2QDRA

Crystal structure of a putative dioxygenase (npun_f5605) from nostoc punctiforme pcc 73102 at 2.60 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
285
structure length
285
Chain Sequence
b'FLHIASVKEDWGGDGRGRMNLSGRRTAIAKEYLPRQYQFFDTNTVMEKQGWRVRGMPDNIAPGSRRLLTWHDSGASTSRVVLPPKFEAPSGIFTADLEIFVIKGAIQLGEWQLNKHSYSFIPAGVRIGSWKVLGGEEAEILWMENGSVPLEYKYAQEDHPDARLSDFIPALDSKLLPWGKADTVQFVQANKKWLRKDINGGGVWLLAILPHFDNKYQMIQPYNEEGYCLTGYCDVGDYRIVKDHYWYCPSFSTLPRHITDDGGLFFVRVDRDLSKVATVLSYAPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (ZP_00345151.1) from Nostoc punctiforme PCC 73102 at 2.60 A resolution
rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
total genus 62
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14499 DUF4437 Domain of unknown function (DUF4437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2qdrA01
4AXOA 1X8MA 3FE5A 4OLLA 3E6DA 4KL1A 3I59B 3DKWA 3UKVA 3E97A 3OGJA 2XLFA 2H0VA 3DN7A 3NL1A 3E6CC 1WLTA 1ZZ7A 2XL7A 3EBRA 1NE6A 4AVBA 2PYTA 1DGWA 3HQXA 4AVAA 4HVQA 4IEVA 2BNNA 4HVRA 2IXJA 1WA4A 2Z2SB 1SQ4A 3IWZA 5KHGA 2P17A 4Z07A 1RL3A 5BV6A 4RD7A 1ZRRA 1O3SA 4YYOA 3S7EA 5D1IA 3RNSA 3QACA 3GYDA 2FQPA 4LUKA 4O9EA 5I0UA 3ES4A 4UBHA 1ZZCA 1EP0A 2BNMA 4ZU7A 5JR7B 1I5ZA 2QCSB 3FZ3A 4I3PA 4YRDA 1J1LA 1RUOA 4X6QB 4OFGA 4BH9A 3SCFA 4XFHA 3RYKA 5BUVA 2GC1A 1CAWB 1PM7A 4XFGA 2QNKA 1TQ5A 1X7NA 5CU1A 2XLGA 3S7IA 4WZCA 1UD1A 3D0JA 1IPJA 4QMAA 3ACLA 4EWDA 2ATFA 2VQAA 2FMYA 2ZCWA 3LZZA 3TNPB 2Q1ZB 3IDBB 4QM9A 2IXIA 4HLTA 4QGLA 1O5LA 1WGPA 4QX5A 3H9AA 2D93A 1X8EA 2O1QA 5T3NA 5I91A 4PIZA 4PIXA 5JCTA 1YUDA 2IXLA 2ZKLA 2IXHA 3H50A 4XFBA 4XFAA 4HN1A 2N7GA 2OA2A 2VECA 3RYPA 1OMIA 3H8UA 2XL9A 4R52A 4YARA 1LB2A 4MGZE 4O9GA 4IEQA 4JTOA 4Q29A 4BHPA 1UCXA 5J7MA 4EWEA 1RC6A 3USSA 1XE7A 2PAKA 3H3UA 4P9GA 1CAXB 1Y3TA 4B29A 1ZZBA 4Q0UA 4WVZA 4META 1QWRA 3KCCA 1RGSA 4A2UA 2C0ZA 2IXCA 4IESA 5FLJA 4FBFA 4KU7A 5FPXA 1ZVFA 1RUNA 1VP6A 1EY2A 2QJVA 4LUMA 4MX3A 1LR5A 1FXZA 1UPIA 3MPBA 3PLQA 4LA3A 2ETEA 2GC0A 3NJZA 2V09A 4MV2A 3BPZA 4NVPA 1YLLA 3FHIB 1O5UA 3CEWA 4XFCA 3PNAA 5KHKA 2ET1A 4IEPA 1OD5A 5I8SA 1ZNPA 3D0SA 4JV4A 2PTMA 4LEJA 3ROUA 2GC3A 4KU8A 3I59A 2I45A 4E2SA 3ZDSA 4IEZA 3WW2A 1Q5OA 3DV8A 4UXAA 1YHFA 3QOPA 3LA2A 1YFUA 4QGMA 2E9QA 1LKNA 1YFWA 2ET7A 1ZREA 1XRUA 1Q43A 1NE4A 1YWKA 5I0SA 1V70A 2PAMA 1H1IA 1YFXA 5FCCA 2BYVE 3CLPA 4KWKA 1YFYA 4K8FA 1U12A 3I7DA 1HW5A 4EWAA 1NZCA 4PIYA 4Q0VA 2GZWA 5K8SA 3B02A 4IEYA 4LLOA 4I01A 4FAGA 2B5HA 1J3QA 1FI2A 1NXMA 3WW4A 1XE8A 4UBGA 2UY8A 3KGZA 2CV6A 1J59A 4I2OA 2MHFA 2EVXA 2PHDA 3ETQA 3OTFA 1OFNA 1CAWA 2O8QA 4L2NA 1Y9QA 5FQ0A 3MDPA 1CGPA 3PVBB 3NW4A 4AQ6A 3BALA 4QM8A 4D7TA 5KBFA 3OCPA 5FPZA 2GH2A 2IXKA 5LRSA 3WW1A 4HBNA 5LEKA 3BU7A 4GULA 2D5HA 4AVCA 1J58A 4KWJA 1CX4A 4ONUA 3BB6A 2IC1A 3MYXA 4HVOA 2XKPA 2EA7A 2H6BA 3FX3A 3I54A 1RTVA 5EZWA 2HKXA 3KGLA 3KSCA 3GBFA 4XEZA 5I8YA 3LA3A 1PMIA 3SCGA 4ZU4A 3H1WA 3H1MA 5KHJA 1OI6A 2HJIA 2Y0OA 2PAEA 3LA7A 3SHRA 4XF0A 3ST7A 3M70A 3H3ZA 4I0AA 1QY4A 3FJSA 3NVCA 4F7ZA 1LRHA 3M3IA 3RPQA 4IEXA 4QGNA 1CAXA 1QXJA 5FLIA 4AQ2A 3H7JA 4IEUA 2QVSB 3O14A 2OPKA 3SCHA 5LEJA 1VR3A 3L2HA 2XHKA 4BYYA 4E2GA 4EV0A 2H6CA 1QXRA 3CL1A 5AVPA 1DZTA 2D5FA 1UW8A 1O4TA 3NSTA 4J1XA 4Q0SA 1G6NA 5BXXA 5KHHA 2WC2A 4CYDA 5HI0A 4MGKE 1NYWA 3DL3A 4XF4A 4ZU5A 1CAVB 3D82A 5FDBA 4MGIE 4HSLA 3UKTA 4HMZA 1ZRFA 3LOIA 5C8WA 1O3RA 1I6XA 3EO6A 4IEOA 1CAUB 1DZRA 1SFNA 4F8AA 1O3TA 5JSPA 1L3JA 1Q3EA 1SEFA 3TNQA 2MNGA 4QXKA 4J1WA 3E5UA 4I09A 4IERA 1UIJA 5CADA 2PQQA 4LTAA 3N4MA 1ZRCA 3EQEA 2CAUA 1EYBA 4D7SA 3H1YA 1ZRDA 5I8TA 3NKTA 2K9ZA 2F4PA 4HN0A 2MPFA 1ZZ8A 2DCTA 1J3RA 3BCWA 3MZHA 5JSOA 3H7YA 2XKOA 4PJYA 4XF1A 3SXWA 4HSJA 4XFIA 4YNIA 2XGXA 1EPZA 5E16A 4HZFA 3KMHA 2Q30A 4FT8A 3OD0A 3EJKA 4IEWA 4MGYE 3E6BA 5J48A 4BIFA 2CGPA 4YSFA 2BNOA 1J3PA 3LWCA 2K0GA 5JAXA 3E5XA 4XETA 1ZZ9A 2OZJA 4Q0QA 2KXLA 5FQ0B 2PA7A 2UYBA 4FAHA 4EROA 2VPVA 3RYRA 3RZZA 3G7DA 4Q0PA 4IETA 1O7FA 4XF9A 2WFPA 3WW3A 4LA2A 3U11A 1GQGA 3HT2A 4H7LA 3CF6E 4XF3A 3EHKA 4LULA 4N9IA 1O3QA 4TLFA 4E2QA 3ELNA 4I0BA 3C3VA 3IDCB 3HT1A 3CO2A 5F1RA 2D40A 2GC2A 3HIFA 2GAUA 4ORFA 1UIKA 1VJ2A 4KWLA 2B9UA 4DINB 3RDIA 4WBBA 3ES1A 1X82A 4L11A 3VHRA 2GU9A 5I0RA 5LRRA 2EAAA 3IIAA 4JVAA 3FFQA 3UKNA 5CVRA 5BPXA 1ZZ6A 2B8MA 2UYAA 2Q0AA 4MUVA 4MZUA 2BEOA 1ZX5A 2UY9A 5J3UA 2XLAA 5FLHA 4XFFA 5I0TA 3S0MA 3U0ZA 2OZ6A 5I93A 3E5QA 3U10A 1CAVA 1DGRA 2Q4SA 2CAVA 3LAGA 5C6CA 3CJXA 1GQHA 3IBMA 1H1MA 2OYZA 5KHIA 5E1RA 1IPKA 3JZVA 4I02A 2Z69A 3FWEA 2BGCA 3SMHA 4X6RB 5EFUA 1FT9A 5JSRA 1JUHA 4R8HA 1CAUA 2PFWA 2QDRA 5BY5A 3OF1A 4JTNA 4N9HA 2PHLA 4Z82A 4MH0E 3R6SA
chains in the Genus database with same CATH superfamily
