2QEJA

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
211
structure length
211
Chain Sequence
ESCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG ALPHA-1 C REGION
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qejA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qejA01
5BVJA 4YPJA 5ITBH 4XP1L 1IE5A 1CDCA 4UTBH 3S35X 3G5YB 1CR9H 3MR9A 5DLMH 4FQPA 3KYMA 3HR5A 3GM8A 5FECB 1EEQA 1Q9WB 4X7TB 2B39A 1IRAY 4GBXA 4EOWL 5KSBE 2NTFA 4YDIL 3BQUC 1KJ2H 3SE9L 3CU7A 2LAGB 1AXSA 1BGXL 2E9WA 3U7YH 3KPOB 4QHUB 2R56H 5C9JA 2CDEB 3HFML 3TH4T 4QRPB 1WEJL 4R97C 1TMCB 3AU1B 5TH2A 4PS4L 5D1ZB 4R4BB 5L88H 1DQJB 5IMKB 1YYLL 5FYLE 1IQWH 3GKWL 3MROB 4UQ3B 2DMBA 2J5LB 3NCMA 1J0KA 1KLGB 3TO2B 4WUKH 4P46D 5C8JA 2X4OB 5TPWL 3RP1A 2L0DA 3OGOE 5GRUH 3DXAA 5E2TL 4YWGH 3QXWA 4LNRA 4OGYL 1CXFA 3KNBB 3Q6GH 2WP3O 4Q9RH 4S1QH 1WZ1L 1WV7T 4UOW0 4FQXB 4OI7A 5IWLA 1AGEB 3QDHA 5I1CH 5I1DB 3O2DA 1FH5L 4P2RD 3WO4C 1TCRA 3FHQA 1JTPA 5ID1B 1T66C 1ZWIB 5IVXE 2M1KA 2PCPB 4EN3A 5EFIB 1YN7A 4V2BA 4NBYB 1V3LA 3KPPB 1H5BB 2R2CA 3HZKB 1IC4H 4U1NA 3B2VL 3FOLA 3IB4A 4ZPTB 4P48A 3ULUE 3RWGB 4QHKI 1WCBB 3DYOA 5EN2B 3FFCA 3SDCC 3D18B 1JYVA 3VXRA 3BYYA 4XCCH 5EBMB 2XG5A 4DTGH 4P2OD 1UXWB 1OSZB 4H0IA 3RWDB 3QUYB 1RV6X 3W2DL 4MXWH 3SQBA 2P46B 1WISA 2XKSA 1CDYA 1XF3A 4K7FB 5D7SH 2D7TL 1P84K 1WBZB 5INCA 4TULL 4JFHE 2AQ2A 2J8UB 4OQTL 4YPGB 3W9DB 4K23L 4EDXA 4M7LH 5TE6H 4WNQA 4XVSH 4MQXD 5IROA 4XCFH 4XPBH 4PJDF 1QA9A 3FTGA 3VFSB 2BDNH 4KJWC 3AB0C 4ETQB 1G6RA 5J1AB 2C4XA 5L6YH 3MLSH 3RUGE 5JPMA 1U9KA 4RX4A 3O6KH 1A21A 2QEJA 3HCVA 4WCYL 1YPZE 4QHLA 3QJFA 1NSNL 3TPUA 1T1WB 2WZPD 1OSPL 1AGBA 4HEME 4XBGA 4ODHH 3NTCL 5DHVB 2C3VA 4GAJL 1BQHA 3VFOA 4CVUA 2ICEB 1MY5A 3VA2C 5IR1A 5C0RH 2F53B 4WV1C 1CXLA 4LVOC 5CUSL 4JFFB 2H6PA 1U2CA 4CVWA 1A7OL 3MYZA 2DICA 1JWSB 4MNGE 4WUUB 4YK4C 1IT9L 3WJLA 4YQXL 4X9FA 2BCKA 3WFDL 2AJSL 1HK6A 1AGCB 3U4EA 2P47B 4ZFOL 3S4SA 1TVBA 2J6EA 35C8L 4LLQB 3PIQA 4MZ3A 2ZG2A 1CBVL 3OL2A 3O8XD 1C08A 1UQSB 5C2UB 4H1LH 1JBJA 4R6UA 5E5RB 2FX7L 1J0ZA 2VISA 5EZLB 1I3UA 2AJ3B 4PREA 3S36L 5D1QD 3CXHK 2FO4A 5ERWA 3WFHA 5J13B 4OCSH 4WW2C 4HQQH 4XCNA 3KJ6H 3RX8A 5F7UA 1NCDL 4YHOH 4PJ7B 4M4RA 5GS2H 1WAAF 3GMNB 1HKFA 3F62A 3HG1A 3SDXF 4QRSB 2ARWA 1MLCB 1SY6A 3MV7D 1RUAL 1EUUA 2GQHA 4OZ4A 3C9NB 1N2RB 5HYJB 4NC1C 4TVSa 4HS6A 1MI5E 4PRPE 1YQVH 3BPCB 3KLAB 2BERA 1H3WM 4ONOA 5TDOA 4K3DL 1VACB 3P4NB 5EA0H 3U9PL 2WBJD 2AXHA 3MLZL 4FQCL 1XFPA 3NOIA 2WWKO 3C2AL 4ZXBD 1R3IL 1A3LH 1V7NH 2W0KA 3T1WA 4N0UA 2R0ZL 1T22B 3ZZ1A 4U05A 3QNXA 4LCUB 2VLRA 5CD5C 4XNUL 4N8VB 1DZBA 3G6DL 4Y19D 2NX5D 4KKAC 3UTQA 1NGQH 3R1GL 4Y4HD 3CK0H 3MXVH 3MXWH 1ZA6B 3EFFA 3FB6B 4Z7NF 3S3SA 1OM3L 4PRDB 5BRZB 5CWSB 2R23A 4TSAH 5DGRA 5JNYB 1R6VA 3HLAA 5SX4I 2W92A 4XBEH 4AMKL 2ICWI 3HB3D 5C0GA 2ZP0T 1S8DB 3S37H 3UX9B 1P53A 1U3ZA 1I1FB 5E8EB 2VDOL 1UEYA 3T1FB 4JFPA 3I2CH 3MBEB 5I15L 3G6AB 3QDME 4RQQB 1PQZB 3FO0H 3OKLB 3ARYA 2VR9A 3NH7H 3HZVA 3UEZA 3BPNC 3JV0A 3OKNA 1PVHA 3AXLB 1HN1A 4J6RH 2YD5A 2DKSA 1K8IB 4R3SA 1U8PB 1V7ML 4CMMB 4YE4L 5JHDB 5J1SC 4KK8C 4MCZA 4BK5A 1U3HB 1IAOA 5JPNA 4G6JH 1ZHBB 2EE3A 3TA3D 2BHYA 5GGTL 1QEWB 1KTKE 3T2OA 5IOPA 2CIKB 1EIBA 5SWQB 1PFCA 3G9AB 4QEGA 3BUYA 4XNMA 1TQCB 5EO0A 1ED3A 3EYQD 3WYRA 5GGSY 3NCCB 2R15A 2IAMA 4NYLA 1MJJA 1P5VA 3MCG1 4M5ZL 1XGRB 3LRSB 2M8XA 1OGAB 1GGCH 4PJBA 2YKLH 4G8EB 4X4ME 1B2WL 1A1OA 1JZ2A 1IAKA 3C60C 3QXUA 1ZGLA 1I1CA 3FB5B 3LEVL 4ISVA 4P2CG 5ID0B 4I0PD 2W0FA 5HHNA 3LN5A 3WHE1 3GO1H 5DT1H 4ORGB 1TJIH 3LN4B 3RZCA 5IM7B 1BEYL 4NWUL 2DQDL 1NMCB 5I1EL 3LD8C 1XGQA 2AV1B 5BZDB 5D2NC 1U95A 4OLZL 5F97E 1KCSL 4XP1H 3WNNA 3OGCA 4R2GC 3S96A 2BRRL 4F7TA 5CD3B 1MJUL 1QPPA 3DYMA 3KS0J 2I07A 1K8DA 1ORSA 2Q3ZA 3VFRA 4LGPB 3ULSB 1PW3A 4LNVA 1KXVC 3UYRL 4O2CA 2NY4C 2WNGA 3WS6A 1ZA3A 1BGXH 1RJLA 2YWZA 3MRBA 2MTPA 2YC1B 2PW1B 3Q1SL 1KCUH 4L4VA 3X14B 4ZPVA 3QUMB 4PS4H 2EKSB 3TVMA 1U6AH 2IBBA 2B1HL 2UV3A 3EJYC 5DZOA 4J7RA 4DK6A 1YYLH 1RU9L 4I5BB 2CUIA 3X17A 1NJ9B 3P9LA 5AD0A 1TNNA 4POZD 2WQRA 1XGYH 2NY0B 3QIWD 2BSRA 4K94C 4QTHB 1XF2B 3X3FL 3O6LL 1UB6A 4HCRL 4NPYA 4EIZC 4U1LB 1AQDB 5IMLB 4LVHB 4V1DA 4OLWL 5E2TH 2DL9A 4OGYH 2EDKA 2EDNA 2V2WB 1EEYA 2F8XC 4PV8B 2QADD 1A1NA 4HUUA 1QPXA 4L8SA 5I1JL 3R4DA 4L5FL 3MA7B 3MLTA 4Z7VE 1JPFA 4OKVB 4H88L 1DQMH 5C0CE 4EDWL 5DURB 1ETZB 1T1XB 3DNKA 4FFYL 3FT3A 4MJIE 3T0WA 3I02B 1F2QA 1KELL 3ZSTA 5D93C 1QRKA 4QRQB 4KH2A 1ZLVK 1RIVL 3AAZA 3MNWA 3B2VH 3CFDA 2Y1VA 2PXYA 5LVEA 3NA4A 2I5YL 5DUML 1OGTA 3KR3L 2AGJH 3GFUA 1JGEB 2XXMB 4YFLI 4OI8A 4PYHA 3D5OF 2H26A 1VFBB 2N7AA 3EJZC 5DVOA 5HHQB 4M43H 1TQBB 3RX7A 1IKFL 4Z78B 4MB4A 3HZMB 5KVFL 5FGSA 1NH6A 1R5IA 3IFLL 4L9DA 5JOPD 4MD0B 2P5WA 5I2IA 2VDQL 4MDJB 5CJXA 4TULH 1IQDB 1H8NA 2FHCA 3U0WH 5D7KD 4Z7UE 5IG7B 4WHYG 4MX7B 3EYFA 1AO7D 3VXTA 3C5ZA 3V6OA 5EBGA 5EBWB 4IRZL 4D3CL 2XY2A 1LWRA 2GUOB 1DE4B 4WWKD 2H32B 2BMKA 4WCYH 4GAGL 1NSNH 3QI9D 5FYLL 1OSPH 3B9KC 3V6BR 5AG9A 4LCWD 4F9PC 3I6LD 3RWEB 1E4JA 4QRRA 3GB7B 4QWWD 5E5UB 1KEGH 1UKQA 3JUZA 4PB0L 4Y2DC 1QACA 5F3HA 5EG6C 3WLWD 2I9TA 