2QEXO

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 2qexO00
3CC7O 2OTLL 1VQ8O 1M90P 1VQLO 3I56O 3CCJL 1VQOO 3CPWK 1K9MM 1Q86M 2QEXL 3CCMO 1K8AM 1Q7YP 1QVFK 3CCVL 3CCUL 3I55O 1YHQO 3CC2L 2OTLO 3CCJO 3CCSL 2QEXO 1YJWL 3I55L 1M90M 1JJ2K 3CCVO 3CCUO 3CXCK 3CC2O 3CCEL 1QVGK 1YITL 3CCQL 1YI2L 1Q7YM 1NJIP 1KQSN 3CCSO 1N8RP 3CC4L 3CCLL 1YJWO 3G4SL 2OTJL 1K73P 3G71L 3CCRL 3CCEO 3OW2N 1YITO 3CCQO 1VQML 1KC8P 1YI2O 1VQ9L 1VQ6L 1VQNL 1KD1P 1M1KP 1Q81P 1W2BN 3CMEL 1VQ4L 1VQ5L 3CC4O 3CCLO 1YIJL 3G4SO 2OTJO 1NJIM 1VQKL 3G71O 3CCRO 1VQPL 1S72L 1N8RM 1VQMO 3CD6L 1Q82M 1VQ9O 3G6EL 1Q82P 3CPWN 1K73M 1VQ6O 1VQNO 1YJNL 1YJ9L 1VQ7L 3CMEO 1QVFN 1VQ4O 3CMAL 1VQ5O 1KC8M 1KQSK 1YIJO 2QA4L 1VQKO 3CC7L 1K9MP 1KD1M 1Q81M 1Q86P 1M1KM 1VQ8L 1VQPO 1K8AP 1S72O 3CD6O 3G6EO 1VQLL 3I56L 3OW2K 1VQOL 1YJNO 1YJ9O 1VQ7O 1JJ2N 3CCML 3CMAO 3CXCN 1W2BK 1QVGN 2QA4O 1YHQL
chains in the Genus database with same CATH superfamily
3CC7O 2OTLL 1VQ8O 1M90P 1VQLO 3I56O 3CCJL 1VQOO 4WJ0A 3CPWK 1K9MM 1Q86M 2QEXL 3CCMO 1K8AM 1Q7YP 1QVFK 3CCVL 3CCUL 3I55O 1YHQO 3CC2L 2OTLO 5FCLA 3CCJO 3CCSL 2QEXO 1YJWL 3I55L 1M90M 4QDLA 1JJ2K 5DLJA 3CCVO 3CCUO 3CXCK 3CC2O 3CCEL 1QVGK 1YITL 3CCQL 1YI2L 1Q7YM 4N06A 1NJIP 1KQSN 3CCSO 1N8RP 3NKDA 5DS5A 3CC4L 3CCLL 1YJWO 3G4SL 2OTJL 1K73P 3G71L 5DS6A 3CCRL 3CCEO 3OW2N 1YITO 3CCQO 1VQML 1KC8P 1YI2O 1VQ9L 1VQ6L 1VQNL 4P6IC 1KD1P 1Q81P 1M1KP 1W2BN 3CMEL 1VQ4L 1VQ5L 3CC4O 5DS4A 3CCLO 1YIJL 3G4SO 2OTJO 1NJIM 1VQKL 3G71O 3CCRO 5DQTA 1VQPL 1S72L 1N8RM 1VQMO 3CD6L 1Q82M 1VQ9O 3G6EL 1Q82P 3CPWN 5DQZA 3GODA 1K73M 1VQ6O 1VQNO 1YJNL 1YJ9L 1VQ7L 2YZSA 3CMEO 1VQ4O 1QVFN 3CMAL 1VQ5O 1KC8M 1KQSK 1YIJO 2QA4L 1VQKO 3CC7L 1K9MP 1KD1M 1Q81M 1Q86P 1M1KM 4W8KA 1VQ8L 1VQPO 1K8AP 1S72O 3CD6O 3G6EO 1VQLL 3I56L 3OW2K 1VQOL 1YJNO 1YJ9O 4XTKA 1VQ7O 1JJ2N 3CCML 3CMAO 3CXCN 1W2BK 1QVGN 2QA4O 1YHQL
chains in the Genus database with same CATH topology
3CC7O 2OTLL 1VQ8O 1M90P 1VQLO 3I56O 3CCJL 1VQOO 4WJ0A 3CPWK 1K9MM 1Q86M 2QEXL 3CCMO 1K8AM 1Q7YP 1QVFK 3CCVL 3CCUL 3I55O 1YHQO 3CC2L 2OTLO 5FCLA 3CCJO 3CCSL 2QEXO 1YJWL 3I55L 1M90M 4QDLA 1JJ2K 5DLJA 3CCVO 3CCUO 3CXCK 3CC2O 3CCEL 1QVGK 1YITL 3CCQL 1YI2L 1Q7YM 4N06A 1NJIP 1KQSN 3CCSO 1N8RP 3NKDA 5DS5A 3CC4L 3CCLL 1YJWO 3G4SL 2OTJL 1K73P 3G71L 5DS6A 3CCRL 3CCEO 3OW2N 1YITO 3CCQO 1VQML 1KC8P 1YI2O 1VQ9L 