2QEJA

Crystal structure of a staphylococcus aureus protein (ssl7) in complex with fc of human iga1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
211
structure length
211
Chain Sequence
ESCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG ALPHA-1 C REGION
publication title Structural basis for evasion of IgA immunity by Staphylococcus aureus revealed in the complex of SSL7 with Fc of human IgA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qejA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qejA01
3QFJD 5FOBA 3T0EB 4EJ1C 3GHBL 1JZ2A 3KJ6H 4R0LA 4ZUTB 3U0TA 1HNGA 3I6GA 3T2OA 4Z78A 1KCSL 3X3FL 2HJKB 3MRHB 4IRJB 4LLUA 3WFHB 1U92B 1X5FA 4AL8L 5DRNB 3S37X 5C6TH 5ADOL 2ZPKL 5KZCD 3KPOA 3UC0L 3FHQA 5F1KC 4PJBB 1QD0A 4JO3H 3MR9A 4N8VA 1A4KB 4JZNB 3P30L 5EZJB 4P5TC 1QSZA 1ETZA 3ZKMC 2VITA 5DLMH 5CJ5A 2VZOA 1XH3A 1NGWB 2Q8AH 3BH9A 4PJ5D 3Q0HA 1BBJB 1M05A 4GSDL 4NWUL 4N1HB 4DKFL 2D0GA 4IOSD 3PGCA 2QLVB 3MXVH 3OKNB 5IMLA 1ORQA 1NMAH 5TF0A 4PUBL 3KPSA 2Y07H 4YHYB 3KPRE 5DR5H 1H3GA 3VGAB 1WTLA 2J8UB 3CLEL 1BF2A 2WWMC 3PXHA 2E7LC 1S9VA 3O0RH 4X6DB 2OL3B 4Z77A 1OL0A 3JVGA 4U6XA 1JVKA 2JELH 3S36X 1WT5C 5F96H 5T3XL 2PW2A 5F1NA 5EO0B 2ZSVB 5EORL 2B5IB 4I3GA 3DVIA 1WC7B 3EZ8A 1F4HA 1PYWA 2ADJB 2ITCA 2E7LA 3TVMB 1BFVH 3DX8B 1XR8A 4WEBL 1OP3K 3VFGL 4QXUH 1OSZB 3QHZH 1UG9A 1UM6L 3MXWH 4AEEA 1PKQB 1FHGA 5JPMB 5KSBB 2V2XA 5DD5L 4LCCB 12E8H 4ZXBC 1BFOA 1XGUB 5FUOH 3TGXA 1KACB 3D5OF 3NIDE 2BVQB 2LE9A 1RK1B 1O5DT 1EMTL 4M00A 4JDZB 4S1QL 3D85A 1D5MB 4ENEC 4KDVA 2BNRA 4U0RC 3PG2A 4E41D 5ID1A 2YD9A 2AK4B 3BAEL 1FNGB 1INQA 2CRYA 4NQCE 1S5HA 1DN2A 1A9BA 4CL7A 2WBJD 2FHFA 4F7CB 2HVJA 1LO4H 3MUGB 5JW3L 5EZIH 3HZYB 5GJSL 1ZSDA 1YPZA 4UV4L 3KYKH 1MFAH 5AAMA 5ANME 5K9KA 2A6DB 4NQVB 3ARGC 1LEKB 1Y6KR 4NQDD 4Z76B 2L7JA 3CDGA 2YUWA 1U8PB 4OI7A 4RDQG 3HNSH 5GS2H 2Q7YA 2SEBA 3HUJE 4XNQB 1KTKE 2XWJA 4CDHA 3I3BA 4MCYB 3O2DH 3BN3B 5AWNL 1R6VA 2B4CC 1I9JH 4I18C 4L4TB 4V1DA 3NIDF 1OTSD 1VFUA 2DYPD 2E7CA 3C5JA 3MA9H 2EE6A 3DWTA 4YXLL 4XVUD 1A6TA 4KXZI 1UJ3B 4CVZA 3M8OH 5DURB 4TVPL 6FABH 1J8HE 1CYGA 1ERNA 4P3DB 4RGOL 2D4DA 3FO2A 3WLBA 4XPAL 3OF6A 3MLTA 5EN2B 5HYJB 1UFUA 3GBNL 1UH3A 3KVQA 5C0FB 2P24B 4UTBL 4QHMA 2R8SH 4HHAA 4PJEB 3JTSB 3TO4C 1P4BL 1QR4A 2BSED 3B5TA 3R1GH 5I1IL 1IGFH 4LVNC 2CJUL 3K8KA 3PHQB 4JKKA 5LGHH 5EOTB 3HUJF 4KKNA 4X6CB 1ZA6A 5GGTL 1DUZA 3PGFH 4YHIA 4X5WB 3ZTNL 3SGKC 4HG4J 1VEPA 4U49A 1ZLVH 2QV2A 4C4KO 4C56B 4LEOA 2DICA 4DVRL 2FJHB 3L7EB 3RBSA 2AI0H 4JO2H 3TO4A 3KXFB 1MHEB 1AP2A 1KB9K 1RZKC 4GW1B 3N06B 2ICWB 2D7TH 4KAQL 3C60D 3C2SA 3G5YB 1NUDA 3PDOB 3FKUS 1JYWA 4NO5A 3QCTL 2VKXA 1U2HA 2VDNL 3EO0A 3KS0H 1N64H 3KPSE 4WW1B 5FYJE 3FCTB 3VXPB 4XC3L 2H41A 2IANA 3TPUA 5GRVL 4WWID 5KVDL 2OX5A 3DVNB 3LEVL 4I48B 4N0CD 4U3XA 4WWKA 4ZUVB 3STZB 4APQA 4P0DA 5IIEA 2XXCB 2FHCA 1IAOB 3ZTJH 3RI5F 4D94A 1J0JA 3CC5A 1LGVA 1FGNH 1X44A 1FCCA 3MODL 3RVTD 5E6IC 5DJ2B 3OAUL 2K7QA 4MJ6A 3EYOB 3N0PB 4R4BB 4XNUL 4ODSH 1YYLL 3DMMA 5D96C 4Z0BH 3FZUD 1DUYA 3HE6D 3WN5B 2DBLL 1QR1A 5E6IA 1DJSA 4ZYKB 4F57H 1XZ0B 3C6SA 4EI5C 3O41B 3RWEA 3MJ9A 4OGXL 3V6BR 3GUTB 1FC2D 5SWZA 2BNRE 3FT4A 1HHHB 1FC1A 2JIXB 3O2WH 4MDJA 5GZND 3LEYH 1F3DH 4K9EL 4KV5F 4E5XB 3B9KA 1MH5A 5EU7C 4JREC 5D6CA 5FYKD 1WK0A 1NDMB 1YPZE 3RZCA 4NZRH 1JGUH 3VXSA 1KJ2A 1T7VA 1H8OA 4LSRH 3UTSB 4XZUA 5T1MA 2EKJA 2D7PA 5BRZA 4H8WC 4J3XA 2NY6D 4M4RA 4HULB 4OD1H 1T22A 1OARL 1CD1A 5IFAH 1DVFD 5ICZA 5ALBL 2A77L 4NNPH 5FKAB 3MNZA 1CR9L 3RDTB 3VWJC 4Q9RL 1GOHA 4HXBH 1IKNA 2JE8A 4XCCL 5HYSA 2A0LD 3K0WA 1YQ2A 4XBGA 4V1DE 5KTEL 1A6VH 1NGQH 1BP3B 4NWTL 5J9PB 3GKWL 1NDGA 3GI9H 3V52L 2FIKB 5IBTH 3HR5A 4LKCB 3QA3B 2NLJB 4YUEL 4HV8B 4LRIC 2FRGP 5BV7C 4M5YH 1OD7A 3DV4B 4LKXA 4NM8H 2ADIB 2J4WH 3GMNA 4NQCD 4OM1H 4HUVA 1M7DA 2UUDK 2QHRH 4HWBH 4HWNA 2EC9U 3OKDA 3W82A 3GMPB 4CMMB 1I7UB 4NJAH 3VRIA 3PWPB 1T83C 4KUZH 1YPZF 2HG5A 2EDQA 4PLKC 1B6DA 3MA7B 1WVZA 4UT7H 2VDOH 2C4FU 1U8HA 1E4WL 4K7FA 1TJHH 4N8PA 1U3JA 2DQCL 3W9EA 4GAGH 5ENWA 5DD3L 3P4MB 3GB7A 1GC1H 1FPTL 3RZWA 5IJKC 4NN5B 4R2GD 5K9OB 3QPQC 3DO7A 4K55A 4OFPA 5F7LB 5SWSD 1QFWI 4HBQA 4WHYH 3B2VH 1AQDB 1S9XB 3ZO0A 5HI5C 1BWWA 3OV6A 1CT8B 2R1WA 1P2CB 3DPBA 2XKUA 4PJ9C 4YBQC 5L2JA 4MAYD 3SOBH 5DJDB 2G9HB 2EZ0D 2FZ3A 1O7VA 1Q94A 1N8ZA 5KSVA 1N4XH 5B21A 4AYFA 4HIJB 3V4UL 4HKBB 2IANE 2CUIA 4UTAH 1X5ZA 5CSGA 2UWEA 1AIFB 1Y0LB 1DBMH 4LAQL 3KDMB 3PGDA 2MQCA 1RIHL 5J6HA 1GGCH 3GFUA 5DD1L 1F8TL 1YN7B 2I9TB 3QIWA 5D5MB 1OGTA 5FGBC 1KPVA 5KS9A 3TYFB 4ZNEA 1SYVA 3MGAA 5JXEA 3FFDA 2JJUA 4I13B 3JWDL 4G43A 4WJ5B 5D7JD 3QUZC 1QP1A 2JLLA 1NAML 2AV1B 4LCUA 5EBMA 2OR9L 3PWNB 1A3RH 4OUOA 3TN0C 4ZPVB 2XQYK 1WIOA 5KANI 4JG1L 5HJ3A 5FGBA 4AH2B 2V9RA 3B2UD 1YNKH 4MQXD 5T1LB 4UNVA 3PWLB 1DBAL 4J1UB 3JV4A 5SWZE 1JPSH 1MF2H 1R24A 3WXWL 2IBBA 5H94A 4MS8C 5AZ2H 3DURA 7CGTA 4N8VG 1KGCE 3LHPL 2MPAH 3D25B 3V4VL 2AKRB 2A6IB 4AEHH 5CINH 1X6NA 1XR9A 2HT4D 4JFPA 1CL7L 1MCFA 4H25A 3VXTA 5A16A 4OZIB 5E4IA 5CKAA 3GMQB 1U8KB 3HLAA 5BXFA 5IMOB 2FEEI 1C12B 2JK5B 4PY8J 2N4IA 2P8LB 4Z8FL 4CW1B 3VXSE 1MEXL 1IEHA 4U1MB 