3M1HA 2QBXA 3HBZA 3NWKA 2BJSA 2WYFA 5FBZA 1AUYA 2V5DA 1S0CA 3E6DA 4OLLA 4PF5A 4KL1A 3VV1A 2V4VA 1POQA 2GP3A 1VBE2 2CL2A 5FY5A 2DV9A 4CDQA 3OGJA 3U37A 3WDWA 3IDEA 1BEV2 3I2OA 3N9NA 1V6IA 3NJYA 1JZ2A 2HWF1 3FN9A 2I74A 3RJ2X 2P34A 1NE6A 2WN3A 2PYTA 1DGWA 4QHBA 1BBT2 2HWC3 5CZKA 4BXFA 2NLRA 3NV4A 3ZVXA 1HB3A 3UT0A 1BKZA 3I97A 1W06A 2IVIB 4QPIB 5ANNA 4COVA 1AXZA 2BNNA 4HVRA 2IXJA 4B8EA 4BOWA 4YG6A 3M4FA 2XJPA 3FHQA 5J09A 5KHGA 5A7WB 1RL3A 2ZX1A 1O3SA 5FZ1A 2J42A 4YYOA 5APAA 3VDAA 1YEWA 3RNSA 2ZX2A 1UMIA 2V72A 2FQPA 2WIIB 2P6CA 2SLIA 3N9OA 4GB33 1LENA 1MACA 3ZFEB 4M4RA 2RR12 5JOZA 4UBHA 5L9BA 5L9RA 1HRI2 4X8NA 1EP0A 2NMOA 4YGDA 1X36A 4ZU7A 2VULA 1W9YA 3IM0A 1QQP1 3HOBA 3NNJA 3GCWA 3KLSA 3HPNA 4Y20B 3WCRA 4XMAA 3JD73 3ZMNA 4X6QB 4MADA 4OFGA 1Q8PA 2WZR2 2Y6HA 4Y4RA 4BH9A 3AP7A 1EAH2 4Q4W1 5BUVA 5SV8A 4QDRA 4YVSC 3ZPYA 2RS33 5CISA 1IS4A 2GALA 4IL7A 2RMU2 4K9SA 2W46A 3FUQA 3T2QA 5FZIA 5CEHA 2YUEA 2RS12 3RJRA 4URAA 5LY1A 5FREA 1EV13 2Q1ZB 4S2DA 4XILA 5CBLA 3BODA 5GZEA 4OI1A 5IK4A 3PUHA 4HLTA 5KXEA 4DFSA 5LWBA 4YG0A 3QCWA 4AOCA 5HPOA 1W9FA 5L36A 2QZ3A 4CA9A 5AFEA 5HXMA 5JIUA 4CDWA 1X8EA 2W9XA 5DUVA 4LBKA 1AX1A 3LQCA 4A3XA 3THDA 5CKNA 3WSOA 3WQ7A 3ZYRA 2VOWA 2OKXA 3TN92 3VB9A 5JCTA 2RDQA 4LR4A 2Y34A 4FFGA 4XAEA 5A32A 1FPN3 1DP0A 2FBEA 2ARXA 1RUG2 4XFBA 5LBFA 4AW7A 3LEKA 3SEPA 5C7GA 1DQ4A 2NYYA 5FP4A 3DYOA 1AHSA 2VXRA 4HN1A 1TZOA 2N7GA 3H3LA 2VUCA 5DUUA 1U5XA 2A1XA 1DIWA 1OMIA 3V64A 1KEXA 4AI0A 3NAPA 2DDUA 2UWAA 4IEQA 4XCBA 3OBAA 4Q29A 4Y22B 3VN4A 4EWEA 2ORZA 1K12A 2PAKA 1OD3A 5CFCC 2FDKA 1ZA7A 2E7TA 2A73B 4GA9A 1Z7S2 1OBNA 1H4GA 1Y3TA 1RMU1 5DAXA 5H9SA 1DLCA 5FYTA 3WNPA 1E5SA 5JMCA 4META 4WVMB 1JTZX 1OA2A 5DAPA 2MEV3 1QH6A 3TYJA 1KRIA 4IQPA 1LU2A 2IXCA 3GHMA 3BIEA 5FLJA 4LKDA 3H8RA 2YFZA 4KU7A 2RE9A 1N1VA 1RUNA 1GSLA 2D6OX 5IUQA 3K4AA 4IE4A 3J8F1 4INDA 1ENQA 1VP6A 3OEAA 3IN9A 2CHHA 1V9U3 1XNBA 5F3EA 4BE3A 1S0JA 1RUJ1 1Y9GA 4MX3A 1WLCA 3S57A 1LR5A 2GMEA 3I2JA 3JU9A 1UPIA 4JGZB 1WWYA 1HQLA 4TXWA 5FJKA 4OHYA 2C6SA 1OLMA 5FTTC 1GZTA 4A7KA 5D8AB 2E51A 2WQZC 4QHOA 1HJFA 5C3PA 1NOVA 1WKYA 1QKQA 3T4HB 1GUIA 1KJRA 2R0HA 1CPMA 4QX0A 4MXWA 5DABA 4HKLA 1OH3A 1FV2A 4P14A 1OD5A 3D0SA 1DQ5A 3GGLA 3KQ4B 2PTMA 1N47A 2WT2A 4GH4B 4JV4A 1MVEA 2GC3A 3WV6A 3B7MA 3I59A 4CXWA 1UXXX 3MBWA 2VMHA 4R9CA 4E2SA 3DV8A 1YHFA 2DVAA 5DDJ1 3LA2A 1JYXA 3A4UA 5C33A 1YFUA 2BERA 5EJZB 5DXDA 1VE0A 1AXKA 2VQUA 3KT4A 1NQDA 1UF2C 3NJXA 1OLQA 4DO0A 5JOWA 1YFWA 2ET7A 1YO8A 5SV5A 1XRUA 5FPVA 1WUVA 1GOGA 2E63A 1NE4A 2ZX0A 4OHWA 5I0SA 5FWJA 3ILRA 1PIV3 2W68A 1ND3A 1ZBA1 3ZN5A 2FD8A 2FDFA 3DUIA 3U4XA 4UFMA 5GZFA 4AHWA 2FZ2A 1F5FA 1MQTB 4D7YA 3KHCA 4OI0A 3KD4A 4M3CB 2W39A 2XVGA 4K8FA 4DRRA 1W8TA 2VOTA 3NAPC 4PI0A 3WCSA 5EIYB 1POV0 1UN1A 3AMNA 2XDVA 3U1XA 4C1WA 4EWAA 3WDVA 1NZCA 2XHNA 4Q0VA 2GZWA 3O0VA 3VZNA 4NRPA 1KITA 3VBRB 1QJY3 2BVBA 2YB7A 4JKLA 3W21A 4FPOB 4HT1T 4XZPA 4XACA 1J3QA 3ZDVA 5DN2A 2BGPA 1FI2A 1NXMA 1PVC1 1UMZA 2L9LA 4L0PA 1LOGA 1VRH3 3I2HA 4MLOA 5A3OA 3A23A 4UBGA 1KS5A 1STMA 5T50A 5JXGA 3KGZA 2EXHA 3L9JT 4I2OA 2MHFA 2EVXA 2PHDA 4CUCA 2CGOA 4GWMA 5T5LA 3ZN6B 4XE9A 2J1RA 5FQ0A 3K3OA 1VBB1 1WLDA 3NW4A 3WUDA 3BALA 4AQ6A 1AR83 4BA6A 1HLCA 1NLQA 5F6LB 1AXYA 2AEYA 2JE7A 4D7TA 3OCPA 5BNQA 1BZWA 4ZPIA 2WS93 1LCLA 4PT6A 5LEKA 3GM8A 4UW5A 2XXZA 5A7PA 3GZAA 4LORA 3GF6A 5BPXA 4ZS3A 1VIWB 1LGBA 1IKQA 3PDQA 1LEMA 3DCQA 2EA7A 2R16A 1LOFA 2ZPXA 4RHV2 1FX5A 2VW1A 3AYEA 4G3YC 4XJAA 1RUC1 3JB4C 1PNFA 2HKXA 2MEV2 1AL22 4YW6A 3VBUA 3KGLA 3PIGA 1F35A 1QHDA 3TAYA 2TEPA 1UYXA 4M0HA 3HN3A 2QE3A 2F17A 3HAGA 3LA3A 1PMIA 2A71A 4ZU4A 4ZXEA 1PO23 3O1PA 5KHJA 1OI6A 1NA1B 2HJIA 2PHUA 3VKNA 4JGYB 1ND3C 1R1A1 3J7LA 1PO12 3WG3A 4ZS2A 3BN6A 4HPKB 3WZ1A 3FJSA 1RUH1 3ZIXA 2ZGUA 1L7QA 5FRAA 3W20A 1LRHA 1YI7A 4FQ4A 4XUQA 4CUAA 5L7OB 1OKOA 3KVAA 1PK6C 4R9BA 1QMJA 3NNLA 4LHKA 3LF7A 2RJKA 4AQ2A 2WQ8A 4BQ4A 2R1DA 2FDJA 1W8WA 4DY3A 3AVRA 5BNPB 1H2MA 5A7QA 2CNAA 3WP3A 2QVSB 4BMEA 1JYTA 5FJHA 2WZPP 1JI6A 3AKPA 1OOPB 2P1BA 1L7LA 3M3OA 5LEJA 4B4RA 3L2HA 4BYYA 2X10A 3P1IA 4K7JA 4EV0A 1OUSA 3A7QA 2LALA 4UOJA 2FDIA 5A33B 3NSTA 1IG3A 5FZOA 4EWDA 5BXXA 4C90A 5FK8A 1OURA 5JZGC 4NIDA 1CAVB 3D82A 1MEC2 2HWD1 4G4FA 3EXUA 2WN2A 4HSLA 4Q8KA 1W2NA 5FR3A 2XG3A 4HMZA 2VQTA 3I2FA 3H42B 3AX4A 2B39A 4A42A 2ZJCA 3MI8A 3POJA 4GQ7A 4AEDA 5CB7A 2HWE1 3POEA 4GXLA 1N3PA 2B46X 3MW2A 5IVCA 1YIPA 2W5FA 5CFDC 5D2AA 4Q4X1 3RRDA 3N9QA 3VBHB 3O1MA 1CAUB 1DZRA 1VRH2 4LHSA 5BNOB 1VAMA 3ITQA 3VBUC 3VKLA 1Q3EA 3PVEA 2MNGA 4XABA 4COZA 2X5IA 1WW5A 5FOBB 2VMIA 3POSA 1FMD3 1TG7A 4QPIA 1IQDC 4I09A 1D4VB 5FWEA 4IERA 1UIJA 3AXEA 4OHXA 5CADA 1W3VA 4K3UA 3W58A 5A7WA 3IPVA 5FYZA 1UOJA 2WDBA 4CDQB 4LTAA 3S5AA 1BYHA 1TMF3 2D44A 3PUIA 1ZRCA 2XUMA 3JBG1 2BGOA 1QQP2 1EYBA 5CIRA 1JMUB 2EALA 3R05A 1HKDA 2A3YA 3U07A 2ZA9A 3VD4A 2Q8EA 1LHNA 2XONA 5IJRA 4FOYA 3B94A 5DUWA 2K9ZA 2PHFA 2JB8A 4PF1A 1HQNA 2XJUA 4YM2A 3SITA 1MZ6A 1ZZ8A 2RS52 2HBUA 2X29A 4ZZ8A 4XOGA 1J3RA 2VMCA 3K4ZA 5IVFA 4QQPA 4IXLA 3CZJA 2XBO3 2GP5A 1IPSA 3TEWA 5K4LA 2XKOA 4PJYA 4IDZA 4YNIA 2XGXA 4KG0A 5F3GA 4FFFA 3AP6A 3NMBA 5E16A 5F32A 4UFLA 3T09A 2XVLA 3EJKA 4BLJA 1RVF3 4UW4A 3E6BA 3MEPA 3VDDC 1G7YA 4WVWA 1Z0HA 1QF3A 2E7QA 5FYVA 2C5DA 3NO8A 2XWJB 4XQ4A 1IHMA 2BNOA 5FUIA 1JYCA 3DPRC 3VKFC 5CYYA 1C8M1 4XETA 2VQ0A 3IB3A 2D43A 2JG9C 2YU2A 4L97A 1Z78A 4Q0QA 2KXLA 5LK7B 3VKMA 4OHZA 3AMQA 5C4WB 4FAHA 4MG2A 4GMP3 1AYM3 1XU1A 4HK8A 1BJQA 2VCMA 2PLV3 1IOAA 2R30A 3RZZA 3IKWA 3WINE 4OHVA 4XF9A 1HXS1 1XB9A 3MF9A 4LBMA 2X5IC 1GQGA 2C4XA 2JDKA 1COV1 1DHKB 5IVEA 4QPIC 3MF6A 4CDWB 