2QEXP

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2qexP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2qexP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2qexP02
3G4SP 1W2BO 3CC4P 2QEXP 3CCMP 3CC2P 3CCJP 1VQNP 1Q81Q 1JJ2O 3CCVP 1VQOP 1K73Q 1NJIQ 3CCEP 3CC7P 1Q7YQ 3I55P 1K9MQ 1VQKP 1VQ8P 3CCSP 1YJWP 3OW2O 2QA4P 1KQSO 3CCUP 3I56P 1YJ9P 1VQPP 1VQ9P 1M90Q 3G71P 1YITP 1N8RQ 1VQ4P 1S72P 1YI2P 1QVFO 1VQMP 1KC8Q 1VQ5P 1VQ6P 3CXCO 1YHQP 1M1KQ 3G6EP 1K8AQ 1Q82Q 1KD1Q 3CPWO 3CMAP 1VQLP 1YIJP 2OTLP 1Q86Q 2OTJP 3CCQP 1YJNP 1VQ7P 3CCLP 3CMEP 3CCRP 3CD6P 1QVGO
chains in the Genus database with same CATH superfamily
2M8RA 1H89A 2YXQB 2YKPA 5HGMA 1HQBA 2IZ1A 5F2NA 1FS0E 1SQVG 1LT9B 2D2CB 1SQPD 2WPQA 4HB1A 1M56D 1YTZI 3EJEA 3AEFC 5CJ0A 2H8PD 2W6JH 3S1KA 3DPHA 3E2DA 1NOHA 2M5AA 2KG6A 1YJ9P 3H1HG 2NPSB 2Z4EA 2FVFA 2SPZA 2QJKB 1YQ4C 4ASVA 1VQLP 3RL0g 2KK7A 1IFMA 1VHNA 1QL1A 2A45I 3CCMP 4BPFA 4GIFA 3L74D 4OGQD 3B5IA 2BEZF 2AEJA 1CZQA 2DGYA 1SQXJ 1K30A 3MZWB 1RO2A 3V4QA 4ASWA 3U1AA 5KLVK 1BDCA 2FHSC 2E76B 5KP8B 3BRVB 1SQQG 2E5TA 2HPCA 3VMZA 4U3FE 2IBZD 4D6TD 1LTJB 1CEIA 2XZ0D 2WITA 2JKVA 3H1LJ 1OX3A 1LWUB 1U7MA 4IFFA 2EHSA 3A0HH 1KILE 1L0ND 3L73G 3KYQA 5KJ7C 1RE4C 2B87A 1BCCJ 3AECC 1KN7A 3L72G 3H4EA 3VP8A 4XFZA 4M0IA 5TJHA 2PEOA 1OVVA 2KZIA 1NTMJ 1KILC 1N7SD 1LT1A 3TNUA 3GZMA 5C39A 3ITKA 2LXCB 5AW3B 2J5UA 3WUUA 1IJDB 1FDIA 1P84H 2BASA 5GTIH 3M1MA 2VLQA 1EZVE 1Y8AA 1NQ4A 4PV1D 1NKNA 2LMLA 1JOCA 1DNYA 3MGNA 2XV6A 2XT1A 3WU2E 1N7SA 3D70A 3CMEP 1QVGO 4EYYQ 2K2QA 2JBGA 2D2CD 2RN0A 4JF7A 3G28A 5CCGA 4PD4E 2NPSC 5KLVE 1SQXG 2KYVA 2KNCB 1AV1A 2GDXA 5BU8B 3NMDA 5APTA 3Q20A 2O1KA 1W2EA 4TLFA 