2VABA 2VTFA 2GK0A 4EI5A 4MNQB 1SJEA 3L7EB 1JV5B 2Z8WC 4YQXH 4X9BA 4OQ1A 4LSDA 1N5AA 4KTEL 2E8YA 1JNNL 4GRMB 3WFDH 3P9WB 4EI6A 1YMME 3ULVE 4YHMH 8FABA 4AL8L 32C2A 5EOCL 1XF4B 4C56D 4JFDD 4P5MB 3BKYL 2XTLA 2VSDA 5DS8A 1NLDL 5I74C 4G9DA 4P4KD 1LEGB 5CZKA 4HH9B 2HMIC 3BZEA 3ULUL 1KPUB 2E5EA 3TH3T 2E6PA 5ACZA 5JA9A 4HFWA 4ODXA 3JWOC 4OCNC 4XPAL 2NYYC 3MV01 1SBSH 5GGRA 3VFTA 4XPTL 5AZEL 3QWOB 1LK2B 1NCDH 4RBPH 2OTUA 3QHZL 3F7QA 1Q9OB 5E6YA 2QSQA 3ARFA 2EXYC 1ZT7B 2NXYB 3IFOA 4MS8D 4RMSA 3TESA 2F5BL 5T1KA 3MV8D 1VKXA 2X4RA 1DTUA 3EDDA 4IRSD 3IS0X 1FFOB 3OX8A 1F6LL 4EXPX 3NA9L 4JKKA 3CFCH 3MLZH 3VWKB 3C2AH 1A47A 3DV6A 2AI0L 1R3IH 5DHYA 3FQWA 2R0ZH 4XMKL 1JL8A 4I2XE 4U31A 3SGDH 3DGGB 2FX8H 1BMGA 4W4NA 5DJZA 2F15A 1KPRB 3VE0A 1F58L 3MACL 3BZFB 5GRJH 3R1GH 3SGKA 2FYYA 5DRWB 2NZIA 2ZWLT 1MUJB 3DHJA 1JNLL 1CF8L 4I18A 4X5XB 5GSVA 2HT4C 4WO4C 3BP6A 3KYKL 4IIQB 3RIFF 4AMKH 4UQ2A 2P8MA 5IMMA 3GJEB 4S1SH 2DQTH 4KJYA 5CS7A 5BO1L 1UA6H 4MVBD 3E2HC 2R0KL 2ITDA 4HLZH 4P46A 1I8IB 4L3EB 4NUGL 4S0SD 4QT5A 3PHQA 1CXHA 5HDBE 4P5KA 1HKLL 4L3AA 2E9BA 3V6ZB 4GKSB 2Z31B 5E6IC 4KZEH 1BBJB 1NGXB 4P2RA 4F7CA 4GMSL 3SCMD 1N0XL 2A0LD 1G9MC 1V7MH 1J88A 2RCSL 2DM3A 5GGVL 5DRNA 1A6WL 4OCXH 3DXAE 3TO4C 3PDOB 3AS1A 3CFKB 3MGOB 4KRPB 1IBGH 5KANI 3GI9H 1W2KT 1UH4A 5BQ7A 5C86A 5F89B 1S9VA 1D7FA 1MCWW 4LLYB 4P2OA 5GGTH 3TIEA 4E0RA 3BGAA 1OP5H 4PLKD 4GRWH 3GMLA 5FGRA 3ARGD 1JJUA 3FFDB 1NCCL 2DDQL 2VDML 4ERSL 3ETBF 1DFBL 5FUOH 3W0WD 3DMMB 5IEHB 3BKCL 3FFCE 1NMBH 2XY1A 4M5ZH 1M1SA 1W72B 3WEXB 1MCDA 3VXRE 3L3DA 3WO3B 1CFNB 1MQ8A 3GSUA 3V5KA 2WWMD 3QEQD 1A22B 4JM2B 1B2WH 3QEGL 5C6WH 2CD0A 1FP5A 4R4ND 5DA4A 4NO2A 3LEVH 5MHSE 5DQJA 4TSBL 1J8HD 5I18L 3CH1B 4OV5B 1DSFH 3ZYZA 2B1AL 1FRGH 3NPSB 1I8MB 2AK1L 5FV1L 4RNRA 4NWUH 5BS0D 2DQDH 4HWNA 1XIWB 3ELAT 1KB9K 5JXEC 2HKFL 4LK4A 1HINL 4HBCL 2DQCL 4YGVA 1DQTA 3RWCA 3FCTA 3FQUA 1MFEL 4M6ML 4CKVX 1L7IL 3MJ9L 1RHFA 2LTQC 2GT9B 4LCCA 4PGEB 1KEML 4OLZH 5IQ9B 3TYGL 4P4RA 4XVUD 3BESR 1A3RH 2VITA 2QQKL 2IGFL 5E1HB 2DOCA 2JK5B 1INDL 1OTUD 2BK8A 3EFDL 2V2TB 1WT5A 2Z9TA 3Q1SH 4LSRL 5HGAA 1QLRB 4H0GA 4E41D 3FRPG 3O8XA 5I75C 1SEBB 1D5ZB 1G7IB 4MQ7B 2RJMA 1P4BL 5CSBA 1QFWH 2KZ1B 4H25A 3X3FH 5D1QA 5F70A 2DQEL 4LPXA 1KB5A 4WFFD 5F7EL 2C3GA 3MC0A 3O4LD 3VXOA 1J18A 1JZ6A 4OLWH 4R96A 3AVEA 1CFQA 4RFOL 5LQBL 4XNXH 4PFEA 5FYKU 3ARBD 7CGTA 3MV7A 3ZHDA 5L2KB 1YY9D 4JO1H 1KLUB 2DJSA 4L5FH 4YNYA 2JCCE 5HJ3B 4H88H 1Q94B 1XMWA 3TNNA 1A64A 1VCAA 3REWA 4FFYH 3QFJE 3P0YL 1OQOA 1KELH 2WBJA 1CG9B 1TENA 2ESVD 3DBXB 1RIVH 2CDFA 4ZXBA 3I6GB 3MMEB 3OXRA 1B9ZA 3HG1E 3KR3H 3NVQA 4PJDB 1W8NA 4JRYA 3ROOA 2I26N 1BJ8A 4Y19A 2NX5A 2P48B 4HWZA 2W65B 3T0ED 2OL3B 3DETD 1H3UA 2VWEE 4Y4HA 1DBJL 4CN1A 1H3GA 1KG0A 2BFVH 2OJZL 2NTSP 3D69A 3L3GB 5BXFA 5B38A 3IFLH 4N0UE 2I60H 3IJSB 2VLRE 1L9MA 5BJTA 4N0FB 2AXFA 4ZSOB 3RTQC 3MLWH 3WO4B 4IRZH 3QFDB 4JFYA 4QHMB 4L8CA 3OAZH 1DVFD 1SMAA 2P44B 2PTTB 5GJSH 3K3QA 3RGVC 2VN4A 5KVDL 3OAUL 4TPRH 4GG8B 3SDDD 1LO3L 4NT6A 2QJDA 4GLRH 4U1KB 5F1IA 1DQQA 2AXGB 3SDCB 1JWUB 3MJ7A 1OP3H 5I16A 2GTZA 4NKMA 2YMXL 1BIIB 3WKNA 4NN6C 3C5JB 3U9UB 3BRDA 1P2CA 1KJ3H 2D0GA 4ALAH 5EUOB 1T89A 2DMCA 5DWUH 3LKPB 2WLZA 2Y36L 2H8PA 4TTDC 3CNKA 1CLZH 3TA3A 1CL7H 3H3PH 1MPAL 1QNZH 1PYWA 4Y5XA 4KTEH 1OY3B 3RVXC 2Q20A 3SDXB 4QRPD 4J12A 4P5TC 5EOCH 3QXAB 3V4VH 4J1UA 1G7JA 5D1ZD 1GC1L 5BVPH 3IAQA 4Q0XH 2F19H 5LG1A 3AB0B 1HXMA 3G5XB 3VXNB 4Z76B 2P24A 3DX9A 3SBWC 5HHPA 1U91B 4GMTL 4P23D 5DTFB 2VZ3A 4LFHD 3OR7A 3GSOA 3EBAA 1W0WB 4U0RC 4YHNA 4I0PA 1NUFA 4C59B 1C8PA 4S2SB 3BUTA 1FNSL 4WV1B 5KSVB 2HH0L 3VFUA 5IJVA 4EBQH 5E9DB 4FQXD 1B3JA 4L3CA 1V8HA 2GSIA 2E8ZA 4PJBE 4RISH 1EZVY 5CHNA 5JIKA 2MPAL 4UDUB 1HHHA 1VFUA 3FO9B 3WUWG 2RIKA 3STLA 2YSSB 4RDQF 1WWAX 3NA9H 5F9JA 4ELMF 4OD2B 4UBDD 5ESVA 1INEL 5GHWL 3RHWF 3FT4B 1MFNA 2OCFD 2AI0H 2R1YB 3EYOA 3P73A 2VAJA 5E7FA 5M95B 5I1LA 4JDTL 4DAGH 1X5GA 4JREB 3C6SB 1HHIA 1M4KA 1PEZA 1ZE3C 2NY5C 1ONQA 2DB8A 4XGZA 3U46A 4LKCA 3MACH 5B3JF 4QHNA 5I8CB 4UUJB 1MIEL 3UCRA 5DEGA 3MODL 3MRCB 3QDGB 4F2MA 1GXEA 5K59F 3OG6B 4CW1B 1T80A 4PGCA 5DJ6B 1KIUA 3QIWA 1UM5L 1AR1C 2EEDA 1BAFH 1T7VA 1A0QH 4Z77B 3BDXA 5BO1H 3H0TB 1FDLL 4GRLD 1A6UL 4QY8A 5IB2A 3OPZL 4WGWB 3QG7H 4L4VE 1DL7L 2UY7A 1HH9B 4NUGH 3UTOA 1XR9B 1AGDA 5K9JH 2NR6C 4NC0B 3HR6A 3ULVL 4YC2B 2EIZB 3P77A 2GCYB 2YRPA 3BP5A 4G8IB 1BFOB 1S78C 4LLDA 3PWNB 3HC3L 1HCVA 4KHTL 4GMSH 4V2CB 1JHTA 4YBQD 4MNHA 4G7YL 1WSST 4ZO8A 1F6AA 2RCSH 1OF2B 3DX8A 1RZJC 5GGVH 4V1DE 2F53D 2LVEA 3N06B 1M6OA 3V95A 1G7LA 2NY6C 4A2MA 4LARH 4M8QB 2UUDH 1F2XK 4DVRL 1FVCB 5T1MB 2XWBA 2V9TA 1EHXA 4HS3A 5DVNA 2R4RH 5D72H 3O6MH 1S7VA 4PTTA 4PLNC 2GJZA 1A7NH 2YD3A 4R7NA 4LIQE 4PYGA 1R5VB 2DDQH 2VDMH 4ERSH 1Q9LB 1DFBH 4NQVB 4WDIA 1K9TA 3HHRB 4FQLH 1I1AC 3BKCH 3MJ6A 4KHXH 4FQIL 4XHJD 3U83A 2MCPH 1JRHL 5C7XL 2EXWD 5CMAB 3IGAA 5C70A 1AO7A 4X4XA 4GKNB 3QEGH 4I3SL 1OD9A 2XN9A 5DQ9B 4PJIA 4WWKA 3G04B 4HK3N 3GRWL 1AE6L 5DHXB 1FZOA 1D9KD 5FYKD 4NJAH 2P5WE 2B1AH 3V0AC 3BW9B 2QTEA 2C4FT 2EDEA 2KBGA 5EO9A 3M1BB 3IJHB 2A38A 