3IDXL 1EAPA 1NCAL 5C86A 1T7YA 4U1JA 1U8OA 1U93A 5BRZE 2W0PA 1OGAE 1FJ1B 4MA1B 3VFRA 5LCVL 5A43C 1FZMA 2FBJH 3WHXA 2AABL 4ODWB 3TJEL 5GQBA 2YSSA 5L9DL 2PYED 5I8KH 3WO3B 2WQ8A 1X5KA 4OCWL 4GBXC 3NH7L 2C3GA 4W68A 1SBSH 4HPOH 4C4KT 2VDPL 3QEQA 2QBWA 3C9NB 5E5UB 4JRYB 4UV7L 4X7SH 2FSEB 1VFAB 3MLPA 2EXWC 4N8CH 1RUML 3W2DH 5A3IC 5J3HC 2GAZB 4HUUA 3OR7B 1U8LB 2XY2A 4MYWB 3G6AB 2VSDA 1RQ5A 4UIMB 4JFOA 3L9RA 2LTQB 4ODUA 5BVPL 2UY7A 1N6QL 3Q5TA 1A22B 3EW3B 2DKSA 2PO6B 5DRZA 5ESQB 3HPLA 3QDAA 1R3LA 2ZJSL 3UTQB 3ARDB 1GJIA 3IDIB 4QOKB 5F7NC 4GS7C 1BZ9A 1VFOA 2LABA 2WWKO 4M93C 4BM7A 2F53B 5B3JF 2A83A 2Y6SC 4F3FB 1HHIA 4PJFB 3F58L 3MRRA 4QHUA 3CNKA 4D8PB 2R39A 4JG0H 4M6OL 3MFGB 3VWKA 4MJID 4R97C 1N2RB 2D3VA 3MRKA 3G04A 2DQDL 3OSKA 5IB5A 3VI3F 3CMOH 4PJXF 4JFFB 1YEJL 2Z92A 2VLKB 2IG2H 4U6VH 4AMKH 4YEEA 1H8NA 2A9NL 4R7DA 2AEWA 5EFIB 5TQ2H 4QXGL 3V6ZA 3LQAL 4KVNL 3SO3C 5JQ6L 1QRNA 1NFDA 4Y16A 3T3PF 3UJTL 4OCSH 1BAFL 1QBBA 2VYRE 1F6AB 3MRBB 2W60A 5I30L 1XGTA 1PFCA 5DJYB 2UWEE 5IVZA 5C07A 3GJFK 4FFVD 3GHEL 3RL1B 2XNAA 4W4OC 3EOAB 5L7XH 4UBDD 3DGGB 3GSNA 2IFFH 1A6AB 3NCYS 4W6WB 1EK3A 4WW2C 4FQIL 5KS9E 1TJGL 3FO1B 2VZUA 3P9WB 2ENYA 2H8PB 3TZVA 4Y5XA 5ACZA 5D1XD 1P5UA 4HCRH 4XPTH 4QF1A 5GSVA 3D3VA 3IU4H 2XQBL 4BSWB 2HFEB 4LEXL 5GZOD 4CUCA 3D18B 1KOAA 1WICA 4L8SB 1IGYA 1YEIL 2AXFA 3V0VA 2BRRH 3OKMA 4POYA 5DJZB 3X14B 3CFCH 3V6FA 1C08B 5F7KC 3MRCB 3BP4A 1WF5A 2A6KB 2IMMA 3QULB 4JN1L 4KRLB 4MCZA 4ZOBA 2PCPB 3QHFH 3M17B 1NCCH 2ZOKB 3STLA 2HT3C 4X4ZA 4HH9A 4J6RH 1ONQB 4U1IA 4APQD 5EPMB 4OJFH 1F4WL 4Z7VB 3ARSA 4PJ8A 4RGMC 3P9MB 5T3ZL 2G60H 3PQYA 1S7XA 4XWOC 4Z7WB 4Y4HB 1R5IA 2VLRA 1CDUA 4X8JB 5J1SC 1FDLH 4FMFA 3RVXD 5D1QB 5KS9F 3G08B 4RISH 1CTNA 4RAVA 3MRPA 1C1EH 2LV4A 3MGTB 4IDJH 4NQUA 5CILH 1SJHA 1WZ1L 1IILE 1DLHA 3VGEA 1ZK9A 4KK6C 3ARFD 3DUSB 3GSOB 4PJCA 2X89D 4U6YB 1T89A 4QO1A 5K59E 1Q9WA 3QXTA 1S7WA 1MIML 1BEYH 1QEWA 2X4TA 3RQ3A 5GHWL 4TRPL 2YBRB 1CLYL 4AT6B 4XTRD 3A0OA 3QEQE 1X5LA 4PS4L 2P4AB 1IEBB 4JY5L 4S2SB 1LNUA 5CZVH 2VDQL 3HAEH 1KYOJ 2Z35A 3W81A 2XACC 1IAMA 3PV6B 4WHDA 4X0KB 4QRRA 2VXTL 4P3WA 2DM3A 1BQLL 2GTWB 4O51A 2JB5H 4MQ7A 4MNQB 2XN9A 2EYRB 4S1DC 2EIDA 1D9KB 4LPYA 1VESA 5D2NC 5C0CA 5F7FA 5CHNA 2IAMD 2XZAH 3MV9A 4EBQL 4K3HA 3VXSD 2DMBA 1SJVA 3TYGL 4BZ1H 5EU4B 1KN2H 5KVGL 4MQSB 4KZDH 3MRMA 5I1DA 1UXSB 4HF5L 1OGAD 3QI9B 2ATKB 3UCRA 3KPNA 5KSUA 5C08B 1QFPA 4YO0B 2G75B 1OSPL 2H3NA 3GMMA 5K59F 1CS6A 2IPUG 4AENB 5KVFL 4KRPB 2NY2C 3NABL 1IFHL 3REVB 4OLZH 4ZAKC 5LGJA 3HCVA 4KHXL 3UX9B 1LEIB 4NN7B 3LN4A 4OGAD 1I4FA 5CJXA 2VDML 3NFPA 2E7BA 1K6QH 3QO1B 4O58L 4WI7A 1YY9D 1JF5A 1H5BA 1QRNE 1NFDE 1I8IA 2YC1A 1GGIL 5E8OB 2FO1A 4JZJC 4HKJA 3O45B 5C07E 4NNXA 1J0YA 4K3JH 3ZDXE 1JMXA 1MNUH 5J6GA 4G5ZH 3RAJL 1LEGB 4D3CL 2CIKB 3WSQH 4RIRB 1T03L 2RB8A 2CGRL 4JHAH 2AXGA 1JF6A 3RX8A 1QKZH 2NY5H 3PDDA 3D2UA 3QO0A 3U9PL 5EZOH 3AM8A 5B8CB 3D3VE 5F9AC 4PR5B 3OGOE 4BYHA 3CU7A 3L3HA 3OGCA 5I1JH 1I7TA 2ZUWA 3AB0C 1T6WA 1IGCH 4M4PA 2ZOLA 1CFSA 1EEZB 4NQED 5IB2B 3TV3H 4OGYL 5E8EB 5GS1B 1UVQB 4EUPA 1ND0B 3RA7L 2WBKA 3BYTA 4XAWH 3P73A 1JBJA 5SWQB 3BZEB 4G8GD 5CEXB 1NFDF 4XGZB 1VCAA 3S88L 2H2PD 4DN3L 1JPTL 5E5RB 3CD4A 3WFEL 1CDGA 3NCMA 3GM8A 3LKQB 3WNMA 3CLFL 1FRGL 3ZDXF 1MCJA 4D0DA 2D03H 5D9SB 3GMRB 1WZMA 4OZHA 4YE4H 2VZVA 3PQYE 3RWJB 1FSKC 2ENSA 1JV5B 3EUUA 1OTSC 3LD8C 2NY4B 4YHML 4ALAL 5HDLA 3C2AH 1QBLL 2GCYB 3ZSTA 2HYMA 1Z9MA 4XVUC 3SDDB 5KG9A 1G7MA 1C5DB 4U1NA 4YHLH 4PJCE 4OBSA 1TMCB 2GEEA 2WWKT 4CNIB 1EHLL 4GMSH 1MWAL 2GITB 2IALA 1DQTA 3BPLC 3TCXA 3IETB 4Z5RB 1MCOH 4EDWL 3CFJA 1HYSD 5BV7L 4CADA 4XP9H 1MCBA 5JR1H 5L2KB 3MRDA 4QRRE 3MJGX 4P2RB 1SYSA 4LSVL 4O2FA 4DGIL 2ESVB 2OMNA 5EZLB 4QRSA 5I1GL 4OF3A 3UYOD 3PE9A 2XN9E 4O2EA 4JVWA 4J3VA 3NPSB 4ONOA 1IKFL 2MJWA 3ARYA 4GKSB 4NUJB 3UBXG 1NAKH 1A7PH 1WCBB 5C0CE 3X11B 2E27H 1N0LA 3ILPB 4JFEB 1OPGL 1P4LB 3BX7C 4YIQB 4MD0A 5D7IB 4JPKL 3C60C 5BVJA 3L3OB 4IOIA 4YPJA 3BRGC 1I3VA 1MFNA 1KTDB 4O5LH 5INDA 4PJCF 4DW2L 2A6JB 1M1SA 1OB1B 1S5IH 4PGBA 3VCLB 2V5SA 1SVZA 2OLDA 1G1CA 1QLEL 4IDLA 2YUZA 4N0CC 5DSCB 2BRQA 1NCTA 3LIZL 3M1BB 1TJIH 2ED7A 4DQOL 2CIIA 4HJJH 1YNTA 4NPYA 4M5ZL 1FFQA 2I07B 4RMWA 1RFDH 4KKBD 5ILTL 2EH7H 5F72S 1WCQA 2QL1A 5E8NA 4QNPE 3D48R 1GGBL 1S3KH 4NO3B 3SJVA 1XIWC 3K46A 2ZCLH 4NO2A 4FQCL 4AZ8A 3VGFA 1VB9A 1Y6MR 5I66A 1BFSA 4LRNL 1U8IB 5BZDA 1PAMA 2IGFH 4NO0A 1X6LA 1FV1A 3FZUC 3HE6C 2VQ1B 4RGND 1XIWA 3V9FA 4X4MA 1MLCA 5GRZA 2G5BB 3IJSA 1IEAA 4XNXH 2HN7B 5DHVA 1ZA3B 1FN4B 2HJLA 4OCXH 5C8JB 1MJUL 1MJ8L 3T3ME 3VWKD 1Q9OA 5GZNC 3OX8A 4G3YL 1RZ8B 4JPIB 2OTWB 4MHHI 4YDLB 2A73A 1MI5A 3FN9A 1H3WM 1CDIA 4G8FA 4Y4FD 3O4OC 1JNNL 1QRND 1TVHB 2EIZA 4QTIL 1K5NA 1I1AA 1ES0B 3CVHH 4ZDHA 4XPBH 1CFTB 4JGJA 2KQMA 2NY6C 3OHXB 4BZ2H 5DJ6B 5FKPB 3U4EA 3ES6B 1ZVSA 4XMPH 4PTUB 1RAMA 1EBAA 2AJUH 4OZHE 1IL1B 15C8L 1B2WL 2B2XH 2NY3B 4XBEL 3ME0A 5D1ZA 3E6FA 1BVLA 1VPOH 4DCQB 3HAEB 2DLIA 4P57A 1G9NH 4X5XA 5FO8B 5E9DB 1A6ZB 3WIHH 3DRQB 5FM5M 2AJXL 2GFBB 2X4PA 3T3MF 3RI5K 2OI9B 4QRTA 1LP9B 1WQVT 1XCTA 3NA9H 2Z4QB 1UT9A 3KR3H 3QNZA 3L5XH 4ZTPH 2J6EA 