2QE7H

Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MATVQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRIKQGDKETLIAVSGGFLEVRPDKVNILADTAELPEEIDVERAKKAKARHETILKRLDKTDKDYLRHKRALERAEVRLQVANSKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha
publication title The Structural Basis for Unidirectional Rotation of Thermoalkaliphilic F(1)-ATPase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 30
structure length 135
sequence length 135
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2qe7H02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2qe7H01
1IFPA 1BSNA 5FL7H 3PJSK 5DN6I 1BSHA 2V7QH 2XNDH 2E5YA 3OAAH 1H8EH 3OEHH 2JDIH 4QMAA 1E79H 2W6JH 1FS0E 1JEKA 2E5TA 4DJGA 4ASUH 4WVZA 2HLDH 4TLFA 2RQ7A 2QE7H 3EFFK 2RQ6A 3OE7H 3OFNH 2WSSH 2CK3H 3USSA 2XOKH 3FKSH 1AQTA 4YXWH
chains in the Genus database with same CATH superfamily
3CWBG 3L72J 1QVFO 1OFCX 1Y47A 1GL2A 1ZP0C 3OEHH 1Q7YQ 5B5EH 1BGYD 2WTYA 4YPCA 4H0LC 1FZCC 3C8VA 3BCCE 3CCJP 3PH0A 3AE4C 1LT1A 1NTMD 2G8YA 3HUSB 2E42A 3V4WA 1GL2B 1DEEG 1N73C 5AW7B 5BVZA 1GZLA 2OYIB 1LTJA 3E7KA 3R4YA 1KQSO 5KTBA 1KQFB 2D2CD 3MP7B 1HGVA 1L0LJ 5AW0B 1JO5A 3V2RA 1EZVG 3D71A 3BATA 2BCCG 5CJ0A 5B66E 1A02J 1J1EB 1LTJB 3L74D 2IBZD 5E79H 1X8YA 3G3ZA 1Q81Q 5AVSB 3GHGC 2WPVB 2M5AA 1BE3G 4YTPC 3KHUA 1SQXE 2WMMA 1PP9D 1QGKB 2AXTE 1AQ5A 3P8CE 4H0LD 2RKLA 1KB9D 2N9YB 1KD1Q 4Y28J 1PGJA 3SWYA 4HB1A 4IFMA 3A0BH 1SQQE 3TF5A 1RF0A 1NTKK 2K37A 2R5DA 1LP1A 1VF5D 2NPSA 3CX5D 2W6BA 1PPJE 1D7MA 4PV1B 4U7JA 2HLDH 3CCSP 2E76B 4H0LB 2E75C 2AEMA 1KYOE 3AEDC 1BCCG 4R4MA 2R3CA 3H32A 2NPSB 3AE1C 5K5GB 1QVGO 1AJYA 5CCHC 5CHXA 4N78D 1VF5B 3BCCJ 4DOJA 4IL6H 4DCKA 2HYNA 1S5LH 3H32B 3B71A 3PRJA 3CD6P 2IFMA 3H1JD 2P10A 3HRNA 1IFPA 1YJ9P 3L4FA 3LIEA 5FL7H 3L70D 5AW8B 3RBZA 3BASA 1EXIA 3Q1MA 3W67A 2L91A 1HJ0A 2FYUG 1P84D 3L75D 2E75D 5KAFE 2IZ1A 1FZGA 2VRSA 1USEA 2WSCH 2Q9IA 1NHLA 4WY4C 5AVZB 2RQ7A 1NOHA 5CJ4A 1HBWA 1SQXJ 1OZHA 3RGUA 5AVVB 5CCHD 1LTTC 1KB9H 3CWBE 1VQ7P 4EDFA 1LGHB 1USDA 1YTZI 1ZMEC 1NTZD 5KKZB 4W7ZA 1YTZT 4IOIH 3RK3C 2R3SA 2Q3EA 2YXQB 1RE4C 3H1HG 4XE5B 1KILC 1H8EH 3AEBC 3M0DC 3TYYA 2WSEH 1K04A 4Z1MH 2QE7H 2KZIA 2O3JA 1K05A 2CPBA 3TGUG 1FDOA 5APTA 1RHZB 2FYZA 3IFMA 4WY4D 1MUUA 4DZOA 2YO3A 3G9RA 1SQVD 2HLOA 3OE7H 1EDJA 2M3BA 2Y9YA 3TDKA 3L36A 4ASVA 4HH2A 1GU5A 1QL2A 3G4SP 2GUSA 3RK3D 5KAFH 4I2LC 4BRYA 4DJGA 2JP3A 1EDIA 2FYUK 1KILD 4YXWH 2JKVA 1NVOA 3CC7P 3FXEA 1N7LA 1J2JB 3A2AA 1UIXA 3A5TA 4BRYB 1RE3A 4B86A 2IYOA 1JOCA 2JJLA 3V6IA 1NTKJ 1S1CX 1K73Q 3E1RA 3CWBJ 4GDOA 2ZT9C 1BCCE 4HJGH 3II6A 4OVNF 1VQ6P 5TISE 1URQA 4UB8H 4W80A 3CCEP 2AEJA 2K9JA 2A06G 1HH0A 1N2DC 1BGYG 4ZKUA 1L0NG 2K1AA 3GF3A 1OW7A 4OGQC 1S5LX 4I7ZB 2KZJA 2M8RA 1URQB 1LTAC 1NTMG 2E74C 3RK2D 1SQPD 2LR2A 1JB0J 2K9JB 3AEEC 2BCCJ 1NWQA 3EWKA 3M9QA 2Y0EA 1FZBA 2IPPA 2HG5D 1JY3N 1VQKP 1VQ9P 3CXHI 1SP4A 