2ZT9B 3CCQP 1JEKA 1NTKD 1EDIA 3FXDA 2PAJA 2FYUK 3H1ID 2CK3H 1OW8A 5KAIE 2OQQA 2FXOA 2FYZA 4QKOA 2XXMA 2AVAA 2POHA 2YXRB 3HE5A 1YJWP 2KS1A 1S5LX 1YQ3C 1BAJA 2KOSA 1FZFA 5CCHC 1X0TA 2WSFH 2AXTH 1LTSC 1MKMA 2GDWA 1ACPA 1A43A 3AE7C 2LPKA 1OVRA 3OAKA 5CBNA 3G4SP 2WT7A 1LTJC 3V4WA 4JBZA 2QM8A 1KLPA 3HZQA 3OA7A 4W80A 5APUA 2AF8A 2E76D 2K9JB 4L74A 2AEMA 3H25A 3VYIA 1BGYG 2KB7P 3CXHI 3USSA 2VLOA 1JUNA 1IZNB 4LGDE 2LIWA 4W7ZA 3NXSA 1BE3G 1PEQA 3KZIH 1URQB 4A7PA 4COCA 4BPHA 1K04A 4WVZA 4GKGA 4MRTC 3MIWA 3L70E 2K0XA 4WBAA 2FADA 2E42A 2KOQA 2WSFJ 1PEMA 1NTZE 2L9FA 1CSBA 1HVVA 2YKOA 1IK7A 2N1TB 3G1IA 2XKMA 1LTAC 3PRJA 2CWOA 4YXDC 3G71P 4N78E 1KC8Q 2HG5D 5HGOA 1NU1G 4R4LA 3C8VA 2VLNA 1PGJA 3VMYA 2ZYAA 2BCCG 4WY4D 3CC4P 3U59A 1FJKA 3OJAB 1L4AB 1KFMA 2PNGA 2W6AA 1KQLA 1J1EB 5EW5E 1BDDA 3N7NA 4Y28J 3CWBE 5HV8A 1P84I 5F2OA 1JY3P 1EDJA 1GTWA 3AEDC 3EWKA 1IK9A 2WTYA 3RL0B 4H0LD 5APYA 2ZT9D 3PLNA 2GA1A 4WY4A 2OYOA 1FZCA 3VMXA 3ZDMA 3NTNA 2OGUA 5KAIH 1RQUA 1KB9E 1MUUA 1SFCB 1CI6B 2FKWB 1MZ8A 1AJYA 1F80D 3H1HD 2MVVA 1DD4A 3D6YA 5E79E 3CCUP 3HUSA 1M90Q 3LRYA 3H1IJ 2Q3EA 2OYIC 3BRTB 4HKGA 2P10A 2K3RA 3BATA 1NWQA 4L76A 2I1JA 3H1JJ 3L35A 1URQC 5KLVJ 3DS1A 3DS4A 3B8EB 1PP9E 4IFMA 3I56P 2K9YA 5AVRB 1M1JC 4U3FG 5L8RJ 1Q86Q 2KI7B 5EFWB 5AW2B 2N1TC 5BU5A 3VRLC 2KGEA 1L0LG 4YTPC 3RK3B 4PJ0E 2M5AB 5AW4B 3IFMA 4U0CA 1OMIA 3L73D 1JMBA 1J1DB 2RMZA 2K0YA 2FXMA 4DT0A 1GL2A 4H44B 3L72D 1M1KQ 3Q3DA 2YIUB 4C7NB 4ZNCA 1GXGA 4U0AA 1OR5A 1J1EC 2IFNA 1Q7YQ 1FC2C 1PGQA 4JPZB 1SQBE 1H88A 2QG4A 3RK2D 1YITP 5BS1A 3L71E 2E1MA 1L4AD 2PEMA 5AVXB 1SQPK 3UIAA 2GM4A 5AVQB 1M7LA 2HPCB 4ZKUA 3CLQA 3RL0C 3C1LA 2FQ1A 2Z45A 2QIWA 1EIAA 