3QWOB 5HY9B 2MKWA 3BQUB 1LE5B 5JHDB 3ZE1F 3E8UL 5CEZE 2OK0H 1TZIA 4I3SH 4Z6AT 1IRAY 5C0BD 5E7FA 3RRQA 4QRPD 3MC0A 5CKGA 3MLUL 4CGTA 3QNYA 2WLYA 2BHZA 2RHEA 3TFKC 5C0EB 5I1LA 5ELIA 4G9FE 1RJYB 4HXAH 4P46C 4JY4B 5MI0B 5DHXB 3CMGA 4OZHF 2FD6L 1A6PA 2H32B 3P40A 3QDGD 4R2GC 1FYTD 3EKCA 1KIRB 1WIPA 5FEBA 4YR6B 2VDRH 3AREA 3INUL 2F5AH 1DR9A 2FX9H 4MAYC 5T1KA 1YMHA 2EZ0C 1HQRB 5K93A 3VDCA 1R3JB 2F74A 5DJ8B 3OAZH 5IQ9B 3RX5A 3EZJB 5INCB 5E1AB 3TC9A 4IJ3C 1YN6B 4HX1B 5C0IA 4ZFZA 4ELKA 1XF5B 3MRNB 2HKHH 4PJDA 43C9A 3HI1B 3PP3K 1OF2B 1W0VB 1AGDB 1G7IB 1RV6X 3FB5B 5ADPL 1REIA 3DV6A 4BKLB 3G5VA 3GSNL 1YZZA 1EUTA 1G6RA 1LWRA 5DVKA 3BIKB 4P2QA 1JHKH 3I02A 5C3TA 3SJVE 5D7JC 4I5BA 1G7HA 1D5ZB 4TNVF 4BFIB 1FNLA 2NW3A 4Q9CA 1T5WA 4LLWA 3MJ8B 3TIDA 2B4CH 4G8IA 1I8KA 3M07A 5JZ7D 3BKML 1OP3H 3VXUB 3BRDA 5DHYB 2KDGA 4MQXC 4FQLL 3V5DA 4R26L 3NMEA 1IM9D 4S0SD 3GNMH 5HVHC 2NTFB 3C5ZA 4NRXB 3QQ4B 3UPRB 4WV1B 1RULL 5E2VL 3F5WA 1RUKL 2HT4C 2OJEB 1K8DB 4YPGB 4F7MB 1VFBA 4JFQA 1MI5E 1J11A 3VG9C 1AGCB 5ITBH 4JN2A 2VAAA 2MCPH 2ID5A 5DUBB 1GPOH 4ODBD 3MBXL 4IOFD 3OWEA 4XP6H 3U0PA 3DX6A 1QFUL 3FT3A 2X70B 1H3PH 2DWEB 4JCMA 4ZFFB 4ZNCD 1LE9B 4RSVA 3HZKB 1MHCB 4LVOB 5CBEA 1S7TA 2GK0B 4UDTA 2E6JA 1RZKH 4NRYB 1HIML 3VFNA 3C6LD 4LCIH 2DQTH 4WFGE 1T5XA 1BOYA 4ETYA 1MJ7H 3B9DA 1UB6B 3T09A 3V2AR 1JJUA 1NAMB 3W11D 1L6XA 4YGAB 1BVZA 1CBVH 4YAQB 2O61A 35C8H 5JUEL 3QIUD 4I0PA 3T0BA 1B88A 3BN9D 1A6WH 2WM0A 1HXYB 5BS0A 3TLRA 3HG1B 3MCKA 1JRHI 3MV7B 4UB0H 3KHQA 3FAWA 1GOGA 3I6KB 5FUCE 5GRJL 2Z8WC 4PRHA 3H42H 4HK3N 1T1YB 4N5UA 4JFZL 1KENH 1V7MH 4Y89A 3KNBA 3ZDYE 4Z7QE 3NFNA 4FP8L 5FGCB 1N5AB 1F90H 4MAUH 5FA3B 1B4RA 5C0AB 1E6JH 3SKOB 3T2QA 3MUJA 5GPRA 2YEZB 1TETH 4Y5YC 1Q9KB 4M48L 3FN0H 5KJRL 4MX7A 1BM3L 2JJVA 1BD2B 1PBYA 4EUPG 2E9WA 3T4AB 1T1ZB 2OBGA 3LZFL 5CAYB 4M9OA 4IHOB 1I7RA 2R4RH 2R0ZH 1AHWC 4JZOB 4PGCA 1FCGA 2FB4L 2COQA 4PJ7B 4K3DH 3MV8A 2R2CA 3CGTA 4EN3D 4JFDB 1ZHNA 2CUMA 3RNKB 1KEGL 1IZJA 3FOLB 3H9SA 5CEZD 4PJDE 5EU6E 4FFVC 1WSST 2UYLB 2JJSC 4YDIL 5FHAL 5SX4H 2AEIT 1U3YA 4UBDC 4YHPB 3R0NA 4Z7QF 3WJLC 3ZDYF 3FN3A 3O3BA 3O6FB 5D8JL 1ORSA 1UWGL 5GGRB 3H9HB 4G9FD 1FL6A 5J13C 5GRYA 3HNTL 5E95B 2MWCA 1GZQB 4OQTA 5D1XC 4HS8H 4GMTH 2X2YA 5I1AB 1OOAA 4PRIB 5GZOC 2P46B 4FXLA 5C09B 1NGXA 4KQ4H 3RU8H 2GJ6D 1AD9A 2JCCB 4K2UL 1LK3L 3RTQA 2UY6A 2Q6WB 4TSAH 3HRPA 1FAKT 2R2BB 1Y18B 3VFWA 3OXSA 5EUOA 1YJDC 2O5YL 4U3CA 5C7XL 5C0RL 3RIFF 4P5TB 3FB6B 1EXUB 4RCAA 4D0CB 3T1WA 5ICXB 1UH4A 4HZLA 5EOCL 2MQ0A 2A74B 1QO3A 3KYOB 1OM3L 4F37F 4KY1H 2H9GB 4MD5B 4GW5B 4PJDF 5E03A 5DI8A 1EFXA 5I2IA 1Z6JT 5JLZA 4TQEL 4ERSH 4OF0A 5TFSL 4TUJB 1YMMB 3EJJX 5KW9H 5CWSA 2GSIA 4RNRA 1HSAA 1P4IL 5DJAB 3A6BL 3RVXC 3O11B 4PREB 3X17A 3FFCB 5JXAL 3MZGB 3TBYB 3JWOC 4ZO7A 3WD5L 1F4YL 3BPCA 2FATH 4Q9BA 1T0PB 2R2HB 1OAUH 1F4XH 1TVDA 1KFAH 4NZTL 2YXFA 4NO0D 1P6FA 3TA3C 4PLNC 2QADB 4A6YH 1JK8A 5DWUL 4XTRC 1ADQA 5IEKA 3SBWC 1WWBX 2WANA 3ARVA 4JDTL 4FXKA 4X4YB 4NKIL 1MUJB 4I9WE 2IADA 2BJMH 3O6LL 2X4SA 4OKVB 5HHPB 3TA3A 5DC4B 4DTGH 2OTPA 2ADFH 3IDMB 4QEGA 3IT8D 1YEFL 4LPXA 2Y23A 1IAIL 4ZXBB 2C1OB 5BS0E 1NSNL 1J1XL 5IK3B 1FZJA 1FNAA 5DMGC 5TJWK 1WEJH 4U0RB 1CE6A 1G84A 3MLYL 4PRHE 3D0VB 2FH8A 2IAMC 4S1RL 4XNMA 5TE7L 2UUDH 1AGFB 5FB8B 4HBCL 5E99L 4LMQI 1S7SB 4Z18A 5E2JA 1R3IL 3Q5YA 2ATPA 1DSFH 4P4KA 3KYMA 4HUKB 4K7PH 4ZTOL 4GG6B 1H9VA 4GO6B 1RURL 3NBNA 3QYCA 1EEYA 2GUOB 3OXRA 5D1ZD 5GXBB 1U8QB 3BISA 3ARGB 4OZ4B 3MMEA 4WUUE 4WFGD 2CR3A 1RK0A 1NGZB 1RHHA 1AGBB 4X4XA 4G6FD 4OGAC 3BZFA 2NYYD 3EO1A 1FH5L 5HD8D 3CUPB 2Y72A 1T2QH 3VFOA 1OLLA 2BNQA 3LQZA 3MV8E 5DTFB 4UUJA 4BQBA 4MDIB 3T77A 4I18B 4XPHL 3OJDA 2H1PH 3HZVB 1ZVHA 3D9AH 3QUMA 2P8PB 3BH8B 4JJ5A 1JP5A 1I9IH 1YY8A 5FM4A 1UACL 3AMLA 3H9SE 5CUSL 5HHQA 4G9DB 3CXHK 3T08A 1RZGA 4M1DH 1IC5L 2HH0H 5CSZB 3OG6B 1F58H 2J7LA 5J4MA 1P7QA 1F6FB 4R8WH 4QGYA 1KJVB 4WU5B 1I8MA 5TDPB 1P7KA 1JHTB 1FO0H 2X40A 1IARB 1HHJA 4M1CD 3RVUC 5KSAA 4G7YH 3RWGA 5IOPB 1NPUA 1HWHB 2I9LA 3NIGE 4LVNB 3RNQA 3S3JA 1M7XA 4QRQB 1X9QA 1VGEH 5EUOE 1P9MC 1NANH 2H2PC 4NZJA 1RIUH 3RWHB 1AO7D 4EQ3A 3KWWB 3PWUB 4FOMA 4X99A 4LLVB 3QG7H 4WO4D 3O4LE 5DGRA 5EU6D 4OCYL 3VE0A 1S7QB 4ZFOA 2NXYB 3SGJC 3U46A 3IFOA 2JB6B 3GIZL 2AJZA 4XP5H 3P4NB 4NQXB 4POUB 3PWVA 3L6FA 1MFDL 2F19H 5EG6C 3QXVA 3MRLB 4HIHA 1TIUA 5DRWB 2CLVA 3ARXA 2B1AH 3O8XB 2Z0BA 2DM4A 4RZCB 5A2FA 4ZODA 4U7MA 4YDVB 4MVBD 1NC4D 5CP7B 1KLFA 2W0FA 3PABA 1E6OL 4LCWD 3WUWA 1CZ8L 1JNLH 3LH2L 2Q7NA 3NIGF 1ZT4B 4D9RD 4X80L 1K8IA 4KJWD 2Z93B 3RWIB 3N50A 5TH2A 2BOCA 3MV11 1FGVL 2HTKD 2Q86B 1ZT7A 1HYSC 3ABZA 2K3TA 3T0EA 4XWGL 4ZUTA 5D96B 1X5HA 3P9LB 4X9BA 3FHAA 1DQML 1EJOH 3JSSA 4EVNB 4YFEA 3GEWB 2HJKA 1AY1L 2CQVA 4EI5B 2ZUTA 3LKRB 4IRJA 5DUPL 3WFHA 4GKNB 1U92A 3NACL 3GI8L 3OPZH 1YC8A 5DRNA 1OP9A 1T80A 3KPQB 3HNVL 1S8DB 4M8QB 2YMXL 3CAFA 4PJBA 4OLUL 1MFEH 4LLQA 3GIVA 3WNNA 3OKYA 5GRXG 3OKEB 3P0VL 1A4KA 1I8LA 1JGLH 4JZNA 2XPGB 1NQBA 4UAOC 3MLSL 3N1PC 5BMFL 4JREB 1D6VH 1T0MB 2YKLL 4JO1H 5DD0L 1NGWA 4KI5F 3WMSA 3JV5A 3ZT5A 1BBJA 4NWUH 1KBGL 3QEGL 5LQBH 1WAAA 2IQ9H 3AFLA 1N0XL 5EC1B 