1NAYA 2UWJE 1RF1C 1CSBA 1JM0A 2ZT9D 1LTBC 1BE3J 4JF7A 4NPEA 3RK2B 4NPDA 1T3UA 2IBZG 4KHXA 2KNCA 3A0HE 1NO4A 1PGOA 3W68A 1JY2N 4W7YA 1XTCC 4JYBA 3D6YA 1PP9G 1SQQG 1HGZA 1NGMB 4OGQD 5BU8B 2P67A 3MD0A 2ZT9B 3H1HE 1PPJG 4M3LA 2KNCB 1H89A 1RQUA 2E74D 3KYQA 5TISH 3WMM0 1JEKA 5B5EE 1VQPP 1GTWA 1S9KD 1L0LD 3L71J 1BCCJ 2QJKB 2ZFCA 2N9BA 3CX5I 1PIXA 2OQQA 1DD3A 1L0NK 5KLVG 4OGQB 1YBKA 1SQBD 3WU2E 4C7NA 4L75A 2POHA 1WRGA 1NTMK 1GW4A 2C0WA 3MZWB 1YIJP 1JCDA 2WSFH 1J1DB 1UIIA 2QJYB 2ZYDA 4ZNCA 1FJKA 1GU4A 1OX3A 1Q86Q 1VDFA 3B5NC 1M7LA 4C7NB 4D6TG 2BASA 5CCGC 2QG4A 1RF1B 1DH3A 1LTSC 4AUWA 2QSIA 3A0HH 3GF7A 1HTLC 1E79H 3O6QA 3M9HA 1OVUA 2FYUJ 3RL0C 3SWKA 2OYHA 4XFJA 5CMZA 5AW5B 3VP9A 2W6AA 3CC4P 2DW3A 1IFDA 3A0BE 3L70G 3HUSA 1EQ7A 2PGDA 3G6EP 1SQQK 3PJSK 3CCQP 2KLUA 2I1KA 2GA1A 3A3YB 1P84I 2OYIA 1N7SC 3O6QB 2RN0A 4I6MC 4ASUH 1BDDA 1BDCA 2OYHB 3QH9A 3IN6A 3BCCD 2ZJSE 1NH4A 5KAIE 2V4HA 2A06E 3B5ND 1LJ2A 1BGYE 1NTZG 1L0NE 2LKMA 3OAKA 4H44D 3WU2H 5CCGD 2W6JH 4JYCA 3OJAB 5KLVK 3TNUA 3CXHD 3AECC 1Z56A 1NTME 2C0XA 5AW4B 4KT0J 4IL6E 1VQ5P 3TGUJ 5AW3B 5AW1B 3RL0D 3HD7D 1S5LE 2CPSA 3F5HA 5AW9B 3HD7A 3TNUB 4H44B 3NXSA 2Q3IA 1WMKA 3L73G 2K9YA 3Q5RA 2D2CB 2QJPC 1N7SD 2Y9ZA 1SQVG 3L74E 2JDIH 1IFMA 2IBZE 1FZFA 1QLED 2FXOA 2BEZF 2QVAA 3HD7B 2FBWC 1VQMP 2FXPA 3Q2YA 1FZCA 3CMEP 5TJHA 4MN4C 4U3FG 1SS1A 1PP9E 1X22A 1NU1D 3F89A 3TK1A 1KB9E 3PP5A 1N73A 1KQGB 2N1TC 1N7SB 2NRGA 1JY3O 1FZCB 1IFJA 1MZ9A 2YNYA 5KAIH 3I55P 2E5YA 1VQ8P 1W2BO 4K35A 1N73B 1NTZK 3ABVC 2WZ7A 5KLVE 4XA4A 3H1KD 1JY2O 3JCUH 5KLIC 2XOKH 4N3YB 3GHGA 3RBXA 2B9BA 1JMBA 2HR3A 1BGYJ 2W83C 1L0NJ 2KLVA 1N86A 3MUDC 3U1CA 1XTGB 4N78E 3CXHH 2MJZA 1GW3A 4TLFA 2HFED 2KS1A 4EI2A 1NTMJ 4D6TE 3GHGB 3JC22 1H88A 4KJMA 4AQRD 5DN6I 2N1TD 2QJPB 3MGNA 4ZKPA 4Y99C 1SQVK 1SQPG 1FJPA 2KS1B 2ZYAA 4K3AA 3FWLA 1QL1A 1PGQA 1VQOP 1VQLP 1NYHA 3VN0A 1VL2A 3NTNA 1NTKD 3L70E 2A45I 3CWBD 2O01J 4IFDK 5EFWB 1P84E 2QRXA 3O8ZA 5CCHA 1SVFA 2WSCJ 1VQNP 1JTHA 1Q2NA 2WSSH 1FDIA 1SQQJ 2NZ2A 2E75B 2KYVA 5AVUB 3CX5H 4DT0A 2Q7CA 1KV4A 5APXA 1NTZE 4L76A 5AVWB 4UB8E 1FOSE 1JTHB 3KZIE 1IK9A 3R2PA 3L37A 2B87A 3AE7C 1EZVD 3CCUP 1YQ4C 2BCCD 2LXBA 2WSEJ 5KLVJ 1AVYA 2XNXA 1IC2A 4WY4A 1GK6A 5APSA 3H25A 2E43A 1BE3D 2B87B 3L73E 3KXDA 3L35A 1SQBG 3V4QA 2BEQD 4WBAA 1ZRTD 4RESB 1SQVE 5AVRB 3VOPA 3OFNH 4D6TJ 4WY4B 1SQPK 3LW5H 3P8MC 3QWOC 1RE4A 1LWUC 2YKQA 4U3FE 2OTLP 3V5BA 2GM4A 1SFCC 1YJWP 1P84H 1KILA 5KJ7C 3IAOA 2Q5UA 3M0DA 2FYNC 2WVRA 4PD4D 1K8AQ 1KILE 1KMIZ 3AEFC 3RK3B 4GIFA 3L70J 2IDBA 4BWNA 3L71D 2V7QH 2M0BA 1BCCD 3G71P 1YYCA 1NKZB 1KILB 1YI2P 4WVZA 2Z5HA 1HWTC 1R5SA 2I8DA 3H1ID 4LLHA 3KZIH 3BVHA 3N7NA 4A7PA 2XNDH 1U57A 1IZNB 1NTZJ 2FFDC 1K9MQ 1RQVA 1LTGC 3CCLP 5APUA 3HTKA 1Y8AA 1SFCD 1FZAA 4L74A 1L2PA 3VYIA 1VPCA 2M3EA 1SQBK 3PTZA 2R5BA 2FYUD 3H1LD 3EFFK 1SQPE 3HTKB 2MKVA 3L73J 1G2CA 1X9VA 3M91A 3L72D 3MHVA 