2QQNH 5J6HA 3QI9A 4U4BA 5D7JB 2P7TA 3QJHB 5ESAA 5A2IH 3OXSA 3TN0D 3EYVA 1HINH 2DQCH 4LCWA 4D9QE 3V6OE 1MFEH 2ICWA 3B5GA 1MFCL 1L7IH 4JLRA 1FFPA 2FEEL 1BX2A 3SGDI 2V5MA 3AFLA 3TYGH 4L1HA 3RDTC 3MOBL 5J6GB 3MRPA 2LU3A 1R5WA 3HE7C 5CZXC 3ZKSD 5KW9L 4GG6A 3Q5OA 2HRPL 3BEVA 3GK8L 3MLYL 3W39A 4JFOB 3DHMA 4AEEA 5SWSB 3QXTA 1INDH 1Y0LB 4CNIA 3LS4L 3T0AA 3EFDH 4QRRE 3HC0B 2HJLA 4LSRH 4TOYL 4C56A 4JFDA 1LILA 3JV6A 5K9OA 4MA3B 3U0TB 1G9NL 3C60B 2P45B 4P4KA 5BRZD 1IKNA 5F21B 4NSKB 4LDOB 4XCEB 1M7DA 5I66B 2EE2A 3INUH 4FFVD 2EIEA 4Y89A 4LOUC 4Q74A 5L8LB 3LQZB 1B88A 4Q9QL 3O2DL 5EIIB 2XACC 5F7EH 5H94A 1IM3A 3A6BH 3JTTA 3B8YA 4JKMA 4WENB 2MHAA 1Q72L 2WIIB 3UJTL 3NFSH 3GSNA 3T0BA 4HZAA 3MZTA 3H7LA 5ICXB 1I7RA 5LQBH 1WZLA 4R2GB 3IDMB 3STZB 2HFGH 3MV9D 3PWVA 1RIUH 4H1LB 3MV8A 2BVTA 5D8JL 1RURL 1TVHA 3H9YA 4BJLA 3LV3A 3RVWC 4XVJL 1K85A 3TZVC 4IRSA 1AFVL 3P0YH 3ZKXC 1MWAB 1PD6A 4PJXE 1X5HA 2FECI 5D70L 4M7LT 5E2UL 1VPOH 4FXLA 1ZVSB 2QBWA 4X7CC 2FB4H 2VR5A 5FM5O 2P8LA 3KYOB 5IVXF 4ONHB 3GMMA 1J1XL 3NIDE 4U1GB 4YX2H 2NXZD 4N8VG 2B4CL 2K7QA 3H9HA 3T65A 1DQDH 2HP4A 4IBLT 5D2LA 4F57H 2OJZH 5DJ2B 1XEDA 2A6IA 3ULUF 1F90L 3MGTA 4ZUSA 5IB3A 3QUXC 2IH3B 4KKCC 1I8KB 3CZFB 4NZRL 5ADOH 1QSFD 3AGVA 1HHGA 2ZSVA 1CE1L 2DWEB 2E27L 2WAHA 2Y06L 5EZIL 1OGAD 1SVZA 2GFBA 4FXKA 4JO3L 4EUPH 3IAGC 1EVUA 3IETB 5FKPB 1IEBB 4KROC 4QYOA 3M07A 1CGTA 3WKML 1AD9A 3EO0B 2C5DC 1FVEB 3BDBA 2YUZA 5C0NC 5I0DA 5K9QG 2MMXA 1BQLL 5AUMB 4K8RD 4P9ML 5IEKA 5TE7L 3EDEA 1RZ8B 3KLHD 5IT2L 5KVDH 3MRHA 3OAUH 4NBXB 3SCMA 4R8WL 1YNTA 5CSGA 2VL5A 1LEIB 4PRBA 1PKQB 3GHBL 1DUYA 2PNDA 3MRIA 4JN2B 1NFDF 2NPLX 3IJYB 1EEZA 3RUGF 3PGDA 5I1IL 2YBRB 3VXQB 3BP7B 2DS4A 1EMTL 3L3KA 3BN3B 1LD9B 5JZ7C 2EYSB 3AMKA 5HPMB 2Y6SC 3UJIL 4P2RE 1WJ3A 5CILH 5B39A 4HKJA 3T4AB 4FFZL 1MPAH 1JF1A 1JUFA 1G7HA 3FB8B 5HPOA 2IWGA 2XA8H 4Q7DA 3ARGA 1KTLA 4TUJB 3D48R 4C4KT 3W0WA 4AEIL 3U4BL 4JN1H 1QFWI 2HT3C 4XTRC 1A6AB 1MY7A 2JJVA 4DEPC 1EBPA 1WTLA 4KKLC 5JMOC 2A1WH 1RUQH 4OCRH 1CIDA 5C0AB 3QUZC 2NY0D 2NW3A 5HI3C 1G7QA 3QEQA 2A6DB 4G9FB 4NUJA 3U0PA 2R2EA 3B9KB 3LKOA 4R0LA 3D25B 1J8HA 4QXWA 2YXMA 5KSUA 4YEFA 2R29L 5EPMB 4R26H 1A9EB 4K71C 1LDPH 1J05A 1FNSH 3LRHA 5BS0A 5FOBB 5DSCA 2FZ3B 2BOCB 4JFZL 1FO0B 4GW4A 4Y2DB 2OS7A 1QBLL 3QPXL 2LFGA 2N4IA 3SKMA 3WE6A 3JWDH 1OT2A 3ROLB 4OT1L 5DURD 4CL7A 2X4SA 4MA7H 5DJAB 5MP6L 1U8NA 1JTOA 4FQ2H 3T0XA 4RSVA 4PRAA 5BW7C 3U7WL 3KGRA 3AY4C 1J0JA 1FAKT 3VMNA 5KG9A 3V0VB 1S9WB 4QKXB 5I74B 3O3DA 1P5UA 3FONB 4HUNB 4OZFH 3LKQB 4NNPH 3EUUA 5JXAL 2B8OT 1WBYB 4NZTH 4MXQD 2IANB 3IKCB 5DVLA 1T1ZB 5J3HD 3MODH 4B7LA 3TBSA 4KDTA 1U8JA 2DTMH 4BZ2L 1OWRM 5CEYA 4E41A 5C2BL 1EGJH 25C8L 3D0LA 1SM3L 2PW2B 1KOAA 2VXSL 4B0MM 4LPWA 4PD4J 1NAKL 1FPTH 2VDPH 1T83A 8CGTA 1D6EB 1FDLH 3VJ6A 2VQ1A 3U30B 1MHEA 3O4LA 1VENA 1U8IA 1K4CA 3DVNB 1HZHH 1DL7H 5FV2A 3SE4C 3S8WA 3HRZB 2R39A 1IGFH 4D0CB 1RZKC 3WSQL 4Y1AD 1NC4B 5FHAH 4GLRI 3DOSA 3ARBA 1LO0L 3CC5B 1XAUA 1AP2A 3BAEL 1A6ZB 5DRZB 3DROB 4KHTH 1FQ9C 5T1LD 3WJJC 1FZMB 1XCTB 1JVKA 2Z92B 1C16A 3L3JB 3TNMB 1XGTB 3MV11 2YPVL 2ESVA 3OJDA 5TDNB 3WN5C 3UROR 1CL7I 3KPNA 5HHMB 1VGKB 4MWFB 4ODVH 4WI5A 2FSEA 4HIJB 4P2QB 3O9WC 1FZKB 3MLXL 3QRFM 4ENED 3PWUB 3FKUS 4MNQD 2CRIA 1CK0L 3EAKA 3MQIA 4PJGA 3T0EA 3GIVB 1A4JA 2QQQA 2F54D 5KSAC 3O6FC 3E2HB 3MLVL 4XPFL 5C0DB 2OTWB 3MLUL 3O45A 4DWHA 2DBLL 4JFQB 3MOQA 2JJWA 1QBMH 5F7KC 4UT9H 1T7ZA 1NDGB 4QF1A 4FQIH 4Y19E 3BP4B 1GYAA 2NX5E 3FJTA 4PTUA 4OCWL 4CMHC 4RZCA 1IC5L 3NCJH 5E6IB 3S5LG 1MH5A 5HDQL 5E56A 3D2UB 4MD4B 1LO4L 4KGJA 4HK0A 1HNFA 3GRWH 4Y5VB 3SKOA 5B8CA 1DVFA 4HUXB 2FJGA 4L9LC 5EOTA 2VKWA 1QLFB 4LKXA 4NJ9H 2Y7QB 2X1WL 3M17B 1JGUH 3SDDA 3BGMA 1J9CT 3FZUC 1YNKL 3GMQB 3I85A 1LP9B 3PHOB 4ZAKD 1E28A 5DJ8A 4M00A 4YIQB 1CU4L 1OAQH 3MOBH 5DD1L 3BE1H 1Q9WA 5SWZE 5IKCA 5KW9H 1FG2A 4XAKE 5TF0A 3MLYH 4FS0A 4FA8A 4L1DA 1CD9B 3JXAA 4QHUA 4DUXA 5FO9B 2CDEA 4QRPA 2AAVA 4TOYH 3UTTB 5D1ZA 1Z3GL 2BSSA 1G9NH 1DQJA 5IMKA 4I48A 4TUKL 2VLKB 2ZPKH 4LHUG 3MRRB 4YBHA 3VFVB 3PF2A 2Q86B 1QD0A 4UB0L 4LSTH 4P23A 3PP4L 5IBTH 1CD1A 1B0RB 3O2DH 5FK9B 3SY0B 4LSUH 1YQ2A 2IFFH 1T20A 4YDLC 4DZ8B 3SDYL 4QGTA 4ZFOB 2O61B 4W6YB 5BZWB 2MKWA 3UJTH 3WXVH 3KNBA 4LIQL 4NFBA 2LTQB 3K81A 1CT8B 4FQXA 1RZ7L 2JELH 3D9AL 1CTNA 2P8PB 1AGEA 3VD7A 1HXYB 5D8JH 5I1DA 1RURH 1U8KB 5ID1A 2VNCA 1ZWIA 3VGAC 4XZUB 4GO6B 5EFIA 5LCVL 4ONFL 4ODBD 4OUOA 1TETL 3KPTA 4KRPD 3OMZA 1YY8A 4X4ZA 5D70H 4ZPTA 2ZCKL 3MBXL 3HNSL 2E7HA 2G5BB 2ZUYA 5J8OA 3PABA 3L5XH 3RWGA 1WCBA 1OQXA 3QCVL 4M61B 5J9PB 3QO0A 4OLXH 4Q6IB 1J1XH 5EBMA 1X5ZA 1UXWA 1OSZA 3ILPB 3RWDA 3OZ9H 3QUYA 2B4CH 3NGBB 4UV7L 4K7FA 4QCIA 1P1ZB 1G9MH 4WEUD 2D7NA 4UOJA 5H35A 2GSGB 4GT7A 1WBZA 1G6RH 5E70A 3EO9L 2IBZX 5ALBH 2MNUA 1CE1H 2E27H 4C83A 3W9DA 5EZIH 4KV5E 4GRLA 2FX9L 4JM2D 5FUCC 2HKHH 5KTEH 4NQUA 5IK3A 4P57B 2APVA 3VFSA 2VLLB 2V5YA 1BQLH 3DX6A 5C09D 5IVZB 1PZ5A 4JHBA 1PSKL 3H7BB 1BFTA 5DHVA 4RGMC 4M1CD 3MJGX 3MRDB 5I30L 2ICEA 1E4XI 4IRJD 4QXTB 2VL4A 1HWHB 4ODWB 2GJ6B 2F53A 1J8KA 4OLUL 3LHPL 2KH2B 5DEFA 5I1IH 3NAAH 2Y4SA 