3OKNA 5FYLD 43CAB 1YQVL 2DQIL 4EI6B 4HAGA 4I9WD 4KKBC 3DHMA 2J8UA 3QDME 3F6LA 3VWJB 4X6DA 1FORL 1JHLL 2BNQE 2OL3A 2DIBA 1MWAB 4XVTL 2R56H 3S98A 5I1HL 2CKNA 2ED9A 4NUGH 1CGSL 1SM3L 1OT1A 4YFLF 5EO0A 2ZSVA 2V2TB 1MELA 2R0KL 1WC7A 4KMLB 2ADJA 4Y19D 1XEDA 3TVMA 3DX8A 4NZUL 3OTTA 3H7LA 1EH9A 4HQQL 4RGNC 1OSZA 5DA0B 4X7CC 5L0QB 3Q6GH 2VL5B 5AZEL 1CE1L 3TH4T 1JE6A 1PKQA 3EYSL 3FRPA 5JPMA 5HGAB 5KSBA 1NBQA 5DC0A 3CZFB 4LCCA 1XGUA 4GKZB 2BVQA 2LU7A 1RK1A 3C5SB 4WUUD 3PL6C 5CCKH 4JDZA 2KZ1B 4E42B 1D5MA 3QRFM 4TULL 1KIPB 5IT2H 1OCWL 2AK4A 3QCUH 1F3JB 3TF7C 1FNGA 2F58H 2DMKA 3QJFB 1KB5B 2XRAH 1HKFA 5JO5B 1ZXQA 4FQ1H 3SY0B 3BKCL 4EZMA 2EIBA 4F7CA 4UZGA 3ULVE 3MUGA 5I1EH 1U8JB 8FABB 3HZYA 4H26B 3CH1B 4LVEA 4PJ9B 4A6YB 5K9QI 1ZHBB 2Z9TA 4NQVA 2ZCHL 5GGVH 5IM7B 5ACLA 1LEKA 2WUBL 4Z76A 2FEDD 1U8PA 3ARRA 4LLDB 4XNQA 5CJQH 3G6JB 1PG7L 1AH1A 2A1WH 1UJ3C 1JPFB 4MCYA 4F9LA 2YPLB 4O4YH 4NC0B 2X4NB 1MAML 4J8RB 4L4TA 4ZS7L 1GGYA 2UZIH 1MCQA 2P49B 5D70L 3CFKB 4R7NA 5CD3B 1ZVYA 3UBXB 3HMWH 1HQ4B 4XPGH 1UJ3A 1A1OB 3QUZB 5HGBB 1Q0YL 3WDHA 3HC4L 4FQ2L 1NEZB 1QNZL 4P3DA 3UTPD 3F7VB 3T0EE 3TN0B 3U2SA 3ULVF 1QQDB 5HYJA 2FWOB 3O4LD 3V6OC 2R15A 5C0FA 4GAYB 2P24A 4H20L 1W72B 5AYUH 3UYRL 1EFQA 1CXKA 4PJEA 3JTSA 3BD4A 2VH5L 3PHQA 2P48B 2OJZL 4PJBE 5EOTA 4X6CA 4X5WA 3ZTNH 4Q0XL 1HZHL 2NXZD 1IJ9A 4C56A 4ZFGH 4AQOA 2FJHA 3L7EA 3VFTB 3UZQA 3V5KB 4YC2B 3KXFA 1AD0B 4NC1E 2QQQA 3S5LB 4KI5D 1MHEA 4OTXL 4GW1A 2HLAB 2ICWA 4JVUA 1WAAE 2YUVA 3G5YA 5F7HA 3PDOA 1MQKL 1KNOB 1KCRH 4WW1A 3S36L 3FCTA 1FYHB 1NCWL 3VXPA 3H9ZA 3PUCA 2D31B 2J8UE 3CIQA 1MVUA 4L5FL 1FO0B 3D39D 4JKWA 4X6DE 3DVNA 4I48A 4ZUVA 3STZA 4OFYD 4GUPB 4RA3A 3QZWB 1AFVL 3VG0H 2EDOA 1DDHB 1IAOA 4OQTL 4M6ML 2PYFB 4RRPA 3VW3H 4OD3H 3SDYH 3L5JA 2F54B 2VC2H 3WLWD 3HE7D 5IGXL 3V8CA 5DJ2A 4PJBF 1NFIB 5JZ7C 1ZGLA 4TUOB 5DMIH 1D5XB 4K8RL 3ROOB 3TT3H 3EYOA 4D0BB 4R4BA 4LSQH 3UDWA 5MHSD 2CKBB 1AXIB 2X09A 2Z31D 3FB7B 1IBGH 3WN5A 2BP3A 5ERWB 3B3IB 4F58H 2DQUL 5KSBE 3MLVH 4ZYKA 1XZ0A 4MNHB 3O41A 1WAAF 1PDKA 1OW0A 3GUTA 2AVGA 4RFEB 4C55A 5A2KH 3K4AA 3QUYA 1RZFL 1X4ZA 4DWHA 3TT1L 2XWTB 4JQIL 1HHHA 4M93B 4YFDB 2JIXA 2YPVL 3MJ7B 4NC2B 5GS3A 2OZ4A 4OIIH 3BSZL 3I2CH 3QCVL 4WCYL 5JPNB 2J8UF 3QDMD 2OYPA 4E5XA 2BNQD 2GK2A 4R97B 4WI4A 1CK0H 1M7IB 4IOFC 1EEUA 2HFGL 2UZYB 3DARA 3G9AB 2EH8H 4UIKL 1NDMA 2P5EB 4Y1AB 3BGMB 4EEEA 2Q20A 3UTSA 1GCFA 1A1NB 3SGEH 3WNOA 1PZ5B 1EERB 1EZVY 3SO3B 1P7QD 3BJ91 1CICB 3JWOL 3C6LC 4JR9H 2CK0H 4OZFG 1ADQL 5FKAA 5ICYB 1X3DA 3QDJD 5D6DA 2EDEA 5SV4A 5BO1L 3W11C 3RDTA 1CR9H 2VE6B 4OF5A 2F8OA 3QH3B 4P59L 4FQJL 4WRLA 4XCNB 3BD5A 4OD2B 5KANG 4XPFL 4L4TE 3QIUC 5J9PA 1HEZB 4M7KH 3BN9C 4WW2B 3GKWH 4XVJL 4XMLH 2FIKA 2P5WB 3MTRA 3QA3A 3S3PA 2NLJA 3EOTL 4HFWB 5I0DA 4HV8A 3GKZA 3DV4A 2FGWH 3LPWA 2ADIA 4TNVK 1CDJA 3RUGF 2DN7A 3ULVD 3GMPA 3X12B 4CMMA 1I7UA 5HYJE 1T04B 1A3QA 3PWPA 3WFZA 5FM8A 3UO1H 1LO0L 3MA7A 4KUCF 4OM0H 4PJEE 5DEFB 4U05A 1A7QL 5GGQL 5E5MB 1TNMA 4KFZC 4PG2C 4X6CE 5HHVL 1T0NB 3JUZA 3NCEB 3P4MA 1EDQA 2WBWB 3L7FA 3K2MC 2OR7A 4NYLB 2HLFD 2X42A 4C56E 5K9OA 3L95B 2QQKL 4RGMB 1AQDA 1S9XA 1MHPL 3KXFE 2HRPH 3DECA 1CT8A 4ZG1A 2J3SA 1P2CA 4NIKB 4R90L 4EN3C 3BPNC 4M02A 1TCRB 2VDLL 5DJDA 5FYKH 2AJ3B 2G9HA 4KTEL 3GJFB 5E2UH 1QACA 1MVFA 4HIJA 4HKBA 4JO4H 3WNLA 1KCVH 3K2UH 3IB4A 1JZ7A 1U3HD 1AIFA 1Y0LA 5TGBB 3QFJB 3KDMA 2GT9B 3WUWG 2X4OB 1OQXA 4XRCB 4MA8H 1YN7A 2I9TA 5CGYD 1DTUA 5D5MA 4OLEA 1ZLVK 3NAAH 3TYFA 4PB0H 4NP4L 4X6CF 4KK9D 4PLJD 4WJ5A 5KZCB 4ONFL 5GRUL 5F89B 2AV1A 1ZLSL 3PWNA 3VGBA 3RL2A 4RX4A 4MD4B 3MRIB 4ZPVA 5L8JB 5SX5K 3W9DB 4AH2A 1ZE3C 2A9MH 5D2NB 1UB5B 3BKYH 1X5IA 5FUZH 4OZGB 1BX2B 3LS4H 5T1LA 4PJ5B 3PWLA 4J1UA 3DVGB 4FQXD 3VDBA 5JHLH 2GKIA 4ZFOL 3U0WH 1MCEA 1N7MH 2N1KA 3D25A 2AKRA 2A6IA 3O2DA 4QWWD 2BVTA 5CIPH 5I76B 3I3EA 4OZIA 1GYAA 3GMQA 2V2WB 1U8KA 2CR6A 5IMOA 1C12A 2C1PB 2JK5A 4ONGH 1G7QB 4ZAKB 3QAZB 2P8LA 5HDQL 4CW1A 4JANB 3OR6B 4HC1A 4JY6B 3UTSE 3UP1A 4U1MA 4JPWH 1NCAH 2CO7B 1LO3L 3UYPA 4OLWH 1Q1JL 3LS5H 5AAWA 4DGVH 1FJ1A 3NCBB 3S35H 2IMNA 4PD4K 4W4NA 3SHSA 3W5NA 4ODWA 4NZDA 3QRGL 3S8WA 1DQLH 4BH8B 4JZJB 2ARJQ 1PZUB 4JQXA 4JCLA 3VJ6B 4WI5A 2X9YA 3NH7H 4HLZH 5FCUL 2LTQC 3B43A 4Y0GA 2P42B 4RWYL 1KC5H 2PUQT 4HIEB 3C9NA 4JRYA 4LQFH 4MNGA 2FSEA 1VFAA 4UV7H 4M62L 1EVUA 3LB6D 2GAZA 5D71H 1U8LA 3OR7A 4K7PX 4E41B 3QEUB 3O6MH 2IFGA 2PW1B 3H3PL 4UIMA 2DRUA 3C08H 3FRPG 2DQEL 3V0WL 1J8KA 3AB0B 3OL2A 3HB3C 2WBJB 4M7LL 2PO6A 4GG8B 3PWPE 5ESQA 2Y36H 1DLFL 4LP4A 1IGTB 4UNUA 5L8KB 3KGRA 3UTQA 3ARDA 4KH2A 3IDIA 1RJLB 4QOKA 5I19H 4JRXD 1J1PL 3MOAL 4DUXA 2F53A 3DJ9A 1HOCB 4WFEE 5DJ0B 4NQDB 2YWZA 2D9CA 4F3FA 4PJFA 5C2UB 5C9JB 4D8PA 5LXGL 5IG7B 2NYYC 3HI5H 4U1SB 5FYJH 5AUMB 1AR1D 1N2RA 3L5WB 5HD8C 3P3YA 1VA9A 4KXZH 4JFFA 1FSKB 2VLKA 2OL3L 4RMVA 5I15L 4IRZH 1GGUA 4P9ML 2DYPB 3LD8B 1YEKL 5JNYB 5EFIA 3WDJA 2XZCH 3BEWB 1LO5B 3DO3A 2E7HA 3CVIH 3FONB 3DRTB 4Q9QH 1F6AA 3MRBA 4GKOA 5DJYA 5C0DB 5HYJD 3O9WC 3RL1A 4LASL 1IT9L 3MLRL 3EOAA 4R6UA 3DGGA 3UTOA 3T0WA 1EAJA 1A6AA 5C2BL 5D5ME 2LVEA 2Y06L 5F7EH 1AC6A 1S7UB 3FO1A 1DBJL 2H8PA 2W9EH 