3L74G 3AE5C 3AE2C 1SFCB 1SQVJ 1L4AC 1Q90D 2ZXEB 4BXLA 4GOFA 1LT9C 2FYNB 1M1JC 2QA4P 4U3FJ 1G2CB 4JPZB 2O1JA 2YKPA 1ZN5A 4ZMDA 1FZEA 2YIUC 2FXMA 1T3JA 2WT7A 2QM7A 3AE9C 3S4RA 1AFOA 1NU1G 3BRTB 2XKMA 3GG2A 1QX8A 1U7JA 3CCMP 3EQ2A 3OAAH 2ITAA 3TGUD 2XZRA 2WT7B 5DJTB 1IFIA 3CCRP 4WWIA 4C7RA 3I5CA 5H2FH 1S9KE 1KYOI 2E74B 1RF1A 1W2EA 1HF9A 2JO1A 1L4AD 3H6PA 2WITA 1SQBE 1OXZA 3H1KG 2Z5IA 1R5LA 1Q82Q 1JMMA 3NMDA 2A45H 1TU3F 2WSFJ 3N4XA 3OA7A 1IFNA 1J1EC 1LTJC 3H1JG 3S9OA 2IX7C 3JSVC 1L4AB 1HUCA 1SQPJ 3SSUA 1ZR4A 3E1IA 3L75G 2L5GB 3GLMA 3EFGA 3D6ZA 3V2PA 5CBNA 3I56P 3U59A 2W90A 2OARA 1NU1K 3H1HJ 1OVVA 2P1JA 2A06D 2O1KA 4PV1C 2C9NY 1L0ND 2H43A 1OVRA 2KXPB 2SPZA 2H89C 2E76C 1RH5B 3B5NA 2KOGA 5CCGA 1RF0C 1FC2C 4R4LA 3JCUE 5AW6B 3WUTA 2KSJA 1G1IA 1OW6A 2IFNA 2HPCA 1KN7A 2NPSC 2Q6QA 1U7MA 3A7OA 4OWFA 3FX0A 3GMAA 4HKZH 1VF5C 3B4SA 1DEBA 5AW2B 2JWAA 3CXHE 3M9BA 3Q3DA 3WUUA 1YQ3C 3B5NB 3M06A 5APVA 1GK4A 3VMAA 2B89A 1T6AA 1EZVI 1SQXD 2HPCB 1KZUB 1M56D 2IYPA 3MTUE 4WB4A 5GTHH 4GKGA 1OIPA 1SQBJ 5CBOA 2XDJA 3V2QA 3P8CD 1CW5A 1N7SA 1ZV8A 2RH0A 4GT1A 4O9BA 3CPWO 3RL0B 1IO4A 4UB6H 3VTPC 4L73A 1SQQD 2W8ZA 4PV1D 2P7JA 5M1BA 3T97A 1S3JA 2E76D 1PPJD 2WQYC 1YITP 1NAFA 1HJBA 4NPFX 1AV1A 2NPSD 2M5AB 2OTKE 2B88A 3FGAD 1VQ4P 1IK7A 1NU1E 1KYOD 2H7HA 3T97B 1S72P 3AE6C 3CX5E 2WPRA 3VMXA 3CL3D 3MIWA 1S4XA 5KKZC 1M1KQ 2JEEA 2E5TA 5KLVD 4PD4I 3NFQA 3BRVB 4GODA 1MFZA 4JQ0D 2W27A 3KDPB 1CZQA 1M8OB 1MKMA 3L71G 1AA0A 1LP1B 4JBZA 1OW8A 1M57D 2QIWA 4QMAA 3H1IG 2WPSA 5DJUB 5L8RJ 2I1JA 4RJTA 2FY8A 2K88A 3H1KE 3CCVP 3B8EB 3FXDA 4D6TD 1ZXGA 4AYCA 2QEXP 3AE8C 1BSHA 5B66H 4EIJA 1EDLA 2FKWB 2RMZA 3C1LA 3VMYA 1PZQA 3KQGA 2HODA 3S1KA 3H1JE 2PAJA 1PV3A 1FAVA 2N1TA 1MFTA 1X0TA 4IFFA 1GD2E 2ZVOB 1OMIA 1KORA 1KC8Q 2O01N 2YKOA 2A45G 2AXTH 2O01H 2P58A 1LNQA 4RO0A 3L74J 2OGUA 1T2KC 3H1LG 2LXCB 3L75E 2HODB 4TT3H 3Q5PA 3VMZA 1KQLA 4GOEA 2N1TB 2WPQA 1AVOA 1CI6A 2R32A 3L72G 4EOTA 1PP9J 1NTKE 3RL0g 1FE6A 4I1LA 1JCCA 3P32A 2IZ0A 3MUDA 3IR9A 1JUNA 4YXDC 1ZW0A 3ITKA 3ZDMA 3IF4A 1CI6B 1EDKA 1KYOH 1NU1J 5KLIB 1JNMA 3PHLA 3FWNA 3LIDA 5BU5A 1GMJA 1FOSF 1ZLLA 1OWAA 1RE3C 4C46A 2ZXXA 4RKUJ 1L0LG 1EC5A 1NKNA 2YMKA 3C9IA 2PRRA 1T2KD 3CI9A 1EZVE 3L73D 2OTJP 5GTIE 2BCCE 4I7ZC 2PP6A 1YJNP 1URQC 4Y99B 1S2EA 5APQA 3GW6A 3TSIA 3H1KJ 3AEAC 2KK7A 2C9LY 1PFIA 1BE3E 4U3FD 1ZRTE 3UIAA 2OYOA 3H1JJ 3RK3E 2J59M 1YHQP 1EXJA 2H8PD 4H13C 1JY3P 3CMAP 3LW5J 4N6JA 2Q1KA 1W5CE 3RK2C 5AVXB 1FU1A 3P7KA 3L75J 4PJ0E 1IJDB 4CPGA 3HE4A 4PD4E 4ASWA 1JY2P 1WT6A 3HE5A 3L71E 1URQD 2V7QJ 3AEGC 2ZYGA 2Z4EA 1ZR2A 1NJIQ 1Y9BA 3BCCG 3H1IE 3HE4B 1FDMA 3SWFA 5H2FE 3HE5B 1L0LK 2QJKC 5KJ7D 2YXRB 3SFEC 5GTIH 4IL6X 1LWUA 4H13D 1SFCA 5KJ7A 2GUVA 2KUBA 2YO2A 5APWA 2KIKA 5C39A 3PLNA 1AQTA 3VP8A 1J1DC 2QJYC 1PGPA 2WWWA 1M90Q 1KTMA 2H88C 1LWUB 3KPEA 2YMYA 2AXCA 1FS0E 2FYUE 3M0AA 3H1LE 5APYA 4H13B 4LC1A 1SQXG 