4NNYB 3R06B 2XXCB 4IEFB 3CFEB 4WFED 3ZHLA 2VQUA 1HI6B 1OLLA 5I73C 2J6EH 3UJIH 4TTGA 4PGZA 1I7UB 5EO1B 4MSWA 3MRNB 1JN6A 4FFZH 2ED8A 1EEUA 4NQEB 1YDPA 2VDNH 4WU7A 4MQSB 1AGCA 4QNPE 4Y2OA 3BWAA 4KAQL 3IXTA 5A43C 3ET9F 3Q5TA 3MREA 3RWFB 1I3RB 1MCNA 1SY6H 4ELMB 5FYJH 3ULVF 1NBQA 3DWTA 2AK4B 3MYJB 5C0BB 3MJ8B 2W9DL 4Y4KC 3ILQD 5ISZD 5CGYD 1G0DA 5ESQB 1H0DA 1D9KA 1DANT 2R29H 5JOPE 4CDGC 4PJ7A 5DK0B 1BZ9B 1IKNC 3DARA 4U1IA 3GMNA 5C0EA 1Y18A 2BSTA 4NN6B 1MFAL 3M8OH 4QRSA 5D7KE 1MLCA 4JFZH 4N8CL 3QPXH 1QBLH 3UPCA 2W9LA 1AO7E 1FAIL 4YHLH 2NY7H 2CO6B 1QFUL 3BDYH 2Q7NA 3FN3A 5FXCH 4BK4A 5EULV 4PJIE 3KLAA 3BVNB 3BQUD 4X0KA 5EU7E 3P4NA 4WI4A 4AM0B 3U36B 4HXAL 3QHFH 4P5TB 3U7WH 1T22A 1T5WA 4QXGH 1A2YB 1MREH 2YR3A 4LCWE 3I6LE 4FQJL 2VH5H 4M6NH 5JXAH 2APBA 1KFAL 3EIFA 1IGTA 1ZA6A 3FB6A 4X6DA 4BZ2H 3O3AA 2HJFB 4PRDA 3O3EA 2B5IB 3OG4B 5BRZA 3RBSA 5CKGA 4KPHH 4JG1L 1SM3H 5LXGL 1ORQB 1ZT4B 2OTPA 4GG6E 2AJZB 4NO3B 1GZQB 3ARDB 4M93C 3SGJC 4J3SA 1KLFA 1U93B 1S8DA 1NAKH 1A1MB 1GIGH 1PX3A 5E8EA 3RAJL 1R0AL 2D2OA 2FDBP 2X4PB 1NCWL 3RIFK 5J0BA 3O11B 5EC1A 3E8UH 4C56E 2OQJB 4JFDE 4HGMA 1T66D 5ICYA 2E7BA 3UAJC 3WSQH 4RQQA 5LWYH 2A9NL 4LLMB 1PQZA 1PG7X 2H2PC 1X4YA 2Z35B 1KYOJ 3MV9A 4NQDD 4QRTB 1CGVA 3E1F1 3L7FB 4KQ3H 4Z8FL 5L9DH 4ZS6C 2J4WL 1U8PA 4HS8H 3QT2A 3SDCD 5EWIL 3ZT5A 4PD4K 3IKKA 3S88L 1UH2A 1N64H 1A6TA 1V5JA 3RA7L 3RVUC 1BZQK 3MLXH 3C09C 3MV8E 5KN5A 1ITBB 1A7PH 4KRLB 1L0XA 1L6ZA 1QEWA 1CK0H 5F96L 1BQSA 4HDIB 3VCLB 2D9QB 3U6RA 3WS3B 2DYPB 1NAML 4H26B 4PLJC 1X9QA 3ZE2E 3SPVB 4NN5C 4KMQA 5SWQA 1HOCA 1JWMB 3MLVH 5J56B 3ARPA 4XPFH 3LS5L 5DK3A 2J3SA 3MLUH 4HWUA 4XP4H 3CSYB 1EHNA 1MCSA 4YHIB 1QSFA 5MEQB 3QWRD 2OSLB 3CVHH 4KJWD 3LRSA 4CJ1A 3IVKB 2AERT 4NM8L 1OGAA 3B3IB 1SEQL 5GGSB 5DFVC 3CPLA 3L3IB 4G8EA 3VI3F 4F33B 3ZKMC 5D2LE 4UNVA 1LO4H 3FB5A 4NO5B 2EH8L 1T04B 4ZMAT 5IBLC 2QHLA 1MELA 4U33A 2P5EB 4HGWA 3ARZA 5ITFB 3OKDA 4OF0A 1NFIA 2NY6B 1ZK9A 1YNKH 2JKXA 2AV1A 4LRIC 3MRQA 4JHAH 5CD3A 3UTZA 5GISL 1CU4H 4ODUB 3EO1B 2FATL 3X11B 1FFQA 1E6JH 5I17B 4M7ZC 4J3VA 5AAMA 2JB5H 2XWJB 4N9OB 3F7YB 4MYWB 3WNPA 2BVPB 3WDHA 1FL3A 4B5EA 2V9QA 2YC1A 3LEXA 3TJEL 2RAMA 1KB5L 5FB8A 1AXIB 2BRQA 3QUMA 2EKSA 5MERB 5ELIA 1Z3GH 5C6TL 4G80B 1IGCH 4I5BA 2JJSA 4U1HB 5JW4R 4LBEA 2O5ZH 4KUZL 4OV6F 1CLCA 1S9XA 5GS0H 3HAEB 4FN0A 3EGSB 2GW5A 4U1LA 3W0WE 1LK3L 5IVXB 1I3GL 3OB0H 1BVLA 4P3CH 4LIQH 1MRDL 2ADGA 4WHTA 1U92B 2IQAB 2V2WA 3RI5F 5CJQL 4PV8A 1JGDB 2Q8BL 3ARRA 3D9AH 5GGUB 1J1OL 5DI8B 5EOCJ 3QEQE 4NO0B 1DBML 1JI1A 3WMSA 2V7NA 3MUJA 4OKVA 4UILH 2D31B 4FFWC 4M5YH 3PWJB 1RZGB 5CD5D 1ETZA 1T1XA 3QIBC 4W4OC 2V17L 4ODTH 2NLJB 1J8HE 3BEWB 3GMPB 1PGRB 1HH6B 5EIQA 3L5WB 4KKAD 1TETH 2ID5A 4MAYC 3S7GA 5BS0E 3DURB 2ZCKH 2I9LA 3DRTB 2JCCF 1GGBH 1SQ2N 3QCVH 1JGEA 1FFNB 1ZHKB 1ADQA 3RY5A 3ZYIA 5HHQA 5DMYA 5T3ZD 1VA9A 4Z78A 4G6MH 2APXA 1MFBL 1I1YB 1AC0A 3LQMA 2EO9A 4MDJA 3GBML 1NFDB 3P4LA 1S7RB 3RUGB 1DN0A 3H9SB 3P4MA 5IG7A 3CFJB 1E4KA 4NP4L 4HIIB 5EBWA 4OZHA 1DE4A 4NKOB 4RIRB 4Y1AA 4E41E 2H32A 2PYFB 2CDGA 5H2BB 4KK8D 1J12A 3NACL 1GCFA 2BJML 4LSQH 3TBYA 2FEEI 4WFFE 5I30H 2M2DA 4KI1A 1MCPH 2A6KB 3PV7A 4MNGB 3GB7A 2XTJC 3PGFH 5HDOA 1ROWA 2HFEB 5IQ7L 2YZ1A 4KDWA 5DDHA 3GM0A 5DJYB 4QLRA 4JPKL 1DN2A 5AZ2L 3MO1A 4FG6C 1K2DA 1B0WA 2MOVA 4MNQA 3QNYA 1JV5A 3L1OL 4HF5L 5F6HI 4PJAA 3PUCA 2F54A 2ESVE 2XZAL 3PL6B 5E5MA 2GIYA 4Z95L 3S36X 2Q8AL 1JIBA 4KROB 3DVIA 3C60D 2DQIH 4HH9A 5F6IC 4DKFL 3HNTH 4P49A 5AAWA 5MEOA 2ADJA 1KCRH 2X4QB 3S98A 4EEEA 1KPUA 1YECH 5MEND 4PJGE 4WEBH 4MB5A 2WM0A 4I8DA 1MLBA 2W9DH 3RWJB 4YO0A 1F8TL 2DLHA 3LKRA 1T1YA 1FNGB 4PRPB 2CR3A 5HYQB 2H1PL 3ALPA 3I50H 2V7HA 1Q9OA 4L8DB 2OR9L 5FCUH 1MFAH 1FJ1B 1Y6KR 4R2GD 2J5LC 1ZT7A 2ITCB 3MUGB 2QSCL 3T4YB 5DMGC 3S34L 4JZNB 2J12B 1CICC 1FAIH 5IB1B 3QDAA 1QFUH 4ZAKA 3UPAA 1U58A 5ECJE 1EO8L 2NY4D 5A2LH 4Z0BL 2BNUB 4XNQA 3TBTB 3VWKA 1RHHA 4KK6C 1BLNB 5I1GL 1FZJB 3KPMB 5DJDB 3EJYD 3RHWK 4HC1H 3BFOA 1M7IA 4DEPB 4GAFB 3QUZB 1U8HB 1CS6A 4XAWH 1H5BC 2G2RA 3E3QE 2B0SH 1UZ6E 2DM4A 1MUJA 2YD9A 4WFHD 3TWCL 4RWYL 3N85L 4FQHB 4JG1H 3ZKQD 5LXGH 3QDMB 4X5XA 3WFBL 2BXYA 1A6VL 2F58L 4WTZG 2BXZA 1RJYB 1XF5B 2DM2A 3LEYL 3AREC 3QUYC 3EZJB 4NKIL 3MRLB 1R0AH 3L6FB 1IZJA 3HKFA 4QRPE 4BQBA 1I8IA 1EBAA 3MRKB 4PG9B 5E08L 2EH7L 3GIZL 1MJ7L 2VXVL 2X42A 3V52L 2A9NH 2DLGA 5A2KH 1EH9A 1GZPA 3QIUC 4LCIL 4M62L 1RJZA 1NGXA 5CBEB 5ADPL 2VN7A 3CX5J 4Z8FH 4K3JL 3G5VB 2J4WH 4H1LG 4JB9L 4X99A 5FYJU 1HSAB 5I1AB 3PGCB 1RAMA 4QGYA 1HHJB 3EJZD 2JJTA 2KPNA 2VIRA 2PR4L 3PDOA 1RK1B 3CFKA 3MGOA 1JFQH 3RA7H 2FCBA 2R69L 4OI9A 4ZQKB 1WLHA 5F89A 4OM0L 5F1KC 3LDBC 4JPIB 3BRGC 1DBKH 1KYOK 2Z8RA 4JGJA 4G6AC 5HYSG 4OZIB 4BQ9A 4XXDB 3FFDA 4ZS7L 2VE6B 4X6EA 5ANMA 3FQXA 3T3PE 5E8PB 5GJTL 4NKDB 5IEHA 1XR8B 3HPLB 5DMIL 4XX1E 4BSJA 1W72A 3WEXA 1S5IL 3ZDXE 3VFMA 4P9HL 3ZTJG 1CFNA 2G9HB 3D85B 3QQ3B 4JM2A 3B9KD 3SE8H 3SKUD 4JO2H 3VMPA 2EH8H 1FHGA 3CH1A 5C09A 4OV5A 3QRGL 5DK2B 4D0DB 5T3XL 2DKUA 4HUMB 4BZ1H 5EU5B 4Y2DD 3LPGA 1MCWM 4MCYB 1VGEL 4NNXA 4KU1A 1F3DH 4G8GD 4IRJA 2HLFC 4EUPB 4S1RH 