2QDRA

Crystal structure of a putative dioxygenase (npun_f5605) from nostoc punctiforme pcc 73102 at 2.60 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
285
structure length
285
Chain Sequence
FLHIASVKEDWGGDGRGRMNLSGRRTAIAKEYLPRQYQFFDTNTVMEKQGWRVRGMPDNIAPGSRRLLTWHDSGASTSRVVLPPKFEAPSGIFTADLEIFVIKGAIQLGEWQLNKHSYSFIPAGVRIGSWKVLGGEEAEILWMENGSVPLEYKYAQEDHPDARLSDFIPALDSKLLPWGKADTVQFVQANKKWLRKDINGGGVWLLAILPHFDNKYQMIQPYNEEGYCLTGYCDVGDYRIVKDHYWYCPSFSTLPRHITDDGGLFFVRVDRDLSKVATVLSYAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein (ZP_00345151.1) from Nostoc punctiforme PCC 73102 at 2.60 A resolution
rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 62
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14499 DUF4437 Domain of unknown function (DUF4437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2qdrA01
5BY5A 1UIKA 1ZZBA 1WLTA 5BV6A 2IC1A 5I0RA 3U11A 3FHIB 3ETQA 1O5LA 1ZZCA 1ZRDA 3E5QA 3OF1A 4F8AA 1RC6A 1O5UA 5JR7B 2ET7A 3SCGA 3FX3A 1YFUA 4I3PA 3EBRA 2XGXA 1CGPA 2UYAA 1O3RA 2EA7A 3R6SA 4XFBA 5JSOA 3G7DA 2ZKLA 4E2QA 2H6BA 1NXMA 4KU7A 2D40A 3E5XA 3H7JA 5FDBA 1EY2A 1YWKA 1Q5OA 4AXOA 3KSCA 3ROUA 4ORFA 1VJ2A 1CAVA 2XKOA 4HBNA 2IXLA 1ZRFA 5I8YA 2BNOA 5LRSA 5FQ0B 5FLJA 1H1IA 5JAXA 3DKWA 2XLFA 5CVRA 4R8HA 1J1LA 2GC3A 4XFAA 4JTNA 4HSJA 1UCXA 5T3NA 1I6XA 3B02A 4IEXA 5J3UA 3L2HA 1RGSA 1CAUB 2D5HA 3KMHA 4IESA 4PIYA 3SCHA 4Q0UA 1ZREA 4GULA 5BUVA 1UW8A 2Z69A 4B29A 4N9IA 4JV4A 1RUNA 4MGIE 1UD1A 3ES1A 2UY8A 3D0SA 4I0AA 1OD5A 3LA7A 2H0VA 2BEOA 5LEJA 2CAUA 3BCWA 1CX4A 1J3PA 2Q4SA 5FPXA 4HVQA 3E6BA 4J1XA 3FFQA 3ST7A 3NVCA 1V70A 4HMZA 4YSFA 1YFYA 3EJKA 1XE8A 1YLLA 3MYXA 1ZZ7A 3RDIA 1O7FA 1CAWB 1SEFA 4QX5A 4MX3A 2IXIA 3E5UA 1IPJA 2WFPA 2Y0OA 2ATFA 2OPKA 3DL3A 1FI2A 4KWJA 4XF9A 4YARA 4LUMA 4AVAA 4IEYA 1CAVB 3ZDSA 4WZCA 5BPXA 3U10A 4X6RB 2IXHA 1ZZ9A 5I0TA 4A2UA 3OCPA 3CJXA 2OZJA 2OA2A 4L2NA 1PMIA 4LULA 4OLLA 1DZRA 4QM9A 2EAAA 4I09A 4JTOA 3NJZA 4MV2A 2XLGA 2BNNA 3WW3A 1TQ5A 4X6QB 1JUHA 2OZ6A 3S7IA 1QY4A 2V09A 3RYRA 5I0SA 2PAKA 4Q0SA 3UKTA 4Q0QA 4XF4A 2BNMA 4L11A 4F7ZA 3RYPA 2B5HA 3KGLA 1Q43A 2CGPA 2BGCA 4XF1A 4XFHA 1OI6A 5KBFA 2H6CA 3U0ZA 1IPKA 4IEVA 2Z2SB 5JSRA 3MZHA 2F4PA 2PAEA 4I01A 4QGLA 2QCSB 4XFFA 4MGYE 1ZRRA 2BYVE 3DN7A 4P9GA 5KHJA 1RUOA 3USSA 4AQ6A 3BALA 4EWAA 3EO6A 3S7EA 1WGPA 2PQQA 3M3IA 1LRHA 4QMAA 3VHRA 3I7DA 4E2GA 5I91A 3ACLA 3TNPB 2WC2A 4MGZE 4ZU5A 4MZUA 1O4TA 2UYBA 2IXKA 3IIAA 4Q29A 4D7TA 3WW2A 4LLOA 1U12A 1ZZ6A 1O3SA 1ZRCA 5I93A 4HN1A 1NZCA 3KCCA 4YNIA 3H1YA 2PYTA 5KHHA 4AVBA 4FAGA 4LTAA 4IEWA 1Y3TA 3BB6A 3D82A 5E16A 5KHGA 3GBFA 2QJVA 4O9GA 3FWEA 3ES4A 3C3VA 3HT2A 2O8QA 3E6DA 3E97A 1SFNA 1SQ4A 3BPZA 2ET1A 3H1WA 1NE6A 4Q0PA 5J7MA 3EQEA 4MUVA 4XEZA 1XE7A 3PNAA 4EROA 2PA7A 5F1RA 2FQPA 4AVCA 4PIZA 2PHLA 4HSLA 3WW4A 1G6NA 3I54A 2C0ZA 4AQ2A 4Z82A 4EWEA 2GC1A 1FXZA 5KHIA 3LAGA 1LR5A 1QWRA 3PLQA 3UKVA 1X82A 3PVBB 4DINB 4R52A 4RD7A 3GYDA 3SHRA 2GZWA 3CEWA 4MH0E 5C8WA 3FZ3A 2XLAA 5LEKA 4YRDA 4LA2A 2MHFA 3H3ZA 4IEPA 3N4MA 2KXLA 2XKPA 5D1IA 2D5FA 4BH9A 4I0BA 4HLTA 3IDBB 3RNSA 4QGMA 1LKNA 4ZU7A 4IEOA 4IETA 3OTFA 3D0JA 4IEUA 4MGKE 4E2SA 4QM8A 4JVAA 4WVZA 4FAHA 2DCTA 3SMHA 3RPQA 4HVRA 5EZWA 3MDPA 2N7GA 4YYOA 3H9AA 4I02A 2PTMA 4XFCA 4FT8A 1J3QA 3SCFA 1I5ZA 2MNGA 4Q0VA 4META 3IBMA 4BIFA 1FT9A 2XL7A 1UIJA 3H1MA 3DV8A 1RL3A 5FCCA 4LUKA 3H50A 1X8MA 2E9QA 4KWKA 2QDRA 4IEQA 2ZCWA 4IERA 1EP0A 4NVPA 2PFWA 1NYWA 3BU7A 3CL1A 4J1WA 2CAVA 4QXKA 1EYBA 2QNKA 4HVOA 1X7NA 2Q0AA 5CU1A 4XETA 3TNQA 2PAMA 1YHFA 1J59A 5JSPA 1O3QA 3H7YA 5AVPA 2OYZA 5CADA 3KGZA 2GC0A 1QXRA 4N9HA 3CLPA 3FJSA 3NKTA 2VPVA 4UBHA 1PM7A 2Q30A 3H3UA 1X8EA 1ZVFA 1XRUA 4PJYA 5JCTA 3CO2A 4KWLA 1QXJA 2Q1ZB 1DGRA 1GQHA 1CAUA 3HT1A 1ZZ8A 1VR3A 3CF6E 1LB2A 2FMYA 2IXCA 3LA3A 3NSTA 4WBBA 3QOPA 3MPBA 1HW5A 3WW1A 2VQAA 5HI0A 1OFNA 4CYDA 1Y9QA 1DZTA 3NW4A 5I8TA 3I59A 5BXXA 2HKXA 4QGNA 2B8MA 3LOIA 3LZZA 4XFGA 2P17A 1GQGA 3OD0A 1J3RA 1L3JA 3OGJA 2XL9A 4UBGA 5FLIA 3NL1A 4BHPA 5LRRA 3H8UA 2GC2A 4HZFA 1ZX5A 4O9EA 4XFIA 2PHDA 2QVSB 3HQXA 4PIXA 1YFXA 5I0UA 1DGWA 1J58A 1WA4A 1Q3EA 4ONUA 3E6CC 2D93A 5EFUA 2MPFA 1VP6A 5I8SA 1H1MA 1UPIA 2IXJA 4Z07A 3UKNA 2CV6A 4LEJA 3LWCA 5FQ0A 5K8SA 4XF3A 4D7SA 1CAXA 2I45A 3HIFA 3O14A 4H7LA 1YFWA 1CAXB 2UY9A 2XHKA 4OFGA 3I59B 3ELNA 2GAUA 1RTVA 4ZU4A 2EVXA 5J48A 4KL1A 2B9UA 4EWDA 4FBFA 3LA2A 4XF0A 2HJIA 3RZZA 2ETEA 3IWZA 1O3TA 4K8FA 1ZNPA 5FLHA 2GH2A 3JZVA 3M70A 3QACA 4KU8A 4UXAA 3EHKA 1NE4A 5KHKA 3FE5A 5E1RA 2K9ZA 4HN0A 3SXWA 2K0GA 3S0MA 3IDCB 4BYYA 1OMIA 2O1QA 4LA3A 2VECA 4EV0A 5FPZA 5C6CA 2GU9A 1YUDA 1CAWA 4IEZA 1EPZA 4I2OA 4TLFA 3RYKA
chains in the Genus database with same CATH superfamily