4LGDE 3K5BA 2KB7P 2KI7B 3L72E 3CC2P 1KFNA 2P2UA 1DD4A 3H1HD 4HYTB 2IBZI 3WUVA 4PJ0H 2JWDA 2FFDA 4PD4H 1SLQA 1GDTA 3FKSH 2Y0CA 5AVYB 1QEXA 3CLQA 2R44A 5AVTB 1KB9I 1PL5A 2OYHC 2FFDB 3V2NA 1X79B 1HVVA 1FBMA 1H0TA 1R8EA 3HUSC 1L0LE 1BSNA 1KFMA 2KP8A 1DX7A 1GL2C 2G3AA 3TGUE 2JR8A 1RY3A 2OYIC 2XV5A 3SFDC 2KSEA 2AEFA 4EYYQ 2XU6A 1H8AA 1MV8A 1L4AA 1LTIC 3H1IJ 1LT9A 2RQ6A 3USSA 1H0TB 2ZVNB 1M1JA 1A02F 2PFXA 3AE3C 1N8RQ 2K3RA 3Q5SA 3OW2O 1G1JA 2QM8A 5GTHE 2Y0DA 5E79E 4H44C 1LT9B 3D70A 2CK3H 2D2CC 1M1JB 4UB6E 1SQXK 2ZAEB 4OH8B 2YIUB 3H1LJ 5AVQB 3HD7C 1ZOYC 1DIPA 2J5UA 1T8ZA 1GL2D 3U1AA 2J58A 1NTKG 1E5WA
chains in the Genus database with same CATH topology
1IFPA 1BSNA 5FL7H 3PJSK 5DN6I 1BSHA 2V7QH 2XNDH 2E5YA 3OAAH 1H8EH 3OEHH 2JDIH 4QMAA 1E79H 2W6JH 1FS0E 1JEKA 2E5TA 4DJGA 4ASUH 4WVZA 2HLDH 4TLFA 2RQ7A 2QE7H 3EFFK 2RQ6A 3OE7H 3OFNH 2WSSH 2CK3H 3USSA 2XOKH 3FKSH 1AQTA 4YXWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFP A;  1BSN A;  5FL7 H;  3PJS K;  5DN6 I;  1BSH A;  2V7Q H;  2XND H;  2E5Y A;  3OAA H;  1H8E H;  3OEH H;  2JDI H;  4QMA A;  1E79 H;  2W6J H;  1FS0 E;  1JEK A;  2E5T A;  4DJG A;  4ASU H;  4WVZ A;  2HLD H;  4TLF A;  2RQ7 A;  2QE7 H;  3EFF K;  2RQ6 A;  3OE7 H;  3OFN H;  2WSS H;  2CK3 H;  3USS A;  2XOK H;  3FKS H;  1AQT A;  4YXW H; 
#chains in the Genus database with same CATH topology
 3CWB G;  3L72 J;  1QVF O;  1OFC X;  1Y47 A;  1GL2 A;  1ZP0 C;  3OEH H;  1Q7Y Q;  5B5E H;  1BGY D;  2WTY A;  4YPC A;  4H0L C;  1FZC C;  3C8V A;  3BCC E;  3CCJ P;  3PH0 A;  3AE4 C;  1LT1 A;  1NTM D;  2G8Y A;  3HUS B;  2E42 A;  3V4W A;  1GL2 B;  1DEE G;  1N73 C;  5AW7 B;  5BVZ A;  1GZL A;  2OYI B;  1LTJ A;  3E7K A;  3R4Y A;  1KQS O;  5KTB A;  1KQF B;  2D2C D;  3MP7 B;  1HGV A;  1L0L J;  5AW0 B;  1JO5 A;  3V2R A;  1EZV G;  3D71 A;  3BAT A;  2BCC G;  5CJ0 A;  5B66 E;  1A02 J;  1J1E B;  1LTJ B;  3L74 D;  2IBZ D;  5E79 H;  1X8Y A;  3G3Z A;  1Q81 Q;  5AVS B;  3GHG C;  2WPV B;  2M5A A;  1BE3 G;  4YTP C;  3KHU A;  1SQX E;  2WMM A;  1PP9 D;  1QGK B;  2AXT E;  1AQ5 A;  3P8C E;  4H0L D;  2RKL A;  1KB9 D;  2N9Y B;  1KD1 Q;  4Y28 J;  1PGJ A;  3SWY A;  4HB1 A;  4IFM A;  3A0B H;  1SQQ E;  3TF5 A;  1RF0 A;  1NTK K;  2K37 A;  2R5D A;  1LP1 A;  1VF5 D;  2NPS A;  3CX5 D;  2W6B A;  1PPJ E;  1D7M A;  4PV1 B;  4U7J A;  2HLD H;  3CCS P;  2E76 B;  4H0L B;  2E75 C;  2AEM A;  1KYO E;  3AED C;  1BCC G;  4R4M A;  2R3C A;  3H32 A;  2NPS B;  3AE1 C;  5K5G B;  1QVG O;  1AJY A;  5CCH C;  5CHX A;  4N78 D;  1VF5 B;  3BCC J;  4DOJ A;  4IL6 H;  4DCK A;  2HYN A;  1S5L H;  3H32 B;  3B71 A;  3PRJ A;  3CD6 P;  2IFM A;  3H1J D;  2P10 A;  3HRN A;  1IFP A;  1YJ9 P;  3L4F A;  3LIE A;  5FL7 H;  3L70 D;  5AW8 B;  3RBZ A;  3BAS A;  1EXI A;  3Q1M A;  3W67 A;  2L91 A;  1HJ0 A;  2FYU G;  1P84 D;  3L75 D;  2E75 D;  5KAF E;  2IZ1 A;  1FZG A;  2VRS A;  1USE