4LLHA 1UNKA 1DD3A 2P2UA 3CXHE 3BCCE 3L70J 2B88A 3FX0A 1EZVI 1ZNVA 2GZJA 2PEJA 2IFMA 3VMAA 4OGQB 1ZP0C 5DJTB 1ZLLA 1AQ5A 5H2FE 3WUTA 1CW5A 3BVHA 1L4AA 2PRRA 4QNBA 2FYUJ 1GPJA 1EDKA 2WWWA 2XNXA 1KB9H 1SFCD 2QJPB 1PZQA 3TNUB 4BRYB 1N73C 2PEQA 5E79H 5KLIB 4IL6E 1WRGA 1GMJA 4DG9A 2MR8A 1XTCC 2I8DA 3L75G 3PHLA 2KG9A 3CWBJ 1YHQP 1Q82Q 1ZRTD 1QLED 1YBKA 2Z5IA 1SFCA 1CI6A 1QX8A 1L0NK 1DEEG 2QEXP 2K93A 1JJ2O 1SQPE 3GMAA 1S1CX 1BGYD 2L22A 1MFZA 3G3ZA 2FVAA 1PPJD 1GU4A 1IO4A 1YI2P 5KTBA 2YIUC 1XTGB 3RK3D 4PV1B 1BE3D 4WWIA 4PJ0H 4XFYA 3G0VA 3CE7A 5AW5B 3Q2YA 1KQFB 1M6NA 4H44D 3HE5B 3P8CD 2L4BA 2KS1B 3NY7B 1IFNA 2Q9IA 2R3CA 1NTZG 4GDOA 2RH0A 2Q6QA 2WT7B 4U0BA 5HGNA 1GW4A 3L74E 1T3JA 1ZW0A 2R32A 2G8YA 1PP9J 1OIPA 3ABVC 5AW7B 2C9LY 2YO2A 2WPTA 4JQ0D 3GG2A 1NU1D 2A45G 1R8EA 3LIDA 4OGQC 2BCCD 3F89A 1LTGC 4OWFA 2KW2A 2IBZE 4C7NA 1FZEA 4D6TE 2HLOA 1OW6A 2K37A 2AXTE 2P58A 2HYNA 2OYHA 2KOOA 3CXHH 1NTKK 3CWBG 1L0NE 1G1JA 2XNDH 5H2FH 1ZMBA 3AE2C 3P8MC 1E79H 5BVZA 1YJNP 2IYOA 1S2EA 3A7OA 3RGUA 5B66E 3CC7P 3CCVP 4KT0J 1KV4A 2AXCA 3KXDA 1SQBJ 4I7ZB 2LOLA 5CMZA 3HD7B 3L71J 1G2CA 1N7SC 2E75D 1JCDA 3JCUH 1L2PA 2H43A 3KZIE 1LTBC 3CX5D 3V2PA 4IL6H 1VPCA 3C9IA 3F5HA 2XU6A 2HFED 1KB9I 1USEA 2IDBA 3V2RA 3AE6C 3TDKA 1VF5B 1N7LA 1Y47A 3EFFK 3BCCJ 5HGLA 3H1KD 4PV1C 4GR2A 1NYHA 2M0BA 4BRYA 5CCGD 3M9QA 5APSA 2GUVA 5TISE 3VP9A 1DX7A 2N5HA 5AVZB 1VQNP 3H0DA 5AVVB 4Z1MH 1LT9C 2D2CC 3T97A 4WY4B 1FZCB 2WSEH 2H88C 1VL2A 1EXIA 1NTKE 2JR8A 3PJSK 1L0LD 3H1IE 2WPSA 1M6EX 1IUQA 4XFJA 1PGPA 3B71A 3FXEA 2KGCA 3H1JE 4Y99B 4F37A 4NPEA 3HUSB 2A06D 1T3UA 4DCKA 1VQ9P 3A3YB 1FZBA 2QJKC 3GLMA 3U43A 3I5CA 1VQMP 4H0LB 3GJNA 1Z6MA 3B4SA 1YTZT 