5B4XA 4CSWA 2QQWA 1IS5A 1UIKA 1ZZBA 4ATEA 4XACA 2XJUA 3ZFEB 1S1AA 1SLAA 1CQ9A 5FOJB 5I0RA 3NRUA 1MVEA 4AI2A 3LGRA 2ZGRA 3O0XA 3ZYIB 1VBE1 5KC6A 4IUGA 4K9SA 3UJQA 1R1ZA 4QKNA 4LBMA 4IQPA 5A33A 1CD3G 3SH3A 3T1LA 3M4FA 3W5MA 4RSUA 3AFGA 2PHXA 3CJIC 3VN4A 5D8AC 4AAPA 3HAGA 2ET7A 2VGDA 3M3EA 2G9GA 2W5FA 3BIEA 4QB6A 3FX3A 1ASJ3 3W20A 1D4VB 4XCAA 1CIWA 3EBRA 1R093 2XGXA 4N43A 1DYOA 4AEDB 4C91A 2CDOA 4A7KA 1FV2A 2WR9A 1XBFA 3AP9A 1ODNA 4A42A 4QB2A 3O1SA 3IIIA 1JOJA 3R6SA 3LFMA 4AFDA 4E27A 5F37A 2QQLA 3GZEA 2WFF2 1CPNA 2VMDA 4B7EA 1UYZA 3AJZA 2VZTA 1NXMA 3ASIA 5BYNA 3E5XA 4NRMA 4YZ4A 3T4HB 5FDBA 3ALQA 3BYWA 3HEIA 1R082 3KSCA 4LO8A 1HRV3 5J09A 3ROUA 4M3CF 1VJ2A 2BRTA 4Y33A 3AMMA 1GYKA 1GZCA 1OOPC 3KS7A 5DUUA 4PQ9A 4UFHA 1ZRFA 4YW6A 2WAAA 4JKLA 5LRSA 2BNOA 4E8CA 4BISA 5GJ6A 1ZBA3 2C4XA 3AL6A 2VZSA 5KC5A 2WNOA 3NNJA 5CVRA 5A3TA 2OIIA 4DQAA 2GC3A 3NNMA 4DB5A 1F4AA 2RM23 3VBFA 3FMGA 4BQ3A 2I2SA 4D6RA 3NJVA 1I6XA 3TEXA 2EF6A 4DUXA 3BUCA 1FMD3 1LULA 2OUJA 4Q26A 1SLLA 3HWJA 5J3UA 2OUHA 3Q9OA 2YC4A 3OPTA 2D43A 3U75A 1ZREA 1K5MC 3MV01 4Q2FA 4BQYA 4GULA 2WWJA 4B1LA 3NV3A 5FMOL 4N9IA 5T5JA 5A6YA 2UY8A 3AP5A 4I0AA 5GALA 2AEYA 5GZGA 2NPIA 4DMIA 1IS4A 1MEC3 2D6KA 3JBG3 3GJBA 3KV4A 3PURA 1V0AA 4GB32 2BFUS 3URFA 2DUPA 3UJOA 3GF6A 1ENXA 5T54A 1QHDA 1A3KA 2PLV2 3FFQA 3NVCA 4FPKA 2HYXA 1PK6C 5ANQA 3F95A 4XJAA 3MYXA 3FBMA 2KR2A 2WNUC 4Y26A 5DG1A 3U4SA 4O65A 4PBOA 4MHUA 5SV5A 2VL4A 3HPNA 3WQ0A 3RSJA 2Y0OA 1S0JA 1KJLA 1QEXA 2DBIA 2PMWB 2YUEA 1ZBA2 3PUIA 4LUMA 4IEYA 3O7OA 1NA1B 4UFJA 1CAVB 3PVOA 1YNAA 2RMU1 4AVAA 4CDXA 3V0AA 2AYHA 4NHYA 1F4HA 4WZCA 2BV4A 2ZHKA 5A3LA 1J83A 5ACA1 2DCKA 1MS8A 1NCQA 3VBRC 4XYXA 3OCPA 4B1MA 5JOXA 1W9YA 2OZJA 2OA2A 4HT1T 1BKZA 2B4KA 5C3QA 1QJY3 4L2NA 3RJRA 5FZGA 4FFFA 1H8TC 1LNSA 1C3HA 1V6IA 2HWE1 3U78A 3K48A 1QNWA 3ACIA 3N9LA 3POBA 5C9AA 4BQXA 1VAVA 3V56A 4QX0A 1AF9A 1BVP1 1YQCA 3IM0A 3OUIA 3ATGA 3VZNA 1OPOA 4Q4W3 4AGRA 2ORZA 2RS31 3VDCA 3ZXDA 3WNOA 1UX6A 2EAAA 2RV9A 1M4WA 5FUNA 4I09A 1D2SA 3AMQA 2VNGA 1PVC1 5JIAA 3WW3A 2JE8A 1NQJA 3WCSA 2YDEA 1NAEA 2RDQA 5IVEA 3MEPA 3AK0A 4FOYA 3GHNA 4N53A 2DDUA 2ARAA 3O1PA 2V09A 5I0SA 4Q0SA 2EAKA 3IDEA 5K0UA 3VKLA 3WXPA 4E4ZA 1CONA 5LA1A 3HQRA 2BNMA 2JDUA 2MEV1 1HB4A 1COV2 2B5HA 2W1UA 3I4IA 3RYPA 5BNOA 5CKMA 2BGOA 4XFHA 1O3RA 1NY72 4EQVA 5A33B 5KBFA 2B7YA 3ZYGA 4AF9A 2FDGA 2GN3A 4Y1UA 2Q8DA 5A1FA 1MZFA 2W46A 4M01A 2PAEA 1TNRA 2CNAA 3OGRA 4H3WA 3IAQA 4MGYE 4N43B 4AEDA 4P9GA 1RUOA 2QDNA 1UX7A 5HXVA 3USSA 2LRPA 3VBOA 3HNMA 1SLBA 1UZ0A 5CFCA 1ULCA 2VJXA 3EO6A 4Q4X3 1HKDA 4KQ7A 2R0FA 4GH4C 3VKNA 2XMLA 4QD2A 5FFOC 5CIRA 4J6GA 3RRDA 1AR63 2R49A 3I7DA 4QPIC 3SKVA 1MPXA 3CJIB 4C0BA 2Y33A 4IV3A 1K42A 3G6JB 4MGZE 4HONA 1GZWA 1O4ZA 1C1FA 3INAA 4BE3A 2JDKA 1RUE2 2HBTA 1O4TA 2SBAA 4GZ9A 2UYBA 3E1F1 4YM0A 4CXWA 5HV4A 5IYYA 3WW2A 2IFWA 2WINB 1HN0A 2VR4A 2HWD3 2WQ8A 3KCCA 4YNIA 1OKOA 1PIV2 3VGIA 3KT7A 1URXA 2QQNA 4JRLA 5FZAA 5B4NA 4LTAA 3GHMA 3ZSMA 1JZ7A 1W9WA 4MYEA 4OHXA 3D8CA 4CDQB 1PZ8A 3N35A 1PVXA 2ZEXA 4Q4Y2 2ZAHA 5CYYA 3JD73 5L7OA 4DY5A 4CDWC 5FY7A 3RI9A 3ZSJA 1SFYA 1DGRN 2ADEA 3N3HA 5DZGA 4AFCA 1RUJ2 2O8QA 1DLCA 5DDJ3 4DUVA 3UL2A 1JYIA 3FFZA 1H2LA 3E6DA 4G4FA 3U37A 1SFNA 5A3WA 3RVHA 3PUQA 1C57A 1NE6A 4IW3A 3UT0A 4GQ7A 5JVVA 3ZFEC 4LT5A 4A6SA 4XMIA 5LBFA 3O12A 1OOPA 3PNAA 4EROA 1OQDA 3AYDA 4ISRA 5F1RA 5F3CA 4P9YA 1N1SA 1IG0A 1C28A 1OHFA 2DU0A 4IE4A 4PIZA 4Y4RA 4YLZA 5JMOA 3NAPB 1BZWA 1WMDA 3I3QA 3NO8A 5FYVA 1AXZA 1G6NA 3A0KA 4L92A 1XYNA 3APBA 3JD72 4AEJA 1DBNA 4FPEA 1LR5A 4QB1A 3GALA 3TN91 5FP3A 4DS0A 5AC92 4CUGA 3D4KA 1O59A 3K3OA 4RD7A 4R9DA 2X5IB 2W94A 4GJZA 4HG6B 4YVSA 3WP4A 5C8WA 3IKWA 2C9KA 2JB4A 2VMEA 2VBBA 1AX1A 3H3ZA 5D8AA 5A7WA 4MVTA 4M00A 1CJPA 4XUNA 4AGVA 5CAZA 2HWF3 2VCCA 5EYYA 2D5FA 2P34A 2XBO2 3BTYA 4HLTA 2J1TA 1GNYA 3GZAA 1LKNA 2JE7A 2WQZC 5DUWA 1W05A 3D5OA 4IETA 1LGNA 2DTYA 1V9U2 1W0NA 4IEUA 4TLGA 4QM8A 4JVAA 2LUWA 1HLCA 2ZEZA 1VBC3 2RDRA 4FAHA 3SMHA 3QH6A 5GLTA 3VV1A 4E4SA 4Z2WA 1PX4A 2FCUA 4FXGB 1BEV3 3RG0A 1BJQA 2D6NA 3THPA 5KXDA 1JH5A 4XQDA 1B35A 1MS5A 4QX3A 4XTMA 1UYXA 4CUCA 4AK3A 1EV11 3IDAA 4IE6A 4Q0VA 4META 3RMXA 2BTVC 1PIV1 1LEMA 1B09A 5DXDA 1FT9A 1FOD1 1LOFA 4P9IA 1RL3A 4BMBA 5FR3A 4UFMA 2PHRA 2BJSA 3LDBA 4WM7B 5C33A 2E9QA 4NR1A 2BDRA 1ST8A 1H2KA 1KITA 2QDRA 3ZN6B 1FPN3 3A4UA 3C7FA 4HKLA 4N53C 4NVPA 2YG0A 2WNUB 1VBC2 4EN6B 1NYWA 4QPGC 1PZ9A 2CAVA 4CP9A 1O8PA 2QQVA 4ZZ8A 2FD8A 4KI5M 1D4M2 2QNKA 3ZFEA 1X7NA 2XJSA 2FZ1A 4Y1VA 5FMOS 4XETA 3TNQA 2PAMA 2AREA 3MUZ1 2XBO1 5JSPA 3SKJE 1O3QA 4QQLA 3H7YA 1EPWA 1NLQA 2WT2A 3KQRA 1V6OA 3CKHA 2OYZA 4BK5A 5C9AB 1WUVA 1KEXA 1PO13 1UKGA 3OD4A 2FDFA 2HWC1 3FC0A 4YM2A 5A3UA 2W52A 4N9HA 1UWWA 3FJSA 3GCWA 2VPVA 2JIGA 1AHSA 3LEMA 1GV9A 3M3QA 1COV1 1W28A 4CTEA 1DQ1A 1LOCA 2FCVA 1AYN1 2NN8A 1AR73 1X8EA 2Q30A 3SQOA 4FFIA 4Y1XA 2AEZA 4PJYA 1FPN2 2ZA9A 1POV3 2HBUA 2RHPA 3WP3A 4D0QA 4TXWA 5BNPA 1QXJA 3HNBM 5FXXA 5KR7A 1DGRA 3R4UA 4JQRA 4UFLA 1RYYA 1DIWA 5JXIA 3J7MA 5F2WA 4MO3M 4A6OA 1SPPA 2QKDA 3EYPA 4EJRA 2BP6A 1AYM3 2FMYA 1T6BX 2BGPA 1CJDA 2IXCA 2PLV3 3WNNA 2VY0A 4YW2A 5FZDA 3WW1A 4TYSA 4QX7A 5HI0A 1OFNA 5FZ8A 2NZ9A 5EJ3A 2ZKNA 3T2QA 2ZJCA 3NW4A 3ZFGB 5I8TA 1ULPA 2LALA 3NMBA 1PGW2 3PVNA 2F6BA 2HKXA 1RUH3 2JE9A 1AR83 3SLIA 3LZZA 4GH4A 4FP3A 1W03A 3PMEA 1RXGA 3RWKX 2ZACA 4V1PA 1UXZA 1UZVA 2YBPA 2C5DA 2RR13 2XL9A 3DXUA 3WDWA 4TTGA 4UF0A 3VL9A 4P5YA 5FUPA 2DU1A 3PVEA 4QPGB 4BQ4A 2RM22 4HZFA 5FWJA 1W90A 1ZX5A 4R9AA 1OVSA 3AZXA 4I30A 2WS91 5L73A 1W2AX 5JI9A 3ILRA 1RUI1 2R071 1Z7S3 3HQXA 1H0BA 1W3XA 4NHLA 3WQ1A 3AVRA 1LHNA 