A;  2WSC H;  2Q9I A;  1NHL A;  4WY4 C;  5AVZ B;  2RQ7 A;  1NOH A;  5CJ4 A;  1HBW A;  1SQX J;  1OZH A;  3RGU A;  5AVV B;  5CCH D;  1LTT C;  1KB9 H;  3CWB E;  1VQ7 P;  4EDF A;  1LGH B;  1USD A;  1YTZ I;  1ZME C;  1NTZ D;  5KKZ B;  4W7Z A;  1YTZ T;  4IOI H;  3RK3 C;  2R3S A;  2Q3E A;  2YXQ B;  1RE4 C;  3H1H G;  4XE5 B;  1KIL C;  1H8E H;  3AEB C;  3M0D C;  3TYY A;  2WSE H;  1K04 A;  4Z1M H;  2QE7 H;  2KZI A;  2O3J A;  1K05 A;  2CPB A;  3TGU G;  1FDO A;  5APT A;  1RHZ B;  2FYZ A;  3IFM A;  4WY4 D;  1MUU A;  4DZO A;  2YO3 A;  3G9R A;  1SQV D;  2HLO A;  3OE7 H;  1EDJ A;  2M3B A;  2Y9Y A;  3TDK A;  3L36 A;  4ASV A;  4HH2 A;  1GU5 A;  1QL2 A;  3G4S P;  2GUS A;  3RK3 D;  5KAF H;  4I2L C;  4BRY A;  4DJG A;  2JP3 A;  1EDI A;  2FYU K;  1KIL D;  4YXW H;  2JKV A;  1NVO A;  3CC7 P;  3FXE A;  1N7L A;  1J2J B;  3A2A A;  1UIX A;  3A5T A;  4BRY B;  1RE3 A;  4B86 A;  2IYO A;  1JOC A;  2JJL A;  3V6I A;  1NTK J;  1S1C X;  1K73 Q;  3E1R A;  3CWB J;  4GDO A;  2ZT9 C;  1BCC E;  4HJG H;  3II6 A;  4OVN F;  1VQ6 P;  5TIS E;  1URQ A;  4UB8 H;  4W80 A;  3CCE P;  2AEJ A;  2K9J A;  2A06 G;  1HH0 A;  1N2D C;  1BGY G;  4ZKU A;  1L0N G;  2K1A A;  3GF3 A;  1OW7 A;  4OGQ C;  1S5L X;  4I7Z B;  2KZJ A;  2M8R A;  1URQ B;  1LTA C;  1NTM G;  2E74 C;  3RK2 D;  1SQP D;  2LR2 A;  1JB0 J;  2K9J B;  3AEE C;  2BCC J;  1NWQ A;  3EWK A;  3M9Q A;  2Y0E A;  1FZB A;  2IPP A;  2HG5 D;  1JY3 N;  1VQK P;  1VQ9 P;  3CXH I;  1SP4 A;  1NAY A;  2UWJ E;  1RF1 C;  1CSB A;  1JM0 A;  2ZT9 D;  1LTB C;  1BE3 J;  4JF7 A;  4NPE A;  3RK2 B;  4NPD A;  1T3U A;  2IBZ G;  4KHX A;  2KNC A;  3A0H E;  1NO4 A;  1PGO A;  3W68 A;  1JY2 N;  4W7Y A;  1XTC C;  4JYB A;  3D6Y A;  1PP9 G;  1SQQ G;  1HGZ A;  1NGM B;  4OGQ D;  5BU8 B;  2P67 A;  3MD0 A;  2ZT9 B;  3H1H E;  1PPJ G;  4M3L A;  2KNC B;  1H89 A;  1RQU A;  2E74 D;  3KYQ A;  5TIS H;  3WMM 0;  1JEK A;  5B5E E;  1VQP P;  1GTW A;  1S9K D;  1L0L D;  3L71 J;  1BCC J;  2QJK B;  2ZFC A;  2N9B A;  3CX5 I;  1PIX A;  2OQQ A;  1DD3 A;  1L0N K;  5KLV G;  4OGQ B;  1YBK A;  1SQB D;  3WU2 E;  4C7N A;  4L75 A;  2POH A;  1WRG A;  1NTM K;  1GW4 A;  2C0W A;  3MZW B;  1YIJ P;  1JCD A;  2WSF H;  1J1D B;  1UII A;  2QJY B;  2ZYD A;  4ZNC A;  1FJK A;  1GU4 A;  1OX3 A;  1Q86 Q;  1VDF A;  3B5N C;  1M7L A;  4C7N B;  4D6T G;  2BAS A;  5CCG C;  2QG4 A;  1RF1 B;  1DH3 A;  1LTS C;  4AUW A;  2QSI A;  3A0H H;  3GF7 A;  1HTL C;  1E79 H;  3O6Q A;  3M9H A;  1OVU A;  2FYU J;  3RL0 C;  3SWK A;  2OYH A;  4XFJ A;  5CMZ A;  5AW5 B;  3VP9 A;  2W6A A;  3CC4 P;  2DW3 A;  1IFD A;  3A0B E;  3L70 G;  3HUS A;  1EQ7 A;  2PGD A;  3G6E P;  1SQQ K;  3PJS K;  3CCQ P;  2KLU A;  2I1K A;  2GA1 A;  3A3Y B;  1P84 I;  2OYI A;  1N7S C;  3O6Q B;  2RN0 A;  4I6M C;  4ASU H;  1BDD A;  1BDC A;  2OYH B;  3QH9 A;  3IN6 A;  3BCC D;  2ZJS E;  1NH4 A;  5KAI E;  2V4H A;  2A06 E;  3B5N