4MO3M 4ARYA 3AZXA 4N9IA 1U0AA 4SBVA 3RG0A 5HV0A 1MS5A 2WZEA 2XVKA 3OPTA 1JU3A 1JN2P 2AH2A 2AREA 4ORFA 1WCUA 3ZFEC 3N9PA 3WDYA 2K46A 1NY71 3OPWA 4EZHA 4UWDA 2RDRA 2B9UA 1VBA1 1YRZA 1JU4A 2G9ZA 1VBC2 2E32A 1TME1 3AXDA 1CR7A 1X82A 3VZMA 4BLIA 2GU9A 3V0BA 4E27A 1F4HA 1W0OA 2VNVA 1ODNA 5LRRA 3J8F2 5A7OA 3T08A 3UKNA 1AL0G 5CVRA 1VRBA 3VD3A 2UYAA 3NAPB 1A8DA 4DS0A 1UO9A 2WWUA 3NJVA 1RUJ2 2D6LX 4MUVA 3SKJE 2BBVA 1PGSA 2BEOA 2OX0A 1DCSA 3ZFGB 1OLME 1GNHA 2XLAA 2YPDA 4XFFA 2WBKA 4Q2FA 1CN1A 3Q8FA 4LOSA 1CJPA 3WD5A 1GOFA 2WFF1 4NIAA 3ZR5A 1AZDA 2R063 4CP1A 5I93A 1H8VA 3ASIA 4ITCA 3VBOA 2DTWA 3NKGA 5D8AA 4QPGA 2QQMA 2X8KA 3ORJA 3GZTB 3UGHA 2Q4SA 2CAVA 2ZS6B 3WQ1A 3B01A 4DXTA 2ZHKA 3WNLA 5F5IA 4HG6B 5DDJ2 2ZZJA 5KHIA 1YC61 2ZGKA 5ACA1 4GH4A 3VZKA 2O0OA 1UYZA 1O91A 3AFGA 3P3PA 2BGCA 1AYN1 1FT9A 1RUD3 2BOJA 1AR71 1JUHA 4BQ5A 2I2SA 2QDRA 4YGBA 4XDOA 2B42B 4JTNA 1ALYA 5F5AA 4Q26A 2E53A 4MXWB 2J1TA 2VW0A 1W2OA 3TRSB 4CZSA 4MYEA 2WA3A 3I59B 3DKWA 1XNDA 3PTYA 4NPMA 3KCXA 4AI2A 4Z8BA 3RZLA 3ZMOA 5FP3A 1RVF2 3G6JB 2HWB1 2XLFA 3IAQA 4M3CA 3W9AA 5FYUA 5FY7A 3IT8A 4COWA 4KMQA 5BNNA 3NL1A 1J1TA 4QX3A 1WLTA 2EXIA 1PVC2 2P3YA 4XXAA 4H7MA 2B9VA 3HQXA 1P8JA 3B93A 1PZ8A 4AVAA 1QJFA 4AEKA 1T6GC 2YC2A 3VBRA 3Q9OA 3ZN4A 1ENXA 4QQHA 3ZSLA 3WUCA 4W65A 4AFDA 4DUWA 1YQ2A 2QQVA 3AYAA 1N1SA 2P37A 2W1UA 1PVXA 1ND3B 1ULFA 1YCIA 3GDBA 1SQ4A 2JG8B 4P9LA 4Z07A 5BV6A 3O1UA 1QJX3 5IAXA 1ZRRA 1OQDA 1Q8VA 5LBCA 3W5NA 4QPYA 1FOD2 5ISLA 3V65A 3IMMA 3QACA 5ABJA 4CEYB 1H2NA 1AVBA 4O9EA 4AEMA 4CU8A 3WDTA 4YGCA 1ULDA 1LGCA 2WNEA 4YZ3A 1OA4A 1ZZCA 3AZYA 5KXBA 3ZYJB 1VBE3 2A5ZA 4YVWB 2VMGA 2BNMA 3T2PA 1DQ2A 4WZFA 4A3ZA 1BEV3 5GKAC 1LTEA 1PX3A 2YXSA 3JD71 5H9PA 4JGZC 2C26A 4DPNA 1MS9A 2PHWA 1J1LA 5H9QA 1XSRA 1BBT3 3KM5A 4QPGC 3HNYM 5D8AC 4YW7A 5FV3A 5JXHA 4XFHA 3RYKA 2CWMA 4E8DA 1PM7A 1PX4A 1KXGA 1TQ5A 3FC0A 2NPIA 2EIGA 1GZWA 4ZKTB 3S7IA 5A3MA 4GJYA 2DCZA 4WZCA 4GH4C 1UD1A 1SDWA 3LSDA 1IPJA 3ACLA 2VQAA 2ZCWA 1OKQA 3UESA 1HV1A 1W8ZA 4M4PA 1CX1A 5CG9A 2IXIA 4PLMA 2W3JA 5EPAA 4DQAA 1EUUA 5DUXA 5DAWA 1IZ3A 3DYMA 1O5LA 1HRI3 1WGPA 4FPLA 5FXXA 3CZUA 1R082 1W99A 1C57A 2VE1A 3WQ0A 4COYA 4NMIA 2VO5A 1RUH2 4LBQA 3H9AA 1PHMA 1DGLA 2YDEA 2C1FA 1RITA 2RM22 2WZR3 4HL0A 1WW7A 5I91A 2YU1A 4IGQA 2R062 1EAH3 1MQTC 4HPKA 4DXRA 3VBUB 3PVNA 5GLWA 1W03A 1YUDA 3UJOA 5BNNC 1V6OA 2RMU3 3H50A 4RQPA 1UY1A 1UZWA 4IV1A 5L7OA 1FPN1 1A8MA 4P08A 1NLSA 2FCUA 4NHKA 3VBRC 1JBCA 1O8SA 4FCAA 2E33A 2OA2A 2SBAA 1UY2A 1XBFA 2ZEZA 3RYPA 2BWCA 1SCRA 4AI9A 4YARA 5FYCA 4NE9A 4MGZE 4Y26A 1POV3 1QDCA 4AAXA 4O9GA 1SBFA 3LE0A 4JTOA 4N7UA 4CVUA 1UCXA 4KG8A 5F9TA 1RC6A 5L19A 3U14A 1SFYA 3T0DA 4QKBA 1C5IA 4QDQA 2WNVA 3DEMA 3RQ0A 3RZHA 3K3NA 3FUOA 3OGRA 4NJ4A 2WSVA 4A6SA 3OSDA 4RR3A 1BHGA 2DCYA 3KCCA 5FAXA 3TN93 2W92A 4AL9A 4BQWA 1YQ8A 1UZ0A 2D7FA 2HWE2 5A6XA 1KGYA 4AEJA 1RUE2 4B4QA 3ZXAC 3BIWE 2J1EA 1RUG3 3OJBA 3A0NA 4Q4X2 1C1FA 4U2AA 4DRVA 2VZTA 3BTYA 1EY2A 1H30A 1ODMA 1YQ6A 4LUMA 2BOIA 1G9DA 3BTXA 2DVBA 2E7AA 2P2KA 1AR91 1LGNA 1H9WA 4AI1A 3MPBA 3PLQA 3DYPA 4UF0A 4ASKA 2ILMA 2EICA 3SC7X 4BU2A 1ND2B 2DCJA 2OIIA 3HNBM 4KGQA 1YLLA 4NIIA 3CNAA 1X9TA 3A0KA 1O5UA 3CEWA 2ES3A 4RS5B 1PGL1 1Z7S3 2RDSA 1VBD2 2VBBA 4E4HA 3JBG2 4AEDB 5C5TA 2CU5A 3LDBA 2DUQA 4CCNA 3PJQA 4LEJA 3WEZA 1XYNA 1NA1C 2I45A 4KU8A 5LA9A 2Q8CA 4ET7A 3NNMA 4JGYC 5C3OA 2A6VA 5A3TA 5IHRA 1Q5OA 4D3WA 3N7JA 1OXCA 3CHXA 5JOXA 1W3XA 5FZBA 2AZ5A 5FYBA 1G9AA 2DVGA 3AZWA 1DDLA 2X5IB 3P5BA 3T1LA 3WNMA 4L99A 5FPUA 5L7OC 5M0TA 1BMV1 4N8MA 2PELA 1S0EA 4Y1YA 1IS6A 1PIV1 5LY2A 1WLWA 5FXZA 1X50A 1FNZA 4EZ4A 3BVCA 3IPVB 4BM8A 2VTFA 4YZ2A 1H1IA 1W39A 3GZEA 1OT5A 2ZGOA 4V1PA 4WV8A 4AVTA 4Z2AA 5BNPC 3CLPA 4YGEA 4QT6A 4Q5OA 1GKBA 1C4RA 4Y5SA 2FZ1A 4UFHA 1OOPC 2HH9A 3VHOA 2FHRA 3KV6A 5FP7A 3PU3A 4LBNA 1QJY1 2JXAA 2W87A 1S2EA 1UZYA 4Q4Y1 5FMCA 1RXFA 2WNVC 3O7OA 1L7RA 1E5IA 4JX0A 4D6RA 1HN1A 5A7SA 3WW4A 4JAAA 1CD3G 5F37A 2JENA 2HEYF 2GDFA 1CONA 2UY8A 2OXBA 2V73A 3LD8A 3BUCA 3MV11 2CV6A 4OCTA 5FIXA 3EMRA 2FDGA 1QJZA 2JDZA 4PBOA 3OTFA 1CAWA 3ZXJA 1HV0A 2O8QA 4IE6A 4YFZA 1CGPA 2VNRA 3MDPA 5IVVA 4CCEA 1AR81 1DGRN 2XQXA 5EP9A 1HXS2 3ACHA 4XPVA 2VCAA 3DECA 5FZHA 2JX9A 5C4WA 1MS3A 4XHBA 5L9VA 3LCPA 3ZYPA 2YC0A 4Y4YA 5KBFA 2GH2A 2IXKA 3KB5A 3VBHC 4UAPA 4QXHA 5BNOC 1BK1A 1DQ6A 3WX5A 1H6XA 2HLEA 2P3KA 3MIGA 1JZ3A 4AHXA 2XJQA 2OW4A 4MVTA 5JR2A 4ONUA 1M06G 4DNYA 2WJSA 5GZDA 4TZDA 1RJ7A 1HRV1 1NY72 1REEA 2BV4A 3RI8A 1H0BA 2JJ6A 4IE0A 4LKEA 4Q4V1 4W6WA 4CDQC 3R4DB 2H6BA 3K48A 3FX3A 3I54A 1A3KA 3K4DA 3O12A 5EZWA 4CXXA 1ASJ1 1H4HA 3KSCA 3VHPA 3GBFA 5A6ZA 5I8YA 3LEIA 1RXGA 1SDDB 2QQKA 4MXVA 5CNAA 4CU6A 3C7OA 1WBLA 2VZVA 3AJZA 3JQWA 3ZSKA 2CGNA 2V4AA 1H2KA 4O65A 5K0UA 3SHRA 4I0AA 1QOOA 1JODA 3JB8A 2VGDA 2XMLA 4J6GA 3NVCA 3ZFGA 4CP9B 4F7ZA 2VH9A 5EJ3A 5F7UA 2NMNA 3I2DA 1D4M1 1KFUL 3M3IA 3TEXA 3WXPA 3AVSA 4B7KA 1CAXA 4P9XA 4RHV3 3FHAA 3RZJA 5IYYA 3V0BB 2VZRA 2XOMA 3I3BA 4IV3B 1S0FA 4H2AA 4I3GA 4FPEA 2ZMKA 1AL23 1UU5A 4CU9A 1UX6A 3RWNA 5ACA2 1WCQA 1NQJA 2DURA 3C7FA 3OD4A 3P3NA 4LKFA 3O14A 4YW5A 1H9PA 4FFIA 4FSJA 2FMDA 2HYXA 1RHI2 1AR72 3S6PA 4BQ1A 1I5PA 1VR3A 1GNYA 