1VQ6L 1VQNL 4P6IC 1KD1P 1Q81P 1M1KP 1W2BN 3CMEL 1VQ4L 1VQ5L 3CC4O 5DS4A 3CCLO 1YIJL 3G4SO 2OTJO 1NJIM 1VQKL 3G71O 3CCRO 5DQTA 1VQPL 1S72L 1N8RM 1VQMO 3CD6L 1Q82M 1VQ9O 3G6EL 1Q82P 3CPWN 5DQZA 3GODA 1K73M 1VQ6O 1VQNO 1YJNL 1YJ9L 1VQ7L 2YZSA 3CMEO 1VQ4O 1QVFN 3CMAL 1VQ5O 1KC8M 1KQSK 1YIJO 2QA4L 1VQKO 3CC7L 1K9MP 1KD1M 1Q81M 1Q86P 1M1KM 4W8KA 1VQ8L 1VQPO 1K8AP 1S72O 3CD6O 3G6EO 1VQLL 3I56L 3OW2K 1VQOL 1YJNO 1YJ9O 4XTKA 1VQ7O 1JJ2N 3CCML 3CMAO 3CXCN 1W2BK 1QVGN 2QA4O 1YHQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 O;  2OTL L;  1VQ8 O;  1M90 P;  1VQL O;  3I56 O;  3CCJ L;  1VQO O;  3CPW K;  1K9M M;  1Q86 M;  2QEX L;  3CCM O;  1K8A M;  1Q7Y P;  1QVF K;  3CCV L;  3CCU L;  3I55 O;  1YHQ O;  3CC2 L;  2OTL O;  3CCJ O;  3CCS L;  2QEX O;  1YJW L;  3I55 L;  1M90 M;  1JJ2 K;  3CCV O;  3CCU O;  3CXC K;  3CC2 O;  3CCE L;  1QVG K;  1YIT L;  3CCQ L;  1YI2 L;  1Q7Y M;  1NJI P;  1KQS N;  3CCS O;  1N8R P;  3CC4 L;  3CCL L;  1YJW O;  3G4S L;  2OTJ L;  1K73 P;  3G71 L;  3CCR L;  3CCE O;  3OW2 N;  1YIT O;  3CCQ O;  1VQM L;  1KC8 P;  1YI2 O;  1VQ9 L;  1VQ6 L;  1VQN L;  1KD1 P;  1M1K P;  1Q81 P;  1W2B N;  3CME L;  1VQ4 L;  1VQ5 L;  3CC4 O;  3CCL O;  1YIJ L;  3G4S O;  2OTJ O;  1NJI M;  1VQK L;  3G71 O;  3CCR O;  1VQP L;  1S72 L;  1N8R M;  1VQM O;  3CD6 L;  1Q82 M;  1VQ9 O;  3G6E L;  1Q82 P;  3CPW N;  1K73 M;  1VQ6 O;  1VQN O;  1YJN L;  1YJ9 L;  1VQ7 L;  3CME O;  1QVF N;  1VQ4 O;  3CMA L;  1VQ5 O;  1KC8 M;  1KQS K;  1YIJ O;  2QA4 L;  1VQK O;  3CC7 L;  1K9M P;  1KD1 M;  1Q81 M;  1Q86 P;  1M1K M;  1VQ8 L;  1VQP O;  1K8A P;  1S72 O;  3CD6 O;  3G6E O;  1VQL L;  3I56 L;  3OW2 K;  1VQO L;  1YJN O;  1YJ9 O;  1VQ7 O;  1JJ2 N;  3CCM L;  3CMA O;  3CXC N;  1W2B K;  1QVG N;  2QA4 O;  1YHQ L; 
#chains in the Genus database with same CATH topology
 3CC7 O;  2OTL L;  1VQ8 O;  1M90 P;  1VQL O;  3I56 O;  3CCJ L;  1VQO O;  4WJ0 A;  3CPW K;  1K9M M;  1Q86 M;  2QEX L;  3CCM O;  1K8A M;  1Q7Y P;  1QVF K;  3CCV L;  3CCU L;  3I55 O;  1YHQ O;  3CC2 L;  2OTL O;  5FCL A;  3CCJ O;  3CCS L;  2QEX O;  1YJW L;  3I55 L;  1M90 M;  4QDL A;  1JJ2 K;  5DLJ A;  3CCV O;  3CCU O;  3CXC K;  3CC2 O;  3CCE L;  1QVG K;  1YIT L;  3CCQ L;  1YI2 L;  1Q7Y M;  4N06 A;  1NJI P;  1KQS N;  3CCS O;  1N8R P;  3NKD A;  5DS5 A;  3CC4 L;  3CCL L;  1YJW O;  3G4S L;  2OTJ L;  