3UBXI 3ARUA 1K5NB 4TVPD 1LE9A 4K9EC 5J13C 4OFYD 2GT9A 3MOAH 5D9SA 4PGEA 4RMRA 1EAJA 5IQ9A 4WY7H 2QR0B 1HNGA 1MCFA 2R9HC 3P0GB 3BN9C 1X5XA 3VW3H 2YRLA 4O5LL 2PKDA 3IFNL 4PUBH 2JK5A 2CRZA 1GHFL 2HMID 3GMOB 4DGYH 4Y4FB 2V2TA 2F53E 4G43B 4XWGL 2IAND 1KB5H 1IZKA 3X3GH 1QLRA 4D8PA 4XP5H 5C6TH 1AHWC 4ODSL 4OAWB 5IFAH 1KN2L 1P4LB 2NYYD 4Y5YC 3SE3A 3BD5A 3MX0A 1C12B 3GSNL 3K1KC 1SEBA 4RMUA 1D5ZA 4PRNB 1G7IA 3EOBA 4OF8A 5DJCB 4G7VL 2H2SC 2X1OA 4U0QB 1PLGL 1S7QB 1N4XL 4KUZH 43C9B 4JJ5B 2EXYD 1ND0A 3NZ8A 5ISZA 3VWJC 2Z93B 2IMMA 1HYSC 5C0CB 5DD6A 3CDGB 1NC4D 1A3QA 3RU8L 5IVNA 4RGNC 5CJQH 4KI5C 2Q8BH 4UT6L 5E7BA 1JNJA 1WIOA 1UVQB 1JGLL 1MSPA 3F58L 4DZBB 1CGUA 2VDRL 3FO1B 5HJ3A 4M7KH 2E3VA 4OTXL 1MHPH 2FJHB 1Q94A 3JTSA 3L9RB 2ARJB 1DQLL 1EJ6A 3BQUA 2V17H 3MBEC 1JPSL 5FYKE 1CG9A 3D0VB 5FUZL 1YZZA 4LLUB 3VD4A 3RWHB 2VLJE 1UJ3C 3PP3K 1BPVA 4Y16B 1CFVL 5HDLA 5IMOB 2C7UA 1RIHH 1F11B 2A77L 2WINB 4Y88A 5DFWH 3OF6D 1CLOH 2HT4D 4WO4D 5F3BA 4PJXF 3ZKNC 1FL5B 1HHKA 3L3GA 4GKZA 2VB5A 1U3HC 1RVFH 2IPKB 4YDLB 4UU9B 2ED7A 3IJSA 2CK0L 1WWCA 1QLEL 3NIDF 5I76B 2HAZA 3K80A 5ILTL 3HE6C 4OZGF 4N0FA 1U8LB 3WUZA 2MSPA 4OB5H 5E6ID 4JO4L 2F8VA 4F7MA 2WW8A 3T2QA 3QFDA 4X6DE 5TQ0L 1OTTC 1A7RL 5BRZE 1FYTB 3BZ4B 3BO8B 2WBKA 1JYWA 1RFDL 3VH8B 3TO4D 4NQDA 2PTTA 3NACH 3LAFA 4YDKH 2BJMH 1DLFH 3VGEA 1DBAL 1G0XA 3FB7A 3WHE0 2RR3A 4YDJA 4YR6B 1IAIH 2VOTA 3EYUL 5DVMA 5IGXL 3SDCA 1JWUA 1ZV5A 2OP4L 1BIIA 1VB9A 3K7UA 3C5JA 3U9UA 5IJKC 5JR1L 1S7TB 3HMWH 4KI5F 4K3GA 5EUOA 2G75B 5AZ2H 3QXDA 4H20L 3MV9E 4HKZB 4YAQB 1NMCC 2VZUA 1ZGLM 1FNHA 2OI9B 4JVPA 5D6CB 1WK0A 2FGWL 3GMRB 4HF5H 2JE8A 4HZLB 1G9EA 3SDXA 1NCUA 1CDUA 1OAXH 3HC4H 2Q8AH 3LQAL 4FZEL 2VLKD 3QWRA 4PY8I 4KTDL 1BVKB 4I9WD 4U1MB 4DKFH 5EU6D 4Z76A 2VDKL 1NBVH 3N1GC 4U2YA 1Q1JL 2L4OA 4RGOH 5L8KB 5DJ0B 1D5MA 5JXED 1YN6B 3NFNA 3VU2A 3Q2CA 4NRXB 1J5OL 1HE7A 4Y8DC 4MJ6B 4S2SA 1QSFE 2YWYA 4WV1A 4KZDL 4HK3J 5E9DA 4LSPL 3OKMA 1OGAE 2R1XB 2OYPA 2YZ8A 5I73B 4UDUA 4L29A 1NDMB 3O0RL 5H37H 5C0IB 3T2NH 5FYJD 3SQOL 4JY5H 4X6CE 1YEHH 1RK0B 2CPCA 3DTXB 4L4TD 1SHMA 4IOSD 4LVHC 1YEGH 1LNUB 4OLVH 4B7IA 4NZDA 2VAAB 2X4UB 4OD2A 3RFZC 1AD0B 2WUCL 5BVJB 5MEPA 3FT4A 1OW0C 2R1YA 1CR9L 3WCYA 1JPGB 3C6SA 1PY4A 3HR5B 4WHYH 4PRHD 2NTFB 4KUCF 1KJ2L 2XQBL 4GXUN 5I8CA 4UUJA 3S35H 1E6OL 3U7YL 4GFTB 3MRCA 5C9JB 4Y4KB 3TWCH 3ABZA 3I75B 4L8BA 4OIAA 5I8EA 3N85H 4DKEL 5TH2B 3H3KA 4JEGB 4WW2A 4NWTL 5L88L 5DJ6A 1OWWA 3GJFA 1A6VH 1IQWL 1PBYA 2R2HA 1DR9A 3H0TA 4NKIH 1YEJH 2N1KA 2JB6B 2XIDA 3KYNB 1G1YA 4N5EC 2GI7A 2M26A 3OSKA 4M3JA 4WUKL 3GIZH 2WUBH 2WWKT 1UM4L 5FF6B 4RAVB 2EIZA 3T8XA 3DXAB 5GRUL 4YWGL 4B50A 4XP9H 1BFOA 3Q6GL 4M62H 1YJDL 3PWNA 4ELKB 5F6HJ 1BOYA 1BECA 4K3JH 5I1CL 4JB9H 1D3CA 1OF2A 4EN3B 1X6NA 1GOHA 4LLWB 2PR4H 3HZYB 3O2WH 2R69H 4YLQT 1WBXB 4OM0H 1IC4L 4U1NB 5T1MA 2LV4A 5E00B 3DO3A 4JHWL 5DQDL 5T5FL 5AEAA 3FFCB 4NDMB 4KVCH 5INDB 1I9RH 2VDLH 4M93B 3VXRB 5GIRA 2C9AA 4XCCL 5L8JB 4GW5A 1EA9C 3CX5K 5IB4A 1R5VA 4NQVA 3RTQD 1XF3B 1II4E 4YUEL 3LPWA 5DMIH 5EIVA 3OKKA 1LO5B 1S5IH 3NIFE 2GAZA 3EOAA 5INCB 3QO1B 5LGJB 5CMAA 3OJMB 5FHBH 4EDXB 3RGVD 5TE6L 4APQC 4XVSL 2MKLC 2FEDC 5D7IB 4JANB 4XCFL 4XPBL 1QA9B 2R0LL 3Q48A 4DN3L 1FC2D 3QP3A 3M1BA 3IJHA 3MLSL 3GEWB 3O6KL 3HCVB 1YUHA 1P9MC 5HGDA 1EJOH 2R0WH 1CDGA 3I9GH 1SMOA 3IDXH 3C09B 2MFNA 3V4UH 4XBGB 1SBBA 4TTDD 3FN0H 3G5ZB 5JOFA 5DMKB 2C3VB 1BQHB 4OZHE 1I7TA 1O5DT 2EDJA 5DF0A 3UPRA 4Y1AE 5C0RL 4HLZG 4LMQI 2IFGA 3RVXD 3UTPD 4P5TD 2NXYC 1NGWA 4MJ4A 4ZDHB 4BFBD 3IFNH 4XC1H 1Y0LA 1GHFH 2DQUH 3HC0A 4XWGH 5DC9B 4OIIH 4YHZL 3VWKC 4MA3A 3U0TA 3U4EB 3C60A 3DVGA 2VYRE 3GSNH 4I3RL 5DUPH 4MNQE 4QTIL 5I66A 3CLFL 5MENA 4G7VH 4R90H 1C08B 1L9NA 5CJBA 1T3FA 4LF3B 1N4XH 5HVWA 4PJAE 2F54E 3VXMB 1MCCA 1KULA 2VISB 3H42L 5EIIA 1I8LC 2JCCB 3RKPA 4PREB 2XFXB 2OZ4A 5JQHC 3PV6B 4LAQL 2ILLA 2WIIA 4AJ0A 1U2HA 1OCWH 3QFJB 3GNML 3WFHB 4U7MA 5ICXA 4OCSL 5C9KA 3L3OA 5D2NA 4XCNB 3KJ6L 4IIQC 3IDMA 4YHOL 4UT6H 1G0YR 3C8KA 3F58H 2NZ9C 15C8L 2K1MA 4LL9A 3X12A 4OZ4B 4E42B 4ORZC 4NRYA 4GRWE 1K6QH 1M05A 2B20A 3NIGF 1UCBH 5EUKB 4RMTA 5DD0H 1JPSH 1MWAA 5I6XB 5ICZB 5TDOB 5EA0L 2YPLB 2Z31C 5BCAA 1A3LL 1V7NL 1QTYT 4N0UB 4ONHA 2C3XA 2VLRB 3V6FB 4TQEL 4WGVB 1TZGL 5E2VL 1AR1D 4WI2A 4ZD3H 3C6LC 3UTQB 5DJ2A 3AROA 4PJFF 3RPIB 3LSOB 3QZWG 3CK0L 1I8KA 3CZFA 3MXVL 3MXWL 1NEZA 3BPOC 2CK0H 2Q87A 2NR6D 5B21A 1QLEH 4TSAL 3N9GH 5GQBA 4HSQA 2AJXH 4XBEL 2X70B 4Q58C 3IYLW 1S78D 5C0GB 4AENA 5JA8B 1IEBA 6FABH 2UYLB 3CVIH 3EO0A 5TQ0H 4PJCF 3DMMC 1BWWA 5AUMA 2C1PB 1XF1A 2EDFA 4JFPB 1RFDH 2H3NA 1CZ8H 4KV5F 1RZ8A 2NY6D 3FO0L 4MJ2A 1FIEA 3DYPA 1PKQA 3NH7L 3ZT6A 3EYUH 5IGXH 1CFSB 1S7SA 3KJ4B 4J6RL 3IU3B 2XNAB 4UNUA 1ZLWH 2YBRA 1GRWA 3BP7A 1P7QB 3NPSC 5GZOC 4MCZB 4HV8A 4P9HC 1LD9A 4H20H 2BY1A 1FNFA 1XIWC 1INQB 4FP8L 4F8TA 1IAOB 1LO2H 2R4SL 2X1QA 4BUGA 4G6JL 2CR6A 4IMLB 1F4WL 3QNZB 3QXVA 1I1AD 5D96B 5E94A 3VXUD 1MHHB 2DI9A 5I0ZA 3K2MC 4PJ8C 4O2FB 2JJUA 4ZNCD 1A6AA 1C7TA 1MIMH 5FYKL 1G6VK 5HSFA 2OBGA 4I4WB 1QO3B 1WGOA 4XNMB 5C0AA 5EO0B 1ED3B 1GH7A 2IAMB 1MJJB 3RQ3A 