4E2GA 3TEYA 3I3QA 3I2IA 3CL1A 5AVPA 2JDYA 2D5FA 1MS4A 4QDSA 1HB2A 1UZVA 3P6BA 4M01A 1PO13 5FXVA 1AR62 1G6NA 5C4WC 1W8NA 2WO7A 3HMYA 1DG6A 2F6BA 3MICA 1RUF2 2LUWA 3MGUA 3VBOB 1PMHX 4ES8A 4QPGB 4DUVA 4CCCA 3OGGA 3MIEA 2JECA 4RFT0 4M3CE 4XZUG 3MIDA 1ZRFA 2HWB2 1F5JA 3EB7A 4CDWC 3O0XA 3MLJA 2A6YA 3N9MA 4FPYA 1I6XA 1NCRB 4HETA 4S2FA 5FP9A 4NAMA 3EO6A 5F2WA 4FOQA 3FBMA 2YGLA 3WLUA 3ZKUA 4LLFA 4QX1A 2JE9A 5HCAA 2R071 1O3TA 2Q1MA 2BP6A 1MR5A 4JRLA 4RA0A 1L3JA 5FZAA 1E5HA 3MIHA 3I3MA 3AL6A 3HJRA 3H8OA 1H6YA 4J1WA 3AKRA 3ZLIA 3E5UA 5J1XA 2C9AA 1HB1A 1YYNA 1DQ1A 3CIHA 4EN6B 2ZZQA 1SLLA 4XDQA 3SQOA 3BTAA 5FY9A 2JG8A 4PI2A 4AGVA 1OVPA 2KM2A 4DB5A 1W6NB 4YW4A 1MEC3 1XOYA 3NQHA 1WMEA 1KDKA 3C7HA 4QX7A 4FPCA 5BNNB 5I0DA 2XB6C 1DLLA 4O7XA 4Y1UA 4CEYA 1AJKA 2FDHA 3C7GA 2G4IA 2YYOA 3J7MA 2RHPA 3ZFGC 4D7SA 2X53S 2IZWA 3MFAA 5FPLA 4YVWA 5JVVA 1R091 3NKTA 2OUJA 1VB2A 1A78A 2D97A 3AL5A 1OPOA 5HCFA 1F31A 3UK9A 2A6ZA 3J26N 2XBO1 1I1EA 5C3QA 2Y6LA 3BCWA 4R4ZA 5ABJB 4QKFA 4BXSV 1CVNA 4XF1A 3SXWA 1ZBE1 4HSJA 2OQ7A 4BJ0A 3KF3A 1HX6A 1LHWA 4URTA 4FXGB 3I49A 3PU8A 4FO9A 4HZFA 1UWWA 4D94A 1MS8A 1W9TA 2Q30A 2ZBJA 4CDXA 1YQ5A 1LU1A 4ZONA 5IVJA 5J48A 2CGPA 1QQP3 4KNCA 2BU9A 2PN5A 5LK5A 3WF2A 2R32A 5F5QA 4YSFA 3RZKA 1J3PA 4ATEA 3AKQA 3VKOA 3I8TA 2K0GA 4CCOA 4BIOA 5KWRA 4HK9A 3KS7A 2ADEA 2CWSA 5IVBA 3WF0A 1GZWB 3O1TA 2DU0A 4G9SB 1K5JA 5E89A 4CDUB 5A3LA 2PA7A 1FATA 2RS53 3Q8CA 1QDOA 2WR9A 5FXWA 2PLV1 5CKMA 5DZGA 2VMDA 3KWVA 1LAJA 2D6MA 4MHRA 5C3SA 5HCBA 3GBGA 3RYRA 4NWVA 5BYNA 1O6UA 2Y26A 3LIHA 5DZEA 2WFPA 4L9BA 3AP5A 5FZ8A 3QD6A 2DTYA 3R4UA 3K46A 5FMBA 3HT2A 2P3IA 1D0HA 4H7LA 4LBQB 5DMYA 3KZ4C 2NN8A 1W05A 3H0OA 4K21A 3FMGA 3TBDA 2JG8C 1O3QA 5LA0A 2XPJA 3ELNA 4I0BA 5GM0A 3IMNA 5JOYA 4IW3A 5F1RA 3A22A 1US3A 3PJYA 2GC2A 3OBRA 2GAUA 4CEYC 4RQPB 4IV1B 3ZX7A 5A1AA 3LB9A 5FYMA 2ARBA 1GYKA 4DINB 4YM0A 2LTNA 4YVWC 4L11A 4O61A 3THCA 2JDNA 2W1SA 2Q5TA 3B69A 3VHRA 4EN8B 5LW9A 1O8PA 2GNTA 4WM8A 3I4IA 4JVAA 5AC92 4ATFA 3FFQA 3PL0A 4QQLA 1K42A 1YIFA 1XYOA 5A1LA 5B4NA 5AFBA 2Y60A 2K2SA 4AF9A 1AR92 1NLRA 5JXJA 2DU1A 4LBJA 2BUKA 3AMPA 2BW8A 2VG9A 2WNVB 3WP5A 4DEVA 2RDNA 4GWIA 2XJRA 2VTXJ 3U0ZA 4UI9L 3I2GA 1OVSA 4RR3B 2OZ6A 5G05L 3MUZ1 3WDXA 1F9KA 3ZSEA 2J1AA 4XJ9A 5T5OA 5JDBA 4JRAA 1ND2A 2JICA 1SBEA 1UOBA 3URFA 5GLZA 2ZTNA 3M7AA 2QFEA 3LAGA 4RS5A 5C6CA 1VBC3 1QJU1 2HWF2 3HWJA 5DAQA 5J98B 3JZVA 2D98A 2XJVA 1UOGA 2WAOA 4I02A 4OQ8A 4CCMA 4FPKA 3J8F3 3TB0A 4AWDA 1LOFC 4XHXA 5LA1A 1C5HA 1RUD1 3LKJA 4WM7A 3T2TA 2G9GA 1BMV2 4UF0B 1RUJ3 4PDWB 1DGWX 3O1RA 5L73A 3LEMA 1ST8A 5IAVA 1CZVA 4AVVA 2PQSA 3OF1A 4CCDA 2VZSA 4MSVA 3BTZA 1LJ7A 2YFUA 4A44A 2JDHA 2CYFA 4HONA 3D6EA 1X8MA 1SBDA 3LIGA 4LQRA 3FE5A 5FYHA 2P3JA 2YROA 3OYWA 4LO6B 3ZYHA 2C9KA 4NIGA 3K2OA 3E97A 1EPWA 4GKYA 4YW3A 4GIQA 4Q4Y2 1GBGA 2RJLA 4A41A 2AEZA 2H0VA 3DN7A 3T0BA 3E6CC 2EF6A 3OY8A 1ZZ7A 1URXA 2XL7A 2VBDA 3EBRA 4Q27A 5DDJ3 4AVBA 3WP4A 1JHJA 3BU0A 2WL1A 4NO4A 3ZKYA 2O8OA 4HVQA 4IEVA 5C71A 4P00B 4Q4W2 5D21A 2E31A 2Z2SB 1N3OA 2VR4A 3N3HA 2VUDA 4XIOA 2P17A 1W9SA 4RD7A 1LHVA 4LO8A 3S7EA 4W6XA 4W6YA 3NNGA 1K5MB 3ZXLA 1W6OA 2ERFA 5I0UA 3ES4A 3LFIA 5F39A 4MGTA 3PMEA 4XUTA 1WMFA 1BEV1 4PLOA 5JR7B 3H8XA 4LE4A 5KXDA 3FZ3A 5FZCA 1Q56A 4YRDA 2R041 2AENA 3ILNA 5FY1A 1PVC3 4AI8A 1ND2C 3PUAA 4GWNA 2BBAA 5JIAA 1UU6A 1HRV2 4KBBA 3SCFA 5HV4A 2YZ4A 1UY0A 4RS5C 1OQ1A 5TSWA 5FO8B 1CAWB 1S1AA 2QNKA 4QWNA 4LO4B 4ARXA 4AEDC 2XLGA 5IK8A 2XWBB 2BVVA 3WG2A 5FZMA 4QMAA 2WT0A 2GNBA 2WWSA 2YBPA 2ZGTA 4L92A 2PHRA 3SH3A 2LS6A 3HQUA 2FMYA 4U36A 1FOD3 3MLLA 5FZDA 3LZZA 3TNPB 2IWGB 4NAOA 3IDBB 4TWTA 5F5CA 3WHUA 2RR11 1KDMA 1H8TB 4PLNA 1HRI1 4XVHA 1ULPA 3MUY1 1KD7A 2XQRA 4QX5A 4YM3A 2WO1A 3RZGA 2YBKA 2D93A 1D4M2 5T3NA 2AACA 1RMU2 4H14A 2HYKA 4LIUA 4C8DA 1RUI1 2LW8A 3AZVA 4PIXA 4Q1PA 5EYXA 3CDZB 3MHZA 4FQZA 4CP9A 4JQTA 3PIJA 4NPLA 5FYSA 2Y6GA 2YBSA 2RS11 2G9FA 4AFCA 2A6XA 1IKPA 1LOEA 1KFXL 4XFAA 3NV3A 5FY0A 2Z42A 4IV3A 4QX8A 3FLRA 4J25A 2W2IA 4SLIA 5K0UB 2Y64A 1D0GA 3H8UA 1OF4A 1DYPA 2P5BA 2XL9A 3KT7A 4H55A 4R52A 5FPAA 3WNOA 4ASMB 2QQPA 1LB2A 1QU0A 3RS6A 2G1MA 1R083 2ZEXA 4D0QA 2BDRA 5J7MA 4XUPA 1GFF2 1RUH3 1SLIA 2VVDA 2VVFA 1XE7A 2IVJA 4XJWA 3USSA 3H3UA 4JZRA 1ULEA 1CAXB 3LEGA 3IZOA 2RM23 4P9GA 4E4ZA 4Z2WA 4WVZA 2YG0A 2VM9A 1WW4A 1PZ7A 5DQ0A 5DPNA 1RGSA 4A2UA 2C0ZA 4IESA 1W9WA 3ZFFA 3HEIA 3OUIA 2Q1FA 1W6QA 4BQ3A 4FBFA 1G8WA 1ZVFA 5A3WA 3USUA 1UU4A 1HIXA 5FPXA 5FP8A 2R072 1OLRA 4DIQA 1GNZA 1GZCA 1NCRA 1RJ8A 2D3PA 1WCDJ 4LA3A 2DVFA 4UW6A 1QH7A 2GC0A 1XNTA 2IFRA 2V09A 4MV2A 1W6MA 5FZ6A 2A3XA 1ZBA2 1XE0A 4NVPA 4QHZA 2DWRA 3IIIA 3FHIB 3OBZA 1DFQA 1Z7S1 2YHJA 2DBIA 4XFCA 4XQDA 1QGLA 5K7PA 5JWPA 4XDPA 3SISA 4IEPA 3OBTA 1SLTA 5DAVA 1ZNPA 5FKCA 5I8SA 4BPZA 5GALA 3ROUA 3KF5A 1W6NA 2H0BA 1OH4A 4UFIA 1I3HA 2HWE3 4IGOA 4IEZA 2WO2A 4K40A 5GJ6A 1RUE3 5LATA 3WNXA 3KV4A 5ANQA 4NRMA 1R092 4QGMA 4YWAA 2JDAA 4HXCA 2HWC1 4Q4X3 3ZXEA 4RL7A 5K9YA 4PQQA 4TLGA 5A7NA 5FZEA 1OSGA 1LKNA 3ZXGA 4A7YA 4YFWA 5FK7A 4BQ2A 4FOWA 1SHWB 1Q43A 4S2GA 2DUPA 4N43A 2VZUA 1ZBE2 2HBTA 2ZGNA 1V70A 2PAMA 4IV3C 4OUSA 1GQPA 4CTEA 5J37A 4XYXA 4CCKA 1YFXA 