D;  1LJ2 A;  1BGY E;  1NTZ G;  1L0N E;  2LKM A;  3OAK A;  4H44 D;  3WU2 H;  5CCG D;  2W6J H;  4JYC A;  3OJA B;  5KLV K;  3TNU A;  3CXH D;  3AEC C;  1Z56 A;  1NTM E;  2C0X A;  5AW4 B;  4KT0 J;  4IL6 E;  1VQ5 P;  3TGU J;  5AW3 B;  5AW1 B;  3RL0 D;  3HD7 D;  1S5L E;  2CPS A;  3F5H A;  5AW9 B;  3HD7 A;  3TNU B;  4H44 B;  3NXS A;  2Q3I A;  1WMK A;  3L73 G;  2K9Y A;  3Q5R A;  2D2C B;  2QJP C;  1N7S D;  2Y9Z A;  1SQV G;  3L74 E;  2JDI H;  1IFM A;  2IBZ E;  1FZF A;  1QLE D;  2FXO A;  2BEZ F;  2QVA A;  3HD7 B;  2FBW C;  1VQM P;  2FXP A;  3Q2Y A;  1FZC A;  3CME P;  5TJH A;  4MN4 C;  4U3F G;  1SS1 A;  1PP9 E;  1X22 A;  1NU1 D;  3F89 A;  3TK1 A;  1KB9 E;  3PP5 A;  1N73 A;  1KQG B;  2N1T C;  1N7S B;  2NRG A;  1JY3 O;  1FZC B;  1IFJ A;  1MZ9 A;  2YNY A;  5KAI H;  3I55 P;  2E5Y A;  1VQ8 P;  1W2B O;  4K35 A;  1N73 B;  1NTZ K;  3ABV C;  2WZ7 A;  5KLV E;  4XA4 A;  3H1K D;  1JY2 O;  3JCU H;  5KLI C;  2XOK H;  4N3Y B;  3GHG A;  3RBX A;  2B9B A;  1JMB A;  2HR3 A;  1BGY J;  2W83 C;  1L0N J;  2KLV A;  1N86 A;  3MUD C;  3U1C A;  1XTG B;  4N78 E;  3CXH H;  2MJZ A;  1GW3 A;  4TLF A;  2HFE D;  2KS1 A;  4EI2 A;  1NTM J;  4D6T E;  3GHG B;  3JC2 2;  1H88 A;  4KJM A;  4AQR D;  5DN6 I;  2N1T D;  2QJP B;  3MGN A;  4ZKP A;  4Y99 C;  1SQV K;  1SQP G;  1FJP A;  2KS1 B;  2ZYA A;  4K3A A;  3FWL A;  1QL1 A;  1PGQ A;  1VQO P;  1VQL P;  1NYH A;  3VN0 A;  1VL2 A;  3NTN A;  1NTK D;  3L70 E;  2A45 I;  3CWB D;  2O01 J;  4IFD K;  5EFW B;  1P84 E;  2QRX A;  3O8Z A;  5CCH A;  1SVF A;  2WSC J;  1VQN P;  1JTH A;  1Q2N A;  2WSS H;  1FDI A;  1SQQ J;  2NZ2 A;  2E75 B;  2KYV A;  5AVU B;  3CX5 H;  4DT0 A;  2Q7C A;  1KV4 A;  5APX A;  1NTZ E;  4L76 A;  5AVW B;  4UB8 E;  1FOS E;  1JTH B;  3KZI E;  1IK9 A;  3R2P A;  3L37 A;  2B87 A;  3AE7 C;  1EZV D;  3CCU P;  1YQ4 C;  2BCC D;  2LXB A;  2WSE J;  5KLV J;  1AVY A;  2XNX A;  1IC2 A;  4WY4 A;  1GK6 A;  5APS A;  3H25 A;  2E43 A;  1BE3 D;  2B87 B;  3L73 E;  3KXD A;  3L35 A;  1SQB G;  3V4Q A;  2BEQ D;  4WBA A;  1ZRT D;  4RES B;  1SQV E;  5AVR B;  3VOP A;  3OFN H;  4D6T J;  4WY4 B;  1SQP K;  3LW5 H;  3P8M C;  3QWO C;  1RE4 A;  1LWU C;  2YKQ A;  4U3F E;  2OTL P;  3V5B A;  2GM4 A;  1SFC C;  1YJW P;  1P84 H;  1KIL A;  5KJ7 C;  3IAO A;  2Q5U A;  3M0D A;  2FYN C;  2WVR A;  4PD4 D;  1K8A Q;  1KIL E;  1KMI Z;  3AEF C;  3RK3 B;  4GIF A;  3L70 J;  2IDB A;  4BWN A;  3L71 D;  2V7Q H;  2M0B A;  1BCC D;  3G71 P;  1YYC A;  1NKZ B;  1KIL B;  1YI2 P;  4WVZ A;  2Z5H A;  1HWT C;  1R5S A;  2I8D A;  3H1I D;  4LLH A;  3KZI H;  3BVH A;  3N7N A;  4A7P A;  2XND H;  1U57 A;  1IZN B;  1NTZ J;  2FFD C;  1K9M Q;  1RQV A;  1LTG C;  3CCL P;  5APU A;  3HTK A;  1Y8A A;  1SFC D;  1FZA A;  4L74 A;  1L2P A;  3VYI A;  1VPC A;  2M3E A;  1SQB K;  3PTZ A;  2R5B A;  2FYU D;  3H1L D;  3EFF K;  1SQP E;  3HTK B;  2MKV A;  3L73 J;  1G2C A;  1X9V