2EIDA 4SBVA 2ES3A 3K3NA 5FMBA 5FK8A 1D4M1 3TEZA 3T4VA 1PNFA 1R081 4OMDA 3NJXA 4Q5OA 5I8SA 5C3PA 5A1LA 1ULEA 1HB2A 3A23A 3VD5A 2ZTNA 1VAKA 3OEBA 5FY1A 4Z07A 4A45A 2P3KA 1EAH3 1P8JA 2KD7A 3HOBA 3O1UA 1C1LA 2JWPA 4XABA 3DGTA 4LORA 3LWCA 1G9CA 5K8SA 5DAXA 3LKJA 2I45A 1NKGA 4TZDA 2UY9A 5F5AA 4OFGA 2JB8A 1DQ4A 1HJFA 4UOJA 1BLZA 4ZU4A 5GLZA 3ZMOA 3A0NA 4COVA 2DVFA 4URAA 4EWDA 4FBFA 3KD4A 4LBJA 3VKMA 1AYN2 2R073 4DIQA 1NX9A 2WS93 5FZ4A 4S2DA 2UWAA 5LASA 2R32A 3K75B 2IVIB 2HJIA 1QJEA 3AJYA 2ETEA 3ZDVA 1O3TA 2ARCA 2ORXA 5FLHA 1YJLA 1JZ2A 5JOWA 3AKRA 3ETPA 1WLCA 3B94A 4KU8A 2RR11 3RZLA 4UXAA 1K5MB 4XJUA 1IQDC 1NE4A 1IS6A 3ZX7A 5KHKA 1B35C 1BEV2 3N7LA 2DCZA 4RS5A 1UYPA 1WZXA 1ZA4A 2WO2A 5FPBA 5LY2A 3BTZA 1O6UA 1AR81 1RUH1 3IDCB 2WA3A 2P37A 1V9U1 1H9WA 2VECA 5FYMA 5F39A 1STMA 4B4QA 2XOMA 3U4XA 5FBJA 3VD3A 4O61A 5A32B 1TME2 4GMP0 3I49A 3PHMA 5FYTA 1UO9A 4LO7A 3O1MA 2DVBA 3WUCA 3ZYPA 2PLV1 3QD6A 2X8KA 4HK9A 1WLTA 5C8CB 4PDWC 3T08A 2XWBB 1GWKA 2BPA2 3ETQA 3BIWE 1QJFA 2RJKA 5FOBB 5DZEA 2W9XA 2Y64A 2JDHA 1ZRDA 4GB31 3MW2A 2RMU2 4RR3B 1UY1A 4AQTA 2JG9A 1O5UA 1D0HA 1W8FA 5DAVA 3SCGA 1JYXA 1F2NA 2QBXA 3S5AA 5EWSA 4KG0A 1AR71 1OC1A 1SCSA 1YFUA 3ZSLA 4DEQA 3HBKA 3NV2A 2YBKA 3PU3A 4S2GA 1F9KA 4KGGA 2IWGB 2WIIB 4EE2A 2LM3A 5BNNC 2E6VA 2EA7A 1OURA 5JUVA 2LW8A 3RZHA 4BLJA 3I3EA 1PO11 4PBPA 5JSOA 3G7DA 2DF7A 4JHTA 1H8TB 4Q8KA 3ZFGA 2VO5A 4OQ9A 4E2QA 5J36A 2XBO3 2ZMNA 1JI6A 3H7JA 4KU7A 1EY2A 1DLLA 5JOYA 2UURA 3KV6A 1GP5A 2HWC2 3DEMA 4YGCA 5JPMB 1JTZX 1XQNA 4ORFA 2VE1A 1F31A 2VZPA 1ONAA 3SNMA 4Y22A 1GZTA 4JDNA 2XKOA 5IAVA 3S6PA 3ZFGC 3AFKA 1ENSA 3OUJA 5LY1A 1O91A 4QU2A 5FQ0B 4AOCA 1H1IA 4RGKA 5LBBA 3DKWA 3MLJA 1I3HA 4JDOA 2OVUA 1T2XA 5DUXA 2IFRA 1J1LA 1OF3A 3ZFFA 3ZXAC 4CCKA 4CU9A 4MGTA 5EP9A 2WRAA 4JTNA 5CFDA 2A3XA 5CEHA 1OQEA 1VBB1 4JGZA 4LIUA 3B02A 4FOWA 4YWAA 4DXTA 1D0GA 5DUVA 1CAUB 3KMHA 4PQQA 2WZEA 1PIV3 4PIYA 5FZCA 1DFQA 1YJKA 2CWSA 5AFEA 5BUVA 3ZN5A 3X29B 2Y6LA 4B29A 2XB6C 1DYKA 4LKEA 4MGIE 5H9PA 4YVWC 2J22A 1UD1A 3ES1A 5HCBA 1QDCA 3D6EA 5FY0A 3LA7A 4AE2A 2H0VA 2JG8A 4Z2AA 3AYCA 1BEV1 4JRAA 1LU2A 4AW7A 1OF4A 3AKSA 2YY1A 2Y38A 2DTWA 2I07B 1MS9A 4PCRA 4XDQA 1PNGA 5CG8A 4AEMA 1E57A 1UF2C 1XU1A 2L9LA 1VBC1 1CPMA 2JG8C 3MPPG 3OY8A 3Q8FA 5FPXA 4J1XA 5HCAA 3T3YA 1V70A 2BOIA 4HMZA 1HXS1 4MGSA 1SDDB 4YSFA 1J84A 1ZZ7A 3RDIA 1AZDA 1AJKA 1SEFA 2E32A 2XDVA 1POV0 4FCAA 4BK4A 3OYWA 4K20A 2WFPA 3MF9A 5LZ6A 1IG3A 4L8QA 1OT5A 3DL3A 4YARA 2VQUA 4KNCA 4CU8A 3CZUA 4GMP3 1TEIA 3FBYA 4HL0A 3ZDSA 4AYUA 4CVUA 5FZ0A 3U10A 3SITA 5AVAA 2DYCA 4ZXKA 4LK6A 1ZZ9A 2HWB3 4K8RB 2PHWA 4CXYA 5I0TA 2CGNA 2EXHA 4GH4B 1R64A 4LE3A 2WZPP 4MXVA 2QQPA 5BNPC 5FYIA 1UU5A 4CPBD 1PGL2 2ZGOA 3TRSB 1DZRA 1W6NA 1PGSA 3SISA 2W08A 5IVFA 1RUC3 2WUHA 5LATA 2GP5A 1HV0A 1DQ5A 1K45A 1E5SA 3B5LB 3OY8B 4JTOA 4NOTA 5ANNA 2BNNA 1QJU2 4D6QA 3KV5A 4AG4A 2BBVA 1G7YA 3C7GA 3WUDA 5K9YA 2VNVA 3C8XA 4X6QB 4OHYA 1XSRA 3POWA 5FYYA 1RMU3 1OA3A 4XUOA 5IFTA 1PO22 2R1BA 2XXZA 5IK8A 1QY4A 4RR3C 5JXJA 4QT6A 1AJOA 1QJY2 2PAKA 2VZVA 3MICA 4YVSB 2HWB2 3V0AB 5DDJ1 2JG9B 5LW9A 1C5IA 1ODMA 3KGLA 2WS92 1Q43A 3P3NA 2CGPA 5C8CC 2A1XA 1W04A 3WR0A 1HQNA 1JZ3A 4S2HA 3ZPYA 2VUDA 2WNVB 3U0ZA 1IOAA 4XCBA 4NIAA 4AI1A 5JR2A 1NY71 3JUUA 1ZYBA 2YU2A 4WM8C 4QGLA 5CKQA 4W4ZA 2QCSB 1VBB2 2ARBA 1N1VA 1QKQA 2X5IC 3A22A 1QGLA 2BZDA 1C8NA 1XU2A 4GWNA 4N90A 4O7XA 1ZRRA 1NT0A 3DN7A 4DUWA 3M3CA 1REDA 5LBEA 2R16A 4LHSA 4AQ6A 1KQRA 3BALA 2NYYA 1NLSA 5A6QA 4KBBA 5C7GA 1QIQA 4XQ4A 5FK7A 3MIGA 2D44A 3CIHA 3K4DA 1ZBE2 5IHRA 1LRHA 3TEYA 1QJZA 3AZYA 4QXCA 1V00A 2VQ0A 1LODA 3POIA 2VOVA 5FYCA 3LSDA 4JHZA 3TNPB 1JYWA 4LPLA 1UOFA 3POSA 5A6ZA 4MZUA 3KB5A 1GZ9A 3ACHA 1UYYA 2AUYA 2JEMA 3IIAA 3WD5A 4AEKA 4B4PA 1AR61 2J7MA 2Y34A 1DCSA 4Q29A 3PTYA 1RUE1 1XYOA 1ZZ6A 2R042 1DU3D 1GNZA 4LITA 3WDTA 5I0DA 2GNTA 3FLTA 3AMPA 1QMJA 1A34A 4V2WA 5JI7A 2PYTA 5KHHA 4UW6A 3C7OA 1GZWB 3OBZA 4W50A 1TZOA 3J7NA 3JQXA 1XNAA 3BB6A 4XVHA 3O1VA 2RDSA 2FDKA 3QLQA 1KDKA 5FJHA 1CWPA 3GBWA 4COWA 2BOJA 2G19A 3DECA 2VQTA 3FWEA 4Y5SA 2VMCA 2RS13 3MIEA 5CKNA 4COUA 5CFCB 2MEV3 3VBOB 3DKQA 4NN0A 1C8M3 3TB0A 1SQ4A 2ZS6B 1U5XA 1RUF3 1YQ5A 2ET1A 4YZ1A 5FZ9A 1FNZA 4MSVA 3S5QA 1G9BA 2WLQA 1RUG3 4K3UA 1QQP1 2JICA 2EALA 3EQEA 4LHKA 4MUVA 3N7MA 2ZX0A 4M0HA 3ZXFA 5F9TA 3THCA 3GM8A 5L9BA 3POFA 2YU1A 1X9PA 5GZDA 1AYM2 1PVC3 1ZA7A 2RS52 4R9BA 4AGGA 3KM5A 1ULGA 2ZX4A 4J25A 4Q4W1 4ZS3A 4EN8B 2NMNA 3I8TA 1XB9A 2WFF3 2C0ZA 5KWRA 4EWEA 3JU9A 1UXXX 2HWE3 4NHMA 3CNAA 1WWYA 4PF1A 4W6XA 5DAWA 5C9AC 1NUKA 4R4ZA 3VBUC 3PVBB 1TG7A 4D8MA 1NCRC 4R52A 3WP5A 1GBGA 3AL5A 4OHZA 4CEWB 3CEWA 2BWCA 2D3SA 2YPJA 3VDBA 3FZ3A 1SBEA 4OVEA 5A6XA 5LEKA 4YRDA 4LA2A 3QCWA 2JG9C 1REEA 2RMU3 1MS1A 1MZ6A 1RVF2 4OCTA 2KXLA 2VVDA 4K40A 3ZVXA 3OJBA 2XKPA 4KWUA 5EJZB 4B3NA 1OLMA 4EN0A 3FHQA 2X09A 4MHRA 5IVVA 1Z0HA 1XPWA 1JMUB 2AH2A 3KVBA 5FKBA 4IEOA 3OTFA 1LU1A 3T0BA 1OKQA 1GQPA 4LOTA 2VUJA 1JU3A 4NHKA 3BODA 5GLWA 2QE3A 3SEPA 5FY8A 2FDJA 5F5IA 3DF0A 3OOXA 5A70A 1F5JA 2C26A 2DCTA 1WCSA 1SPPB 3MBWA 4LBQD 3RPQA 1OLME 3AMHA 4HVRA 5BNNB 4U36A 1JBCA 2ZHMA 3MDPA 1MEC1 3JBG1 5J37A 3I3DA 4YYOA 3B9IA 3H9AA 