4FTEA 1VBB2 2VBPA 1Y7BA 5FCCA 2WZ8A 4ISRA 4KH9A 4CCLA 4LXLA 1DYOA 4GB31 2TUNA 4KWKA 1W0NA 4PQ9A 1DBNA 1VBD3 4BB3A 2Y33A 3JBG3 4PBPA 1HN0A 2GN7A 4PIYA 3ECQA 5F8PA 5K8SA 1CESA 4IEYA 4LLOA 1TE1B 4I01A 4YZ1A 3BOWA 3OOXA 1B35A 1BQPA 2AR6A 2B5HA 3LSEA 2VOKA 3U75A 4P9JA 4FPJA 3VBOC 3ACGA 1A6CA 1JOBA 1G9FA 2RS31 3N7KA 1WCKA 4XCAA 5T54A 4LOTA 1J59A 3K77A 1CIYA 1O59A 3ETQA 1RUC2 4N90A 1HDKA 1OFNA 1YXWA 3AP4A 1Y9QA 4L2NA 3ZYIB 1OHFA 3PVBB 1JOJA 4XJZA 4HOOA 4CDUA 4D69A 4M3CF 3M2MA 4CDXB 2JD4A 4I0WB 4QM8A 2EAKA 2ZHMA 1NCRC 4LHLA 1EV11 2QQLA 5FPZA 1V00A 1W8HA 1E5RA 3KVBA 3Q8AA 5LBEA 3WW1A 1RB8G 4HBNA 5FY8A 2VOXA 2WNUB 4BQXA 4XUOA 3VBFA 3ENRA 3TWIA 1R1A2 4QKNA 2XUEA 4NROA 2EIDA 2OPWA 4BZ4A 5KC5A 3VZLA 3MIFA 1W28A 3JCIA 4GULA 4EYUA 3I3EA 4CPBD 1Q8OA 1J58A 4KWJA 1CX4A 3AFKA 5IT6A 3BB6A 4HVOA 3VD5A 1ULGA 2VMFA 3MO4A 5FUNA 1BXHA 1MZEA 4UFKA 2BTVC 2R1BA 4Y5Z0 4JKMA 5FPBA 4CEWB 3O1SA 3LDRA 4Q1RA 2ZGMA 1RTVA 4TTGA 3HD8B 4RGAA 3PVOA 2WT1A 3CQOA 3DXUA 2CSGA 1HXS3 4Z1VA 3ZSJA 4QXCA 2ZGQA 4ISQA 5T5PA 2VTXA 4P9IA 2ZABA 3SCGA 3H1WA 3H1MA 3MPPG 4N43C 3THPA 4NR1A 2PAEA 3LA7A 2Z5WA 1W6PA 2DUOA 3ABZA 5F3IA 3Q8BA 3ST7A 1LOAA 3M70A 1JZ5A 4OMCA 1F2NA 1VAVA 3H3ZA 1QY4A 1JZ4A 5FYYA 5EJ1B 3ZSMA 4H3WA 4S2HA 3OUJA 5ABJC 5IVYA 4FTSA 1UMHA 1GOHA 1S0GA 5FMDA 3W5MA 3D3AA 2HWD2 4OQ9A 1VAKA 3RPQA 2Q8DA 4RHV1 4QGNA 3C8XA 1JXNA 1PNGA 1SFPA 1W0PA 2R0FA 1QXJA 2MEV1 3F95A 4UT5A 1NG0A 5FYIA 1QJU2 1TME3 4WM8B 2J1VA 2DFBA 4QXBA 2EIEA 2JDPA 4IEUA 2WLQA 4JDMA 1UYPA 3RMXA 3S5QA 5A6YA 4A7ZA 2A6WA 2UU8A 4OZOA 4QU1A 3SCHA 2W52A 3LGRA 2DVDA 2ZACA 1V9U1 2XHKA 3ON7A 1XQNA 3ZYGA 1SLCA 3VBSA 1QXRA 5F3CA 3GJBA 1DZTA 5T52A 1KQRA 4CDUC 5IK7A 1O4TA 4NHMA 4Q0SA 4J1XA 4PDWA 1QNWA 4CYDA 1OUXA 1PGW1 5HI0A 5JUVA 1NYWA 1NX9A 3HR9A 4ZU5A 5IK5A 4NHXA 4OZXA 3VBFC 2ADDA 4N7IA 4P02B 4YVSA 4DZGA 3M3QA 5CAZA 4OUEA 3DGTA 1LULA 4BK4A 2YC4A 3ZXKA 1N1TA 5FZ0A 5LCWL 2JEMA 1O3RA 5ACA3 4WM7B 3UETA 4ZHNA 4P5YA 1QOSA 1NCQB 2JWPA 1YQCA 3OEBA 2X05A 3SLIA 1RHI3 1AR73 5JSPA 4LT5A 1SEFA 3TNQA 4RQPC 5G04L 4IV1C 3ZXFA 4FP2A 5FZKA 4QXKA 1AR63 1SG3A 3MIBA 2VVEA 2ZOEB 2A70A 1RUF3 2RV9A 3OYWB 4LBOA 4NHLA 1MEC1 4AGGA 3ME2A 4CP2A 3MFCA 3O1OA 1BLZA 1F15A 2JDUA 2W94A 4XBLA 1VMFA 3CJIA 1ENSA 2TBVA 3EQEA 1JHNA 2P4EA 5GZGA 2CAUA 3OY8B 2HWB3 4AHZA 1K5MA 3VZJA 1OFSA 2A75A 3O1VA 5CG8A 1CZSA 5CKQA 1D2QA 2R042 4W50A 3UYJA 1V6KA 2WRAA 3H1YA 4B7EA 5A6QA 1C8M2 4HN0A 1VRH1 4E4DX 3RMYA 5EQUA 4RR3C 2EXKA 2MPFA 1VMJA 2DCTA 2VC9A 5A3PA 4JCKA 4XBQA 1BVVA 3MZHA 1JUIA 2AUYA 3O0WA 3H7YA 4C91A 1W6OB 3AKTA 5EYYA 3ZM8A 1D2SA 1NUKA 3N35A 2Y6FA 4AI3A 3NRUA 2J1UA 5CFCA 3KMHA 2JB4A 3VBSC 4FT8A 2PHTA 4JDNA 4MGYE 5FY4A 3VDCA 2GMMA 1COV2 2VNOA 2WS91 3M3CA 4FXKB 1S55A 3AP9A 4OMDA 3MLKA 4PDWC 4BIFA 3RZMA 3SNMA 5KXCA 2OUHA 1R64A 3JXSA 1H8TA 2D3SA 4D6SA 3LWCA 3I2KA 3FLPA 4Y24A 4DY5A 2ID4A 1ZZ9A 1DQ0A 4C0BA 1J84A 1RUI2 2OZJA 2ZX4A 2EIBA 2WUHA 1IS3A 3M8LA 2RS51 4NOTA 2BQPA 2Y6KA 2UYBA 1VBA2 3PMSA 4EROA 4E4SA 3WF3A 1TME2 1R1ZA 2LRPA 3D8CA 4CPBA 3LOBA 2ZMLA 3G7DA 4Q0PA 4IETA 4Y1ZA 4F3JA 3BI3A 4TN7A 2XJTA 3ZXDA 4LA2A 4JDOA 1APNA 4P9YA 3U11A 1PO21 2CDOA 1W04A 1Y9MA 2QQJA 2YMZA 4Y5TA 2GNDA 5FKBA 1XNAA 3CF6E 1B09A 4XF3A 5FO9B 4RYDA 3EHKA 1HB4A 4E2QA 2X09A 3GBWA 4FPHA 3CJIC 2WFF2 2D40A 2YGMA 4EQVA 1G9CA 3HIFA 1K5MC 3QH7A 1G86A 4K8RB 5HXVA 4XTMA 2GMPA 1UIKA 2ZMNA 3PTRB 2GSYA 1ULOA 3MV01 4WBBA 3RDIA 4DEQA 3AM2A 3V56A 1V6LA 2ARAA 3LPGA 2EAAA 3IIAA 1GWMA 3PHMA 4AQTA 3WG1A 2CDPA 1MS0A 4AFAA 3N36A 4RSUA 2ZAHA 1RIRA 2B8MA 1ZM1A 1ZZ6A 1AYN2 4LK6A 2Q0AA 1V0AA 2ZGLA 4QQ2A 4YZ4A 2TNFA 4OI4A 2NP0A 3BKZA 1UY4A 3UNPA 3TEZA 1ZX5A 2BZDA 2UY9A 5J3UA 5E88A 5FLHA 4GWJA 4QKDA 3S0MA 3OUHA 4KI5M 1CIWA 5IFPA 4ZZ5A 3QBQA 2FCVA 4QQOA 3E5QA 2ZEWA 3AZZA 4Z92B 3ZFFB 1TNRA 1H8TC 1W6QB 4UW3A 2W08A 1NAEA 3USUB 4D8MA 1VBC1 1WW6A 1GQHA 3IBMA 3SKVA 4AFMA 1I9RA 2JIGA 2OT7A 5E1RA 1IPKA 1REDA 2HWC2 4UYBA 2Z69A 4QU2A 1M4WA 4QB6A 5AC93 3AKSA 4K1YA 3GJAA 4BDVB 3SMHA 1GR3A 4X6RB 1U5YA 4KGGA 3WNNA 4CUGA 5C9AB 3VUOA 5T55A 1AR93 4R8HA 1PM4A 1W6MB 2PFWA 3AMMA 5BY5A 1UX7A 2UWCA 2LM3A 4N9HA 2PHLA 1T6BX 4MH0E 1FMD1 3R6SA 4AK3A 4AXOA 1PMJX 1QXPA 2WABA 4GB32 4AG4A 2OVUA 1KJLA 4TYSA 2Z4FA 1NT0A 1TMF1 4NPRA 4B1LA 5KR7A 3UKVA 1TEIA 5K0UC 2QQWA 1LHUA 1WCSA 3HQRA 3WVJA 1LNSA 1XPWA 4N53A 4QB2A 3JD72 2HWF3 2J1SA 2QQIA 1H1AA 2P6HA 2D3RA 2YY1A 4AYUA 4CRQA 1GWKA 2ZHLA 3ZOIA 4DXZA 4E8CA 1NXD1 3BOPA 2RS32 4N43B 3NNFA 1UY3A 2JDMA 1WA4A 2WA4A 3I3DA 3IWZA 4OULA 2Y0IA 1LOBA 2Y6JA 3LPFA 2HEVF 5FUPA 3VL8A 1AF9A 1AX2A 2RG4A 1W2AX 4W8JA 5GLUA 1DU3D 5D1IA 2RJ2A 3WNKA 1EV12 1CQ9A 1CJDA 2E26A 3GYDA 4K20A 1MPXA 4LUKA 1ENRA 4ES9A 4MGSA 2VJXA 1GMMA 4KQ7A 1BCXA 1PK6A 1LHOA 3T1MA 4AAPA 1RVF1 4YW2A 3SEEA 4ZXKA 5E8AA 1QEXA 1B35B 4Q4Y3 3ZYFA 3AYCA 1I5ZA 2QCSB 1JYWA 3V0AA 1DF0A 2WQ4A 1DYKA 1F8VA 3PURA 4I3PA 2WNUA 2YPJA 3KCYA 5GZCA 5EV7A 4R9DA 1RUOA 1WMDA 5C5UA 1G9BA 3IAPA 1ULCA 4CCJA 1GICA 2VZPA 2GC1A 4Q4W3 1UNBA 4XFGA 4Y1VA 4YLZA 1X7NA 5CU1A 3KQRA 4YW1A 5ERLA 4CE8A 4GMP1 1AYM1 1FPN2 3D0JA 4NN0A 4BISA 1FOD1 3O5SA 2ATFA 4CEWA 4KBZA 5JZGA 5J96B 4QM9A 1IGOA 3VBFB 1D7PM 3INAA 1GZ9A 3POYA 1CZTA 4GD4A 1QIQA 