A;  3M91 A;  3L72 D;  3MHV A;  3L74 G;  3AE5 C;  3AE2 C;  1SFC B;  1SQV J;  1L4A C;  1Q90 D;  2ZXE B;  4BXL A;  4GOF A;  1LT9 C;  2FYN B;  1M1J C;  2QA4 P;  4U3F J;  1G2C B;  4JPZ B;  2O1J A;  2YKP A;  1ZN5 A;  4ZMD A;  1FZE A;  2YIU C;  2FXM A;  1T3J A;  2WT7 A;  2QM7 A;  3AE9 C;  3S4R A;  1AFO A;  1NU1 G;  3BRT B;  2XKM A;  3GG2 A;  1QX8 A;  1U7J A;  3CCM P;  3EQ2 A;  3OAA H;  2ITA A;  3TGU D;  2XZR A;  2WT7 B;  5DJT B;  1IFI A;  3CCR P;  4WWI A;  4C7R A;  3I5C A;  5H2F H;  1S9K E;  1KYO I;  2E74 B;  1RF1 A;  1W2E A;  1HF9 A;  2JO1 A;  1L4A D;  3H6P A;  2WIT A;  1SQB E;  1OXZ A;  3H1K G;  2Z5I A;  1R5L A;  1Q82 Q;  1JMM A;  3NMD A;  2A45 H;  1TU3 F;  2WSF J;  3N4X A;  3OA7 A;  1IFN A;  1J1E C;  1LTJ C;  3H1J G;  3S9O A;  2IX7 C;  3JSV C;  1L4A B;  1HUC A;  1SQP J;  3SSU A;  1ZR4 A;  3E1I A;  3L75 G;  2L5G B;  3GLM A;  3EFG A;  3D6Z A;  3V2P A;  5CBN A;  3I56 P;  3U59 A;  2W90 A;  2OAR A;  1NU1 K;  3H1H J;  1OVV A;  2P1J A;  2A06 D;  2O1K A;  4PV1 C;  2C9N Y;  1L0N D;  2H43 A;  1OVR A;  2KXP B;  2SPZ A;  2H89 C;  2E76 C;  1RH5 B;  3B5N A;  2KOG A;  5CCG A;  1RF0 C;  1FC2 C;  4R4L A;  3JCU E;  5AW6 B;  3WUT A;  2KSJ A;  1G1I A;  1OW6 A;  2IFN A;  2HPC A;  1KN7 A;  2NPS C;  2Q6Q A;  1U7M A;  3A7O A;  4OWF A;  3FX0 A;  3GMA A;  4HKZ H;  1VF5 C;  3B4S A;  1DEB A;  5AW2 B;  2JWA A;  3CXH E;  3M9B A;  3Q3D A;  3WUU A;  1YQ3 C;  3B5N B;  3M06 A;  5APV A;  1GK4 A;  3VMA A;  2B89 A;  1T6A A;  1EZV I;  1SQX D;  2HPC B;  1KZU B;  1M56 D;  2IYP A;  3MTU E;  4WB4 A;  5GTH H;  4GKG A;  1OIP A;  1SQB J;  5CBO A;  2XDJ A;  3V2Q A;  3P8C D;  1CW5 A;  1N7S A;  1ZV8 A;  2RH0 A;  4GT1 A;  4O9B A;  3CPW O;  3RL0 B;  1IO4 A;  4UB6 H;  3VTP C;  4L73 A;  1SQQ D;  2W8Z A;  4PV1 D;  2P7J A;  5M1B A;  3T97 A;  1S3J A;  2E76 D;  1PPJ D;  2WQY C;  1YIT P;  1NAF A;  1HJB A;  4NPF X;  1AV1 A;  2NPS D;  2M5A B;  2OTK E;  2B88 A;  3FGA D;  1VQ4 P;  1IK7 A;  1NU1 E;  1KYO D;  2H7H A;  3T97 B;  1S72 P;  3AE6 C;  3CX5 E;  2WPR A;  3VMX A;  3CL3 D;  3MIW A;  1S4X A;  5KKZ C;  1M1K Q;  2JEE A;  2E5T A;  5KLV D;  4PD4 I;  3NFQ A;  3BRV B;  4GOD A;  1MFZ A;  4JQ0 D;  2W27 A;  3KDP B;  1CZQ A;  1M8O B;  1MKM A;  3L71 G;  1AA0 A;  1LP1 B;  4JBZ A;  1OW8 A;  1M57 D;  2QIW A;  4QMA A;  3H1I G;  2WPS A;  5DJU B;  5L8R J;  2I1J A;  4RJT A;  2FY8 A;  2K88 A;  3H1K E;  3CCV P;  3B8E B;  3FXD A;  4D6T D;  1ZXG A;  4AYC A;  2QEX P;  3AE8 C;  1BSH A;  5B66 H;  4EIJ A;  1EDL A;  2FKW B;  2RMZ A;  3C1L A;  3VMY A;  1PZQ A;  3KQG A;  2HOD A;  3S1K A;  3H1J E;  2PAJ A;  1PV3 A;  1FAV A;  2N1T A;  1MFT A;  1X0T A;  4IFF A;  1GD2 E;  2ZVO B;  1OMI A;  1KOR A;  1KC8 Q;  2O01 N;  2YKO A;  2A45 G;  2AXT H;  2O01 H;  2P58 A;  1LNQ A;  4RO0 A;  3L74 J;  2OGU A;  1T2K C;  3H1L G;  2LXC B;  3L75 E;  2HOD B;  4TT3 H;  3Q5P A;  3VMZ A;  1KQL A;  4GOE