4WM7C 1YC61 2XPJA 3KF3A 3V65A 1W9TA 5IUQA 4XFCA 5IVBA 5JPNB 3LQCA 2Y6KA 1W6NB 2MNGA 2V72A 3MIFA 3VKOA 4LBQB 2ZMKA 2XVKA 4GWMA 1D2QA 4I3GA 3WG3A 1TME3 4QKFA 1UIJA 4YGEA 1HRI3 4A41A 5B2GB 4FPFA 3DV8A 3WNMA 1BCXA 4KG8A 1OA2A 3SEEA 1L7RA 1UY4A 3VBOC 3PIJA 2AC1A 4WVMB 4CCOA 1N1TA 1W2UA 2P6HA 1HDKA 2VVFA 2UU8A 5F5CA 1EP0A 2WN3A 1TMF2 3BPSA 3KT1A 3WG2A 3POEA 5BNQA 4QX1A 4GALA 1J1TA 4FPYA 1QF3A 2Y8KA 5FAXA 3BU7A 3CL1A 4CP9B 1AR72 4J1WA 3DPRA 4LBKA 4QXKA 3J8F1 2X29A 3LFIA 1PVC2 4HVOA 4WM8B 1HRV1 2W0XA 3ZYJB 1SDWA 3V0BA 1X33A 2Y6GA 4NHXA 3RGBA 2E51A 5LWBA 1JYVA 4AWDA 4QDSA 5FY4A 4IE0A 2CHHA 3NQHA 1U5YA 2WO1A 4RFRB 3DPRC 2OXBA 1UMHA 2GC0A 3VBSC 1QXRA 1UU6A 2GALA 3ZM8A 1YI9A 3RWNA 2P5BA 3M2MA 4UBHA 4D69A 1R091 1RUJ3 3B69A 4ET7A 2VW2A 1ASJ1 4M0NA 5L36A 2VCBA 5D2AA 4Y20A 1XNTA 2QQOA 4FXKB 2XUMA 4WM7A 3WLUA 2D6PA 3L9JT 4Q1PA 4ASLA 4AQSA 1VBE3 2ZGSA 4XBNA 1CAUA 3UYJA 3MIHA 3U07A 2XG3A 2DCYA 4Y20B 1QJU1 1OPMA 4B7KA 2XWJB 3LA3A 5FYHA 3NSTA 3IZOA 3GZTB 4WBBA 4C0HA 3QOPA 2VMGA 4LQRA 3OB8A 5EV7A 5G05L 3W21A 1VPHA 5G04L 1Y9QA 3P3PA 5JZGA 4CDXC 5IK4A 2ZBJA 4ZY9A 1XE0A 5FZMA 1QJX3 2KM2A 3MIDA 3F2ZA 4DEVA 1NOVA 4QGNA 2EIEA 1WW4A 3SH4A 2XR4A 5JXGA 2B8MA 2R072 3LPFA 4IXLA 3ABZA 5JZGC 1XNKA 3AXDA 2WWUA 5T50A 1MZEA 4NIDA 3I2GA 4AR2A 3I97A 5FXVA 2WZR3 3ZXLA 4XIKA 3WNLA 4XHBA 1QJU3 4FFHA 1CESA 5CISA 5FREA 3WQBA 1GOGA 1HX6A 5LRRA 1BYHA 2VULA 3H8UA 3WF0A 4BMEA 4CCEA 1W8TA 5EJ1B 1DG6A 1VRH3 2YROA 4UFIA 4AZZA 4O9EA 1SBDA 4N8MA 2D97A 4LHLA 4ZONA 1BMV2 1POQA 5IK7A 1W6PB 4H55A 5IJRA 5D8AB 1PO12 5A7WB 4Z92B 2DFCA 4XDOA 5I0UA 1DGWA 1WA4A 2OKXA 2OT7A 2HWF2 1RUJ1 2MPFA 5EFUA 1VBD2 4RR3A 2RVAA 3WINE 2RS32 3DPRB 4FSJA 1H1MA 3IAPA 3VBUB 2IXJA 4CCCA 1Q8OA 1PMHX 1QOOA 2VUCA 3J8F2 4CDUB 1XJAA 1BK0A 3IMNA 2BU9A 2PHFA 4FOVA 2CTVA 1ZBE1 5F6LB 3ZFFC 3JCIA 3VL8A 3ZFFB 4XPVA 4FPCA 3K4ZA 1VMHA 3VB9A 2EICA 1AR93 4Y4YA 4YW1A 2WYFA 2BFUL 4BQWA 3OBAA 1EAH2 4CDQC 4D7SA 1UNBA 3VHPA 3J8F3 1CAXA 2XJPA 5FZ3A 4RHV1 4XJWA 2HYKA 1MS3A 5FPLA 1SHWB 2WO7A 2VD7A 2GAUA 1NCQB 2WDBA 3GDBA 3KZ4C 4KL1A 2B9UA 3IB3A 3Q8CA 2WNEA 2BQPA 1ND2A 4E8DA 2J1EA 4WVVA 1AR82 3BVCA 4KGQA 3LE0A 3LA2A 3DXTA 1H8TA 1MR5A 1ENQA 3UK9A 4B8EA 3FN9A 3T0AA 2W87A 2NP0A 1HRI1 4FPGA 2GH2A 3JZVA 1TME1 3M70A 1W3VA 4TWTA 5L7OC 4PDWA 2P1BA 4RL7A 1GKBA 5FXZA 3RZMA 3EHKA 2ID4A 5E89A 3TYJA 4QKBA 3VBHB 3RZKA 4H2AA 1HIXA 4YVWB 4FFGA 4HN0A 5A32A 3QBQA 4RYDA 2YGLA 1W8UA 4UFKA 4BA6A 1OMIA 2O1QA 2DVGA 3WF2A 4LJHA 1CAWA 5F3EA 1YRZA 4COZA 2WLPA 3IPVB 4CDUC 1WMFA 1H2MA 4TLFA 4DZGA 1EUTA 4XMAA 4ZKTB 5FZ1A 4OZXA 4HFSA 2RS51 1A8MA 3P6BA 4AL9A 2VTXA 4NIGA 3JQWA 1IHMA 1QJX2 2YFZA 4DY3A 1ZZCA 2K2SA 3KT4A 4QX8A 1GR3A 4XAAA 4LIVA 4A44A 2WZ8A 3E5QA 4F8AA 1RC6A 4H7MA 5JR7B 4FP2A 5JIUA 4ITCA 4JX0A 4LK7A 3ZOIA 1X36A 5HBAA 5J96B 5E8AA 1AL0G 3TWIA 1CN1A 1K5MA 1KFUL 4LBNA 1G8WA 2GN7A 5CA6A 4FO9A 5FRAA 1S2BA 4NMIA 2JKBA 3UGHA 3ZSEA 5GZFA 4ASKA 5ACA2 3MF6A 2ERFA 4LO5B 4XFBA 1S0BA 2P4EA 2GNBA 1XNDA 2Z79A 3EXUA 1I1EA 1WMXA 4UF0B 2Q8CA 4K6BA 4BLIA 2D40A 2WFF1 2QZ3A 1YWKA 2E53A 1Q5OA 2HH9A 3H3LA 1FOD2 3KWVA 2ENRA 2XHNA 2ZOEB 5K0UB 4G3YC 2GP3A 2WSVA 5FZOA 3HMYA 3MI8A 3RQ0A 2A6WA 2RE9A 5FPVA 2AZ5A 4HBNA 2PHTA 3WVJA 2IXLA 4FPHA 3ORJA 5I8YA 4Y1YA 3T2OA 1QQP3 1FAYA 5C4WC 1FATA 1RUG1 1WD3A 4QXBA 4AHZA 1W8WA 2XLFA 4R8HA 4A4AA 1LECA 1RUF1 3TN92 4YG3A 3MUY1 1LOGA 4XFAA 1QDOA 4INDA 1Q8PA 1C8M1 4HSJA 4RQPC 1UCXA 5A7QA 5T3NA 4ARYA 1E5HA 2BWAA 4OQ8A 1US3A 3L2HA 4GD4A 4QWNA 1RGSA 2E7TA 2D5HA 4Q8LA 2BW8A 2RS11 4LKSA 3AP4A 5FYZA 1WCDJ 5C3SA 3SCHA 4Q0UA 2W68A 1JYCA 1JN2P 3J9SA 1UW8A 2R041 3MLKA 2Z69A 4V2VA 3WSOA 2DURA 4LOSA 1XNCA 1RUNA 3LDKA 4D6SA 2A6ZA 4CDUA 1OD5A 5DZFA 5GZCA 2BEOA 4K21A 1E5IA 4BU2A 5LEJA 5CZKA 2J1RA 1CX4A 4IV1C 2Q4SA 4LLFA 1BXHA 1RUE3 5DPNA 5F8PA 5JDBA 5A3MA 4QXHA 3JB4C 4YGDA 5T5LA 4ARXA 3ST7A 1OLQA 4OI0A 4YG6A 1HN1A 1GP4A 1W99A 5KXBA 1XE8A 3N9MA 3VDDB 5FZIA 1W6PA 1O7FA 1AXYA 4QX5A 5LA2A 4XBLA 2IXIA 3POYA 3E5UA 3CHXA 5J1XA 2WWSA 3C7HA 3ZXGA 3JB8A 2W1SA 2WAOA 2OPKA 4ZXEA 1FI2A 5BNPB 4FQ4A 5FZBA 1YQ2A 2Y0IA 4CCDA 1UAIA 5FWEA 3OUHA 2YBSA 2IXHA 5J98B 1YIFA 1SBFA 1H30A 1H2NA 2WT0A 3WNPA 4LBLA 1GOHA 3KQ4B 2ZGLA 2E26A 1VRBA 3WHTA 2VAUA 2J1SA 4OLLA 4FOQA 4CRQA 1WLWA 1LOBA 3N9PA 2W2IA 4LXLA 3CMGA 2D98A 1TVGA 2UWBA 4CDQA 2VZQA 5HCFA 1W8HA 1KJRA 3AYAA 4LO6B 1VBE2 1WW7A 1OH3A 3NJZA 3ZYFA 2XLGA 3LDRA 4GIQA 1KXGA 2ZX1A 1OQ1A 1RMU1 2VBDA 3N7JA 4CUBA 1JUHA 2OZ6A 3AB0A 3S7IA 4LKFA 3N36A 1AVBA 2A6YA 3RYRA 5CB7A 4P5HA 3UKTA 2YXSA 1RUC1 2TNFA 4L11A 5IWFA 4JKMA 3J4UH 2YGMA 4LR4A 1BHGA 3CJIA 2ZX2A 5K4LA 1C8M2 2BGCA 4XF1A 4XILA 2F17A 1GOFA 1OI6A 3KVAA 2H6CA 2W1WA 1W6MA 1IPKA 1DDLA 4IEVA 3DYMA 2F4PA 1UMZA 4Q4V2 2Q1FA 3KF5A 3VBFB 2HWB1 2ZGPA 3WOGA 3P5BA 2BYVE 1VB2A 3VD9A 5T5PA 4HETA 3WHUA 4N53B 4GMP1 4M3CB 1PMJX 5F6KA 1WGPA 2J42A 2PQQA 2QQIA 2JECA 2ZGUA 3M3IA 4K7JA 4AFMA 4QMAA 4E4DX 3VHRA 4YZ5A 4AI8A 3T1MA 4E2GA 1IS3A 2DVDA 5C4WB 3LB9A 4MADA 5I91A 1DGWX 1IGOA 3ACLA 1FNYA 4IGQA 4OULA 1YQ8A 5DAPA 4ZU5A 2HWD2 5FZFA 1HXS3 3NAPA 2R1DA 4XHXA 3GJAA 4WZFA 2IXKA 1W2OA 2R0HA 2RG4A 3LPGA 4M4PA 4D7TA 4GJYA 4AAXA 1U12A 4QDRA 4BB3A 3UGGA 5IAXA 