2QEUA

Crystal structure of putative carboxymuconolactone decarboxylase (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
ATSQDILKQHAAHYESDMGGLPEALVQLAEYAPETFDAYSRMRTTMLKSEADGAKLPLKYKHLILVVLDAIRDEPIGIVNHTRAAMNAGLSVDELIEGILLGIIVYGMPAWGKTGRKAVTFAVEFEKELAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative carboxymuconolactone decarboxylase
publication title Crystal structure of Putative carboxymuconolactone decarboxylase (YP_555818.1) from Burkholderia xenovorans LB400 at 1.65 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Lyase
total genus 45
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2qeuA00
5DIPA 1GU9A 1LW1A 2IJCA 2PRRA 2QEUA 3LVYA 2O4DA 1KNCA 2OYOA 1ME5A 1VKEA 3C1LA 3D7IA 2GMYA 2PFXA 2Q0TA 1P8CA 5DIKA 2OUWA 2CWQA 3BEYA 2AF7A 4G9QA
chains in the Genus database with same CATH superfamily
3AA0A 5DIPA 5AFUK 2JN8A 2KZ7A 1GU9A 1LW1A 2IJCA 2PRRA 4AKRA 2QEUA 3LVYA 2KXPA 2ES9A 3AA1A 2O4DA 3AA7A 1KNCA 3AAEA 2OYOA 1ME5A 5ADXK 1VKEA 3C1LA 3D7IA 2GMYA 2PFXA 2Q0TA 3LK3A 3AA6A 1P8CA 5DIKA 3LK2A 3AAAA 2OUWA 2CWQA 3BEYA 1IZNA 2AF7A 4G9QA 3LK41
chains in the Genus database with same CATH topology
3AA0A 5DIPA 5AFUK 2JN8A 2KZ7A 1GU9A 1LW1A 2IJCA 2PRRA 4AKRA 2QEUA 3LVYA 2KXPA 2ES9A 3AA1A 2O4DA 3AA7A 1KNCA 3AAEA 2OYOA 1ME5A 5ADXK 1VKEA 3C1LA 3D7IA 2GMYA 2PFXA 2Q0TA 3LK3A 3AA6A 1P8CA 5DIKA 3LK2A 3AAAA 2OUWA 2CWQA 3BEYA 1IZNA 2AF7A 4G9QA 3LK41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIP A;  1GU9 A;  1LW1 A;  2IJC A;  2PRR A;  2QEU A;  3LVY A;  2O4D A;  1KNC A;  2OYO A;  1ME5 A;  1VKE A;  3C1L A;  3D7I A;  2GMY A;  2PFX A;  2Q0T A;  1P8C A;  5DIK A;  2OUW A;  2CWQ A;  3BEY A;  2AF7 A;  4G9Q A; 
#chains in the Genus database with same CATH topology
 3AA0 A;  5DIP A;  5AFU K;  2JN8 A;  2KZ7 A;  1GU9 A;  1LW1 A;  2IJC A;  2PRR A;  4AKR A;  2QEU A;  3LVY A;  2KXP A;  2ES9 A;  3AA1 A;  2O4D A;  3AA7 A;  1KNC A;  3AAE A;  2OYO A;  1ME5 A;  5ADX K;  1VKE A;  3C1L A;  3D7I A;  2GMY A;  2PFX A;  2Q0T A;  3LK3 A;  3AA6 A;  1P8C A;  5DIK A;  3LK2 A;  3AAA A;  2OUW A;  2CWQ A;  3BEY A;  1IZN A;  2AF7 A;  4G9Q A;  3LK4 1; 
#chains in the Genus database with same CATH homology
 3AA0 A;  5DIP A;  5AFU K;  2JN8 A;  2KZ7 A;  1GU9 A;  1LW1 A;  2IJC A;  2PRR A;  4AKR A;  2QEU A;  3LVY A;  2KXP A;  2ES9 A;  3AA1 A;  2O4D A;  3AA7 A;  1KNC A;  3AAE A;  2OYO A;  1ME5 A;  5ADX K;  1VKE A;  3C1L A;  3D7I A;  2GMY A;  2PFX A;  2Q0T A;  3LK3 A;  3AA6 A;  1P8C A;  5DIK A;  3LK2 A;  3AAA A;  2OUW A;  2CWQ A;  3BEY A;  1IZN A;  2AF7 A;  4G9Q A;  3LK4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...