1JYVA 2V5YA 2KD7A 4QGLA 3DXTA 3OG2A 1REFA 3OPZA 3M3EA 1VALA 3WT3A 4CUBA 4IUGA 1W8FA 4XC9A 3J9SA 4E9KA 4HANA 1SPPB 2DF7A 2FCTA 2O1QA 2WO3A 3WR0A 5CFDA 2QQOA 4PIZA 1HRV3 4M00A 2VY0A 4Q4V3 1NKGA 1FV3A 4N53C 2NM1A 1UXZA 5IFTA 2IXLA 2ZKLA 2B4KA 2IXHA 4I30A 1ASJ3 2AYHA 1XJAA 2JE8A 1XXNA 1S2BA 2DFCA 4MHUA 1LEDA 1HJGA 3HVDA 3VGIA 1FYUA 2ARCA 3VD7A 4A6OA 1V9U2 1Q8QA 2VECA 4OVEA 1W6PB 4UFJA 2UURA 4LHNA 1W8UA 4C0HA 1R081 4AVSA 2JKXA 1WBFA 4BHPA 5JMOA 1PGW2 5FZLA 3VLBB 1T2XA 2VU9A 4Y1XA 5DG2A 1FAYA 4Y3OA 5DG1A 3UL2A 2RM21 3LFMA 1C8NA 1PGL2 1W8OA 3VD9A 1D4M3 2R061 2R7EB 4B29A 4CDXC 5HCHA 1RMU3 1ZZBA 4Q0UA 1QWRA 2EXJA 5JI7A 4XAAA 1ACCA 2WNUC 2VUAA 4NRQA 1OPMA 2QKDA 4JHTA 1GU3A 4FPGA 1CPNA 4LBLA 2QTWB 5FOJB 2J7MA 1UQXA 2CY6A 2WWJA 3VBSB 2QJVA 3U4SA 4X8PA 2R49A 1U5IA 2W1WA 5T5JA 5C8CA 3BGAA 2D6NA 1FXZA 1SZBA 1JOPA 1MZFA 3VDDA 1NCQA 1PIV2 2ETEA 3FL7A 3NJZA 4CEWC 2WLPA 4DMIA 3BPZA 3JQXA 3AMHA 1MS1A 4XBNA 3ALQA 3GZUC 1Q8SA 4YVSB 3DPRA 4IE5A 1S4CA 1AX0A 2JD9A 3PNAA 3W59A 2JG9A 5FFOC 1YJKA 2ET1A 1XSQA 2Q8OA 5KHKA 1JW6A 3UV9A 4A4AA 4LJHA 4XIKA 1QJY2 1RUE1 3ZDSA 3AJYA 3ACIA 3WP6A 3WW2A 4UXAA 5JLVA 3QOPA 3B9CA 4GAZA 3VDBA 2ZHNA 2D6PA 1OC1A 3POFA 1GV9A 1S2KA 1W2UA 3A21A 4OI2A 2E9QA 2GN3A 2R073 5A1FA 4AZZA 3CKHA 1A34A 1ZREA 1WMXA 4ASLA 4DXSA 3ILFA 1YWKA 4LO7A 1Y43B 4EE2A 4AGRA 1UZZA 1QJX1 4NIHA 4WM8C 1TVGA 1GWLA 1ZBA3 2ZAAA 1AR82 3HBKA 2KR2A 2AC1A 2BYVE 3CJIB 1US2A 4R9AA 3T0AA 1QOTA 2ZX3A 2ORXA 1LOCA 1YFYA 5FZGA 1VBD1 2UWBA 1N1YA 4D6QA 1U12A 1UAIA 2WS92 2J22A 4HFSA 3I7DA 2WSUA 4JKKA 1HW5A 4M0NA 3S30A 3ZFEA 2LROA 3FBYA 2NQYA 3J7HA 1VBE1 4QPWA 3IDAA 2DCKA 1S0IA 3U78A 2OS2A 3B02A 3BYWA 4L8QA 1NZIA 1TNFA 2VXJA 3F2ZA 4XURA 4FAGA 1R093 5LB6A 1U5ZA 5FZ9A 1BBT1 4Y20A 1XE8A 2F4LA 5IWFA 4GZ9A 2BPA2 4LKSA 2A3WA 3WOGA 4Q4V2 3GHNA 1V6NA 3POBA 4B4PA 1UPSA 2BFUS 1ASJ2 3OGSA 1ZBE3 4XTPA 4AHYA 2QZ2A 3T2OA 5CFCB 1JZ6A 1GLHA 1BVP1 5LASA 4NHYA 5FMOS 1VBB3 1C3HA 4WM7C 2GNMA 2JIJA 5C8CC 1YI9A 3EYPA 5JXIA 1JZ8A 1PO22 2WINB 5LRSA 3B00A 1NCQC 4WVVA 1V6MA 4OYUA 4CXYA 3VL9A 4MGQA 3CU7A 1K3IA 2VCBA 3BU7A 3QLQA 4DOUA 2RVAA 5A3UA 3J4UH 2XR4A 2D5HA 1QNYA 1VB4A 3UJQA 4AVCA 5EHDA 4QD2A 4LMFA 4XMIA 3ZIWA 5LBBA 5J36A 2IC1A 3MYXA 2XKPA 3DKQA 2WZR1 1K45A 2QDNA 4XW3A 1HQWA 1EAH1 4KWUA 5AVAA 3N7LA 3Q8EA 4MOAA 4PCRA 1FNYA 2W47A 2RMU1 2XH6A 4LBQD 1RUC3 3TOJA 1W90A 5DZFA 4COUA 4XEZA 2Z79A 3ZPOA 1VMHA 2GH8A 2BFUL 2R6QA 3OB8A 1QJEA 2Y0OA 3WG4A 1POV1 1Y4WA 4XF0A 1R1A3 5FMOL 2B45X 4B3NA 4EN7B 3POIA 3UGFA 2VNGA 3APBA 3GCXA 3POWA 1OF3A 4FPFA 4BQYA 4Y22A 1GANA 3GXUA 2WKKA 3JUUA 4JQRA 5A32B 3WY6A 5C3RA 4GALA 4BWOA 5B2GB 3AB0A 4IEXA 5F6KA 3TN91 2G19A 3ETPA 3X29B 1JZ7A 3GNEA 4LE3A 4WVMA 5FLIA 2WNOA 4IE7A 2PXJA 2WYSA 3H7JA 4XQWA 2QQUA 4YG3A 5C70A 4PHZA 1RUG1 2YV8A 5FBJA 2OPKA 2ZGRA 4JHZA 2JKBA 3HNMA 4Y33A 3ATGA 2H6CA 3J7NA 2IFWA 3RI9A 2VW2A 1UW8A 2ENRA 1DZQA 1E57A 5JPNB 1MZ5A 1FMD2 5B4XA 3ACFA 3B5LB 5C9AA 3N7MA 5LZ6A 5KHHA 5FZ4A 2WC2A 4JGZA 4R4XA 4MGKE 3DL3A 4P9WA 4XF4A 1O4YA 3B9IA 1SLAA 1TMF2 3FFZA 4MGIE 4CSWA 4XUNA 2HWD3 3UKTA 1ZRIA 5FDBA 3K75B 1OQEA 3THTA 2VMEA 2E6VA 4TSVA 2ZKNA 4BCUA 3LOIA 5C8WA 1QJU3 2DYCA 4C1XA 3R4SA 4GKXA 5CA6A 4IEOA 3SH4A 4A45A 1RHI1 1SFNA 4F8AA 3PUQA 4AQSA 1GP6A 1MVQA 3BPSA 5FZ3A 2C24A 3PUSA 3NV1A 4IGPA 2XBO2 1AR61 2QUOA 3E1F1 1RUF1 2BWAA 4FP3A 1UOFA 2PQQA 3MW3A 5H9RA 1WA6X 1S0BA 3HN1A 3N4MA 1ZYBA 1SACA 1VPHA 1MQTA 4N53B 2NZ9A 4GJZA 2XJSA 3N9LA 5E6HA 4BK5A 3D5OA 4LITA 3C7EA 3WQBA 3T30A 2PHXA 1AJOA 4JC1A 5F2SA 3UGGA 3ZFFC 5FZ7A 3OGVA 3KHBA 4YPJA 4V2VA 5I8TA 1ZRDA 3VHNA 4AR2A 2F4PA 4ZY9A 4FOVA 2VCCA 1V6JA 1XYPA 1C1LA 4HKWA 1UKRA 1AYM2 1SCSA 2I07B 2VAUA 2DBNA 4FI9A 4RN5A 1XU2A 3KV9A 2PLV2 5JSOA 1WD4A 4XFIA 4AFBA 5IATA 5EWSA 1EPZA 4AE2A 5HBAA 2VZQA 3POGA 2CTVA 4NUBA 3KV5A 3ZN6A 1PK6B 1JYIA 3WHTA 1XNKA 4K1ZA 5FZFA 4IEWA 3OD0A 3V0AB 2IUWA 3C2UA 5C9AC 5GLVA 5A80A 4BMBA 4LNVA 1X9PA 4K6BA 2ZGPA 5JI9A 2R043 1UL9A 2W0XA 4EN9B 4QAWA 5JAXA 1WD3A 5KC6A 1IQAA 3E5XA 3GALA 1GP4A 1KS4A 1C8M3 2ZGSA 3SH5A 1H2LA 1YJLA 1WZXA 4QB1A 4XJ8A 2ZXQA 5FQ0B 1BK0A 1S0DA 3LDKA 1IS5A 1SPPA 3RVHA 3CBNA 5JZGB 5LA2A 1ONAA 3ZR6A 2VPVA 1SLBA 1OA3A 4V2WA 1O7FA 2Y8KA 2ZEYA 2RR13 4LO5B 3WW3A 2AGSA 4LIVA 1COV3 4F83A 4NWWA 2HEWF 4XXPA 2D6KA 1NA1A 1RINA 1CWPA 1EUTA 4LULA 4JGYA 1YNAA 4TLFA 3T4VA 5CFDB 4FTBA 4DUXA 3C3VA 4P5HA 3IDCB 2QQNA 3HT1A 3CO2A 2B7YA 1ZA4A 1GP5A 3QH6A 4RGGA 4XJUA 5GLTA 2VL4A 1RUI3 4CP0A 3VZOA 4FVVA 3NV2A 1VJ2A 1XC6A 1JH5A 4KWLA 1PZ9A 1VBA3 2RS13 3ES1A 2BRTA 1AL21 3RFRA 1B35C 5EXOA 5I0RA 2KA3A 2VOVA 5BNPA 2VUJA 3ZO0B 1RUD2 2W95A 4MZUA 3FLTA 5JPMB 1XNCA 2OQ6A 4EN0A 1W2TA 1OOPA 4QX2A 2A7AA 4FFHA 3R0RA 1LESA 1PO11 5I0TA 1UKGA 2W91A 2WAAA 2PMWB 4W4ZA 3CMGA 5A33A 5IW0A 4HKOA 2VZOA 4OUMA 3WDUA 4YZ5A 1F4AA 3L2YA 3T3YA 2WFF3 2VD7A 1J83A 4LPLA 4RFRB 3U10A 5A70A 1C28A 1CAVA 1DGRA 3RWKX 3K51A 1N3QA 3RGBA 4EJRA 1IG0A 4YM1A 1LECA 3CJXA 2O14A 1H1MA 3MW4A 2OYZA 1SMVA 1RYYA 1UYYA 1O4ZA 3WF1A 5AC91 3FWEA 5A3NA 4Q8LA 5C8CB 5FO7B 5EFUA 3AK0A 3VDDB 1AYN3 5JSRA 5FZOB 4B1MA 2Y38A 3VBHA 1JYNA 4GMP0 3KT1A 4CU7A 1CAUA 1JS9A 3AC0A 2VZ1A 2VZ3A 4LK7A 4RGKA 1QJX2 3RSJA 3ZYBA 1X33A 5BNOA 3D4KA 3DF0A 3DPRB 4Z82A 1VLNA 3AYDA 3B3QE 1LODA 3WF4A 2W1QA 2JG9B