2GMMA 1NZCA 4W8JA 3H1YA 3WQ7A 5K7PA 2AGSA 4JGYA 5GLVA 4AVBA 4FAGA 2AACA 4EN7B 1Q8QA 5CFDB 1PGW1 4IEWA 5LA9A 5FPUA 4GXLA 1JHNA 1PO23 2QZ2A 3D82A 4LKDA 3ZXJA 1AR92 2Y26A 1NLRA 2Y6HA 3LSEA 5KHGA 3GBFA 2QJVA 3HBZA 4O9GA 2D3PA 4BOWA 1LOEA 2LTNA 5FZKA 2SLIA 4R4XA 3C3VA 3WZ1A 4FQZA 1NG0A 1RJ7A 4OUSA 3FUQA 4X8PA 4XIOA 4CE8A 3ZYRA 2RJ2A 1VBB3 1GMMA 1WCKA 2G1MA 1R1A1 4CEYC 3V0BB 3BPZA 1NXD1 2YV8A 5IK5A 3Q8AA 1HRV2 3OEAA 4NAOA 3PUSA 4XBQA 2JDAA 1QU0A 3K46A 2VXJA 5FP4A 1NQDA 4CCMA 4UI9L 2I74A 2VMHA 1N1YA 2R061 1UZZA 1BBT2 2FQPA 5CNAA 2OS2A 2RDNA 5DG2A 2CDPA 3ZXKA 4AVCA 3V64A 5GKAC 3WW4A 4AHXA 1LESA 3LEGA 5E6HA 3W59A 4DNYA 3I54A 3HD8B 4AQ2A 1LENA 1RUI2 2WZR2 2YFUA 3CDZB 3GZUC 1FXZA 4Q4Y3 4CEWA 4ES8A 1AL23 1XYPA 3LAGA 4W6YA 1GP6A 2A3YA 3PLQA 4JKKA 4Y1ZA 2WNVA 5FKCA 2RJLA 4BIOA 3H8RA 5FXWA 3LCPA 1WLDA 1X9TA 4BXFA 1LCLA 3SHRA 2GZWA 2OX0A 5FIXA 3I2IA 5CBLA 1KS5A 3ZN6A 4MGQA 3VDAA 2MHFA 4IEPA 1C4RA 1U5IA 1W39A 5D1IA 2ILMA 2X05A 3ZKYA 4BH9A 1MEC2 3JBG2 4GB33 2YZ4A 1W6MB 3WCRA 3ZIWA 2C24A 4YFWA 2FZ2A 2W1QA 2HEVF 3ILNA 4DPNA 2JDPA 5APAA 2MEV2 3WG1A 3D0JA 3AKTA 4XJZA 3ZR5A 2RS12 4E2SA 3IMMA 5IVJA 4HANA 2E63A 2G9FA 4PI2A 4DOUA 3WDVA 3Q8BA 2JD4A 2O14A 4QAWA 1EV12 4L0PA 4LHNA 4AVTA 2HLEA 4BQ5A 1V9U3 2Y60A 1IKQA 1VBD1 4I02A 2PTMA 4BZ4A 4QHOA 5JZGB 2ZEYA 1Y7BA 2VOXA 4QDQA 3KLSA 2TEPA 4IGPA 3SCFA 3CZJA 1IZ3A 2GNMA 3IBMA 4CP2A 1VMFA 2XL7A 1LOAA 2PHUA 3HJRA 3VBSA 1RUF2 3FL7A 3H1MA 2VW0A 4YW7A 1JZ4A 1YI7A 3PL0A 5FCCA 5FJKA 4K1YA 4E4HA 4LUKA 3PUHA 4M3CA 3H50A 5C71A 2FHRA 5DDJ2 4JDMA 1VBA3 3R4SA 3O0VA 4SLIA 5FMDA 1WD4A 4IEQA 3ZN4A 2ZCWA 1WBFA 2E33A 1RMU2 3I3BA 4LMFA 5IW0A 3VHNA 1A78A 3WDXA 1F8VA 1RB8G 1K3IA 2V5YA 3GCXA 4P00B 3O1TA 4BWOA 1T6GC 3HN3A 3I2KA 4XUTA 3O5SA 1GU3A 4AHYA 2QQJA 2J1UA 1FV3A 1WBLA 1JYTA 1R092 4YM1A 4D3WA 1EYBA 1JODA 3LIGA 4HPKB 2DCJA 2V4AA 2P3IA 2Q0AA 5CU1A 3USUA 1J59A 4HKOA 1UL9A 4FPLA 3N9QA 1SLIA 4CEYA 1EAH1 5A3PA 1ND3A 4AVSA 5AVPA 2W47A 5FP8A 4PI0A 5FYUA 2VNOA 2GSYA 4YG0A 3WX5A 2JENA 4QPGA 4YM3A 1YXWA 3B3QE 1R083 1Q8SA 2OQ6A 1D4M3 1NA1C 3CLPA 2WA4A 3N9NA 4ZS2A 1DZQA 4XE9A 1PM7A 4BDVB 1OLRA 1OVPA 3H3UA 1S0GA 3ON7A 2D6LX 2WSUA 2CGOA 1Z7S1 1NZIA 3KCXA 5FTTC 1RUI3 1RHI1 5C5UA 1WW5A 2Q1ZB 3P1IA 4LNVA 5FYBA 3VD4A 4QPIB 4MXWB 5L7OB 2PN5A 1LB2A 1UY2A 3MO4A 2BVBA 3N7KA 2D6MA 4LBQA 3DYPA 1HRI2 3DYOA 2A5ZA 3MPBA 1HW5A 4EN9B 4JCKA 3VLBB 3ZSKA 4CA9A 4CYDA 1A6CA 1DZTA 1HQWA 3FLRA 1BQPA 4FTBA 2VBPA 4M4RA 2HEWF 1V6JA 5FZ6A 4QPIA 4NJ4A 5A7NA 1O4YA 2JDNA 1JXNA 2VW1A 2A73B 3LOIA 3J7HA 2D3RA 4XFGA 1BMV1 2J1AA 2P17A 1OH4A 1GQGA 1Q56A 1VB4A 2V73A 2DUOA 1BVVA 2WBKA 3OD0A 4UW3A 5L9RA 4C90A 4ZZ5A 3OGJA 4XJ9A 4IV3B 5EIYB 5DABA 4AEDC 1AYM1 1SCRA 3UETA 2O8OA 4OMCA 1UPSA 1SG3A 2GC2A 2GMPA 4W65A 1ND3B 2V5DA 5C8CA 4XFIA 1POV1 2PHDA 2QVSB 3POGA 4Y5TA 5IFPA 1SACA 2QFEA 4UW5A 3BKZA 1J58A 1AYN3 2JKXA 1RVF3 3T09A 3E6CC 2D93A 1COV3 4Q4V1 4QQHA 1H6XA 3VBRB 4GKYA 3ACFA 2V4VA 4UYBA 3PU8A 1Z78A 1F15A 2XQXA 3ZPOA 1UPIA 2HWC3 2PQSA 3OBRA 1GFF2 3RJ2X 1DQ0A 5C3OA 4CEWC 4XAEA 2QQMA 4TN7A 1V6NA 2X10A 1YO8A 3VHOA 5FZEA 4XURA 4L9BA 4LO4B 1H1AA 2CV6A 4YW4A 2ZGTA 4XW3A 2P2KA 4A7YA 3AZZA 5A3OA 1RUC2 1Y4WA 3QH7A 5DAQA 4ATFA 1ASJ2 1CIYA 1HB1A 5J48A 5FBZA 3I59B 4Q4V3 1N3OA 1VIWB 2C9AA 1RVF1 3R05A 4JGZB 1FPN1 4RGGA 3AP7A 3J26N 3OSDA 5A3NA 1DQ2A 5KXCA 4FVVA 3WDUA 3A21A 4JGYC 5E88A 1KGYA 1DGLA 1UU4A 5A7OA 4XF0A 4N7UA 3RZZA 1G86A 2JX9A 1S0EA 4K8FA 3WF4A 1FOD3 4QQOA 4AHWA 2W91A 3FUOA 1RIRA 1NCQC 2CU5A 3AYEA 3GXUA 3VBRA 1XC6A 1Z7S2 2DBNA 3GGLA 3L2YA 4YZ2A 1EV13 4JAAA 1YIPA 1SLCA 5E1RA 3H8OA 5HPOA 4E9KA 4JQTA 5EQUA 3SXWA 3VZJA 2W92A 3S0MA 1H9PA 3BOWA 4BYYA 3ZXEA 1X50A 5FUIA 4AI3A 4EV0A 4IV1A 4QHBA 3K4AA 1QXPA 1RUH2 3WV6A 5C6CA 2CY6A 2GU9A 4FTEA 1DP0A 1GICA 2BBAA 4BQ2A 2NQYA 4YZ3A 5DMYA 5LK7B 4NIHA 5HV0A 4IEZA 4IL7A 3VBHA 3NAPC 4M3CE 3RYKA 2G4IA 4WVMA 1WKYA 5BY5A 2X5IA 3LD8A 5BV6A 2IC1A 2DVAA 2WABA 2JD9A 3PMSA 3U11A 3FHIB 3TOJA 4A3ZA 4GKXA 1DF0A 1CZTA 1O5LA 1Y43B 3KHCA 1RHI3 5FZLA 1W6OB 3AKPA 3ZMNA 2FCTA 5BNOC 3AM2A 4RS5C 3OF1A 5JMCA 5LBCA 2HWF1 4CCJA 3VZLA 4NPRA 4JGZC 4JC1A 1AL22 5L19A 1W0OA 4I3PA 5K0UC 1XNBA 5FY5A 1CGPA 2Q8OA 2UYAA 4MXWA 2YC2A 4IV1B 3PTRB 3ZYHA 1IQAA 3TN93 1UOBA 1ULFA 5C5TA 4RA0A 2ZKLA 5ABJB 4DXSA 2YPDA 2JDMA 2H6BA 4QU1A 4A7ZA 2Y6FA 4EYUA 4XC9A 3TBDA 1JHJA 4AXOA 4URTA 1D7PM 2VXRA 4OI4A 4FTSA 1CAVA 4CDXB 5ABJA 4FPOB 5LA0A 2B9VA 4RGAA 5AFBA 4P9WA 2Z42A 3HNYM 1G9DA 4XOGA 3AVSA 2LS6A 2VUAA 2CSGA 1S0DA 3POJA 2VOTA 5FLJA 4OI1A 1W8ZA 5JAXA 1SMVA 1G9AA 1JUIA 3U1XA 3MGUA 2AENA 2BVVA 3NNGA 1KD7A 3BU0A 1VBA1 2Q8EA 5T55A 4YW3A 2YMZA 4IEXA 4DRRA 2QQUA 4CXXA 1VLNA 3ILFA 2JDYA 3FLPA 2X53S 1CZSA 2OW4A 4IESA 4Q4W2 1F35A 2W3JA 1VMJA 3VZKA 4HOOA 5HXMA 2A75A 3JD71 4P9JA 4QX2A 1W8NA 3CU7A 2ZGMA 4FPJA 3I2DA 4CEYB 1L7QA 1CVNA 4XZUG 1AXKA 3R0RA 4JV4A 5FMCA 3LF7A 1PM4A 3D0SA 1H6YA 3HQUA 1W6QA 1MACA 1VBD3 3WG4A 3H8XA 4CDWB 1KFXL 2HWD1 5FYSA 1XXNA 2CAUA 3BCWA 1J3PA 2CL2A 3VUOA 2F4LA 3OPZA 5CG9A 1W6QB 2VZ3A 2WN2A 3E6BA 4HVQA 4QHZA 3ZIXA 1YFYA 3EJKA 1YLLA 4UT5A 2VCAA 1CAWB 2XJVA 2GH8A 4COYA 3NWKA 4MX3A 4Y5Z0 3LOBA 4QQPA 4IGOA 1IPJA 4X8NA 2NMOA 4CU7A 