T L;  4FYV B;  4JLI A;  2EBP A;  1EEI D;  3QG1 A;  4A3B G;  3JCM h;  2F3I A;  2F0E A;  4RTV A;  3FJP A;  5C4H A;  1Y14 B;  1H9J A;  3QZ5 B;  4CDF C;  2XRS D;  3HOW G;  3V7S A;  5CC4 A;  4DXG A;  2E65 A;  2XGT A;  1FYC A;  3QUI A;  4EX5 A;  5IGC A;  4FXG C;  3NWT A;  4QF4 A;  2ZCF B;  2A1A A;  4C5H A;  3QR8 A;  3KUF A;  3H0H A;  3PT9 A;  4PJO C;  1Q3L A;  2RHY A;  5AT1 B;  4HXJ A;  3K7U C;  1XNR Q;  4IJL A;  4PJO B;  2ZJP A;  4R8N A;  1HJD A;  4ZRZ A;  3K5M A;  1TVX A;  2R7D A;  3EG1 A;  4C92 D;  2L12 A;  2LMC B;  4TSS A;  5IP9 G;  5JAV A;  3R6N A;  3RKY A;  4QQ6 A;  5DEH A;  3D7S B;  2EQK A;  5D3D A;  1IW7 D;  1BUV T;  3BZD B;  3HFO A;  1B9M A;  1YJW Q;  4L5G A;  3RZD H;  1ZSZ C;  4HIO A;  4DBR A;  2O5J C;  1ZSZ A;  1LPL A;  1ZSZ B;  3MP6 A;  2RI5 A;  5GAN d;  2L15 A;  3M4Y A;  2OTJ T;  4KHV A;  5ELD A;  3U58 A;  4KTA A;  1UGP B;  1I4G A;  1HTL D;  1NR2 A;  1XPR A;  4PQX A;  1LT5 D;  1G51 A;  1E2W A;  5GMK e;  1KG1 A;  3TP7 A;  1C0A A;  5BR8 Q;  2DK3 A;  3BY7 A;  4YHH L;  1STB A;  1GBQ A;  3VR3 A;  4YY3 L;  1XPO A;  1HXY D;  1VQH A;  3M4O H;  4QCL A;  3ZL7 C;  3WDN A;  1VYV A;  1E7O A;  1YFN A;  2E75 C;  2PNI A;  1BO0 A;  2LP5 A;  2OQK A;  4RKL A;  1IYJ B;  1QP2 A;  3OSV A;  3J7Y W;  1WCM G;  1AZP A;  5FW9 A;  3A8O B;  1C48 A;  4BY1 H;  2LXJ A;  2M9V A;  1YJ9 T;  2Q2H A;  5C4Z A;  5C3E G;  2LX7 A;  3NWS A;  1YJ9 A;  4FYW B;  4F7X A;  4OO1 I;  2ED1 A;  3AYH B;  1HH2 P;  1X3E A;  4M7A C;  1HFG A;  1LM0 A;  1HFN A;  4M7A B;  2FZC B;  1HTP A;  4FF3 A;  3M4O B;  1XX8 A;  1N9S A;  2EQS A;  3QHS A;  2NWM A;  3OYK A;  4CGY B;  3K57 A;  3QJY A;  5LJ5 g;  4LF8 L;  3NPF A;  1IHZ A;  3N52 A;  3SB2 A;  1QNK A;  1I5O B;  4RHR A;  3RLF A;  2HT1 A;  2KCC A;  1YJN T;  1MGS A;  2WAQ B;  3VUB A;  1YJN A;  4BY1 B;  4JZ3 A;  2JEB I;  1GJX A;  1FMK A;  3OBW A;  4HID A;  2K2M A;  3S1M H;  1UDL A;  3L7Z C;  1UHC A;  4HVV A;  3BE3 A;  2RCN A;  2VKN A;  1VYT A;  3I5R A;  1C0M A;  1JC7 A;  4F16 A;  2BZY A;  4IQZ A;  1EWH A;  1SR3 A;  4DV6 L;  3NTH A;  4YWL A;  4HCS A;  1AZE A;  1LT4 D;  3RNJ A;  2DMO A;  1NYF A;  1R0C B;  4C3J B;  1TWG H;  