5EA0L 4IM8A 1J05B 1P53A 2X1QA 3T2NH 3MLXL 5I8OL 4BSWA 2HFEA 2P47B 3GJEB 3E3QE 3QQ9D 2V7HB 3V4PL 2O26U 3D18A 4PPTA 4RWHA 1CXIA 4L8SA 3QEHB 4YJZL 4LSUH 4PIRF 1KIQB 4ZSOB 1J12A 4L8DB 4LGSB 5DJZA 2C3HA 4XT1C 3X14A 1MCWM 4WO4C 2R23B 2AK1H 1XGYH 1C08A 4JM2D 3MRCA 3C60B 2Q3ZA 2A6KA 2QQNH 3HFMH 3IXTB 2HTLC 4LSTH 4ONHB 3QULA 3SCMD 4DUWA 2PCPA 3ZL4L 3M17A 2DQHL 4CN4A 1X5GA 2BNUB 1EO8L 2F5BL 5CFHA 2ZOKA 1ONQA 4FTVD 4HSQA 1I9RL 2HRLA 5EPMA 4OZIE 4Z7VA 2GQHA 3LN9A 2HT2D 3BUTA 3IAQA 4YHZL 4MVBC 5J57B 4Z7WA 4Y4HA 5IQ7H 5D5MF 3IFLH 2IPTL 5F1SA 3SE9H 5D1QA 3G08A 2HKFL 3MGTA 5GSRB 4TSCL 1TQCB 2AS5M 3W0WE 2C9AA 3T2PA 4URTB 4KJWC 2DQGH 3DUSA 2CMRL 3GSOA 2HTKC 2X7LB 2R4SH 4U6YA 3TJHD 1NGPL 4NGHL 5DT1H 2YHGA 4Y4KD 3F7PC 3SKUD 4KTDL 1CGVA 2YBRA 3HE6B 4AT6A 5TF1H 4L4VD 1KTLB 1IEBA 3QUYD 4MNGE 1TPXC 2VO5A 5JOPD 5FGSA 2FX7H 3CXDH 3PV6A 4X0KA 1MHHB 2VXVL 1MRFL 2GTWA 3Q6FB 4HFUH 5B3NA 1HH6B 2EDFA 3DTXB 3QI9C 4MNQA 2EYRA 1UKTA 4GJTB 1B4JH 4M6AA 5DA4A 1D9KA 2WINB 3KLHD 3VD3A 4HPYH 3TBTB 3FOMB 1WGOA 4U6HB 1RVFL 5B38B 5HVFB 1RD6A 5EU4A 3O4OB 1FNSH 4QOKE 1UXSA 3SN6N 2VIRB 2ZUUA 3QI9A 2ATKA 5DK2B 5TDNB 4CKVX 2F53E 1YJDH 2J8OA 2NY6B 4PJFE 5C08A 4PRNA 4YO0A 5IMMB 1A7RL 2G75A 1SY6A 4QCIB 3A67H 1OAZL 4AENA 2VKWA 4KPHH 3IFNH 1Z3GH 4UOW1 1D3CA 3REVA 4LPTA 4JGUA 1J87A 4JAMB 2K1MA 4JFFE 4LIQE 3TO2B 4GRMB 2VLKE 4U6TA 1LEIA 3P11L 1ZS8B 4PRPD 1C5CH 1RI8A 1NBYB 4M6NL 4G8EA 5DUMH 3QIBD 2W92A 4MZ2A 1UADC 4ZOAA 5IESL 3O45A 1UEYA 5B8CC 3PWPD 2AEPH 3GZKA 1W2KT 2CIKA 4M7LT 4RIRA 1ZTXH 1A47A 1IGIL 3N9GH 2R0WH 3LY6A 4NKDB 1FAIH 1MPAH 5ANMB 1EX0A 1LQSR 3MJ9H 1QFWH 2E9BA 4WFED 1OVZA 3GSRB 4GRWE 5CIPB 5B8CA 4HIXH 4P46B 3HUJB 4KJYB 5AYQA 2GI7A 1JFQH 1A14L 1AKJD 2YK1H 3T0XA 4J23A 4P3CL 4R2GB 5KVEL 1JZ5A 4X9IA 1G0XA 1EEZA 2AQ3A 4LGPB 5SWSB 1D7FA 3RWCB 5IB2A 1MCCA 3K4ZA 5E8EA 1MREL 4U1LB 1UVQA 1JGVL 5GS1A 1ND0A 1I1YB 3GSWB 5HPOA 2R2EB 4AEIH 1QSED 5SWQA 3BZEA 1K3ZA 5CEXA 4EOWH 4DAGL 4MAYB 4XGZA 3KPTA 1KJ2H 4PGJA 3HC3L 2FEDC 4XCEB 1CLOL 2AP2A 1NMBH 3LKQA 3EDKA 2BFVL 5C0GB 1DL7H 4RA0C 4QLRA 3U48A 4IJ3B 3KJ6L 3GO1H 5D9SA 4Z7VE 4G6KH 5E2WL 1DZBA 1W8NA 4ODXB 3RWJA 4Z7WE 1JV5A 4RMRA 5IBUG 5C6TL 4GRWF 5D7LB 2GCYA 2C3WA 4JO3L 3SDDA 1H3VA 1C5DA 4HD9A 5D7JB 4KK8C 3GK8H 4J4PA 5M95B 3ULUF 3MLZH 1IM3B 4CNIA 2GITA 3RJDA 1L0YA 2FO4B 5TE6H 3ZZ1A 2WW8A 5DLML 5J1AB 4M3KB 2Q8AL 4MHHG 3BH9B 3IETA 5CJOL 4WI2A 5KOMC 4Z5RA 1PX3A 2ZG2A 4EDWH 1ZOXA 4RMTA 2WV3A 3KHOA 1NGYB 3MXVL 5L2KA 2LFGA 3VI4E 1NMAL 4P2RA 4C58B 2Y07L 2ESVA 5EZLA 5I1GH 1OWWA 3Q2CA 4MNQE 5DR5L 4MLSA 5KBNC 4Z7VF 1M6OB 2NXZC 5FFLA 3O0RL 1S9VB 4GKSA 4NUJA 1UWXH 4EXPX 3UEZA 1WCBA 3X11A 3VG9B 5FHBH 4L8BB 2G2RB 4U6XB 1K4DB 2JELL 2QSVA 3ILPA 4JFEA 1P4LA 4KI5C 1OPGH 2O5ZH 2XA8H 4YIQA 5B4MD 5D7IA 3W0WD 4JPKH 2EDDA 3L3OA 1XF4B 4S0TD 1BFVL 1KTDA 4PJAF 3RY6A 4QXUL 2FBOJ 4RFOH 4X98B 1G0YR 1OB1A 3FQUB 3QHZL 3VCLA 3WDIA 5L6YL 1Q0XH 1FE8H 3MXWL 2PYEB 2ZUYA 1QLEH 1QYGH 5DSCA 3BE1H 3IRPX 4JB9H 3M1BA 12E8L 2AEQH 3LSOB 3SDCD 4L3CB 5FUOL 1OAKH 5KAQG 2I07A 4HCRA 5ILTH 3VI4F 3WLWC 3HE7C 4HWZB 4PYGA 3LDBC 2BSSB 1GGBH 3DI3B 4FZEL 4NO3A 5IEHB 1KJMB 3U4AA 4DZ8B 2X44D 1KV3A 3GBLA 2PR4H 5F88B 3FQXB 3L3JB 1U8IA 2YRLA 3OKKB 2Z31C 1LO4L 5AG8A 2VLME 2QEJA 3NGBC 1F11B 2VQ1A 2VNCA 1DQJB 7FABH 1MFAL 1G9MH 5T33H 5GGTA 3I9GH 3RVVC 2G5BA 5HHME 2HN7A 1ZA3A 1FN4A 1T66D 5C8JA 4OF8A 5E8DH 1H0DB 5EUKB 4Y5YB 4LGRB 2HVKB 4J3WA 2K9UA 1RZ8A 1KTRL 2W0LA 3O2DL 4JPIA 4MJIB 2OTWA 3U7YH 4P23C 1I9JL 4QGTA 3UJJH 4LHUD 3F7YB 4E9LA 2OCFD 1TVHA 1FG9C 1FVDB 3F6IA 1I85A 3IKKA 4PYHA 5T1DH 3FQWB 4YWGH 1MCLA 1ES0A 1AHWB 3M8OL 1CFTA 1JUFB 3KPLB 3OHXA 2EEBA 1QSVA 5DJ6A 3P77B 3ZTJG 4PGZA 3HHRB 2BC4B 5FKPA 4NBXB 3ES6A 4PTUA 5M94B 1IL1A 2OI9C 15C8H 1B2WH 2AJSL 1YEEH 4TPRH 2X1PA 5CGTA 2R8SL 4DCQA 3HAEA 5E08H 5FO8A 5E9DA 1A6ZA 3NTCH 3R1GL 1IGFL 2QSCH 5TE4H 3HI6H 2GFBA 3FO0H 5LGHL 2NCMA 5KOVC 1IAKB 4ZD3H 1ROWA 3JV6B 5J13B 3PGFL 5D1XB 4HUNB 4LPCA 1LP9A 3UTTD 2Z4QA 4CDGC 3ULUD 5IHUH 1U42A 1VERA 2PF6A 2DTMH 3QWOA 5HY9A 3BQUA 4G6AD 4X6FB 2AI0L 4JO2L 1TTUA 1LE5A 5JHDA 5TQ0L 3FB8B 1IQWH 3WJJC 3VD7A 3VXRD 2D7TL 3MCLH 2H26B 5H2BA 1IC1A 1HXMB 2IEPA 1HH9B 5LVEA 3VDAA 5L2KE 1CDHA 5C0EA 2OS7A 3B9VA 4KHTH 3AROA 1RJYA 3CX5K 2NY0D 2ESVE 4CVXB 4JY4A 5IW1B 3WJJA 4PJGF 2HLFC 2H32A 4BZYA 1J0ZA 4W6YB 3TNNB 1KIRA 4YR6A 3S97C 4JFEE 1FGNL 3INUH 2YD7A 5D7IE 2VZ3A 5C6WH 1VSCA 2IPKB 3IS1X 3T0DA 1HQRA 2CRIA 2NY5C 1A7OH 1R3JA 1LK2B 5DJ8A 3MNWB 5IQ9A 5HBBA 5INCA 3ARFB 1CGTA 4ODSL 5E1AA 2BK8A 1YN6A 5DC9B 1EHAA 4HX1A 4F8QA 1MLBB 5K33A 3O2VL 4Z0BL 1CLZH 3CFEB 1U3HC 1XF5A 3MRNA 2X9WA 3HI1A 1OF2A 1W0VA 4UILH 4F57L 1AGDA 1G7IA 3FO9B 4ESKA 4BKLA 5CGYC 2EDWA 2DS4A 2I5YH 2Z8RA 4MB5A 3BIKA 5MP6H 3O2WL 1QVOB 1T4KB 4KK9C 3LEYL 4G42B 5CLWA 2NY1C 5HYEA 1D5ZA 4BFIA 1CGXA 4FXGB 4FN0A 3MJ8A 2VXUH 1TQBB 1QZ1A 4XVSH 3TBSB 3VXUA 4NZRL 1JGUL 2IAMB 2YN5A 5DHYA 1KJ2B 4LSRL 2JF1A 3JZ7A 1GL4B 2CRZA 4P9HH 4IMKA 4CMHC 1OGAB 1IC7H 4FQXC 4OD1L 2VB5A 3LRHA 2NTFA 4NRXA 3ARBD 3QQNA 4WHYG 5IFAL 3QQ4A 3UPRA 4Y2DD 3PV7A 4WV1A 2NY7H 4NNPL 4HXBL 4OZFB 2OJEA 1K8DA 4YPGA 2V5MA 