chains in the Genus database with same CATH topology
3M1HA 3HBZA 3NWKA 5FBZA 1AUYA 4OLLA 1S0CA 3E6DA 4PF5A 3VV1A 4KL1A 1VBE2 2CL2A 2DV9A 4CDQA 3OGJA 3WDWA 3IDEA 1BEV2 1V6IA 2HWF1 2I74A 3RJ2X 2P34A 1NE6A 2PYTA 1DGWA 4QHBA 1BBT2 2HWC3 2NLRA 3NV4A 3ZVXA 1BKZA 4COVA 4QPIB 1AXZA 2BNNA 4HVRA 2IXJA 4B8EA 4BOWA 4YG6A 3M4FA 2XJPA 5J09A 5KHGA 1RL3A 2ZX1A 1O3SA 4YYOA 3RNSA 2ZX2A 2FQPA 2WIIB 2SLIA 4GB33 3ZFEB 1LENA 1MACA 2RR12 5JOZA 4UBHA 1HRI2 4X8NA 1EP0A 2NMOA 4YGDA 1X36A 4ZU7A 2VULA 3IM0A 1QQP1 3KLSA 4Y20B 3WCRA 4XMAA 3JD73 3ZMNA 4X6QB 4OFGA 1Q8PA 2WZR2 4BH9A 3AP7A 1EAH2 4Q4W1 5BUVA 5SV8A 3ZPYA 4YVSC 2RS33 1IS4A 2GALA 4IL7A 2RMU2 4K9SA 3FUQA 2YUEA 2RS12 3RJRA 5FREA 1EV13 2Q1ZB 4S2DA 4XILA 5CBLA 3BODA 5GZEA 4OI1A 5IK4A 4HLTA 5KXEA 4DFSA 4YG0A 3QCWA 5L36A 2QZ3A 5AFEA 5JIUA 4CDWA 1X8EA 5DUVA 4LBKA 1AX1A 4A3XA 3WQ7A 3ZYRA 2VOWA 3TN92 5JCTA 4LR4A 5A32A 1FPN3 2FBEA 2ARXA 1RUG2 4XFBA 4AW7A 1DQ4A 2NYYA 1AHSA 2VXRA 4HN1A 2N7GA 5DUUA 1U5XA 3V64A 1DIWA 1OMIA 4AI0A 3NAPA 2UWAA 4IEQA 4Q29A 4Y22B 3VN4A 4EWEA 2PAKA 5CFCC 2E7TA 4GA9A 2A73B 1Z7S2 5H9SA 1H4GA 1Y3TA 1RMU1 5JMCA 4META 4WVMB 1JTZX 1OA2A 2MEV3 1QH6A 3TYJA 1KRIA 4IQPA 1LU2A 2IXCA 3GHMA 5FLJA 4KU7A 2RE9A 1N1VA 1RUNA 1GSLA 2D6OX 5IUQA 3J8F1 4INDA 1ENQA 1VP6A 3IN9A 1V9U3 1XNBA 4BE3A 1S0JA 1RUJ1 4MX3A 1WLCA 1LR5A 2GMEA 3JU9A 1UPIA 4JGZB 1HQLA 4OHYA 5FTTC 4A7KA 5D8AB 2E51A 2WQZC 1NOVA 1QKQA 2R0HA 1KJRA 1CPMA 4MXWA 4HKLA 1FV2A 4P14A 1OD5A 3D0SA 1DQ5A 4GH4B 4JV4A 2PTMA 1N47A 2WT2A 3WV6A 1MVEA 2GC3A 4E2SA 3B7MA 3I59A 4R9CA 2VMHA 3DV8A 1YHFA 2DVAA 5DDJ1 3LA2A 3A4UA 5C33A 1YFUA 5DXDA 1AXKA 3KT4A 1NQDA 1UF2C 1OLQA 5JOWA 1YFWA 2ET7A 1YO8A 5SV5A 1XRUA 1WUVA 2E63A 1NE4A 2ZX0A 4OHWA 5I0SA 3ILRA 1PIV3 2W68A 1ND3A 1ZBA1 3ZN5A 3DUIA 3U4XA 5GZFA 4AHWA 2FZ2A 1F5FA 1MQTB 4D7YA 4OI0A 3KD4A 4M3CB 2W39A 2XVGA 4K8FA 4DRRA 3WCSA 3NAPC 1POV0 1UN1A 3AMNA 4C1WA 4EWAA 3WDVA 1NZCA 4Q0VA 3VZNA 2GZWA 3O0VA 1KITA 3VBRB 1QJY3 2BVBA 4FPOB 4HT1T 4XZPA 1J3QA 1FI2A 1NXMA 1PVC1 1UMZA 1LOGA 1VRH3 4MLOA 4UBGA 1KS5A 5T50A 3KGZA 2EXHA 3L9JT 4I2OA 2MHFA 2EVXA 2PHDA 2CGOA 4GWMA 5T5LA 3ZN6B 4XE9A 5FQ0A 1VBB1 1WLDA 3NW4A 3WUDA 3BALA 4AQ6A 1AR83 4BA6A 1HLCA 5F6LB 1AXYA 2JE7A 4D7TA 3OCPA 5BNQA 1BZWA 2WS93 1LCLA 5LEKA 4UW5A 3GZAA 3GF6A 5BPXA 1VIWB 1LGBA 1IKQA 1LEMA 2EA7A 2R16A 1LOFA 2ZPXA 4RHV2 1FX5A 2VW1A 3AYEA 4G3YC 4XJAA 1RUC1 3JB4C 1PNFA 2HKXA 2MEV2 1AL22 3VBUA 3KGLA 3TAYA 1QHDA 2TEPA 4M0HA 2QE3A 3HAGA 3LA3A 1PMIA 2A71A 4ZU4A 1PO23 5KHJA 1OI6A 1NA1B 2HJIA 2PHUA 3VKNA 4JGYB 1ND3C 1R1A1 1PO12 3WG3A 4HPKB 3WZ1A 3FJSA 1RUH1 3ZIXA 2ZGUA 5FRAA 1LRHA 1YI7A 4FQ4A 5L7OB 1PK6C 4R9BA 1QMJA 4LHKA 2RJKA 4AQ2A 2R1DA 4DY3A 5BNPB 1H2MA 3WP3A 2CNAA 2QVSB 4BMEA 2WZPP 3AKPA 1OOPB 3M3OA 5LEJA 4B4RA 3L2HA 4BYYA 4K7JA 4EV0A 2LALA 5A33B 3NSTA 5BXXA 4C90A 5JZGC 1CAVB 3D82A 1MEC2 2HWD1 4G4FA 3EXUA 4HSLA 4Q8KA 2XG3A 4HMZA 3AX4A 2B39A 2ZJCA 3MI8A 4AEDA 4GQ7A 5CB7A 2HWE1 4GXLA 1N3PA 2B46X 3MW2A 1YIPA 5CFDC 3RRDA 4Q4X1 3VBHB 1CAUB 1DZRA 1VRH2 5BNOB 1VAMA 3VBUC 3VKLA 1Q3EA 3PVEA 2MNGA 4COZA 2X5IA 1WW5A 5FOBB 2VMIA 3POSA 1FMD3 4QPIA 4I09A 1D4VB 4IERA 1UIJA 3AXEA 4OHXA 5CADA 4K3UA 3W58A 3IPVA 4CDQB 4LTAA 1BYHA 1TMF3 2D44A 1ZRCA 2XUMA 3JBG1 1QQP2 1EYBA 5CIRA 2EALA 3R05A 1HKDA 2A3YA 3U07A 2ZA9A 1LHNA 4FOYA 3B94A 5DUWA 2K9ZA 2PHFA 1HQNA 2XJUA 4YM2A 3SITA 1MZ6A 1ZZ8A 2RS52 2X29A 4XOGA 1J3RA 4QQPA 4IXLA 2XBO3 2XKOA 4PJYA 4YNIA 2XGXA 4KG0A 3AP6A 5E16A 2XVLA 3EJKA 4BLJA 1RVF3 4UW4A 3E6BA 3MEPA 3VDDC 1G7YA 4WVWA 1Z0HA 1QF3A 2E7QA 2C5DA 3NO8A 2XWJB 4XQ4A 1IHMA 2BNOA 1JYCA 3DPRC 3VKFC 1C8M1 4XETA 2VQ0A 2D43A 2JG9C 4L97A 1Z78A 4Q0QA 2KXLA 5LK7B 3VKMA 4OHZA 3AMQA 5C4WB 4FAHA 4GMP3 1AYM3 1XU1A 4HK8A 1BJQA 2PLV3 1IOAA 2R30A 3RZZA 3IKWA 3WINE 4OHVA 4XF9A 1HXS1 3MF9A 4LBMA 2X5IC 1GQGA 1COV1 1DHKB 4QPIC 3MF6A 4CDWB 3AZXA 4N9IA 1U0AA 4SBVA 3RG0A 1MS5A 2XVKA 1JN2P 2AH2A 2AREA 4ORFA 3ZFEC 3WDYA 1NY71 2B9UA 1VBA1 1YRZA 1VBC2 3AXDA 1TME1 3VZMA 1CR7A 1X82A 4BLIA 2GU9A 3V0BA 4E27A 1W0OA 5LRRA 3J8F2 3UKNA 1AL0G 5CVRA 4DS0A 2UYAA 3NAPB 1A8DA 2BBVA 1RUJ2 2D6LX 4MUVA 1PGSA 2BEOA 3ZFGB 1GNHA 2XLAA 4XFFA 4Q2FA 1CN1A 1CJPA 3WD5A 2WFF1 1AZDA 2R063 4CP1A 5I93A 1H8VA 3ASIA 4ITCA 3VBOA 2DTWA 3NKGA 5D8AA 4QPGA 2X8KA 3GZTB 2Q4SA 2CAVA 2ZS6B 3WQ1A 3B01A 2ZHKA 5DDJ2 2ZZJA 5KHIA 2ZGKA 5ACA1 4GH4A 3VZKA 2O0OA 1O91A 3AFGA 3P3PA 2BGCA 1AYN1 1FT9A 1RUD3 1AR71 1JUHA 2I2SA 2QDRA 4YGBA 2B42B 4JTNA 1ALYA 4Q26A 2E53A 4MXWB 2VW0A 4CZSA 3TRSB 4MYEA 2WA3A 3I59B 3DKWA 1XNDA 3PTYA 4AI2A 3KCXA 4Z8BA 3ZMOA 1RVF2 3G6JB 2HWB1 2XLFA 4M3CA 3W9AA 3IT8A 4COWA 5BNNA 3NL1A 1J1TA 1WLTA 2EXIA 1PVC2 4XXAA 4H7MA 3HQXA 3B93A 1PZ8A 4AVAA 4AEKA 1T6GC 3VBRA 3Q9OA 3ZN4A 1ENXA 4QQHA 3ZSLA 3WUCA 4W65A 4AFDA 3AYAA 1N1SA 2P37A 1PVXA 1ND3B 1ULFA 1YCIA 1SQ4A 2JG8B 4P9LA 4Z07A 5BV6A 1QJX3 1ZRRA 1OQDA 1Q8VA 4QPYA 1FOD2 3V65A 3QACA 5ABJA 4CEYB 1H2NA 1AVBA 4O9EA 4AEMA 3WDTA 4YGCA 1ULDA 1LGCA 2WNEA 4YZ3A 1OA4A 1ZZCA 3AZYA 5KXBA 3ZYJB 1VBE3 2A5ZA 4YVWB 2VMGA 2BNMA 1DQ2A 4WZFA 1BEV3 5GKAC 1LTEA 2YXSA 3JD71 5H9PA 4DPNA 4JGZC 