1K73 P;  3G71 L;  5DS6 A;  3CCR L;  3CCE O;  3OW2 N;  1YIT O;  3CCQ O;  1VQM L;  1KC8 P;  1YI2 O;  1VQ9 L;  1VQ6 L;  1VQN L;  4P6I C;  1KD1 P;  1Q81 P;  1M1K P;  1W2B N;  3CME L;  1VQ4 L;  1VQ5 L;  3CC4 O;  5DS4 A;  3CCL O;  1YIJ L;  3G4S O;  2OTJ O;  1NJI M;  1VQK L;  3G71 O;  3CCR O;  5DQT A;  1VQP L;  1S72 L;  1N8R M;  1VQM O;  3CD6 L;  1Q82 M;  1VQ9 O;  3G6E L;  1Q82 P;  3CPW N;  5DQZ A;  3GOD A;  1K73 M;  1VQ6 O;  1VQN O;  1YJN L;  1YJ9 L;  1VQ7 L;  2YZS A;  3CME O;  1VQ4 O;  1QVF N;  3CMA L;  1VQ5 O;  1KC8 M;  1KQS K;  1YIJ O;  2QA4 L;  1VQK O;  3CC7 L;  1K9M P;  1KD1 M;  1Q81 M;  1Q86 P;  1M1K M;  4W8K A;  1VQ8 L;  1VQP O;  1K8A P;  1S72 O;  3CD6 O;  3G6E O;  1VQL L;  3I56 L;  3OW2 K;  1VQO L;  1YJN O;  1YJ9 O;  4XTK A;  1VQ7 O;  1JJ2 N;  3CCM L;  3CMA O;  3CXC N;  1W2B K;  1QVG N;  2QA4 O;  1YHQ L; 
#chains in the Genus database with same CATH homology
 3CC7 O;  2OTL L;  1VQ8 O;  1M90 P;  1VQL O;  3I56 O;  3CCJ L;  1VQO O;  4WJ0 A;  3CPW K;  1K9M M;  1Q86 M;  2QEX L;  3CCM O;  1K8A M;  1Q7Y P;  1QVF K;  3CCV L;  3CCU L;  3I55 O;  1YHQ O;  3CC2 L;  2OTL O;  5FCL A;  3CCJ O;  3CCS L;  2QEX O;  1YJW L;  3I55 L;  1M90 M;  4QDL A;  1JJ2 K;  5DLJ A;  3CCV O;  3CCU O;  3CXC K;  3CC2 O;  3CCE L;  1QVG K;  1YIT L;  3CCQ L;  1YI2 L;  1Q7Y M;  4N06 A;  1NJI P;  1KQS N;  3CCS O;  1N8R P;  3NKD A;  5DS5 A;  3CC4 L;  3CCL L;  1YJW O;  3G4S L;  2OTJ L;  1K73 P;  3G71 L;  5DS6 A;  3CCR L;  3CCE O;  3OW2 N;  1YIT O;  3CCQ O;  1VQM L;  1KC8 P;  1YI2 O;  1VQ9 L;  1VQ6 L;  1VQN L;  4P6I C;  1KD1 P;  1Q81 P;  1M1K P;  1W2B N;  3CME L;  1VQ4 L;  1VQ5 L;  3CC4 O;  5DS4 A;  3CCL O;  1YIJ L;  3G4S O;  2OTJ O;  1NJI M;  1VQK L;  3G71 O;  3CCR O;  5DQT A;  1VQP L;  1S72 L;  1N8R M;  1VQM O;  3CD6 L;  1Q82 M;  1VQ9 O;  3G6E L;  1Q82 P;  3CPW N;  5DQZ A;  3GOD A;  1K73 M;  1VQ6 O;  1VQN O;  1YJN L;  1YJ9 L;  1VQ7 L;  2YZS A;  3CME O;  1VQ4 O;  1QVF N;  3CMA L;  1VQ5 O;  1KC8 M;  1KQS K;  1YIJ O;  2QA4 L;  1VQK O;  3CC7 L;  1K9M P;  1KD1 M;  1Q81 M;  1Q86 P;  1M1K M;  4W8K A;  1VQ8 L;  1VQP O;  1K8A P;  1S72 O;  3CD6 O;  3G6E O;  1VQL L;  3I56 L;  3OW2 K;  1VQO L;  1YJN O;  1YJ9 O;  4XTK A;  1VQ7 O;  1JJ2 N;  3CCM L;  3CMA O;  3CXC N;  1W2B K;  1QVG N;  2QA4 O;  1YHQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...