2QEUA

Crystal structure of putative carboxymuconolactone decarboxylase (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
132
structure length
132
Chain Sequence
b'ATSQDILKQHAAHYESDMGGLPEALVQLAEYAPETFDAYSRMRTTMLKSEADGAKLPLKYKHLILVVLDAIRDEPIGIVNHTRAAMNAGLSVDELIEGILLGIIVYGMPAWGKTGRKAVTFAVEFEKELAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative carboxymuconolactone decarboxylase
publication title Crystal structure of Putative carboxymuconolactone decarboxylase (YP_555818.1) from Burkholderia xenovorans LB400 at 1.65 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Lyase
total genus 45
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2qeuA00
2OYOA 5DIKA 2CWQA 2O4DA 2Q0TA 1GU9A 2PRRA 5DIPA 1VKEA 2QEUA 1LW1A 2IJCA 2OUWA 2PFXA 1P8CA 2GMYA 1ME5A 2AF7A 4G9QA 3LVYA 3C1LA 3D7IA 1KNCA 3BEYA
chains in the Genus database with same CATH superfamily
2OYOA 5DIKA 2CWQA 2O4DA 3AAEA 3LK41 2KZ7A 5AFUK 2Q0TA 3AAAA 1GU9A 2PRRA 3AA7A 3AA0A 3LK3A 5DIPA 1VKEA 3LK2A 2QEUA 1LW1A 2KXPA 2IJCA 2OUWA 2PFXA 1P8CA 2GMYA 3AA1A 2JN8A 1ME5A 2AF7A 4G9QA 2ES9A 5ADXK 3LVYA 3C1LA 3AA6A 3D7IA 1IZNA 1KNCA 4AKRA 3BEYA
chains in the Genus database with same CATH topology
2OYOA 5DIKA 2CWQA 2O4DA 3AAEA 3LK41 2KZ7A 5AFUK 2Q0TA 3AAAA 1GU9A 2PRRA 3AA7A 3AA0A 3LK3A 5DIPA 1VKEA 3LK2A 2QEUA 1LW1A 2KXPA 2IJCA 2OUWA 2PFXA 1P8CA 2GMYA 3AA1A 2JN8A 1ME5A 2AF7A 4G9QA 2ES9A 5ADXK 3LVYA 3C1LA 3AA6A 3D7IA 1IZNA 1KNCA 4AKRA 3BEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYO A;  5DIK A;  2CWQ A;  2O4D A;  2Q0T A;  1GU9 A;  2PRR A;  5DIP A;  1VKE A;  2QEU A;  1LW1 A;  2IJC A;  2OUW A;  2PFX A;  1P8C A;  2GMY A;  1ME5 A;  2AF7 A;  4G9Q A;  3LVY A;  3C1L A;  3D7I A;  1KNC A;  3BEY A; 
#chains in the Genus database with same CATH topology
 2OYO A;  5DIK A;  2CWQ A;  2O4D A;  3AAE A;  3LK4 1;  2KZ7 A;  5AFU K;  2Q0T A;  3AAA A;  1GU9 A;  2PRR A;  3AA7 A;  3AA0 A;  3LK3 A;  5DIP A;  1VKE A;  3LK2 A;  2QEU A;  1LW1 A;  2KXP A;  2IJC A;  2OUW A;  2PFX A;  1P8C A;  2GMY A;  3AA1 A;  2JN8 A;  1ME5 A;  2AF7 A;  4G9Q A;  2ES9 A;  5ADX K;  3LVY A;  3C1L A;  3AA6 A;  3D7I A;  1IZN A;  1KNC A;  4AKR A;  3BEY A; 
#chains in the Genus database with same CATH homology
 2OYO A;  5DIK A;  2CWQ A;  2O4D A;  3AAE A;  3LK4 1;  2KZ7 A;  5AFU K;  2Q0T A;  3AAA A;  1GU9 A;  2PRR A;  3AA7 A;  3AA0 A;  3LK3 A;  5DIP A;  1VKE A;  3LK2 A;  2QEU A;  1LW1 A;  2KXP A;  2IJC A;  2OUW A;  2PFX A;  1P8C A;  2GMY A;  3AA1 A;  2JN8 A;  1ME5 A;  2AF7 A;  4G9Q A;  2ES9 A;  5ADX K;  3LVY A;  3C1L A;  3AA6 A;  3D7I A;  1IZN A;  1KNC A;  4AKR A;  3BEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...