2ATFA 4P9LA 4KWJA 4XF9A 3TEWA 2W95A 4Q4X1 1W2TA 5BNOB 5FZOB 2JG8B 2ZZJA 3KHBA 4MOAA 4D94A 4AVVA 4OHVA 4YVWA 5BPXA 3NNLA 3RZGA 4S2FA 5FV3A 4X6RB 2LROA 1GNHA 1ND2C 4RFT0 2VMIA 4NIIA 1A8DA 3O1OA 4A2UA 2WKKA 1ACCA 3CJXA 1US2A 1MZ5A 3DCQA 1PMIA 1QH6A 2C1FA 4LULA 1AL21 3C7EA 1V6LA 2FMDA 2Y6JA 2ZHNA 1Y9MA 3LEIA 4Q4Y1 1BK1A 1H4GA 4Y22B 3UNPA 1DYPA 4QM9A 5T52A 2J1VA 1K5JA 2XJTA 3MLLA 2QUOA 4MV2A 2VCMA 5FPAA 2FDHA 1NA1A 2R063 3R4DB 1G9FA 1N3QA 1TQ5A 2VNRA 3WF1A 2A3WA 2CYFA 5C70A 1CZVA 1RUD2 4JZRA 3PJQA 1TNFA 3C2UA 4LE4A 1LTEA 2ZEWA 1QH7A 3KCYA 1MQTC 3I2HA 3SC7X 2P3YA 3ZLIA 4NWVA 4RN5A 1VE0A 4NAMA 3DUIA 1SFPA 1R1A3 4Q0QA 4RHV2 4XF4A 4XDPA 5IVYA 2RS33 5IVCA 4F7ZA 3IPVA 3W5NA 3M8LA 2ZZQA 2VU9A 4NRQA 5LB6A 4H14A 4NO4A 2QQKA 1QOSA 1DHKB 2B42B 1ZRIA 5A7SA 4OI2A 1DQ6A 1LOFC 5FY9A 1W0PA 2VZRA 1UMIA 1QJY1 2EXJA 2Z2SB 5JSRA 3MZHA 2A6VA 2ZGNA 1PHMA 1Y9GA 4I01A 4UWDA 1M06G 1VALA 3T2TA 1PO21 4Z8BA 1KDMA 2B45X 2VH9A 4OYUA 5ACA3 4XFFA 4NE9A 1HB3A 2D6OX 4HXCA 4XXPA 1WW6A 5JXHA 5KHJA 1I5PA 4RQPB 3USUB 3BI3A 2ZHLA 2ZGQA 1W2NA 1WA6X 1AR62 1YCIA 1RJ8A 5GLUA 4EWAA 2CWMA 3VKFC 3IN9A 3S7EA 5F3IA 1APNA 1F5FA 5FZ7A 1GWLA 1C5HA 3UV9A 4Q1RA 3EMRA 4TSVA 1WMEA 2VZ1A 3THDA 2WC2A 4L99A 5L9VA 1LHVA 1GSLA 2VZOA 1UZYA 4PLMA 5FP7A 2FDIA 3B93A 4LLOA 1OFSA 2ADDA 1CR7A 3TAYA 1AUYA 1O3SA 1ZRCA 5I93A 2R30A 3VBSB 1VAMA 4HN1A 4PLOA 3CBNA 5CFCC 1VRH2 4Q4X2 1JYNA 1GANA 1Y3TA 5E16A 1ENRA 5JOZA 2ZABA 5M0TA 1NCRA 4CCLA 3NNFA 4NWWA 3LIHA 3OPWA 3BOPA 3VBUA 1ULOA 4XUQA 5F2SA 3D3AA 4YPJA 3ES4A 2UWCA 2WO3A 4IE5A 4WVWA 3ECQA 3HT2A 2JIJA 1FMD1 5CFDC 5FO9B 1UKRA 1UN1A 4BJ0A 2FBEA 2RM21 3E97A 3BN6A 1ULDA 1QQP2 2IZWA 3H1WA 5C4WA 2IUWA 1ZBA1 2WJSA 4Q0PA 5J7MA 5ISLA 1W06A 2ZXQA 2OQ7A 2B39A 4XEZA 1XE7A 2W39A 1GLHA 4ZPIA 3RS6A 2PA7A 3I2OA 4QQ2A 4N7IA 3OGSA 3OG2A 1RINA 4UAPA 3Q8EA 3THTA 4KMQA 2E7QA 2PHLA 3KV9A 4HSLA 3WP6A 2WQ4A 2G9ZA 1JZ8A 4GA9A 4HK8A 2C6SA 4OHWA 1HV1A 1V6MA 4PT6A 2RR12 3CQOA 2GC1A 4Z82A 4FI9A 5F5QA 4DXZA 1HQLA 3H0OA 3ITQA 1EUUA 5KHIA 1QWRA 3UKVA 4Z1VA 3IT8A 1X82A 2VMFA 1JU4A 2XUEA 4PF5A 4DINB 2H0BA 4LBOA 5FP9A 4N43C 4NPLA 1IPSA 1LJ7A 3GYDA 4MH0E 2A6XA 3ZR6A 1FYUA 3UGFA 2XLAA 5C3RA 3B01A 4OUEA 4A3XA 3NV1A 2VVEA 3NV4A 1V6KA 2Z5WA 3N4MA 1RHI2 3AP6A 1RUG2 2E7AA 4I0BA 3RNSA 3IDBB 1JOBA 4QGMA 3SH5A 1OBNA 1K12A 4DO0A 1OUXA 1Q8VA 4ZU7A 2EIGA 2B46X 4IE7A 1NCRB 5GZEA 3GNEA 3HVDA 1S2EA 3ZKUA 2JJ6A 3VDDC 1LHWA 1OA4A 4MGKE 4B4RA 4ZHNA 1PK6A 4WVZA 1U0AA 4I0WB 2QTWB 4F3JA 4PHZA 4ES9A 1PX3A 4QPYA 5EZWA 2VOWA 2VOKA 3RZJA 2KA3A 2XONA 5IATA 3O1RA 3ZO0B 2N7GA 5H9QA 1PZ7A 5T5OA 3I3MA 2XH6A 1JZ6A 2TUNA 3VDDA 4P9XA 3PJYA 1XOYA 4FT8A 2ARXA 4XXAA 1J3QA 2R043 1S4CA 1I5ZA 4GWJA 1IKPA 1WCUA 4WM8A 1PGL1 2HEYF 2ZMLA 5FZHA 4EZHA 1W6OA 4BIFA 1AX0A 1W9SA 2GMEA 4KH9A 1R1A2 4G9SB 1MS0A 4D7YA 4ASMB 2XJQA 1MQTB 2A70A 4Q27A 5AC93 1ND3C 1X8MA 3AKQA 4KWKA 3ZYBA 3M7AA 4RQPA 3JXSA 2JXAA 3B00A 3HR9A 4IERA 4ISQA 4BPZA 2BERA 1RUD3 4GWIA 3B9CA 3AC0A 1MQTA 2WYSA 1BBT1 2PFWA 4NRPA 5A80A 3S30A 4C1XA 1ALYA 1UOJA 1LGBA 1YEWA 4OZOA 1QOTA 4XTPA 4C1WA 1JW6A 1LEDA 1MS4A 3BGAA 2R7EB 3T2PA 3U14A 4C8DA 3FHAA 4UW4A 1TMF1 5SV8A 2DUQA 3I2JA 1YHFA 2PELA 4YW5A 1FX5A 2O0OA 3MIBA 5CADA 5F3GA 2XJRA 3B7MA 3MV11 3KGZA 2DWRA 3EB7A 4CPBA 4CZSA 2R6QA 4CDWA 1QNYA 4DXRA 3RI8A 3NKTA 2ZPXA 4MLOA 5A7PA 2VG9A 1XSQA 3MFAA 1ZVFA 3W58A 1XRUA 3ME2A 3T30A 1B35B 5JCTA 3CO2A 3MFCA 5LCWL 2D7FA 4IDZA 4KWLA 5F7UA 4CCNA 5D21A 1ZM1A 2XVGA 3K77A 4XJ8A 1S0CA 2A71A 4CP0A 2ZX3A 4U2AA 1GQHA 2XQRA 1JOPA 1WCQA 1TE1B 3HT1A 4AI9A 1ZZ8A 1VR3A 2P6CA 2RS53 3ACGA 3CF6E 1E5RA 1W9FA 2DV9A 3PIGA 5EHDA 2VM9A 2VTFA 2YHJA 5A1AA 3AX4A 1L7LA 2VQAA 2WL1A 2DFBA 4HPKA 2Q5TA 4K1ZA 4R9CA 3VBHC 3OBTA 3VZOA 1N3PA 3I59A 3RMYA 2VTXJ 1LHOA 2Q1MA 4Y3OA 5BXXA 3PDQA 2PXJA 3OYWB 3OGVA 4DFSA 2OPWA 5EXOA 3T0DA 1RITA 1S2KA 1GUIA 4XQWA 2NM1A 3WDYA 3M3OA 1YYNA 1J3RA 4MG2A 1L3JA 4BQ1A 3I2FA 4GAZA 5EYXA 5LK5A 2JDZA 4XUPA 4YVSC 5F32A 1S55A 2XVLA 2A7AA 3MW4A 5H9RA 5EPAA 2R062 4UBGA 5FLIA 4BM8A 3NL1A 1REFA 3MW3A 4BHPA 4W6WA 1H8VA 2EXKA 4OUMA 2WNVC 1CX1A 1LAJA 4BXSV 3K51A 3N9OA 2GDFA 4NUBA 1OD3A 2BUKA 3LEKA 2YC0A 2VZUA 3K2OA 4AFAA 4CUAA 1YQ6A 4WV8A 3MHZA 4PIXA 1YFXA 3AXEA 1SLTA 1W8OA 2GNDA 4NPMA 5FO7B 3O0WA 2K46A 1Q3EA 4ONUA 4PDWB 1VP6A 5DQ0A 1SZBA 1HXS2 1OOPB 4RHV3 4P08A 1UQXA 2EXIA 1GWMA 1KS4A 1AR91 5ABJC 4HKWA 1HJGA 1I9RA 1OUSA 2YYOA 3VBFC 4CP1A 3S57A 2HWE2 1ZBE3 3AZWA 4KBZA 1AX2A 3UKNA 5DN2A 1TMF3 3ENRA 5FO8B 5TSWA 1JS9A 1H4HA 4LEJA 1FMD2 1N47A 5FQ0A 4XF3A 3VZMA 3WY6A 3AZVA 1KRIA 3O14A 3HIFA 4H7LA 1LHUA 1YFWA 1CAXB 1U5ZA 3BTAA 4P02B 3PUAA 5GM0A 5BNNA 3W9AA 2XHKA 3ELNA 1RTVA 2WT1A 1BBT3 2EVXA 4P14A 1S0IA 3NKGA 2VC9A 1PK6B 3UESA 1ND2B 1VBA2 1RUD1 3BTXA 1RXFA 2P3JA 4YGBA 2IVJA 3WNKA 5KXEA 3OGGA 4JGYB 2ZAAA 4L97A 2E31A 1VRH1 3HN1A 1UZWA 4NROA 4XZPA 4Y24A 1OXCA 5AC91 5IT6A 4AI0A 2Z4FA 3IWZA 3WF3A 1UY0A 3A7QA 1MVQA 4F83A 1ZNPA 4PLNA 4YFZA 5JLVA 1UY3A 4AFBA 4BCUA 1UOGA 3QACA 4CU6A 2WZR1 4QPWA 3WT3A 1OSGA 1S0FA 4QKDA 3FE5A 3WEZA 2TBVA 2K9ZA 3NJYA 3WNXA 4IV3C 2NLRA 2K0GA 2EIBA 1O8SA 1LGCA 2ZGKA 3AMNA 3RFRA 3H42B 4LA3A 5JWPA 3GBGA 5ERLA 1QJX1 5FPZA 1JZ5A 2AR6A 2YB7A 5H9SA 2WNUA 3VD7A 1YUDA 4RS5B 5HCHA 3J7LA 4DRVA 4EZ4A 1EPZA 4I2OA 3M1HA