1MS9A 2PHWA 1J1LA 5H9QA 3KM5A 1BBT3 4QPGC 5D8AC 4XFHA 3RYKA 2CWMA 1PM7A 1KXGA 1TQ5A 3FC0A 2NPIA 2EIGA 1GZWA 4ZKTB 3S7IA 5A3MA 2DCZA 4WZCA 4GH4C 1UD1A 1SDWA 3LSDA 1IPJA 3ACLA 2VQAA 2ZCWA 1OKQA 1HV1A 5CG9A 2IXIA 4PLMA 4DQAA 5DUXA 1IZ3A 1O5LA 1HRI3 1WGPA 4FPLA 1R082 1C57A 3WQ0A 4COYA 1RUH2 4LBQA 3H9AA 1PHMA 1DGLA 2YDEA 2C1FA 1RITA 2RM22 2WZR3 4HL0A 1WW7A 5I91A 2R062 1EAH3 1MQTC 4HPKA 3VBUB 3PVNA 5GLWA 1YUDA 3UJOA 5BNNC 1V6OA 2RMU3 3H50A 4RQPA 4IV1A 5L7OA 1FPN1 1A8MA 1NLSA 4NHKA 3VBRC 1JBCA 4FCAA 2OA2A 2SBAA 3RYPA 2BWCA 1SCRA 4YARA 4MGZE 4Y26A 1POV3 1QDCA 4O9GA 1SBFA 4JTOA 4N7UA 5L19A 1UCXA 4KG8A 5F9TA 1RC6A 1SFYA 1C5IA 2WNVA 3RQ0A 3FUOA 2WSVA 4RR3A 2DCYA 3KCCA 5FAXA 3TN93 2D7FA 2HWE2 4AEJA 1RUE2 4B4QA 3ZXAC 3BIWE 1RUG3 3OJBA 3A0NA 4Q4X2 1C1FA 4U2AA 4DRVA 1EY2A 1H30A 4LUMA 1G9DA 2DVBA 2E7AA 2P2KA 1AR91 1LGNA 1H9WA 4AI1A 3MPBA 3PLQA 2ILMA 1ND2B 2DCJA 2OIIA 4KGQA 1YLLA 3CNAA 3A0KA 1O5UA 3CEWA 2ES3A 4RS5B 1PGL1 1Z7S3 1VBD2 3JBG2 4AEDB 2DUQA 3PJQA 4LEJA 1XYNA 1NA1C 2I45A 4KU8A 4JGYC 2A6VA 1Q5OA 4D3WA 3N7JA 5JOXA 2AZ5A 1G9AA 1DDLA 2DVGA 3AZWA 2X5IB 3T1LA 4L99A 5L7OC 1BMV1 2PELA 1S0EA 4Y1YA 1IS6A 1PIV1 1WLWA 1X50A 1FNZA 4YZ2A 3IPVB 4BM8A 1H1IA 1W39A 4V1PA 2ZGOA 4AVTA 4WV8A 5BNPC 3CLPA 4YGEA 4QT6A 1GKBA 1C4RA 2FZ1A 1OOPC 3VHOA 2FHRA 4LBNA 1QJY1 2JXAA 1UZYA 4Q4Y1 2WNVC 3O7OA 3WW4A 4JAAA 1CD3G 2JENA 2HEYF 2GDFA 1CONA 2UY8A 2V73A 2CV6A 1QJZA 2JDZA 4PBOA 3OTFA 1CAWA 3ZXJA 1HV0A 2O8QA 4YFZA 1CGPA 2VNRA 3MDPA 1AR81 1DGRN 1HXS2 4XPVA 5C4WA 2JX9A 1MS3A 4XHBA 3LCPA 3ZYPA 2YC0A 4Y4YA 5KBFA 2GH2A 2IXKA 3KB5A 3VBHC 5BNOC 1BK1A 1DQ6A 3WX5A 2P3KA 3MIGA 4AHXA 2XJQA 2OW4A 4MVTA 4ONUA 1M06G 4DNYA 2WJSA 5GZDA 4TZDA 1RJ7A 1HRV1 1NY72 1REEA 3RI8A 1H0BA 2JJ6A 4Q4V1 4W6WA 4CDQC 3R4DB 2H6BA 3K48A 3FX3A 3I54A 1A3KA 3O12A 5EZWA 1ASJ1 1H4HA 3KSCA 3VHPA 3GBFA 5I8YA 4MXVA 5CNAA 1WBLA 3AJZA 3JQWA 3ZSKA 2CGNA 1H2KA 5K0UA 3SHRA 4I0AA 1QOOA 3JB8A 2VGDA 4J6GA 3ZFGA 3NVCA 4F7ZA 2VH9A 5EJ3A 2NMNA 3I2DA 1D4M1 1KFUL 3M3IA 3WXPA 4B7KA 1CAXA 4P9XA 4RHV3 3V0BB 4IV3B 1S0FA 4I3GA 4FPEA 2ZMKA 1AL23 1UU5A 1UX6A 3RWNA 5ACA2 1NQJA 2DURA 3OD4A 3P3NA 3O14A 4YW5A 1H9PA 4FSJA 2FMDA 1RHI2 1AR72 3S6PA 4BQ1A 1VR3A 4E2GA 3CL1A 5AVPA 2D5FA 1MS4A 4M01A 1PO13 1AR62 1G6NA 5C4WC 3HMYA 1DG6A 2F6BA 3MICA 1RUF2 2LUWA 3MGUA 3VBOB 4ES8A 4QPGB 3OGGA 3MIEA 2JECA 4RFT0 4M3CE 1ZRFA 3MIDA 2HWB2 1F5JA 4CDWC 3O0XA 3MLJA 2A6YA 4FPYA 5A3LA 1I6XA 1NCRB 4HETA 4S2FA 3WLUA 3EO6A 4FOQA 3FBMA 2YGLA 5HCAA 4LLFA 2JE9A 2R071 1O3TA 2Q1MA 1MR5A 4JRLA 4RA0A 1L3JA 3MIHA 4J1WA 3AKRA 3E5UA 2C9AA 1YYNA 1DQ1A 4EN6B 2ZZQA 1SLLA 4XDQA 4AGVA 3BTAA 2JG8A 2KM2A 4DB5A 1W6NB 4YW4A 1MEC3 1WMEA 1KDKA 4FPCA 5BNNB 2XB6C 1DLLA 4Y1UA 4CEYA 1AJKA 2G4IA 2YYOA 2RHPA 3ZFGC 4D7SA 2X53S 2IZWA 3MFAA 4YVWA 5JVVA 1R091 3NKTA 2OUJA 1VB2A 1A78A 2D97A 1OPOA 5HCFA 1F31A 3UK9A 2A6ZA 3J26N 2XBO1 1I1EA 3BCWA 4R4ZA 5ABJB 1CVNA 4XF1A 3SXWA 1ZBE1 4HSJA 1HX6A 1LHWA 4URTA 4FXGB 4FO9A 4HZFA 4D94A 1MS8A 2Q30A 2ZBJA 4CDXA 1LU1A 5J48A 2CGPA 1QQP3 4KNCA 2PN5A 5LK5A 2R32A 5F5QA 4YSFA 1J3PA 4ATEA 3AKQA 3VKOA 3I8TA 2K0GA 4BIOA 5KWRA 4HK9A 3KS7A 2CWSA 1GZWB 2DU0A 4G9SB 5E89A 4CDUB 2PA7A 1FATA 2RS53 1QDOA 2PLV1 5DZGA 2D6MA 5HCBA 3GBGA 3RYRA 4NWVA 5BYNA 2Y26A 5DZEA 2WFPA 4L9BA 3AP5A 3QD6A 2DTYA 3R4UA 3HT2A 2P3IA 1D0HA 4H7LA 4LBQB 3KZ4C 2NN8A 3H0OA 4K21A 3FMGA 3TBDA 2JG8C 1O3QA 2XPJA 3ELNA 4I0BA 5GM0A 3IMNA 5JOYA 3PJYA 2GC2A 3OBRA 2GAUA 4CEYC 4RQPB 4IV1B 3ZX7A 3LB9A 2ARBA 1GYKA 4DINB 4YM0A 2LTNA 4YVWC 4L11A 3VHRA 2Q5TA 3B69A 4EN8B 2GNTA 4WM8A 3I4IA 4JVAA 5AC92 4ATFA 3FFQA 4QQLA 1YIFA 1XYOA 5AFBA 2K2SA 4AF9A 1AR92 1NLRA 2DU1A 4LBJA 2BUKA 3AMPA 2BW8A 2VG9A 2WNVB 3WP5A 2XJRA 3U0ZA 3WDXA 4RR3B 2OZ6A 1F9KA 3ZSEA 4XJ9A 5T5OA 5JDBA 4JRAA 1ND2A 2JICA 1SBEA 3URFA 5GLZA 2ZTNA 3M7AA 2QFEA 3LAGA 4RS5A 5C6CA 1VBC3 1QJU1 2HWF2 3HWJA 5J98B 3JZVA 2D98A 2XJVA 4I02A 4FPKA 3J8F3 3TB0A 4AWDA 1LOFC 4XHXA 1C5HA 1RUD1 3LKJA 4WM7A 3T2TA 2G9GA 1BMV2 1RUJ3 4PDWB 1DGWX 5L73A 4AVVA 3OF1A 4MSVA 1LJ7A 2CYFA 3D6EA 1X8MA 1SBDA 3FE5A 2P3JA 2YROA 3OYWA 4LO6B 3E97A 1EPWA 4GKYA 4YW3A 4GIQA 4Q4Y2 1GBGA 2RJLA 2H0VA 3DN7A 3E6CC 2EF6A 3OY8A 1ZZ7A 1URXA 2XL7A 5DDJ3 3EBRA 4Q27A 4AVBA 3WP4A 2WL1A 4NO4A 4HVQA 2O8OA 4IEVA 4Q4W2 2Z2SB 1N3OA 3N3HA 4XIOA 2P17A 4RD7A 1LHVA 4LO8A 3S7EA 4W6XA 4W6YA 1K5MB 3ZXLA 1W6OA 2ERFA 5I0UA 3ES4A 3PMEA 1WMFA 1BEV1 4PLOA 5JR7B 4LE4A 5KXDA 3FZ3A 1Q56A 4YRDA 2R041 2AENA 3ILNA 1PVC3 4AI8A 1ND2C 4GWNA 5JIAA 1UU6A 1HRV2 4KBBA 3SCFA 2YZ4A 4RS5C 1OQ1A 5TSWA 5FO8B 1CAWB 1S1AA 2QNKA 4LO4B 4AEDC 2XLGA 5IK8A 2XWBB 2BVVA 3WG2A 4QMAA 2WT0A 2GNBA 2WWSA 2ZGTA 3SH3A 4L92A 2PHRA 4EWDA 2FMYA 4U36A 1FOD3 3MLLA 3LZZA 3TNPB 2IWGB 3IDBB 4TWTA 3WHUA 2RR11 1KDMA 1H8TB 4PLNA 1HRI1 4QX5A 1KD7A 4YM3A 2D93A 1D4M2 5T3NA 1RMU2 4H14A 2HYKA 1RUI1 4PIXA 3AZVA 4Q1PA 5EYXA 4FQZA 2RS11 2G9FA 4AFCA 2A6XA 1IKPA 1LOEA 1KFXL 4XFAA 3NV3A 2Z42A 4IV3A 3FLRA 4SLIA 5K0UB 1D0GA 3H8UA 2XL9A 1DYPA 4R52A 4H55A 3KT7A 2QQPA 4ASMB 1LB2A 1QU0A 3RS6A 1R083 5J7MA 1GFF2 1RUH3 1SLIA 2VVDA 2VVFA 1XE7A 4XJWA 3USSA 3H3UA 4P9GA 1ULEA 1CAXB 4E4ZA 4Z2WA 2RM23 4WVZA 1WW4A 1PZ7A 1RGSA 4A2UA </