A;  2N1T B;  2WPQ A;  1AVO A;  1CI6 A;  2R32 A;  3L72 G;  4EOT A;  1PP9 J;  1NTK E;  3RL0 g;  1FE6 A;  4I1L A;  1JCC A;  3P32 A;  2IZ0 A;  3MUD A;  3IR9 A;  1JUN A;  4YXD C;  1ZW0 A;  3ITK A;  3ZDM A;  3IF4 A;  1CI6 B;  1EDK A;  1KYO H;  1NU1 J;  5KLI B;  1JNM A;  3PHL A;  3FWN A;  3LID A;  5BU5 A;  1GMJ A;  1FOS F;  1ZLL A;  1OWA A;  1RE3 C;  4C46 A;  2ZXX A;  4RKU J;  1L0L G;  1EC5 A;  1NKN A;  2YMK A;  3C9I A;  2PRR A;  1T2K D;  3CI9 A;  1EZV E;  3L73 D;  2OTJ P;  5GTI E;  2BCC E;  4I7Z C;  2PP6 A;  1YJN P;  1URQ C;  4Y99 B;  1S2E A;  5APQ A;  3GW6 A;  3TSI A;  3H1K J;  3AEA C;  2KK7 A;  2C9L Y;  1PFI A;  1BE3 E;  4U3F D;  1ZRT E;  3UIA A;  2OYO A;  3H1J J;  3RK3 E;  2J59 M;  1YHQ P;  1EXJ A;  2H8P D;  4H13 C;  1JY3 P;  3CMA P;  3LW5 J;  4N6J A;  2Q1K A;  1W5C E;  3RK2 C;  5AVX B;  1FU1 A;  3P7K A;  3L75 J;  4PJ0 E;  1IJD B;  4CPG A;  3HE4 A;  4PD4 E;  4ASW A;  1JY2 P;  1WT6 A;  3HE5 A;  3L71 E;  1URQ D;  2V7Q J;  3AEG C;  2ZYG A;  2Z4E A;  1ZR2 A;  1NJI Q;  1Y9B A;  3BCC G;  3H1I E;  3HE4 B;  1FDM A;  3SWF A;  5H2F E;  3HE5 B;  1L0L K;  2QJK C;  5KJ7 D;  2YXR B;  3SFE C;  5GTI H;  4IL6 X;  1LWU A;  4H13 D;  1SFC A;  5KJ7 A;  2GUV A;  2KUB A;  2YO2 A;  5APW A;  2KIK A;  5C39 A;  3PLN A;  1AQT A;  3VP8 A;  1J1D C;  2QJY C;  1PGP A;  2WWW A;  1M90 Q;  1KTM A;  2H88 C;  1LWU B;  3KPE A;  2YMY A;  2AXC A;  1FS0 E;  2FYU E;  3M0A A;  3H1L E;  5APY A;  4H13 B;  4LC1 A;  1SQX G;  4LGD E;  3K5B A;  2KB7 P;  2KI7 B;  3L72 E;  3CC2 P;  1KFN A;  2P2U A;  1DD4 A;  3H1H D;  4HYT B;  2IBZ I;  3WUV A;  4PJ0 H;  2JWD A;  2FFD A;  4PD4 H;  1SLQ A;  1GDT A;  3FKS H;  2Y0C A;  5AVY B;  1QEX A;  3CLQ A;  2R44 A;  5AVT B;  1KB9 I;  1PL5 A;  2OYH C;  2FFD B;  3V2N A;  1X79 B;  1HVV A;  1FBM A;  1H0T A;  1R8E A;  3HUS C;  1L0L E;  1BSN A;  1KFM A;  2KP8 A;  1DX7 A;  1GL2 C;  2G3A A;  3TGU E;  2JR8 A;  1RY3 A;  2OYI C;  2XV5 A;  3SFD C;  2KSE A;  2AEF A;  4EYY Q;  2XU6 A;  1H8A A;  1MV8 A;  1L4A A;  1LTI C;  3H1I J;  1LT9 A;  2RQ6 A;  3USS A;  1H0T B;  2ZVN B;  1M1J A;  1A02 F;  2PFX A;  3AE3 C;  1N8R Q;  2K3R A;  3Q5S A;  3OW2 O;  1G1J A;  2QM8 A;  5GTH E;  2Y0D A;  5E79 E;  4H44 C;  1LT9 B;  3D70 A;  2CK3 H;  2D2C C;  1M1J B;  4UB6 E;  1SQX K;  2ZAE B;  4OH8 B;  2YIU B;  3H1L J;  5AVQ B;  3HD7 C;  1ZOY C;  1DIP A;  2J5U A;  1T8Z A;  1GL2 D;  3U1A A;  2J58 A;  1NTK G;  1E5W A; 
#chains in the Genus database with same CATH homology
 1IFP A;  1BSN A;  5FL7 H;  3PJS K;  5DN6 I;  1BSH A;  2V7Q H;  2XND H;  2E5Y A;  3OAA H;  1H8E H;  3OEH H;  2JDI H;  4QMA A;  1E79 H;  2W6J H;  1FS0 E;  1JEK A;  2E5T A;  4DJG A;  4ASU H;  4WVZ A;  2HLD H;  4TLF A;  2RQ7 A;  2QE7 H;  3EFF K;  2RQ6 A;  3OE7 H;  3OFN H;  2WSS H;  2CK3 H;  3USS A;  2XOK H;  3FKS H;  1AQT A;  4YXW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...