5LGKA 2FECL 4OLXH 1BECA 4F7MA 3AGVA 3F8UB 1NGQL 1INDH 1XAUA 4WEMB 1AGCA 3S35X 2AJYH 4PJXB 4WI6A 3GI9L 1NC2D 5DUBA 5IBTL 5ID0B 5I18H 4UT6H 2IQAB 5DYOB 4M5YL 2XKNB 3G9VA 3DYPA 4EQ2A 4NM8L 2J4WL 5D7KE 2XI9A 2X70A 4OM1L 5C71A 1KLGB 5HYIA 1NLDH 2DWEA 4ZFFA 1LE9A 1MAJA 1QFWM 2QHRL 3HZKA 1MHCA 2XTJD 2VLMD 1TVBB 1CXFA 2GK0A 4NJAL 4KUZL 4NRYA 2AGJL 4UT7L 2VDOL 1CGYA 5IROA 5E9DE 1TZHB 1UB6A 5HHMD 1NAMA 3KPPB 1TJHL 5JMOC 2BX5A 4GAGL 3LB6C 2EE2A 3AY4C 5IJVB 4RDQF 4YAQA 1NH6A 1LP9E 1GC1L 4KQ3H 3DX7B 1HXYA 2E8YA 2Q3AA 3B2VL 3HG1A 5JHDE 2KPNA 3MV7A 2P44B 1A7BA 1PGRB 3I6KA 1QLFB 4NQEB 3PIQB 1T1YA 3HKFA 3LEXB 3SOBL 3SGDI 3DUHA 1N5AA 4G8GB 1JTTA 2KZWA 2YOCA 5C0AA 2WLZA 3VXMD 3SKOA 1EO5A 2YEZA 2OR8A 4XNZC 4UTAL 3PWJB 1Q9KA 3S6CA 4M48H 1DBML 3LN5B 4ZOEA 4OV5B 1BD2A 5T3XD 1GGCL 3EJZD 3T4AA 1YA5A 1T1ZA 4IRSC 1EZVX 4IHOA 1R5WB 2EIEA 3X3GH 4JZOA 2QTEA 3IF1B 3LKSB 4YHOH 4PJ7A 5CZXD 4DGYH 1A3RL 1ACYH 2RJMA 5F9OH 4JFDA 5MENA 1RHFA 3RNKA 1JWMB 2X1XR 4X83A 2LVCA 2BY1A 1KEGH 1N3NB 5JIHA 3FOLA 4WIQA 2UYLA 3ZMRA 4WVRA 4WFHE 4C83B 1YNKL 4YHPA 1QA9A 4CAGA 5IV2B 3O6FA 1MF2L 5GGRA 3H9HA 5AZ2L 5DO2D 4K94L 1GZQA 2MPAL 2GIYA 5LBSH 4LSPH 1B9ZA 5CINL 4AEHL 4DN4H 2X6MA 5I1AA 1LO2H 2FR4B 4L3ED 4PRIA 3QQ9C 1RZ7H 2GJZB 3IDYC 2EYTB 2NX5D 2VUYA 5C09A 1RJCA 4GFTB 5HYQB 1TLKA 2Y7QB 4GRLD 5DVMA 4KKLC 2JCCA 3OAZK 1G0DA 2MCG1 2Q6WA 2R2BA 1G9NC 1Y18A 5HGHB 2V7NB 8CGTA 4JVPA 4JM2C 4U1GC 1WWWX 4UAOB 3DXAD 4P5TA 3FB6A 2FBJL 1EXUA 3SCMC 4JKPH 3VMPA 4D0CA 1ZANH 4PY8I 5DEZA 2A74A 3KYOA 3QDHA 5I8KL 3RGVD 2ITDB 2H9GA 4MD5A 4GW5A 4L9LC 1MIEH 4ELMB 4TUJA 1SBSL 1YMMA 3QHTC 4HPOL 2HT2C 3WIHA 4O9HH 1KLUA 4X7SL 5DJAA 2QADC 3O11A 4N8CL 4PREA 4TVPD 4UOW0 3FFCA 3SE4C 3W2DL 3I6LD 5JXAH 3TBYA 3ARUA 5F7YC 4HGKC 2R2HA 2BZDA 4JFOB 3DGCR 2NQCA 1WT5A 3TJHC 2ZUQC 1G7JB 4Y4KC 1IGML 2EDJA 3NZHH 4MLIA 5CLTA 5LWYH 5CEZH 4RGNB 2KKQA 1DBBH 4X4YA 4WEUD 1Q72H 4KK5D 1MUJA 5DQDH 5HHPA 3IDMA 1P69B 4JG0L 4KKAD 4PV9A 3FQTB 4ZXBA 5FM5O 2C1OA 3BZ4B 5IK3A 1L7IH 3HG1E 3MV7E 3CMOL 3PL6B 3KLHC 2IG2L 4U6VL 4AMKL 4MA7L 3D0VA 4LBEB 1AGFA 4Y4FB 5FB8A 4KGJA 1LDPL 5FGCE 5TQ2L 1S7SA 4NQSB 3UTZB 2BCKB 2W65B 2XIDA 5D7KD 3EFDH 2FL5B 5C0AE 4N90D 4OCSL 3G6DH 4GG6A 2F8VA 2Z91B 3F7RA 1HKLL 2GUOA 1BD2E 1U8QA 5L7XL 1P7HL 1I1FB 4U7SA 3ZKNC 3ARGA 2CLRB 1LILA 1JF1B 4OZ4A 2A38A 1GZPB 2EDLA 4MZ3A 5F1IB 2IFFL 1NGZA 5BW7C 1AGBA 3IDGB 4OIBA 2X4RB 4ZO8A 1E28B 3CUPA 4R9HA 5C1MB 4HCRL 4XPTL 2O5XH 4UINH 4PBWD 4PJ7E 3IU4L 4GOSA 5DTFA 5J0BA 2VRAA 3QIBC 4MDIA 1DQDH 4JFDE 5MENE 4OBRA 4I18A 4GH7B 4XPHH 1ZWIB 3HZVA 3NCFB 1KEMH 2P8PA 3BH8A 4YZFE 5BW7A 5JHDD 1U8MB 4M8VA 2BRRL 4G7VH 3DVFA 4G9DA 3HAEG 3I50H 3SDAD 3CFCL 5MERB 4P48A 3BHBB 5CSZA 3P0YH 4PRAB 5C0BB 2G5RA 4D9QE 3BEVB 4QRPB 5F93C 4BSVB 4M43L 3L3IB 1KJVA 4J3SA 4WU5A 3T65B 3QHFL 5TDPA 3EJYD 4PJIB 3RWFB 1NCCL 1JHTA 4J6RL 5HYFA 1RIVH 4NKQB 4PRIE 4OJFL 4JHWH 2UV3A 3BO8B 2AXJA 4XXDB 5C09E 5IOPA 2G60L 3QDGB 1FYTB 5DQ9A 1MCPH 1U41A 2JCCE 3IGAB 1K85A 1FDLL 4LF3B 4QRQA 4KMQA 4RISL 5E2TH 2NXYC 1PKOA 1C1EL 1T1XB 4IDJL 4WTWA 3SGKA 5SX5H 3VFVB 4KWUA 3RWHA 5FECB 4G6JH 2BVUA 2XV6B 3KWWA 3O8XC 2NZ9D 1MFCH 3CK0H 3PWUA 4J3OC 4KDWA 4LLVA 4YZFF 3RPKA 3B8YA 1BEYL 1S7QA 1EO7A 1I3RB 3NCJH 1YMME 2JB6A 4POZD 3P4NA 4NQXA 2W91A 2C7UB 3UJIH 3MRLA 4RAHA 5DRWA 3FFCE 1BBDH 4H88H 3O8XA 4ZOCA 1JPST 4RZCA 5E0QA 4YDVA 3MFFB 5CP7A 2DLFH 3MYZA 4U0QB 5L88H 1J5OH 2ORBH 3U83A 1KELL 3LH2H 4ZUSB 1DP0A 1ZT4A 4QHKJ 2GY5A 4X80H 2XZAL 4NFDA 2J6EH 4BZ1L 2Z93A 4ZO6A 1KN2L 3RWIA 5DRXB 4KZDL 2PXYD 2Q86A 3T4YB 1MCNA 1IM9B 4G6MH 3EO9H 3P9LA 3KPRD 4JLRB 5E4EC 4EVNA 4EI5A 3RHWK 3LKRA 5F70A 4GKNA 4OLZL 2EDKA 3KPQA 4S10A 2Q8BH 5K9QG 4M8QA 3DSFH 5GS0H 3P4OB 1K6QL 4HEME 2YWYA 2VZSA 3OKEA 5AEAA 3LKPB 2YD2A 4MSWB 2XPGA 5EU3B 5FYKU 4XXCC 4YHKH 4GG6E 2HWZH 1T0MA 2YKLH 2B0SH 3WFCH 1NFKA 5T3ZE 4K3JL 3QUXD 1MNUL 4MQTB 5JORB 4G5ZL 2VXQL 4KDTC 4PGDB 1N0XH 2D4FA 2I27N 3KPMB 2NR6D 4L3AA 1F2QA 43CAA 3K81A 4XXCA 4K23H 3SDCC 4EI6A 4JHAL 1QKZL 3C6LB 4H1LH 3H8NA 2NY5L 1GGTA 5D72L 2GY7B 4FQQB 1F6LL 2HAZA 1JRHH 3JXAA 5EZOL 3VWJA 3V8OA 1ZMYA 1G6RH 1EBPA 1MWAA 4GT7A 4F8TA 3U9UB 5L0QC 2PTUA 1QSFB 3OJMB 5I1JL 5HHNB 3RPIB 1WBZB 3QIUB 3HG1D 1IGCL 4JGMA 5DFWH 1SM3H 5TPWH 2V2TA 2QQLH 3TV3L 3RWDB 4LRIA 3MBEC 4FFYH 4XAWL 2VDKH 4YQXH 4KZEH 3U7WH 2WNGA 1R5VB 4H5SB 5C0AD 1I7ZB 2VL5A 3V79C 2OP4H 3R06B 1T66C 1BHGA 1T83A 5HGAA 2ZP0T 5J12C 4KJQD 2B1HH 3CZFA 2BOBB 2D03L 4GKZA 4YE4L 3C5SA 5FV2A 4E42A 3SQOH 3BOVA 1KIPA 3IXAB 5EBWB 3VRJB 4LLAA 5DZNA 1OLZA 4M7JH 1F3JA 4OIAA 3QJFA 1KB5A 3C2AL 5IJKA 2V9QA 3RIAK 5JO5A 5IBUB 3SY0A 5TDOB 1J8HD 5C0JB 5MEND 2J2ZA 5ESVB 1U8JA 2CDEB 4A2LA 1NBZB 4MXQD 8FABA 4H26A 3CH1A 2D2OA 4GMSL 4EN3B 3BPNB 4B5EA 4PJ9A 1ZHBA 1E4XL 1FVCB 1HINH 5IM7A 5JIKA 4OUUB 2VAJA 1MCOL 1QUNA 3BUYB 4XHJD 3G6JA 3MJ6A 4XP9L 1CQYA 5JR1L 5JTWA 4YX2H 5FYLH 2AXHA 1JPFA 2ZUVA 4G9FB 4QRSB 2X4NA 3WNKA 4J8RA 4P49A 5C09D 3ULUC 2H6PB 3CFKA 5CD3A 4G6AC 3UBXA 2E27L 1HQ4A 1A1OA 2GJ6B 3QUZA 4OAWB 5HGBA 1Q0YH 3ZDZE 1NCBH 1NEZA 5FOJA 3S37H 3F7VA 3KPSD 5FYJD 4ODVH 3L1OH 3FMGH 4YNYB 1C16B 3TN0A 1S9YB 3ZKMD 