chains in the Genus database with same CATH topology
1IS5A 1UIKA 1ZZBA 4ATEA 3ZFEB 2XJUA 5FOJB 1S1AA 1SLAA 1CQ9A 5I0RA 1MVEA 4AI2A 3LGRA 2ZGRA 3O0XA 3ZYIB 1VBE1 5KC6A 4K9SA 3UJQA 1R1ZA 4LBMA 4IQPA 5A33A 1CD3G 3SH3A 3T1LA 3M4FA 4RSUA 3AFGA 2PHXA 3CJIC 3VN4A 5D8AC 3HAGA 2ET7A 2VGDA 3M3EA 2G9GA 3FX3A 1ASJ3 1D4VB 1CIWA 3EBRA 1R093 2XGXA 4N43A 4AEDB 4C91A 4A7KA 1FV2A 3AP9A 1JOJA 3R6SA 4AFDA 4E27A 2WFF2 1CPNA 4B7EA 3ASIA 3AJZA 5BYNA 1NXMA 3E5XA 4YZ4A 5FDBA 3ALQA 1R082 3KSCA 4LO8A 1HRV3 5J09A 3ROUA 4M3CF 1VJ2A 3AMMA 1GYKA 1GZCA 1OOPC 3KS7A 5DUUA 4PQ9A 1ZRFA 5LRSA 2BNOA 5GJ6A 1ZBA3 5KC5A 5CVRA 2OIIA 4DQAA 2GC3A 4DB5A 2RM23 3VBFA 3FMGA 2I2SA 1I6XA 2EF6A 1FMD3 1LULA 2OUJA 4Q26A 1SLLA 3HWJA 5J3UA 2OUHA 3Q9OA 2D43A 1ZREA 1K5MC 4Q2FA 4GULA 3NV3A 5FMOL 4N9IA 5T5JA 2UY8A 3AP5A 4I0AA 5GALA 5GZGA 2NPIA 4DMIA 1IS4A 1MEC3 2D6KA 3JBG3 4GB32 3URFA 2BFUS 2DUPA 3UJOA 3GF6A 1ENXA 5T54A 1QHDA 1A3KA 2PLV2 3FFQA 3NVCA 4FPKA 1PK6C 4XJAA 3MYXA 3FBMA 4Y26A 2WNUC 5DG1A 4PBOA 5SV5A 3WQ0A 3RSJA 2Y0OA 1S0JA 1KJLA 2YUEA 1ZBA2 4LUMA 4AVAA 4IEYA 3O7OA 1NA1B 1CAVB 3PVOA 1YNAA 2RMU1 4CDXA 3V0AA 2AYHA 4WZCA 2ZHKA 5A3LA 5ACA1 2DCKA 1MS8A 1NCQA 3VBRC 4XYXA 3OCPA 5JOXA 2OZJA 4HT1T 2OA2A 1BKZA 1QJY3 4L2NA 3RJRA 1H8TC 1V6IA 1C3HA 2HWE1 3K48A 1QNWA 5C9AA 1VAVA 3V56A 1AF9A 1BVP1 3IM0A 3VZNA 3ATGA 1OPOA 4Q4W3 4AGRA 2RS31 3ZXDA 1UX6A 2EAAA 1M4WA 4I09A 1D2SA 3AMQA 2VNGA 1PVC1 5JIAA 3WW3A 1NQJA 3WCSA 2YDEA 3MEPA 3AK0A 4FOYA 3GHNA 4N53A 2V09A 5I0SA 4Q0SA 2EAKA 3IDEA 5K0UA 3VKLA 3WXPA 4E4ZA 1CONA 2BNMA 2MEV1 3RYPA 2B5HA 1COV2 3I4IA 5BNOA 4XFHA 1NY72 5A33B 5KBFA 2B7YA 3ZYGA 4AF9A 2GN3A 4Y1UA 1MZFA 4M01A 2PAEA 1TNRA 2CNAA 4H3WA 4N43B 4MGYE 4AEDA 4P9GA 1RUOA 2QDNA 5HXVA 3USSA 3VBOA 1SLBA 5CFCA 1ULCA 3EO6A 4Q4X3 1HKDA 4KQ7A 2R0FA 4GH4C 3VKNA 4QD2A 5FFOC 5CIRA 4J6GA 3RRDA 1AR63 2R49A 3I7DA 4QPIC 3CJIB 4C0BA 4IV3A 3G6JB 4MGZE 1GZWA 1O4ZA 1C1FA 3INAA 4BE3A 1RUE2 1O4TA 2SBAA 2UYBA 4YM0A 3WW2A 2IFWA 2WINB 2HWD3 3KCCA 4YNIA 1PIV2 3VGIA 3KT7A 1URXA 4JRLA 4LTAA 3GHMA 3ZSMA 4MYEA 4OHXA 3D8CA 4CDQB 1PZ8A 3N35A 1PVXA 4Q4Y2 2ZAHA 3JD73 5L7OA 4DY5A 4CDWC 3RI9A 3ZSJA 1SFYA 1DGRN 3N3HA 5DZGA 4AFCA 1RUJ2 2O8QA 5DDJ3 3UL2A 1JYIA 3FFZA 1H2LA 3E6DA 4G4FA 1SFNA 1C57A 1NE6A 4GQ7A 5JVVA 3ZFEC 4LT5A 4XMIA 3O12A 1OOPA 3PNAA 4EROA 1OQDA 3AYDA 4ISRA 5F1RA 4P9YA 1N1SA 1C28A 1OHFA 2DU0A 4PIZA 4YLZA 3NAPB 1BZWA 1WMDA 3NO8A 1AXZA 1G6NA 3A0KA 4L92A 1XYNA 3APBA 3JD72 4AEJA 1DBNA 4FPEA 1LR5A 3TN91 3GALA 4DS0A 5AC92 3D4KA 4RD7A 4R9DA 2X5IB 3WP4A 4YVSA 5C8WA 3IKWA 1AX1A 3H3ZA 5D8AA 4MVTA 4M00A 1CJPA 4AGVA 5CAZA 2HWF3 5EYYA 2D5FA 2P34A 2XBO2 4HLTA 3GZAA 1LKNA 2JE7A 2WQZC 5DUWA 3D5OA 4IETA 1LGNA 2DTYA 1V9U2 4IEUA 4QM8A 4JVAA 2LUWA 1HLCA 1VBC3 4FAHA 3SMHA 3QH6A 5GLTA 3VV1A 4E4SA 4Z2WA 4FXGB 1BEV3 3RG0A 1BJQA 2D6NA 3THPA 5KXDA 1JH5A 4XQDA 1B35A 1MS5A 4XTMA 4AK3A 1EV11 4Q0VA 4META 3RMXA 2BTVC 1PIV1 1LEMA 1B09A 5DXDA 1FT9A 1FOD1 1LOFA 4P9IA 1RL3A 4BMBA 2PHRA 4WM7B 5C33A 2E9QA 4NR1A 2QDRA 1H2KA 1KITA 3ZN6B 1FPN3 3A4UA 4NVPA 4HKLA 4N53C 4EN6B 2WNUB 1VBC2 1NYWA 4QPGC 1PZ9A 2CAVA 1D4M2 2QNKA 3ZFEA 1X7NA 2XJSA 2FZ1A 4Y1VA 5FMOS 4XETA 3TNQA 2PAMA 2AREA 2XBO1 5JSPA 1O3QA 4QQLA 3H7YA 1EPWA 2WT2A 3KQRA 1V6OA 2OYZA 5C9AB 1WUVA 1PO13 1UKGA 3OD4A 2HWC1 3FC0A 4YM2A 2W52A 4N9HA 3FJSA 3M3QA 2VPVA 1AHSA 1GV9A 1COV1 4CTEA 1DQ1A 1LOCA 2Q30A 1AYN1 1AR73 2NN8A 1X8EA 4Y1XA 4PJYA 1FPN2 2ZA9A 1POV3 2RHPA 3WP3A 5BNPA 1QXJA 1DGRA 3R4UA 4JQRA 1DIWA 2QKDA 4EJRA 1AYM3 2PLV3 2FMYA 1CJDA 2IXCA 2VY0A 4YW2A 3WW1A 4TYSA 5HI0A 1OFNA 2NZ9A 5EJ3A 2ZKNA 2ZJCA 3NW4A 3ZFGB 5I8TA 2LALA 1PGW2 3PVNA 2F6BA 2HKXA 1RUH3 2JE9A 1AR83 3SLIA 3LZZA 4GH4A 4FP3A 3PMEA 2ZACA 4V1PA 2C5DA 2RR13 2XL9A 3WDWA 3VL9A 2DU1A 3PVEA 4QPGB 2RM22 4HZFA 4R9AA 1ZX5A 3AZXA 4I30A 2WS91 5L73A 5JI9A 3ILRA 1RUI1 2R071 1Z7S3 3HQXA 1H0BA 4NHLA 3WQ1A 1LHNA 4SBVA 2ES3A 1D4M1 1PNFA 1R081 5I8SA 1ULEA 2ZTNA 1VAKA 4Z07A 2P3KA 1EAH3 1C1LA 3DGTA 1G9CA 3LWCA 5K8SA 3LKJA 2I45A 4TZDA 2UY9A 4OFGA 1DQ4A 4ZU4A 4COVA 5GLZA 3ZMOA 3A0NA 2DVFA 4EWDA 4FBFA 3KD4A 4LBJA 3VKMA 1AYN2 2R073 2WS93 4S2DA 2UWAA 2R32A 2HJIA 3AJYA 2ETEA 1O3TA 5FLHA 1YJLA 5JOWA 3AKRA 1WLCA 3B94A 4KU8A 2RR11 4UXAA 1K5MB 4XJUA 1NE4A 1IS6A 3ZX7A 5KHKA 1B35C 1BEV2 3N7LA 2DCZA 4RS5A 1ZA4A 1AR81 1RUH1 3IDCB 2WA3A 2P37A 1V9U1 1H9WA 2VECA 3U4XA 4B4QA 5A32B 1TME2 4GMP0 3PHMA 4LO7A 2DVBA 3WUCA 3ZYPA 2PLV1 3QD6A 2X8KA 4HK9A 1WLTA 5C8CB 4PDWC 2XWBB 2BPA2 3ETQA 3BIWE 2RJKA 5FOBB 5DZEA 1ZRDA 4GB31 3MW2A 2RMU2 4RR3B 4AQTA 2JG9A 1O5UA 1D0HA 3SCGA 1F2NA 5EWSA 4KG0A 1AR71 1SCSA 1YFUA 3ZSLA 3NV2A 4S2GA 1F9KA 4KGGA 2IWGB 2WIIB 2LM3A 5BNNC 2E6VA 2EA7A 4BLJA 4PBPA 1PO11 5JSOA 3G7DA 2DF7A 1H8TB 4Q8KA 3ZFGA 4E2QA 5J36A 2XBO3 2ZMNA 4KU7A 3H7JA 1EY2A 1DLLA 5JOYA 2UURA 4YGCA 2HWC2 5JPMB 1JTZX 1XQNA 4ORFA 3SNMA 1F31A 1ONAA 4Y22A 4JDNA 2XKOA 3S6PA 3ZFGC 3AFKA 1ENSA 1O91A 4QU2A 5FQ0B 1H1IA 3DKWA 3MLJA 1I3HA 4JDOA 2OVUA 5DUXA 2IFRA 1J1LA 3ZFFA 3ZXAC 5CFDA 4JTNA 2A3XA 1OQEA 1VBB1 4JGZA 3B02A 4FOWA 1D0GA 5DUVA 1CAUB 3KMHA 1PIV3 4PIYA 1DFQA 1YJKA 2CWSA 5AFEA 5BUVA 3ZN5A 3X29B 4B29A 2XB6C 1DYKA 4MGIE 5H9PA 4YVWC 5HCBA 1UD1A 3ES1A 1QDCA 3D6EA 3LA7A 4AE2A 2H0VA 2JG8A 3AYCA 1BEV1 4JRAA 1LU2A 4AW7A 3AKSA 2YY1A 2Y38A 2DTWA 2I07B 1MS9A 4PCRA 4XDQA 1PNGA 5CG8A 4AEMA 1E57A 1UF2C 1XU1A 1VBC1 1CPMA 2JG8C 3MPPG 3OY8A 5FPXA 5HCAA 4J1XA 1V70A 4HMZA 1HXS1 4YSFA 1ZZ7A 3RDIA 1AZDA 1AJKA 1SEFA 1POV0 4FCAA 3OYWA 4K20A 2WFPA 3MF9A 4L8QA 3DL3A 4YARA 4KNCA 4GMP3 1TEIA 3FBYA 4HL0A 3ZDSA 4AYUA 3U10A 3SITA 5AVAA 2DYCA 4ZXKA 1ZZ9A 2HWB3 2PHWA 5I0TA 2CGNA 2EXHA 4GH4B 4LE3A 2WZPP 4MXVA 2QQPA 5BNPC 1UU5A 1PGL2 2ZGOA 3TRSB 1DZRA 1W6NA 1PGSA 3SISA 2W08A 1RUC3 1HV0A 1DQ5A 3B5LB 3OY8B 4NOTA 4JTOA 2BNNA 1QJU2 4AG4A 2BBVA 1G7YA 3WUDA 5K9YA 4X6QB 4OHYA 3POWA 1RMU3 1OA3A 1PO22 2R1BA 5IK8A 1QY4A 4RR3C 4QT6A 1AJOA 1QJY2 2PAKA 3MICA 4YVSB 2HWB2 3V0AB 5DDJ1 2JG9B 1C5IA 3KGLA 2WS92 1Q43A 3P3NA 2CGPA 5C8CC 3WR0A 1HQNA 4S2HA 3ZPYA 2WNVB 3U0ZA 1IOAA 4AI1A 1NY71 3JUUA 1ZYBA 4WM8C 4QGLA 2QCSB 1VBB2 2ARBA 1N1VA 1QKQA 2X5IC 4N90A 1QGLA 4GWNA 1C8NA 1XU2A 1ZRRA 3DN7A 3M3CA 1REDA 2R16A 4AQ6A 1KQRA 3BALA 2NYYA 1NLSA 4KBBA 4XQ4A 3MIGA 2D44A 1ZBE2 1LRHA 1QJZA 3AZYA 1V00A 2VQ0A 1LODA 2VOVA 3LSDA 3TNPB 3POSA 4MZUA 3KB5A 1GZ9A 2AUYA 2JEMA 3IIAA 3WD5A 4AEKA 4B4PA 1AR61 4Q29A 3PTYA 1RUE1 1XYOA 1ZZ6A 2R042 1DU3D 1GNZA 3WDTA 2GNTA 3FLTA 3AMPA 1QMJA 5JI7A 2PYTA 5KHHA 4UW6A 1GZWB 3JQXA 3BB6A 3QLQA 1KDKA 3GBWA 4COWA 3FWEA 3MIEA 2RS13 4COUA 5CFCB 2MEV3 3VBOB 4NN0A 1C8M3 3TB0A 1SQ4A 2ZS6B 1U5XA 1RUF3 2ET1A 4YZ1A 1FNZA 4MSVA 1G9BA 2WLQA 1RUG3 4K3UA 1QQP1 2JICA 2EALA 3EQEA 4LHKA 4MUVA 3N7MA 2ZX0A 4M0HA 3ZXFA 5F9TA 5GZDA 1AYM2 1PVC3 2RS52 4R9BA 4AGGA 3KM5A 1ULGA 2ZX4A 4Q4W1 4EN8B 2NMNA 3I8TA 2WFF3 2C0ZA 5KWRA 4EWEA 3JU9A 4NHMA 2HWE3 4W6XA 3CNAA 5C9AC 4R4ZA 3VBUC 3PVBB 1NCRC 4R52A 3WP5A 1GBGA 4CEWB 4OHZA 3CEWA 2BWCA 2D3SA 2YPJA 3FZ3A 1SBEA 4OVEA 5LEKA 4YRDA 4LA2A 3QCWA 2JG9C 1REEA 2RMU3 1MS1A 1MZ6A 1RVF2 2KXLA 2VVDA 4K40A 3ZVXA 3OJBA 2XKPA 4B3NA 4EN0A 1Z0HA 2AH2A 4IEOA 3OTFA 1LU1A 1OKQA 2VUJA 4NHKA 3BODA 5GLWA 2QE3A 3DF0A 1F5JA 2DCTA 3WHUA 1WCSA 4LBQD 3RPQA 3AMHA 4HVRA 5BNNB 4U36A 1JBCA 2ZHMA 3MDPA 1MEC1 3JBG1 5J37A 4YYOA 3B9IA 3H9AA 4WM7C 2XPJA 3V65A 5IUQA 4XFCA 5JPNB 1W6NB 2MNGA 3MIFA 3VKOA 4LBQB 2ZMKA 2XVKA 4GWMA 1D2QA 4I3GA 3WG3A 1TME3 4YGEA 1UIJA 1HRI3 5B2GB 4FPFA 3DV8A 1BCXA 4KG8A 1OA2A 3VBOC 4WVMB 1N1TA 1W2UA 1HDKA 2VVFA 2UU8A 1EP0A 1TMF2 3KT1A 3WG2A 5BNQA 4GALA 1J1TA 4FPYA 1QF3A 5FAXA 3BU7A 3CL1A 1AR72 4J1WA 3DPRA 4LBKA 4QXKA 3J8F1 2X29A 1PVC2 4HVOA 4WM8B 1HRV1 2W0XA 3ZYJB 1SDWA 3V0BA 1X33A 2E51A 4AWDA 1U5YA 3DPRC 2GC0A 3VBSC 1QXRA 1UU6A 2GALA 1YI9A 3RWNA 3M2MA 4UBHA 4D69A 1R091 1RUJ3 3B69A 2VW2A 1ASJ1 4M0NA 5L36A 4Y20A 4FXKB 3WLUA 2XUMA 4WM7A 2D6PA 3L9JT 4Q1PA 4ASLA 4AQSA 1VBE3 2ZGSA 4XBNA 1CAUA 3MIHA 3U07A 2XG3A 2DCYA 4Y20B 1QJU1 1OPMA 4B7KA 2XWJB 3LA3A 3NSTA 4C0HA 3GZTB 4WBBA 3QOPA 2VMGA 5EV7A 1Y9QA 3P3PA 5JZGA 4CDXC 5IK4A 2ZBJA 1QJX3 2KM2A 3MIDA 1NOVA 4QGNA 3SH4A 1WW4A 2B8MA 2R072 4IXLA 5JZGC 1XNKA 3AXDA 5T50A 1MZEA 2WZR3 3ZXLA 4XIKA 4XHBA 1QJU3 1CESA 5FREA 1HX6A 5LRRA 1BYHA 2VULA 3H8UA 4BMEA 1DG6A 1VRH3 2YROA 4O9EA 1SBDA 2D97A 4LHLA 1BMV2 5IK7A 1W6PB 4H55A 4Z92B 5D8AB 1PO12 2DFCA 5I0UA 1DGWA 1WA4A 5EFUA 2HWF2 1RUJ1 2MPFA 1VBD2 4RR3A 3WINE 2RS32 3DPRB 4FSJA 1H1MA 3VBUB 2IXJA 1Q8OA 1QOOA 3J8F2 4CDUB 3IMNA 2PHFA 4FOVA 2CTVA 1ZBE1 5F6LB 3ZFFC 3JCIA 3VL8A 3ZFFB 4XPVA 4FPCA 1AR93 4Y4YA 4YW1A 2BFUL 4CDQC 1EAH2 4D7SA 3VHPA 3J8F3 1CAXA 2XJPA 4RHV1 4XJWA 2HYKA 1MS3A 2GAUA 1NCQB 3KZ4C 4KL1A 2B9UA 2WNEA 2BQPA 1ND2A 4WVVA 1AR82 4KGQA 3LA2A 1H8TA 1MR5A 1ENQA 3UK9A 4B8EA 2NP0A 1HRI1 4FPGA 2GH2A 3JZVA 1TME1 3M70A 4TWTA 5L7OC 4PDWA 4RL7A 1GKBA 3EHKA 5E89A 3TYJA 3VBHB 1HIXA 4YVWB 4HN0A 5A32A 3QBQA 2YGLA 4BA6A 1OMIA 2O1QA 2DVGA 1CAWA 1YRZA 4COZA 2WLPA 3IPVB 4CDUC 1WMFA 1H2MA 4TLFA 4DZGA 4XMAA 4ZKTB 4OZXA 4HFSA 2RS51 1A8MA 3JQWA 1IHMA 1QJX2 4DY3A 1ZZCA 2K2SA 3KT4A 1GR3A 3E5QA 4F8AA 1RC6A 4H7MA 5JR7B 4FP2A 5JIUA 4ITCA 5HBAA 1X36A 5J96B 5E8AA 1AL0G 3TWIA 1CN1A 1K5MA 1KFUL 4LBNA 1G8WA 2GN7A 5CA6A 4FO9A 5FRAA 1S2BA 1O3RA 2JKBA 3ZSEA 5GZFA 5ACA2 3MF6A 2ERFA 4LO5B 4XFBA 1S0BA 2GNBA 1XNDA 2Z79A 3EXUA 1I1EA 4K6BA 4BLIA 2D40A 2WFF1 2QZ3A 1YWKA 2E53A 1Q5OA 1FOD2 2ENRA 2ZOEB 5K0UB 4G3YC 2WSVA 3HMYA 3MI8A 3RQ0A 2A6WA 2RE9A 2AZ5A 4HBNA 2PHTA 3WVJA 2IXLA 4FPHA 5I8YA 4Y1YA 1QQP3 1FAYA 5C4WC 1FATA 1RUG1 1WD3A 4AHZA 2XLFA 4R8HA 1LECA 1RUF1 3TN92 4YG3A 1LOGA 4XFAA 1QDOA 4INDA 1Q8PA 1C8M1 4HSJA 4RQPC 1UCXA 5T3NA 2BWAA 3L2HA 1RGSA 2E7TA 2D5HA 4Q8LA 2BW8A 2RS11 4E9KA 3AP4A 1WCDJ 3SCHA 4Q0UA 2W68A 1JYCA 1JN2P 3J9SA 1UW8A 2R041 3MLKA 2Z69A 2DURA 1XNCA 1RUNA 2A6ZA 4CDUA 1OD5A 5DZFA 5GZCA 2BEOA 4K21A 5LEJA 1CX4A 4IV1C 2Q4SA 4LLFA 1BXHA 1RUE3 5JDBA 5A3MA 3JB4C 4YGDA 5T5LA 3ST7A 1OLQA 4OI0A 4YG6A 5KXBA 1XE8A 3VDDB 1W6PA 1O7FA 1AXYA 4QX5A 4XBLA 2IXIA 3POYA 3E5UA 2WWSA 3ZXGA 3JB8A 2OPKA 5BNPB 1FI2A 4FQ4A 2Y0IA 1UAIA 2IXHA 5J98B 1YIFA 1SBFA 1H30A 1H2NA 2WT0A 4LBLA 2ZGLA 3WHTA 4OLLA 4FOQA 4CRQA 1WLWA 1LOBA 2D98A 4CDQA 2UWBA 5HCFA 4LO6B 1KJRA 3AYAA 1VBE2 1WW7A 3NJZA 2XLGA 4GIQA 1KXGA 2ZX1A 1OQ1A 1RMU1 3N7JA 1JUHA 2OZ6A