1SQBG 2CQ8A 4M3LA 2JQ4A 1SQPJ 1N2DC 1SQVK 1IC2A 3H1LG 3EJDA 3D6ZA 5AW1B 4H13D 4N6JA 1HWTC 3MTUE 2WMMA 2WSEJ 2E76C 3CMAP 1ZR4A 1BCCG 1IMQA 4OH8B 1NTMG 3R2PA 1AF8A 1IFIA 5DCKA 1X22A 1FDMA 1LWUC 4H2YC 2FVEA 4PD4D 1GL2B 1HUCA 2VLPA 3G6EP 5AW0B 1MV8A 5B66H 3Q1MA 2K1AA 3L74J 1KQGB 3HD7D 3B5ND 3L37A 2FFDA 5KP7B 4CPGA 1K73Q 1JCCA 2KXPB 3MP7B 3SSUA 4RESB 2QA4P 1KQSO 1NGMB 2GZGA 1KZUB 2KSEA 2MVUA 7CEIA 3AE3C 2Z46A 2KIKA 2L0QA 5KAFE 2KZJA 1S9KD 1SQQK 4D6TJ 1VF5D 1GDTA 2JWDA 2N9YB 3L75D 1RF0C 2LXBA 1GD2E 4WY4C 1FZCC 1L0NJ 2GZEA 2FYUE 1VQPP 1S72P 3TGUD 3HD7A 3B5NA 1MZ9A 3JSVC 5KKZB 5TISH 2DNWA 3N4XA 2AFEA 2ZJSE 5CCHA 3RK2B 4JYCA 2LF4A 3M0DA 3CCSP 2IPPA 3S4RA 4H0LC 2B89A 2ZT9C 3H1HE 1M57D 1OFCX 3R4YA 3CCLP 2IYPA 1BSNA 2O01N 4EIJA 1SQVD 4NEOA 1RQVA 1NTZD 5GTHH 5CBOA 2PEIA 3NTEA 4C46A 1W5CE 2M5RA 3CI9A 2OARA 4WB4A 1IFDA 4B86A 3RBXA 2JEEA 3L74G 2ROQA 3CPWO 1JY3N 3L4FA 2X2BA 3V2NA 4OVNF 4KJMA 1Z56A 1S5LE 1EDLA 1H0TA 4NPFX 2E5YA 2FYNB 3H47A 2WQYC 4JYBA 2Y0DA 1NTKJ 1VQ6P 5APWA 1SS1A 1UJZA 2L6EA 2ONTA 2PFXA 4DZOA 5M1BA 2WPVB 1GL2D 2M8LA 4ZKPA 3L72E 1RF1A 2IBZI 3MUDA 2GDYA 1HTLC 1NHLA 1SQQD 3FWNA 1LP1A 5AVWB 5F2KA 3E7KA 4HJGH 2EHTA 1T2KD 2XDJA 3IR9A 2GZFA 1GK4A 2KG8A 1VQ8P 5B5EE 2HR3A 5KAFH 5KKZC 2N50A 3P05A 2Q3IA 1E6JP 5AVUB 2E43A 4U0EA 2VRSA 3RK2C 1OVUA 1U7JA 3DTJA 3GHGA 1L4AC 1FAVA 2W83C 3O6QA 2OYHB 1Q2NA 3PH0A 2Y0EA 1JMMA 2YMYA 4K35A 1S3JA 3M9BA 4GODA 4EI2A 2XZRA 1NAFA 4GOFA 4BPGA 1KFNA 2Z44A 2UWJE 5APXA 2OYIA 1EZVG 2J59M 2VSQA 2ZXXA 5AW6B 1DH3A 4TT3H 2PY8A 4MN4C 1ZV8A 3G21A 4U0FA 1WMKA 1VQOP 1JB0J 3E1RA 3H1IG 3QWOC 1PEUA 2O01H 1G2CB 5EJDA 1SFCC 1NU1K 2LIUA 3SFDC 3H1JG 3GKLC 1SQXD 5KLVG 1NVOA 