3HKZ B;  1B70 B;  3J7A V;  2EYF A;  3E9I A;  4ME3 A;  3IAY A;  3S15 H;  2R57 A;  2CSQ A;  3S1M B;  1KC8 C;  2ZPF B;  1PHT A;  1YNJ D;  3M53 A;  1QVF A;  3KBX A;  1K83 H;  3HOU G;  3P7J A;  3FRN A;  4NP5 A;  4APV A;  4EQN A;  3NBH A;  4FXK C;  1I8F A;  4IPG A;  1YBY A;  4X3U A;  3SE0 A;  2NUP B;  2QQB A;  2CFM A;  4K5W A;  3M55 A;  1NJI C;  3VRZ A;  1EL0 A;  2LVM A;  1D3B A;  4A75 A;  1D3B B;  1DCZ A;  3TZU A;  5L37 A;  3KFU A;  1GHJ A;  1IBL L;  1RAG B;  1TWG B;  1C4Q A;  4A3I B;  2SEM A;  5J3B A;  5JEA H;  5KYX A;  3JAM c;  3DB3 A;  5A0D A;  5KYX B;  2F69 A;  1X56 A;  3K5L A;  4PFP A;  4IFD H;  3Q22 A;  3H0G H;  5EQ0 A;  2QA4 Q;  5FO9 B;  1P16 A;  4XYQ A;  5IOD A;  1EQT A;  5KCO A;  1VF7 A;  2I5L X;  3V96 A;  1GM5 A;  5M5X B;  4XQN A;  1DON A;  4H02 A;  1JOQ A;  3G7L A;  4OB0 B;  1VQJ A;  5JPN C;  1I4R A;  5AJ3 L;  2I5H A;  4UPA A;  2XSC A;  1W70 A;  2RHS B;  2RK1 A;  4DGZ A;  1DJR D;  4KKT A;  2E6Z A;  2KRO A;  1E2Z A;  4ODG A;  4FW2 A;  1EFI D;  4YCU A;  2XID A;  4P71 A;  4X65 Q;  5COR A;  2B2U C;  1D2B A;  2OAW A;  2EYO A;  2B2U A;  3W1B A;  3PE0 A;  4PJO D;  3H0G B;  1A0I A;  1Y7X A;  4F7U F;  3QO2 A; 
#chains in the Genus database with same CATH homology
 2EVR A;  4RTW A;  2KYB A;  2LNH B;  3VS0 A;  4CC2 A;  1H3H A;  2W0Z A;  2DYB A;  4Z89 A;  4D8K A;  2DL8 A;  3CQT A;  2D8J A;  1K1Z A;  2DL3 A;  1WIE A;  1U5S A;  1W6X A;  2GBQ A;  1GFD A;  2W10 A;  1M27 C;  1KFZ A;  2X3W D;  2EYZ A;  1E6H A;  1G2B A;  1IO6 A;  2RQW A;  1UHF A;  1SPK A;  4K11 A;  1N5Z A;  1UUE A;  2KBT A;  1WLP B;  2YDL A;  4J9G A;  4WCI A;  5FWB A;  1NEG A;  1JU5 C;  1NG2 A;  3SEM A;  1MV0 B;  2D1X A;  1AWO A;  3I9Q A;  2M0Y A;  2ED0 A;  1QKW A;  4IIO A;  1KIK A;  2EYY A;  3O5Z A;  4AG2 C;  2FG0 A;  2CUD A;  4JPB W;  2J06 A;  1UE9 A;  2E5K A;  3U23 A;  2EW3 A;  2FRY A;  2FRW A;  2KR3 A;  1YN8 A;  1K76 A;  2YUO A;  1A0N B;  2FO0 A;  2FEI A;  2QDL A;  1T0H A;  3QWY A;  2JTE A;  1T3L A;  2RNA A;  5IXB A;  1K0S A;  2O2O A;  2C0O A;  2DBM A;  4KRT A;  1RLQ C;  4RTX A;  2JS0 A;  1SRL A;  2F2X A;  1I07 A;  3SHW A;  2DF6 A;  4QT7 A;  3RBB B;  2LJ1 A;  