2A6DA 5DYOA 2E6JA 3WIFB 2EDQA 5LGHH 2PYEB 1GGCL 3B9KA 2YKLL 4WWID 5ANME 4F9PA 1J5OH 5EPMA 1ZGLB 1A9EA 2ZOKB 3BOVA 3QPQC 2XTJB 2DN7A 5FOBA 3VFWB 4L9LA 2FZ3A 5HHNB 3LN5B 2BOCA 3CXDL 3GO1L 5DT1L 3W5MA 4Y2DA 3RZCB 2DJ4A 3WDJA 3RDTD 4IHOA 2E6QA 4HJ0C 3ESVF 3HE7D 4G8GA 3O0RH 5CZXD 1FIGL 1EAPB 3MNZA 2ZNWA 3ROLA 4OFYA 4Y0GA 3QA3A 1XGQB 2YPKA 5DJAA 1NPUA 5C09E 2V5SA 3THML 5JW5A 2X6MA 5KVGH 2WUCH 1U95B 4AEFA 4FMFA 4UTAL 3JV4B 3V0VA 3QSKB 2I07B 1S9WA 1URLA 5LBSL 3VFRB 4PJIF 4WU5A 3FONA 5F6IB 4JFHD 1NGPH 4LHJB 2BY3A 1WBYA 2XQBH 4LEOA 2IANA 1E6OH 1NL0H 1ZA3B 4LOUD 5DUBA 3MRBB 4WFEE 4Y8AA 1KCUL 3LCYA 4L4VB 1ZAGA 4ZPVB 4DKEH 2PW2A 3O3BA 4TSCH 5KAQF 1U6AL 4NWTH 4Z7WA 2R2BA 4E9LA 3MCLH 4XMLL 5KVEL 1KIPB 6CGTA 2AQ1A 4Z7QF 5AD0B 5C0JA 3H9SD 4U2ZA 1XGYL 2K9UA 1IJ9A 2BSRB 2D7QA 4U1JB 5KZCD 1UB6B 1PDKA 1CICB 4HUWB 4HX1B 3RVWD 4D0CA 3HAEG 3TZVD 1LMKA 1NC4A 1UM4H 3NZHH 3HPJA 5E24E 1IAII 3CC5A 4IOIB 2DRUA 1YJDH 4JR9H 1A6ZA 2MQ3A 5IF0A 2OJEA 4C54A 4L8SB 1MOEA 3K8LA 1XCTA 1JPFB 5ISZE 3L3HA 2H9GA 4UIKL 1YMHB 3CZJA 1DQML 2Z92A 1XGTA 3K46A 4DGVH 3RNQA 1VGKA 4O2EB 4MWFA 2CRMA 1VFMA 3QWQB 3AAZB 2Q6WA 3CFDB 3C2SA 2PXYB 5CP7B 4JHWH 3KPSE 5DQDH 3CSPA 5T5FH 1OGTB 3QUXD 2AGJL 4HIHA 4KKCD 4YXKL 3OF6A 4HKBA 4WO4A 3VD5A 3GIVA 2AEIT 2FNBA 1L7TH 2H26B 4M43L 1FNLA 1WTGT 3AREB 4BSWA 5C0DA 2FWOB 3R8BB 3IFPB 4JGUA 1UH3A 2VLMD 4KROD 2OR7A 1AKJD 4YUEH 4D9LH 3BGFB 4X7SH 1NDGA 5C0ND 4GSDL 4K8RL 5FKAB 4JFXA 1DEDA 3QIUB 5E6IA 3U0WL 3ARXA 4J8RB 1HQ4B 4O51A 1W0YT 2ICES 3EYFB 3VXTB 5DZLA 5T33L 3C5ZB 3R0MA 2R0LH 4DN3H 4YHKH 2PO6C 3TO4A 4PY7A 3T3ME 2P42B 2BMKB 1QLFA 4OQTA 1MCKA 3E6HA 5JZ7D 2DM7A 3EOTH 3GMQA 2Y6SD 2A2QT 3LDBB 4OIBA 1LP9A 3PHOA 2GITA 1L6XA 3LQAC 4QRRB 5FM5M 5BV7L 2XT1B 3ORJA 2VERN 2AEWA 1Z5LB 2VMFA 4PG2C 3MFFA 1KEGL 3QUML 4G6FB 4HWBA 4NQDE 1T4KB 1A4KA 5F3HB 3VDCA 1V05A 3RKDC 1IMHC 1NCBH 2HT3D 4XP6H 4XTRD 4DUWA 2VABB 5C71A 5F88B 3F6IA 4YFEA 2GK0B 4KKLD 3PWLB 4XT1C 3QUZD 4TUOA 3WDIA 5HI3D 5EORH 4BQ6A 1N5AB 3CDFA 1FVDA 4YHZH 1T5XB 5EUOE 4NHUB 4YHML 5C08D 2VLKA 4I3RH 1ERNA 2Q86A 5DS8B 3QDMD 5EU6A 4JREC 4QTIH 3CLFH 3K8KA 2K3TA 5DO2C 4N9GB 5JXEA 3SY0A 3NBNA 3H42H 3BYTA 4DZ8A 4HFWB 4ZO6A 4ODXB 3O81A 4LAQH 4ZFOA 2O61A 5BZWA 1SBSL 2VZ1A 5FA3B 3VFTB 3GNMH 3JWNC 1CT8A 3WL9B 4PJXB 1TIUA 2P8PA 1ZVHA 2OTUB 1HXYA 3MZGB 2UZXB 15C8H 3ARFB 3IFOB 3RI5K 1REIA 2WV3A 4L4TA 4H8WH 4OZGB 4YC2C 1EO7A 4RFEB 1D5XA 1N6VA 4KRNA 2G5BA 3CFCL 3GBNL 3QQNA 3DV6B 3VRIA 4DOHE 1AHWB 5DHYB 5J9PA 4Y5YB 3LKNA 4PRHA 2Y5EA 4YFLF 3ILPA 4TQEH 1RPQA 2FX8L 3EDKA 4JRYD 1TZGH 5E2VH 4GQPH 2BC4A 5T1DL 1SJVA 4FABH 5F9OL 3TF7C 4PP1C 1P1ZA 5GRJL 4GOSA 2A74A 4ZUTA 3VWJB 5F7WC 2GSGA 3UBXA 4KJQC 1KC5L 1OB1B 1R3JB 2BY2A 3KWWB 1H8OA 2VZSA 5GSVB 5CEZH 1ZT1A 4RGNB 4CU6A 3D85D 2IBGA 4S1SL 2DQTL 3B6SA 5DHVH 1M71B 1UA6L 2VQTA 1O7VA 3MTRA 4P57A 5CLTA 4P46B 1MAJA 2VLLA 3ME0A 4EZMA 4OFIA 1KCVL 3PHQB 1OARH 4K07A 4MHHG 4P5KB 2BNQE 3H7BA 1OVZA 1UJ3B 4CUCA 3O9WD 4KZEL 2V6HA 4U7SA 4F7CB 4P2RB 4U6HA 2AVGA 4PIRF 4QXTA 4ODWA 2EE6A 3B2UC 2D7PA 1CN4A 4NC1E 1ZLUK 5E1AA 1UT9A 2DWDB 5DRNB 4Z0XB 1T0NB 4OCXL 1QZ1A 4LHQB 1HI6A 5KSAD 3O6FD 1IBGL 3GI9L 5D7JC 1I7UA 4FP8H 5EO1A 2R4SH 2EIBA 4P2YA 1S9VB 1F4WH 2UZIH 1BF8A 4XCYB 4JZJC 4KY1H 2FECL 3HE6B 3TIEB 2DKMA 2HVJA 2VXQL 4YBLB 4E0RB 1MAML 1PY9A 5DC4B 3GMLB 3CH8A 3RTQA 2XG4A 5FYKH 5FUOL 1SYSB 3BXNA 1A02N 4AIZA 1NMBL 5CAYB 4YFDB 4FMKA 5T3ZE 1F3JA 3MYJA 3RGVA 1NAMB 3WNOA 3GSUB 3V5KB 1HQRA 4NCC2 3FZUD 4Q9CA 5ESQA 5JORA 4DVBA 4KFZC 5DK0A 1BZ9A 3FQTB 2BVYA 3LB6C 4PJGF 1RZIA 1DSFL 3CXDH 3CVHA 1FRGL 1JMXA 1GPOL 1KUMA 1FIGH 3QEUA 2MWCA 4AH2A 1J10A 4YGVB 1L4IA 1GGUA 3BVNA 3FCTB 1U8QB 4EUPG 1D5BA 4GXVL 1FCCA 3THMH 5IV2A 3U36A 1BOGB 2V5RA 4LCCB 2XKNB 4P5TA 4UTAH 1A2YA 1RULH 2PTUA 1A3RL 5LBSH 2VITB 4OFVA 2EO1A 1Q0XH 4X9HA 4MGXA 3VI4F 4JQXC 3BD4A 4U6VH 1AGFB 3SBWA 1HIMH 2YN5A 1DEEB 1TXKA 4GKOA 1F3DJ 2AW2A 3DSFL 4XVTL 2YA1A 5HGAB 3UTSB 5A2JH 1ZT4A 2AJZA 4NO3A 1GZQA 4X5WB 4XMLH 5KVEH 2R1WA 1A1MA 1SJHB 1UYWH 1UZ6F 4U1GC 3ALXA 4WW1A 4HAGA 1QFWL 2ATKB 2J1KA 3TT3L 5J57B 2EC9T 3RWIA 4H25B 5A3IC 2OQJA 2QSVA 3GZKA 1JGVH 4GUPA 1FYTD 2X7LA 4LLMA 4MMXC 1NQBA 4F37F 4R96B 4QRTA 4XNXL 5MENE 4FXGB 2VZOA 3ZE1E 5GZNC 3L7FA 2PETA 5FGBC 3V4PL 3E6FB 4JO1L 3SOBH 4YNYB 4HCRA 5GS3A 1NUNB 3UYPA 4UIKH 2Q7YB 2QKIB 3TNNB 3REWB 3FOMB 4PJ5B 1KXQE 43CAA 2HWZH 5EC2B 5D2NE 4UAOC 3IRPX 2BHUA 5DJXA 3OXRB 1PG7W 3IDUA 1YA5A 4YXKH 1W72L 2RBLA 4HDIA 3VCLA 3OHXA 4Y19B 2NX5B 4HWZB 1CIUA 3SPVA 3WFCL 2NY3C 1UB5A 4HIXH 1KG0B 2BFVL 3HUJA 4YHIA 3D69B 1QFHA 2EIDA 5B38B 3IDIA 2OSLA 2YN3A 4GSDH 4K8RH 2I60L 5GGSA 2O5XL 2X1XR 4PRID 3LKSB 3L3IA 2QHRL 3S5LB 5BJTB 2X4NB 4FHBD 3QULB 4HXBH 3T3PF 3OB0K 4NO5A 4WFHE 3MLWL 1WWBX 5T33H 5J7CC 4F15C 1U8MA 3CDCA 2XN9D 3ZDXF 4OJFH 4UINL 3QBTB 5GS1C 1QHPA 1AIFB 1D6VH 2XZCH 2NCMA 3VH8G 5GJSL 4WIQA 5SWZB 2ERJC 3UC0H 3QH3B 4TPRL 4RRPA 3VRLF 4NGHH 3PQYB 1OPGH 3IDJB 1DQQB 4NQCD 5M94B 2EDWA 5I16B 2GTZB 5BV7H 3O4OB 4NKMB 3VRJB 3QUMH 3EO1A 4LQ1A 1GOFA 1KJ3L 4ALAL 3B4NA 3P0VL 2FBJH 5DWUL 3QG6B 2H8PB 4O9HL 1E4WH 