1SP4A 4L73A 2ZFCA 2FYNC 2JP3A 4IZ6A 4I2LC 2KGDA 1ZRTE 1E5WA 1SQVJ 5KP6B 3MHVA 1KD1Q 1S5LH 2MR7A 3K5BA 3H1LD 1AFOA 2E75B 3JCUE 4GOEA 1BGYE 1OWAA 1FJPA 1PPJE 2WPRA 1MFTA 1JY2N 1BCCD 1KORA 2M3EA 3T97B 1LTIC 3RK3E 3H32A 3H1HJ 3AE4C 1NTMD 3BASA 2O01J 2C0XA 2NZ2A 2LKMA 3KPEA 4IOIH 1ZXGA 1OW7A 3CD6P 2PENA 3P8CE 1PV3A 1NH4A 3RK3C 2Y9ZA 1LJ2A 2N6ZA 2KLVA 3KQGA 1QGKB 3MD0A 3WUVA 2KSJA 1J1DC 2Y0CA 2Q1KA 2E74D 4H44C 1VQ4P 2N98A 3JC22 1TU3F 4YPCA 3II6A 2OYHC 2DW3A 5CJ4A 2JWAA 5B5EH 1SLQA 2JU1A 4R4MA 1HH0A 1ZR2A 2BCCE 1HGVA 1JM0A 2P67A 3IAOA 2QM7A 2EFJA 5BS2A 3L70G 3G29A 2C0WA 1AVOA 2FAEA 2JYLA 4U7JA 1N73A 1YYCA 5DJUB 1D7MA 3L73J 1L0LK 2MD9A 1GZLA 1LTTC 2FYUG 2CPBA 2WVRA 2O3JA 1U57A 3L72J 3VN0A 1VQKP 1X3OA 4DJGA 1PFIA 1FE6A 2FACA 1PGOA 1P84D 4HYTB 2QSIA 4H13B 4XRQA 4XA4A 1DV5A 3FWLA 1RE3A 1EC5A 2FFDB 4IFDK 3SFEC 3CC2P 1KYOD 1GK6A 2QNWA 1HJBA 3AEAC 2QJPC 2MY5A 3Q5PA 4IPYA 1S4XA 2K92A 1X8YA 3IF4A 3CX5E 1QVFO 2GZIA 3DS3A 1FOSE 3Q5RA 2E75C 2KWLA 3O8ZA 5KLIC 1HF9A 3P7KA 1AA0A 2ITAA 5CHXA 2JB0A 1FBMA 5K5GB 1Q90D 3H1KE 1FR2A 3DS2A 4I6MC 1RY3A 4RJTA 3B5NB 2FXPA 1QRJA 3WBHA 1IFJA 4RKUJ 1K8AQ 4DOJA 2JGPA 2GUSA 1PEOA 5CCGC 2V7QH 5I4TG 1Q81Q 2ZYGA 4BWNA 2JU2A 5JPAA 2HODA 1L0LE 3EQ2A 2KUBA 3DS5A 1AVYA 1ZN5A 4BXLA 4XE5B 3MGEA 3KDPB 1FDOA 1PP9G 2A06E 1RNIA 1G1IA 1PL5A 3HE4A 1T6AA 3TYYA 4U3FD 1VKUA 2FBWC 2BQ1E 3FGAD 3A0BH 4XROA 3QH9A 2CGQA 5KJ7D 2QJYB 4ZMDA 2KODA 1LNQA 1J2JB 3G9RA 1D1DA 1BGYJ 4C7RA 1KILD 2BHVA 2Y9YA 1OXZA 1H0TB 2XV5A 2V7QJ 3B4QA 1KYOH 1BE3J 2RKLA 1IMPA 1ZMEC 5GTHE 4H13C 1NAYA 3CL3D 5AVSB 3VOPA 2YNYA 2FFDC 1AQTA 2C9NY 2QVAA 2AEFA 4GR6A 1NJIQ 2KORA 3AEGC 1RE4A 5KJ7A 2L5GB 2XZ1C 3L71G 1RF1B 1RH5B 