1QQDA 3DROB 1A6UL 4FQPA 2FWOA 2NY0C 1S5IL 3CDYA 2J8HA 4P2OC 2AJVH 2EDYA 4GAYA 5ETUB 1J0KA 1W72A 4U31A 3EOBB 3U6RB 3A6OA 4YC2C 4HH8A 1TJIL 2DF3A 4NOFA 2ZCKH 4HJJL 4NRZB 3H0TB 1RFDL 4XB7A 2EH7L 4JPVH 4GQ9L 3T0VA 4MA3B 4O2CB 1FVEB 4U1KB 5EU7E 3S34H 4JM4L 1S3KL 1ACZA 3VFTA 2BVOB 2ZCLL 3V5KA 1AD0A 4PBXA 3EYFB 5CP3A 3S5LA 1U36A 3W39B 1FFOA 4OTXH 5IKCB 2HLAA 3BZDA 4IMLB 1F5WA 1AE6H 1UZ6E 4NO0B 4KROD 1KNOA 1MQKH 3C8KB 3BT2L 3WE6B 2J88H 3D85D 1C8PA 2BNRD 1RUQH 1BQSA 1B90A 2XXMB 3QBTB 2D31A 4XNXL 3WBDA 1RMFH 1PG7W 4OCXL 1FO0A 4GUPA 3QZWA 4GBXA 4LLYB 1DDHA 4KGLA 2PYFA 2J5LC 2DQJH 4MJ5B 4F7EB 1Z9SA 2F54A 4UU9B 4OLVH 1OAXH 1F13A 4N0RA 3RBGA 1CDBA 1NFIA 5EULV 4I3RH 5EBLB 4TUOA 3ROOA 1D5XA 4D0BA 4K8RH 2APWA 2R29H 1FFPB 2CKBA 4XPBL 4ZDHB 4BH7B 3FB7A 3FRUB 3FQNB 4NDMB 3U4BH 1TZGH 4LAJH 5ERWA 3B3IA 3GMOB 3ARBC 4Y2DC 4MNHA 3U30B 1X4YA 4XMPL 1YEDB 2AJUL 2JJTC 1AXTH 1T7WA 2B2XL 5I17B 4V1DD 4RFEA 25C8H 2XWTA 1VPOL 4LSSH 1G9NL 2E6PA 3MJ7A 3WIHL 2FJGB 4WGVB 3E0GA 5JPNA 4G6FB 1MFBH 2ILLA 3QT2A 4NJ9H 1M7IA 2HFGH 1CICC 3IJYB 4DKEH 1XCTB 1ULVA 3NA9L 4AIOA 5FO9B 4QRUB 3J8F7 2EC8A 3C87A 3KR3L 3OF6D 1E27B 1XGRB 2P5EA 4Y1AA 2DDQH 3L5XL 4ZTPL 3BGMA 2XTJC 3UPCA 2EDRA 1A1NA 2OK0L 4I3SL 1PZ5A 2PTVA 1F3RB 3WL9B 5F1OB 4M61B 1G7LB 2UVEA 5EC2B 1CICA 4HUWB 1I1RA 3G6JE 4ZNEE 1T1WB 3SE8H 5ICYA 3CPLB 4PRDB 3O9WB 4HXAL 2VE6A 1QOKA 4O02H 3QH3A 4W4OA 4XCNA 1Z2KA 4FQJH 4OD2A 2IWGA 4WDIB 1WFUA 1VGKB 1HEZA 3TO4D 4WW2A 2BXYA 2P5WA 2R69H 3KYNA 4WI3A 5T5NF 4HFWA 3WXVH 4K3EH 2VDRL 1TDQA 3IDNB 1NBVH 2F5AL 2FX9L 4BELD 1GIGH 1RZJH 1A8JH 4R96B 3E2HC 3UZEA 2IAND 3X12A 2BDNH 1T04A 3WEXB 1Z5LB 1EIBA 5JA8B 2UWEF 1AO7B 4WWKD 3VGGA 3EYUH 2M8XA 3O6KH 4WO4B 2HKHL 2HA1A 5EU6B 5EOQH 3QWQB 5DEFA 1P6AB 4R4FH 4H1LB 4PGEB 5E5MA 3EJZC 1HI6B 3G6JF 1T0NA 3MPCA 1YEGH 3CFDB 1G6RB 3IFPB 3A6CH 4DJMA 4NYLA 1T20A 1JHKL 1D5BB 3I02B 3L95A 1ZT1B 3DMMD 1NC4B 5CZXC 4XP1H 2VR5A 1TCRA 5E6ID 4ORZC 2B4CL 4HGMA 4LCWB 3SE3C 5GRWA 5ITFB 2AJ3A 4Z0XB 3HZMB 1UCBH 1UXWB 3QUMH 4DOHB 3GJFA 4HG4K 4TYUA 1A5FH 4Q74A 1H3TA 5SWZD 2FNBA 2VWEC 5GGRY 2FLRT 1KGCD 3CSPA 3GNML 4K3GA 1BOGB 4RMQA 5DS8B 4RAUB 5DO2C 3QFJA 5TGBA 2GT9A 3B9KD 4HS3B 1N5YH 2X4OA 4XRCA 5IR1B 1I9EA 2F54E 1TPXB 5FIEA 1IE5A 3RZCD 4NP4H 3BDYH 1FG2B 4GRLC 5ITBL 1WLHA 1ZLUK 2MCPL 1GPOL 5F89A 3BP7B 5BRZD 3VFUB 1U0QA 3SKMB 1ZGLP 1BIIB 1CXEA 4MD4A 3MRIA 4PFEA 5IHLB 3FT3B 5I1KH 3W9DA 5D2NA 1L9NA 1UB5A 1H3PL 3IDJB 3N1FC 1CG9B 1G7PB 5F6IB 2VZ1A 4OZGA 1BX2A 1B6UA 3ULVH 3RGVC 4PJ5A 1A2YB 1RZKL 5J1TC 3BP5B 1EHXA 3QAZC 3DVGA 3S4SB 5FF6B 1LVEA 3KJ4C 4LCIL 2DQTL 1MJ7L 4GLRH 1DBKH 4OLYL 5D93C 3SPVB 5I76A 4HAFA 1CBVL 2BMKB 2V2WA 35C8L 3EDDA 2PN5A 2C1PA 5K9JH 1G7QA 4ZAKA 4YDKH 1A6WL 2P5EE 4Y1AE 4JANA 3OR6A 3NCYP 4JY6A 3ETBF 3IU3B 4UB0L 3BVNB 3BDBA 2L4OA 3H42L 1ED3B 1KENL 1V7ML 4HIIB 1AQKH 1FFNB 4P5KB 4Y19B 3TWCH 1F90L 4MAUL 5EO1B 4BH8A 5J89A 4JZJA 4WY7L 2VR4A 3K3QA 1NCUA 3K80A 3VJ6A 1E6JL 4HMCA 4KK5C 4P4RB 2DI7A 1CQKA 1TETL 3T04D 3TESA 1HCFX 4W70A 4NHCH 2DWDB 5EIIB 3FN0L 1U8NB 4RWYH 4KKAC 1CGWA 4HIEA 2WBJC 4LNVA 2P5WE 1UQSB 5HHOB 5EIVA 4WUUB 4K07A 4UQ2B 4F9PC 1B3JA 4E41A 5JW4Q 3H3KA 3QEUA 2PW1A 2R4RL 2R0ZL 4YEFA 5BQ7B 5B39B 5HI5D 4WI9A 2WBJA 4K3DL 4GG8A 3GSXB 2XT1B 3AU1B 3R4DA 1IGTA 4OSUH 4I2XB 2B39A 1RJLA 4PLOB 5T5NG 3QIWD 2VLRE 4KRNA 4HGWB 1FL3B 1W0WB 2CDGB 1HOCA 4JDVB 4NQDA 3V7AE 4NCDA 5JXED 2WIMA 3ELAT 3VMNA 4H8WL 5C9JA 5CBAB 2DD8H 4G80B 4IIQC 1KB9J 5IG7A 5BOPA 1VDGA 4FFZH 4U1SA 2C3VB 5AUMA 4PTTB 3WIFB 3L5WA 1UM4H 1UZ8B 4GMTL 5IHZB 1NJ9B 5JQHC 1CF8H 4WW2F 5I15H 4TSBH 1MCKA 2K7PA 5I8EB 3LKNB 1X5XA 3E6HB 5IB4B 2DYPA 4KQ4L 5JNYA 1YECH 2W9LA 3RU8L 3DX9B 3BEWA 1QG3A 1LO5A 4FABH 3SDAC 5H8DA 3FONA 3DRTA 4TSAL 1AI1H 3BDXA 4WI8A 5HI4D 3LMJH 3QG6B 4ACPA 4M1GH 3S3SA 1BFTA 1S9KC 5C0DA 2ZKHH 4ORGB 3QFJE 4WHTB 3B8SA 4KY1L 3O4LB 4ERSL 2Y06H 1S7UA 3MV9E 5KW9L 4QYOB 1J05A 4PB9H 1WZKA 4ZQKB 1NEZG 2ZNWA 1M71B 4NM4H 3TCLB 1RU9H 4XNYH 3GJEA 2V7HA 3V4PH 2XKSA 3ZYOA 1D5IH 2FATL 5FAAA 2NXZB 3QEHA 5FA4B 1KIQA 1KB5L 4ZSOA 1F4XL 5D2NE 4L8DA 3EYVB 4LU5H 2UZXB 1KFAL 4OZGE 2R23A 4PJ5E 4RMUA 1WBXB 3QEQD 4EKXA 3C60A 4A6YL 3IXTA 4ONHA 4FRWA 5C92A 5KVMC 2BERA 2V5RA 4POZC 2BNUA 3U1SH 3L5IA 1TQCC 3RVTC 5F3BB 4LFHD 4GBXD 2BJML 2J12B 4DTGL 3D39B 1TTGA 1DEDA 2ADFL 3S5LG 5GSRA 3ESUF 1WEJL 4IBLT 3HE7B 3MX0A 3LDBB 1JZ3A 4YHNB 2X7LA 3QZWG 4QTHB 1R0AH 4NGHH 4NKMB 4K7PL 2Z31B 3CFBB 1ZLWH 5F7UA 3NGBB 3HE6A 1RUPH 2IF7A 4OZGF 4J12A 4DVBB 3VD4A 1KTLA 5LAXB 2VISB 2VLJB 2XQYG 1BZ7B 1W72L 1HHKA 4HJ0D 3G5XB 3BW9B 3Q6FA 1MJJB 4LP5A 1MAKA 4Y16D 1HH6A 3DTXA 4QNPF 2R0LH 3QDMB 3R0MA 1T2QL 4XCFH 2WINA 3LQZB 1U91B 4P23B 1HYRC 2P5ED 3TBTA 3FOMA 1A7NH 4XHQA 5C07D 1DVFC 1ZV5A 2CLZB 4U6HA 4I77H 5B38A 3D9AL 3KLSA 1HSBB 2DQFB 3OJVC 4FQHB 2VIRA 4JEGB 1EUUA 5DK2A 4M1DL 5TDNA 1IZKA 2HH0L 2A0LC 2Y5TB 4Z7UB 1EGJH 4NQDE 1F58L 3Q1SH 3TZVD 3WS3B 4PJHB 1A1MB 4PP2B 1II4E 4R8WL 5IMMA 3S96B 5D4QA 4QCIA 3D3VD 2OSLB 3QDJB 2DOCA 4JAMA 1FO0L 3TO2A 4GRMA 4U33A 4N0YH 3HC0B 2P5WD 3BWAA 4LDEB 1AXSB 5ALCH 1ZS8A 4LQ1A 2I9LB 1TITA 1NBYA 1A4JB 2X41A 4I0CC 3IKCB 4GW4B 