1I1AA 1PKQE 2XPGA 1CLZL 3F7YA 4UMGA 2CO7B 1CL7L 3VXUA 4KMTH 3H3PL 3BIKB 3D3VB 1QNZL 5GGVY 1PYWB 4NBZB 1MRFH 2XYCA 5MERA 4ZFFA 3RY4A 4APQB 4Y4KD 1F02I 3IDGB 2X09A 1OAUH 2VZVA 4LHUB 4U1HA 3V4VL 2D03H 2COQA 2QV2A 4JZOB 3H2WA 5E8NB 5BVPL 4Q0XL 2F19L 5E03A 3P9MA 3RJDA 3EOYG 7FABH 3DUSA 1SJXA 4LU5L 1VEOA 2ZUTA 4MJ5A 3BKJH 3DX9B 2DMKA 5HHPB 3EGSA 3DI3B 5JW3H 3OR7B 1QSEB 3GSQB 1GAFH 4HIEA 3U48A 2VUOA 4PJ9C 4OCMC 2CIIA 4I0PB 1U92A 2IQAA 3WFZA 3QYCA 5GGUA 4QHKJ 4XRCB 3VFUB 1EHLH 3RDTA 4EBQL 1FYHB 4JY4A 4PJFB 3HE7A 4L3CB 2D31A 1IGJB 2GSIB 3PWJA 4JFED 1ADQH 1RZGA 3U30C 4NQTA 1LVEA 5CHNB 4RISL 3V5HA 2D9CA 3IDYC 1HHHB 5DD3L 2NLJA 1U3YA 2ZUSA 3STLB 3BEWA 3K4AA 4M1DH 5BMFH 1OTSC 2YD4A 4JDVA 5DR5H 3DURA 1X7QA 3LH2L 5F9JB 2D0FA 3DRTA 3GBNH 3ARQA 5FDWA 1ZHKA 5GSRB 3P73B 4G8GE 4PJCB 5I1LB 3N1FC 4DAGL 4TVPE 2VSCA 3S6CA 3CMOL 4LKCB 5T1DH 2DIAA 5F9OH 3GBLA 1VADA 1I1YA 5DEGB 1C5DB 1Q9KB 4J23A 3ZTNL 2H32H 1NC2D 1NFDA 5MHSD 1KC5H 3UAJD 4CRPA 1S7RA 2GHWB 1QVOA 4XB8A 1KCLA 4U6TA 3BT2L 4HC1A 3H9SA 4P0DA 1MJ8H 2H2PD 4RMWA 3C08H 3HRPA 3MLRH 1BAFL 1A0QL 2ADIA 1I7ZB 2IANE 3CFJA 3VXSB 4F9LC 1WQVT 5HYEA 3BH8A 4QY8B 4F3FA 4ZS6D 3TZVA 4NKOA 3QG7L 1WFTA 4YHPA 3D6GA 2PYFA 1KCVH 5H2BA 4Z7WE 5F8QC 5K9JL 5CEXA 3P77B 4AK1A 3HA0A 3RVUD 3S97C 5E6ZA 3BP5B 4NQXA 2QADB 2UWEA 4X6DF 3TCLB 2W38A 3O2VL 4MNHB 5JW4M 4O00A 1F6AB 3RRQA 1CYGA 1FNEA 4Y5VC 4PJEF 5DJYA 1MQKH 3C6LB 4PLJD 5JHLL 3W9EA 2Q1EA 5L2JA 3CCHA 4HT1L 1NFKA 4LARL 3QUXA 5KJRL 4HS3B 3BPOB 4RAUB 1WICA 2R4RL 5D72L 3O6ML 1CLYH 3SHSA 2VXQH 4PTTB 4HJJH 1MAMH 5DFVD 2GJZB 3J7HA 3ZSSA 1A7NL 1LEKB 3ZKMD 1AKJA 3QQ4A 4HUVB 5KOVC 3CSGA 5IBLD 3OAYH 4FQLL 4KHXL 5L0QC 4ZODA 2MCPL 1CQKA 1X6LA 1ZHNB 3IGAB 3TT1L 3VXMD 5IIEA 1AO7B 4X4XB 3WNLA 3TEUA 5K9KA 2ZOLA 5HYQA 1EFQA 4WFGD 1R3LA 4JY6A 5C07D 4L8DA 1JPTL 2W60B 4NJAL 2Y07H 1FJ1A 1XZ0B 2D4FA 1GPOH 2ITCA 4PB9H 4PP2B 3MUGA 1QHOA 2QQNL 5J6HB 4JZNA 4KJPC 3I84A 3BJ91 3OXSB 4AT6A 3KPQB 4LCWB 2IBZY 3I3BA 4GXVH 5GRYA 2HFTA 2ICWB 2BNUA 1BQHG 2IG2H 4JLRB 1FFPB 1VSCA 4PJ8B 1BLNA 2B7DT 1BX2B 2YPLD 1E4XL 5DJDA 3VG0H 3MRPB 1R5WB 1J87A 1UWXK 2ICWJ 1IM9B 3EYSH 1CXIA 4X6CF 3ZE0E 3W39B 1LP9E 4W70A 3QUZA 1U8HA 1UWGH 2CMRL 2IJ0C 3GSRA 3MJ9A 4M02A 1N3NA 1A14H 1N7ML 3REVA 5C08A 4JFDB 3DSFH 4FQHA 4XVTH 5K9OB 2JIXB 4OSUL 3QDMA 4Q6IC 1RJYA 3S4SG 5JQ6H 3RIAF 1CGYA 1M7DB 3MRLA 2BVOA 4F8QA 3INUL 3TT3H 3D39D 3NGBC 4FFWD 5H94B 3SN6N 1IM3B 3A6BL 3JTTB 1IEAA 2VLKE 4OBRA 3QIBD 4I9WE 2MHAB 4HFUH 3BIAX 4XPGH 3RPKA 1S9YA 5EU6E 3NFSL 3GSNB 4OKDA 3R8QA 1I7RB 1C5CL 1IAMA 5CBEA 2VXUH 4MAYD 5BW7A 1F4XL 1JHKH 4XPHL 2HFGL 3AY4A 3ZDYE 3V4PH 1WIPA 2YUWA 1BBDH 1RIUL 3G5VA 1TJGH 5I1AA 3PGCA 4KRMB 1HHJA 5T3ZL 3C8HA 5J89A 4IRSB 1RK1A 5IBUG 1P84J 3DIFA 3KPLA 4BH7A 2BOBB 3V79C 2FGZA 1P7QD 3FO2B 3HI6H 4ZQKA 5CSZB 3PXJA 4OBSA 3L95A 1VPOL 3TFKC 4JPIA 4OF5A 2FB4L 5FYJE 4M6OH 1W72H 3TBWB 2P8LB 5D71L 4OZIA 4L4TE 2ATPB 4LDLB 2VE6A 3WFCH 2BNRD 4X4MA 4YX2L 5F1NB 2CKBA 4XC3H 1DQDL 4F57L 1OAZH 2J8OA 2A6IB 3P4OB 4AIXA 1ZVYA 4NKDA 1I4FA 4ZUSB 3SE4A 1XR8A 3HPLA 3N1MC 5IB3B 5C6PB 4PRHE 5ADOL 2G9HA 1HHGB 3D85A 2AKRA 2O5XH 2QHRH 4IJ3C 2YA2A 5TDPB 3LMJH 1P6AB 4X6BA 2GFBB 2PYED 3IS1X 4FXKB 3WJJA 4DGIH 5CIPA 5IFHH 1NGZB 4X8JB 4QYOB 12E8H 1TZHB 3NIFF 1FGVL 5DK2A 1ZMYA 2XTJD 3WN5A 4UINH 1PZUB 2KUTA 5EU5A 5GPRA 3O9WA 5IP4A 4FG6D 3LPFA 4I0KA 4G6KL 3OR6B 4W6WB 3WD5H 1YNTB 2Q76B 4HBQA 1BM3H 4PRBB 1B0GA 1DUYB 3MRIB 3A6OA 2ZKHH 1EEZB 1LE5B 3PGDB 5KSAA 3O6FA 3L3KB 1H8SA 4QXUH 3P0VH 3A6CL 4BFIA 2X4TB 3TYFA 4O9HH 4OZHF 5LAXA 4HPOL 5K9QI 1N5YL 5D5MF 3DO7A 4MZ2A 5CILL 3CXHJ 4HKJB 3GMOA 1A6PA 1JUFB 4G43A 1G7HB 2XA8L 3ARGB 1KTLB 3MRJA 2YHGA 3W0WB 3RNKA 3TJHC 2UY6A 4JN1L 4KKBC 3VG9C 1UJTA 3K74B 1JPST 1OD7A 2PO6B 2A1WL 4FQ1H 1QG3A 1RUQL 4HJGB 1EFXB 3DRQB 4OCRL 1UKTA 1X5IA 3VGFA 2NW3B 4LU5H 5A16A 1G7QB 3QDJB 2ADFL 5DMGD 3U0PB 3R0NA 1CICD 2R2EB 2ORBH 2B5IC 3LKOB 3CDGA 3FAXA 1P7KA 2B2XL 2A6JB 5KSUB 1ULVA 3ARDC 1KXTB 4R26L 4OGXH 2FJFA 1LDPL 1I85C 4PJAF 4AQ1B 5BS0B 5F44A 5DSCB 4KK6D 4DZBA 3FO1A 3FRUB 2FJHA 3WIHA 3J8F7 3SKMB 3JWDL 5DD3H 1T0MB 3M45A 4CVZB 4K94L 3D0VA 3WHXA 4MA7L 1TLKA 5B3JE 3LH2H 4XXCC 1U8NB 4EVNB 4FQ2L 5IMOA 4PRAB 3I6KA 4M6AA 1F11A 2AEQH 2YUVA 4GRWF 2WBWB 2WINA 5E2WH 1YEIL 3QEHA 3O3DB 1FG9C 1FL5A 3KDMA 5JO5A 3CMOH 4NNPL 3ARED 3QUYD 1IGMH 4CAGA 4NZTL 3UTPE 2IPKA 5AG8A 3CFBB 3NMEA 4UU9A 3CAFA 4K7PX 3ZTNH 2DTML 4J4PC 2KDGA 4N0CC 1EGJL 5I76A 2EDHA 1AH1A 3BT2H 2LU7A 4DCQA 3N1QC 4YZFE 2W59A 2EDLA 3QIUD 1T0PB 2F74B 5FO8B 1FPTL 2VDPL 1KJ2B 5DD5H 1T03L 3FQNB 2FH8A 1MHEB 1U8IB 1FYTA 1HZHL 3BO8A 3GDBA 2CRYA 1F3RB 4IS6B 1FCGA 3JUYA 1IGFL 3BMVA 5D6DC 4EJ1C 2YD7A 2CXGA 2H45A 5FHAL 2OK0L 3ARBB 4XNYH 1WC7B 5F7YC 4PGBA 1AP2B 4C58B 3BWUC 2J88L 5CEZD 1VDGA 4HWEH 1NANH 3JVGC 3O2VH 4HPYH 4ZUUB 1JMZA 2EDYA 4G6AD 1PG7L 4X8XA 5KOMC 3VD3A 1FLRH 5JHLH 2ESVB 3F8UB 3KPNB 5CINH 5FGCE 4JFFD 4ODVL 3IF1A 4HT1H 5HY9A 5KJRH 1C1EH 2OXGA 1N6UA 2FHBA 4HZLA 4WUUD 4PJGB 4P3DA 1QKZL 1QRNB 2XRAH 4MDIB 2AXJA 1A4JB 1YNLL 1JF6A 2KL6A 4XNZB 3ZL4H 1IL1B 1BVKA 1HSBA 4U1MA 1T2XA 