5L23 A;  2SRC A;  2LZ6 B;  4J9F A;  1JQQ A;  2OI3 A;  2J6K A;  4GLM A;  3I5S A;  3NGP A;  4DEY A;  2EGC A;  1Z9Z A;  1AEY A;  1B07 A;  1EFN A;  4AFU C;  5IHN A;  2K3B A;  1ABO A;  2HBW A;  2ECZ A;  2PZ1 A;  1Z9Q A;  3FJ5 A;  4JJD A;  3KFV A;  2F2V A;  1UTI A;  1YCS B;  2GTO A;  3TSZ A;  5IHK A;  2KRM A;  2CH4 A;  2YT6 A;  3PVL A;  2DVJ A;  4D8D A;  4RTY A;  2JMC A;  1WFW A;  2EPD A;  2DLP A;  3M0P A;  1B3Q A;  3NMZ C;  2L3S A;  2KRN A;  2MOX A;  5EC7 A;  3JV3 A;  1SHF A;  2H8H A;  2L3Q A;  2V1Q A;  4LNP A;  2DL4 A;  2EGE A;  2O9S A;  4JJB A;  3EG2 A;  2VVK A;  1TUD A;  2YSQ A;  3VS2 A;  4HVU A;  2DNU A;  1OEB A;  2DBK A;  1MUZ A;  1X2Q A;  2YUQ A;  2D8H A;  2HEQ A;  1X27 A;  1SRM A;  4A63 B;  1WX6 A;  2KXD A;  1AOJ A;  1M3C A;  2ABL A;  3M0U A;  3UA7 A;  5HCK A;  2LJ0 A;  2DA9 A;  2M51 A;  1V1C A;  3UA6 A;  1WXT A;  2P4R A;  2K79 A;  3H41 A;  1OOT A;  1VA7 A;  1X6G A;  4DEX A;  2I0N A;  1W1F A;  3VS1 A;  4CC4 B;  4RUG A;  4JJC A;  4ESR A;  2DJQ A;  2AZV A;  4E6R A;  2MCN A;  4Z88 A;  2PTK A;  1JEG A;  2O31 A;  2YUN A;  2LQW A;  1ZUU A;  1BU1 A;  2MIO A;  4CC3 A;  2RQR A;  1OPL A;  2JW4 A;  4HCK A;  1BB9 A;  1M3B A;  1HSQ A;  3VS4 A;  1UG1 A;  2LQN A;  2K6D A;  2EKH A;  3C0C A;  1K4U S;  2JM8 A;  4LUE A;  1WI7 A;  3H0I A;  1UJ0 A;  1SHG A;  2L0A A;  1X69 A;  1WA7 A;  3PVQ A;  3REB B;  2JT4 A;  4LN2 A;  2AKK A;  1AVZ C;  1GRI A;  1QLY A;  1HD3 A;  4OML A;  3UF4 A;  3REA B;  4M4Z A;  2CT3 A;  2KT8 A;  1U3O A;  1UJY A;  1I0C A;  1GCQ C;  2A08 A;  2KRS A;  1BBZ A;  2A28 A;  1RI9 A;  2IIM A;  2VWF A;  2X3X D;  3A98 A;  5GJV B;  2EYW A;  2RQU A;  5GJW B;  1WXU A;  2DE0 X;  1G83 A;  3M0S A;  2KXC A;  1T0J A;  3NHN A;  1NLP C;  1PRM C;  1QKX A;  2FPF A;  2LJ3 A;  4GBQ A;  1YNZ A;  2AKL A;  1ZSG A;  3M0T A;  1ABQ A;  4LUD A;  3THK A;  4Z8A A;  2FPE A;  3EHR A;  2RF0 A;  2RN8 A;  4J9I A;  3GBQ A;  1SEM A;  2FPD A;  1ARK A;  2C0I A;  2BZX A;  2HDA A;  2G6F X;  4Y92 A;  2KEA A;  2HCK A;  2A36 A;  2GNC A;  4J9B A;  1CKB A;  1KJW A;  1OPK A;  2L3P A;  1I1J A;  1YWO A;  1TUC A;  1CKA A;  2AZS A;  3VS3 A;  1J3T A;  2F2W A;  3EHQ A;  4AFQ C;  1Y57 A;  2ENM A;  1GBR A;  1OV3 A;  2OJ2 A;  2J6F A;  1S1N A;  4RTT A;  2KYM A;  1UEC A;  4LE9 A;  2GTJ A;  4OMQ A;  3UAT A;  4R0K A;  5FWC A;  5IH2 A;  1AWW A;  2ROL A;  2J7I A;  2JS2 A;  3IQL A;  1PKT A;  2V1R A;  1JXO A;  1NLO C;  3VRY A;  1JO8 A;  2CH4 W;  1ZUK A;  2CDT A;  2EBP A;  2LCS A;  4RTU A;  1K0X A;  4RTV A;  1AWJ A;  4F17 A;  2C0T A;  3QWX X;  3VS6 A;  1PNJ A;  1LCK A;  1QWF A;  1GCP A;  1M3A A;  1SSH A;  1PWT A;  1ZBJ A;  1YP5 A;  2DIL A;  1PRL C;  5IXF A;  3H0H A;  2K9G A;  3VS5 A;  2AK5 A;  3I35 A;  2L2P A;  4HXJ A;  1X43 A;  1HJD A;  4EIK A;  2KT1 A;  1NEB A;  1ZX6 A;  4CC7 A;  1MV3 A;  2RQV A;  4OMM A;  2DRK A;  3EG1 A;  4X1V A;  1UFF A;  2JMA A;  2RQT A;  3R6N A;  4OMN A;  2EYX A;  1NYG A;  4ORZ A;  1VYU A;  3LH5 A;  1GFC A;  2KGT A;  1M30 A;  1PKS A;  4F14 A;  1FYN A;  1WYX A;  5ECA A;  3TSW A;  1UGV A;  2DRM A;  2O9V A;  2JM9 A;  4OMO A;  3H0F A;  1GCQ A;  1X6B A;  1GBQ A;  3ZL7 C;  1VYV A;  1E7O A;  4HVW A;  2PNI A;  2LP5 A;  1H92 A;  2HSP A;  1ZUY A;  5FW9 A;  1E6G A;  2JXB A;  2LX7 A;  1QCF A;  3EG0 A;  2B86 A;  2ESW A;  2ED1 A;  1AWX A;  1JXM A;  2RMO A;  3TVT A;  3EGU A;  4AFZ C;  1XOV A;  1NM7 A;  2EGA A;  2BZ8 A;  1RUW A;  1M8M A;  1BK2 A;  2NWM A;  1QWE A;  5IHI A;  3NPF A;  2NUZ A;  2RPN A;  1Y0M A;  1WDX A;  3M0R A;  4JZ3 A;  1FMK A;  4IIM A;  4J9C A;  2K2M A;  1GL5 A;  2D0N A;  2DL5 A;  2EQI A;  1UDL A;  3ULR B;  1UHC A;  4HVV A;  2VKN A;  1VYT A;  3EG3 A;  3I5R A;  4JZ4 A;  4F16 A;  2BZY A;  4ZNX A;  2GGR A;  4J9D A;  2ROT A;  3M0Q A;  1AZE A;  3RNJ A;  2A37 A;  2DMO A;  1X2K A;  1NYF A;  4AFS C;  2CRE A;  2DL7 A;  1TG0 A;  5I11 A;  1K9A A;  2XMF A;  2KNB B;  2CUB A;  2CSQ A;  1CSK A;  1RLP C;  1PHT A;  5I22 A;  2BTT A;  2O88 A;  1U06 A;  3VRZ A;  2DM1 A;  1H8K A;  1T3S A;  3VS7 A;  1YWP A;  2DX1 A;  4RTZ A;  2SEM A;  4AG1 C;  1ZLM A;  2LMJ A;  2J6O A;  4OMP A;  2CT4 A;  1WXB A;  2CSI A;  1AZG B;  1KSW A;  1W70 A;  4FSS A;  2YUP A;  4J9E A;  2KRO A;  2J05 A;  4J9H A;  1AD5 A;  2OAW A;  2K7A A;  2GQI A;  2KE9 A;  3PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...