3D69B 1UM5H 1VGEL 1MCIA 1SEQH 1J7VR 2NNAB 4M9PA 4K71B 4Y8DC 3ORJA 2W9DH 1DQQB 3LOWA 4ODHH 4D9LH 3VA6A 3VA2C 2CKBL 1NMCC 2BSRB 3ZYZA 3MACH 3QG7L 4Q6IB 4KJQC 4PJ8D 4NKDA 4OFIA 3PQYD 1FLRH 5ANMA 1YYMH 2VLRD 3IVKB 4N1CA 3JTTB 1OP5H 2X1OA 4XP5L 3GSRA 2F19L 5CIPA 4P46A 4KJYA 2B1AL 4HT1H 4OGZA 2ZG1A 3ILQD 2OZ4H 2JTDA 5KVEH 2FDBP 1JPGB 5I8CB 5SWSA 4NCC1 2EDBA 4JHBA 3RWCA 2CDFB 3D6GA 4FNLL 4R0LC 3T0AA 5GIRB 1JNLL 1I1YA 3GSWA 1OAYH 2R2EA 4UT9H 5ACMA 3EHBD 3CSYB 4I4WB 4MAYA 1UA6H 1UC6A 4KK6D 3V7AG 1DN0B 4GXVH 4XCEA 1CFVH 4QRRD 2KH2B 3DSNA 5C0GA 4XHJC 4Z7NE 3MRGB 5GJTH 3RKDD 1PY9A 1U3HB 1A0QH 2XN9D 1EJOL 5E2WH 2YA2A 4S11A 4ODXA 5JIPA 5AD0B 3OB8A 5C0CD 4FZ8H 1WJ3A 3MV9D 3LAFA 3KLAB 3OPZL 3BGFC 2VJXA 5D7LA 5HI3D 3B2UC 1MFEL 4LLQB 3GIVB 3I75B 1SBBA 5D7JA 4X4ME 1TFHA 3CCHB 4K7PY 3WIIH 1JGLL 2NY1B 4RQQB 4S1DD 2MNUA 1PSKH 5F9JB 1IM3A 1X5YA 1FL5B 1YUHB 2FO4A 1D6VL 3PP4H 5J1AA 4JO1L 1H15B 1WV7T 1QBMH 3WFDH 3UROR 5CJOH 3VFPB 2DJSA 1L0QA 5LQBL 2IQ9L 1BQHB 3U82B 1NGYA 4CMHB 4XI5D 3JVGC 2P7TB 3LQAC 4FQXB 3HMXH 1OAQH 4U1HB 4TVSa 2HJFB 1T7XA 3BKJL 4Z7NF 4OT1H 2NY2D 3MRFB 6CGTA 1FNHA 2V6HA 1M6OA 3SKJH 2Q76A 1SEBB 5FK9B 2XA3A 4ZAKD 3GRWH 2QKIB 4M03A 2ED8A 1KPUB 2R56L 5FYKE 2CH8A 3L3KB 4OCNC 1KYOK 3TBWB 4L8BA 2G2RA 4KMTH 1K4DA 4NUGL 4KROC 1XF4A 2ZUXA 3SDXB 3Q3GB 3WKMH 3FT2B 4Y5VB 3D2UD 1XF2B 1JZ6A 4X98A 1YNLH 5CEYB 3FQUA 3Q6GL 5CMAB 5L6YH 1INEH 4TUKH 2PYEA 2FLBT 3LSOA 3K4DA 1KF9B 4L3CA 2H2SD 3WFBH 2I25N 3P0GB 1Q9LB 3PHOB 5CCKL 1UWEH 4HWZA 4JKMA 5IT2L 2BSSA 3QCUL 4FZEH 5IEHA 1KJMA 4DZ8A 2WAHA 2F58L 1ITCA 2XRAL 4FQ1L 2EECA 3RUGB 5F88A 3FQXA 3L3JA 1UYWH 1MRDH 4B0MM 3OKKA 2IBZY 1CFNB 5I1EL 1PJ9A 1F11A 1DQJA 1T3FB 5GGVL 3U7AA 1KJ3H 5GGUB 4JRXB 2EDTA 5CJQL 1H0DA 2BY3A 4XNZB 5EUKA 4Y5YA 2HVKA 2A1WL 2VZTA 4NFBA 1D6EB 4O4YL 3BGAA 4MJIA 5DEGB 4MGXA 2XZQH 1DFBL 4HKZB 5SWSE 1A64A 3CSGA 1FZKB 4CVWA 3FQRB 3F7YA 3TEUA 3MSPA 2UZIL 1GHFL 4PG9B 4IRSB 4R7NB 1FVDA 3HMWL 4HC1H 3FQWA 4XPGL 4HK0B 3GBMH 1AHWA 2EO1A 1FFRA 1JUFA 3KPLA 5A2LH 3P77A 2BC4A 2I26N 4JFXB 3U2SB 4L29B 4P2QE 4OB5L 2AJSH 4YDJB 5MEQB 2JJSA 4DK3A 1HDMB 5AYUL 3WJLA 2I60H 1BF8A 4JKLA 5D7LE 1XT5A 2IBGA 3H2WA 1IAKA 3JV6A 5D1XA 3CVHB 2E5EA 2IPUK 2DIJA 2DMCA 4ZFGL 3IDYB 1J0IA 5I9QC 4X6FA 5IMKB 2XICA 4WUKH 5TQ0H 1T2XA 3FB8A 1I3UA 5IFJB 4WWKC 3ULSB 1BJ8A 4APQC 2X05A 2H26A 4F80A 4L8CB 1S7RB 1X7QB 1LD9B 1HXMA 1HH9A 1KCRL 4JM2B 4U1GB 5F97E 3HS0B 2QSTA 3SCMB 5F3HB 3EDEA 5EWIH 5I74C 4CVXA 4X7EC 4DZBB 5IW1A 1MVUB 3CJJA 4H0IA 3SJVD 4KV5E 1F4AA 5EOCJ 1UKSA 4FTVB 4L9LB 2V9TA 4YXHH 3MGOB 3QPXH 3VG0L 3TNNA 4X7DC 3ARFC 3VW3L 1BJ1J 3DMMC 4OD3L 4KTYA 3ALXA 4ODTH 3SDYL 4DFIA 4QT5B 2VC2L 4LIQH 2FYYB 5IVXB 4EIZC 3LV3B 2IPKA 4ETQB 5DQJB 1XGPB 1XIWD 1ZGLB 1LK2A 5DMIL 1PEWA 1L4IA 3TT3L 2IH1B 3MNWA 3UXFA 4LSQL 5I1CL 5IBLD 3ARFA 3OKOB 4NBZB 2BSTB 5GISH 1F02I 3MOBH 1MLBA 1CU4H 3O2VH 2PYEE 2X89A 1IBGL 1WISA 2OXHA 2DBJA 3CFEA 2ZUQB 4KJPD 4F58L 1CIDA 4Y4KB 3MLVL 3QFDB 3B9KC 3FO9A 1VFMA 4HS6B 4CN1A 2KUTA 4L4VB 5FCSH 5IP4A 1MI5D 4AG4H 3SBWA 1T7ZA 3DYOA 1TQBC 1V05A 1Z0MA 3QUYB 4JFYB 4HWEH 1UWXK 3RZCC 1L7TH 3VFSB 4QXTB 1QVOA 1T4KA 4Z95H 5BJTB 4OIIL 3I2CL 1I1AD 4G42A 4LOUD 4GRWH 4S1SH 4XC1H 1CK0L 4FXGA 3SEPA 3AMKA 3SKNB 2EH8L 1IC4H 5GGVY 3ULUH 3TBSA 2C5DC 4Z9KB 4BUHA 2IAMA 1IKNC 3U36B 5HGDB 4KC3B 4LARH 4ZS6D 4LLMB 1Z9OA 1OGAA 1AJ7H 1YEHH 4YXKH 4Q2ZB 1KN4H 2M2DA 3F12B 4JR9L 4MXWH 2C4XA 2CK0L 5E56A 1YY9C 4OZFA 4MJIE 5B38G 2V17H 1ZGLM 1FZOB 4PJXA 3IYLW 4M7KL 2YA0A 2RCSH 4XMLL 2FX8H 4LHQB 5ID0A 2VTFA 2YD6A 3GSQB 4PRPB 4PP1D 2IQAA 5DYOA 5IF0B 5DMKB 4ZPTB 2XKNA 2AERT 2FGWL 2EKSB 4L1HA 3PNWB 5H37H 4OCRH 5ISZB 1KLGA 3QIBB 2DTSA 1KCUH 5F7DB 4P2CG 3MLWH 3BPOC 1O0VA 1TVBA 2MKLC 5CSBA 3MRQB 3C8HA 5D7SH 1NL0H 3MO1A 5CS7A 3UO1L 2X4UB 4X6EB 1T21B 1GAFH 2AGJH 2VXSH 1RUAH 1C5BL 5GS0D 4OM0L 1TXKA 4TOYH 1F42A 1TZHA 2P8MB 1K2DB 3ARED 3TFKD 3KPPA 3WNPA 4P46D 5IJVA 4GAJL 5T1KD 3OAYH 4MWFB 3L7FB 3QXAB 1B0GB 4MMZC 4PBVC 4NN6B 3DX7A 1YDPB 1AKJB 3H7BB 5HHXH 2HRPL 1QLFA 4YFLI 5JDSB 4NQEA 3PIQA 3LEXA 4LL9A 4HKXB 5FYKL 3RJQB 4TTDD 4LVHC 1P9MA 1QSEB 5E2UL 4IEFB 4G8GA 3HTLX 1JYNA 3QIWC 2EDNA 2DLGA 5A1AA 4JO4L 1KCVL 5JXEC 1I3GH 4WTZA 4TTGA 1OWRM 1F2XK 3PWJA 4P2QD 3K2UL 1VENA 3OZ9H 4X6BB 2E3VA 4XP4H 1RPQA 4QHLB 1W8OA 3LN5A 1SY6H 4OV5A 1I75A 3SGJA 4MA8L 3T1FB 4Q58C 1B0RB 5HDOA 2FJFB 5DVLA 3MNVB 2OXGA 3DUUB 3NAAL 1NKRA 1KPRB 4PB0L 5D7LD 2BY0A 5DMYA 5T5FH 1R5WA 5CJBA 1G9MC 32C2B 3THML 3GSVB 3NFSH 5EUOF 3LKSA 3IF1A 4HLZG 4KI1A 3RL2B 5HI4C 5DJCB 3C5ZD 4OI8A 1JWMA 2YZ1A 3GHBH 1N3NA 2A9ML 3BKYL 3AS0A 1KCSH 3X3FH 4C83A 3MRHA 5FUZL 3LS4L 5IV2A 1NUNB 4AL8H 5JMRA 2KL6A 1JGEB 5ADOH 5JHLL 2ZPKH 3UC0H 3U0WL 1N7ML 4K94H 2VN4A 4BFGA 5E4EB 3P30H 5EZJA 2FR4A 2ICCA 4JE4B 2GJZA 5E1HB 3LQMA 2EYTA 1MRCL 4ONGL 5HYQA 2Y7QA 4GXUN 5D2LB 4GSDH 5FGRA 4DKFH 4JPWL 2W0KA 3DIFB 5HGHA 2V7NA 4OLWL 3LS5L 3W0WB 4JRWA 4DGVL 1P84J 3S35L 4PUBH 3QQ3B 5B3JE 4AM0B 1JI1A 5GGSB 1DQLL 1RZIB 2ITDA 3CLEH 3MZTA 4ELMA 4I0PD 1BPVA 2YRZA 1HK6A 4GLRI 4XBPB 3VI3E 1KC5L 5BS0D 1DANT 1VEMA 4PJXE 3SDCB 3U79A 3BIBX 4LQFL 4MNGB 5T3XH 4PRHD