3SJVB 1QBML 4UT9L 4PRIA 4YDVA 5DJ0A 5DMJB 5T5NG 3TT1H 3U1SL 1NCAL 1WWWX 3NCJL 4NRXA 1MH5B 3CD4A 2F9BT 5CP3A 4NCDA 2HLFD 3DUHA 1DBBL 2RFXB 3HUJE 5SV3A 1AI1H 4QO1A 1KIRA 3SKOB 1JPTH 1DVFB 3UP1A 2DQFA 5IW1B 2FJGB 5EOTB 1W0VB 1XH3B 2R1XA 3N1PC 4NJ9L 2R9HD 1JGUL 3BN9D 3OKEB 3BGMB 1MCOL 3HI1B 5TGBB 4O58H 5HYJD 4NQCA 3AS0A 3B9VA 3L5JA 1Y6NR 1LNUA 4JZJB 4OLYH 2VAAA 4JGMA 3MRMA 4U7KA 5KVMC 3PE9A 3HS0B 4P99A 1ZTXL 3W5NA 3JWOL 1E4XH 1OAQL 4JM2F 5CZVH 3RVVC 1JPGA 3ULUC 2CKNA 1CFTA 3BE1L 3GJFH 3VGGA 5I8KL 5IKCB 1FG2B 3IDNA 4XBPB 1X3DA 2CMRH 5EZJB 2H2SD 1TPXC 1XGPA 3V0WL 2Z91B 3MGAA 4Y4KA 5KS9A 3I75A 1N7MH 3PWPB 3VWJD 4OSUH 2BSSB 1HYSD 4I48B 2AJUH 1UCTA 2ZPKL 5KSBF 4IOFC 1AJ7L 3VXUE 4RGND 1S7WA 5CKAA 4KI5D 1Y6MR 4P23B 2JB6A 2W0PA 1JI2A 4LSTL 4OFPA 3JV5A 3KYNA 5J11B 1CD1B 5IBTL 4LSUL 1T20B 2IFFL 4BSVA 5FF6A 4RAVA 3G6JA 1Q8MA 3LZFL 4EXKA 3CMGA 4JPWH 3MBED 1FNAA 4U3HA 3WXVL 4X9GA 5GRZA 3QB7C 1ACZA 4PR5A 1C5CH 1AY1L 1F42A 2DD8L 1F4XH 4XPHH 4ELKA 1HEZA 2JELL 4JFEA 3UJJL 5IB5A 4J2XA 5GRWA 5I9QB 1XCQB 2VJXA 1PEWA 5CJOH 5T3ZH 4LLWA 4BQCA 3ZKND 2GY7B 3HZYA 4LVNC 5JHDD 1WBXA 3Q3GB 5E00A 3UXFA 1YY8B 1DDHB 1U3HD 3UDWC 3PABB 4PJHA 3L5XL 4JQVC 4NDMA 5D71H 2EDBA 2FIRT 5INDA 3SGJA 5HYSB 3QO0B 4OLXL 3W11C 1MCLA 1YEDB 3HE6D 3OZ9L 1CE6A 1KENH 2N7BA 5CBAB 1YEFL 3H6JA 4QCIB 1FORH 1G9ML 1NC2A 1XGUB 2EYRB 2XV6B 1OTTD 5H35B 4ZYKB 1LO5A 2GYSA 1G6RL 3RL2A 2WMPA 3QO1A 5ALBL 5LGJA 5EU3A 1IVLA 4IM8A 4PV9A 4C83B 1VESA 5HVGB 1MHCA 4GRLB 3PL6C 2IALA 5I71C 2HKHL 4JANA 5D7IA 5KTEL 1KCKA 2AJVH 1DP0A 5IK3B 1FGVH 1NFDE 1EERB 2CJUH 3TPKA 3DX6B 4KUCD 4M48H 4OM1H 4HWBL 4LMQE 3H9SE 1PZ5B 3Q6FA 1AXTH 4UAOB 3F7RA 5J1TC 1BZ7A 4U1SB 4G6KH 2CUMA 1FL6B 3G5ZA 5DMKA 5D1XC 4A6YA 4OF6A 1S5HB 4J3OC 5BOPA 4JPVH 1VHPA 3T3MF 5MI0C 3VGDA 5DEFB 2IPUG 1YPZF 2NY3B 3NAAL 2NY1C 3G08B 1X4ZA 3A6CH 4JVUA 4ZDHA 5SX5K 2J6EL 1HWGB 4Q2ZB 2NY2C 2UWEE 4HPOH 2L7JA 1N5YH 4MSWB 1N0LA 4QOKB 1JN6B 2HN7A 1HDMA 1YDPB 1ITCA 2VDNL 1I9EA 2DLFL 3V2AR 4M4PA 4WU7B 5DGQA 2KZWA 5F9DC 2OZ4H 5HGBB 4G8FB 2X41A 3BWAB 1OHQA 2YRZA 1R3HA 3FRPA 5I1KH 4HG4J 3UTSD 3IXTB 4ZUVB 2C1OA 4F15B 4P59H 1OL0A 3MREB 4PGDA 2YD1A 1RJCA 4LF3A 5GS1B 3NFPB 2VUYA 3VXMA 1SY6L 3F12A 2JCCA 5EUOF 5FYJL 4CADB 2XFXA 1NBZB 2ADFH 3OKOB 4F7EB 5I1HL 3PV6A 2ERJB 4LRIA 1SYVB 1WUNT 2VLME 1MWAH 3QFJA 5C07A 2B2XH 1H0DB 1V3KA 1D9KB 4AZ8A 1Q0YH 4JCLA 1X5FA 4U1IB 5JMRA 5C0EB 1Y18B 1I3VA 2BSTB 2VLJB 3M8OL 2C3HA 4OCYL 3QCTL 5JIHA 4E42A 3TN0B 3BRFA 1ZLWK 5IFJB 1H3PH 3SDAC 5EUKA 4YHLL 2NY7L 3BDYL 2FR4A 2FLRT 4K94H 4PJ5D 3RVTC 5ICZA 4JQIH 4JRXB 4X0KB 1I9IL 3D87B 2YPLA 5F72S 3ZTJH 4CVXB 4KK5C 1X44A 3QHFL 5TE4L 3SO3C 1T5WB 1KNOB 1ZEAH 4K55A 4QXGL 3V6FA 1MREL 1YEIH 2BVUA 2AEPH 4KC3B 4OGAC 2VH5L 2W91A 4M6NL 1Q38A 5F7FA 4MD5A 3RPIA 1QFWM 5ETUA 3LSOA 5ABDE 1IGTB 4N5ED 4X6DB 3O3AB 1MEXH 3O3EB 4KPHL 4PJ9B 2ICCA 4E5XA 2CLZA 1EXUB 2X70A 4PJEB 3WFEL 1EPFA 1J1PH 3D39A 1H3XA 1GIGL 3HMXA 4ONGH 2UYLA 4AEHH 1T03H 4FZ8H 3BHBA 5EC1B 1BF2A 3E8UL 5C08E 5C0FB 2C1PA 3QIBA 4W4OA 3IDYB 4D0BB 5ICYB 3PNWB 1KN4H 5LWYL 4MAYA 1N8ZA 2OK0H 3X13B 5CCKH 5JUEL 3MV9B 3GGWB 2FIKA 2J88H 3BH9A 5SWZD 3DX7B 2Q3AA 4XAKD 1CFSA 5FEBA 4KQ3L 3OB8A 5L9DL 3PQYD 3IU3A 4IMKA 2XNAA 4HULB 2AJYH 3EHBC 4WW2F 2VC2H 2DJUA 4HS8L 4TNVF 1A9BA 1PG7H 3NN8B 1P7QA 2W9EL 4U6YA 5FM4A 1N64L 1A6TB 3F5WB 1INQA 3KAAA 2DQGH 1I75A 3MV7E 4IMLA 2ZUVA 3QNZA 5KN5B 1BHGA 1A7PL 2HG5B 3KLDA 5B22A 1MHHA 3D3VD 2BNRA 4O2FA 3U6RB 2HLAA 2RHEA 2NXZB 4KVNH 1QKZH 4ZFGL 1YNLH 3QUKB 4RCAA 4Z9KB 1AQKL 4APQD 1HOCB 1QR1A 4LHUD 2FEDD 1KB9J 4FNLH 4I4WA 1QO3A 4XP4L 1QSFB 3FT2A 5B38G 1K4DA 3CVHL 4JRYE 1FO0H 1T21A 3ZLQC 2CLRB 4OZIE 4Y4FC 3WIFA 2PYEA 3CPLB 3U1SH 1NCAH 4TVPH 1QSED 4HGKC 5IESH 1DBBH 2EEBA 2ZOKA 3MRGB 4X6CB 4NFCA 3RJQB 1FE8L 3VFWA 4HGWB 4WJ5B 4IDJH 2CGRH 3KHQA 3OKDB 3IAPA 1NFIB 2Z0BA 3WUWA 5I19H 2KQMA 2NXYD 1EAPA 5K93A 4MA1C 1BFSA 1MCOH 4XMPH 5ENWB 2HVKA 4IDLA 1TVDA 2AP2A 1UWEH 4CU8A 3MRQB 3GSXB 4JHAL 1GC1C 1GGIL 3UTZB 1ZTXH 3JWOH 3JV4A 2WK2A 4DKDC 3G5YA 3VWKD 1WFOA 2R8SL 1KV3A 1E6JL 4Z7OE 3QISA 4X7TA 5FECA 5I8KH 4EOWH 3WIIL 4YDIH 5A2FA 2JB5L 3SE9H 2O26U 2X44D 5L0QB 3KPOA 4LGRB 3V0WH 3HFMH 1FL3B 4NQSB 3FQRB 3LEXB 2RGSA 1WEJH 5BV7B 5FB8B 1NUGA 1F5WA 3AU1A 4Y16C 4R4BA 1GJIA 1EUTA 3U4AA 1IGCL 3V5DB 1KIPA 3GKWH 3VXPB 1AJ7H 2FO1A 3MROA 3JWDC 5FAAA 4LBEB 4UQ3A 1DUZB 3GSWB 2OX5A 1KJVB 1KLGA 1WZMA 2O5ZL 4U1JA 3VXSD 2NZ9D 3TO2A 1S9XB 1CICA 5GS0L 4HUWA 5JDJA 1EO5A 2NY5L 2YD8A 4HX1A 2XQYK 2X4OA 5GGRY 5J12C 5TPWH 3LZFH 2A73B 4L3ED 2F8OA 2IF7A 1ZS8B 1DLHB 1BVLB 4P3CL 4IOIA 2ADGB 4WHTB 1NANI 1WZ1H 1AY1H 2DD8H 5HI4C 1BVZA 1T7XA 2YK1L 4F37K 3JZ7A 4DUVA 4QRUB 3UJJH 2Z31D 3BPLB 1FH5H 2V7NB 2ZUUA 4UILL 1YMHA 4M5YL 4F7PB 2PCPA 2CK2A 4ODTL 4O2EA 3ZMRA 3KPPA 1H5BA 3C6LD 3ZE1F 3HZKA 1T2JA 1NGYB 3LRGA 5CP7A 4LLVB 2I9LB 4Z7VF 2A83B 1GGBL 5EN2A 4TN9A 3D18A 3AM8C 2AV7B 1JZ7A 2VR4A 3AREA 5H37G 3W2DH 4FTVB 4J3WA 3Q0HA 2FWOA 3ULVC 4G6ML 5EOQL 3IFPA 1YEFH 3HI5L 5HXMA 2AS5M 2D7TH 2F5AL 1RZJL 2BZDA 2OI9C 3DMMD 3VDBA 3ALWA 5FKAA 4NZUL 4KGLA 4OQTH 2J8UA 4YPGA