1FZAA 1NTZK 1VDFA 1KILA 1EZVD 2I1KA 3CXCO 1A8OA 2JJLA 1LP1B 2W27A 3SWYA 3PTZA 4CA3A 1NU1J 2NPSD 2PGDA 3CX5H 2BCCJ 4I7ZC 3BCCG 3OW2O 2W90A 3B5NC 3HD7C 4O9BA 1S9KE 3H1JD 5AW8B 5KLVD 1LT9A 3SWFA 2QRXA 3L75E 3HTKB 3GHGB 3AEBC 1BSHA 3M0DC 1W2BO 3O6QB 3TF5A 1WT6A 2K94A 1VF5C 3RG6C 2PP6A 3TGUE 1K05A 1Y9BA 5CCHD 1QEXA 1A02F 4H2WC 2LR2A 4R0MA 4GT1A 2KGAA 2NPSA 1L0IA 2Q5UA 2MKVA 4K3AA 1A02J 1DEBA 4UHPB 2B9BA 1EOQA 2ZYDA 4LC1A 3S9OA 2OYIB 2CPSA 1PPJG 2CNRA 3CCRP 4EOTA 3VTPC 1FOSF 2QJYC 2M3BA 1FZGA 2KLUA 1SQVE 2MJZA 3GF7A 3RBZA 1M1JB 4AUWA 2ZVOB 2MF4A 1NO4A 1R5LA 3KHUA 4RO0A 1SQPG 4UB8E 4Y99C 2K5XA 2M8PA 1SVFA 1ZOYC 1HBWA 3H1KJ 5APQA 3WMM0 2GYKA 3HUSC 1LTJA 3G1GA 4KHXA 2WZ7A 3NFQA 3PP5A 1GU5A 3LW5H 1LWUA 1EXJA 2LKIA 3EFGA 4W7YA 5AVYB 1QL2A 2JAZA 4U3FJ 3L70D 4AYCA 2L91A 2K0DX 1RF1C 3GZLA 3DS0A 3MUDC 4WYMA 1L0LJ 2JO0A 1JO5A 3TK1A 3WU2H 4COPA 3H32B 2Z5HA 2QE7H 2JO1A 2FYUD 1YIJP 4N78D 2W8ZA 4PD4H 2WSCH 4H2XC 3M06A 1RO0A 1JTHB 2YKQA 1JY3O 1RHZB 2R3SA 1KYOI 1SQXK 1K9MQ 1RF0A 1SQQE 2G3AA 1GL2C 2OTKE 3GHGC 1IFPA 5AW9B 2P7JA 2P9XA 2IBZG 2EIAA 4D6TG 1GXHA 2N9BA 3LW5J 3M9HA 2V4HA 2ZVNB 1SQBK 1USDA 2R44A 4HKZH 1H8AA 2H89C 2YO3A 3CWBD 1X9VA 2CG5B 3L73E 4AQRD 3CCJP 1L0NG 3AE8C 3AE5C 1T2KC 2AFDA 1EQ7A 2FY8A 4L75A 1M74A 2KNCA 3G26A 1AYIA 4IL6X 2EG5A 1VQ5P 4PWVB 5HVCA 1KTMA 3EJBA 1N73B 3TSIA 2E74B 3CX5I 3H1KG 1NTMK 3W68A 3V5BA 1KB9D 2WSCJ 2PEKA 3A2AA 3CCEP 3LIEA 4NPDA 2LL8A 3A5TA 5CZDB 2N6YA 3LMOA 2P1JA 4EDFA 1KMIZ 2FQ2A 3HTKA 4YXWH 1URQD 4QMAA 2KOPA 4UB6E 5APVA 2LTEA 2NO8A 1N86A 3I55P 2M8NA 1BXIA 1T8KA 4XFXA 2K9JA 3SWKA 1SQXE 3L75J 1PP9D 3D71A 2N1TD 4UB8H 2KR5A 2W6BA 1FU1A 2A06G 2K88A 3V2QA 3GW6A 1UIIA 3H6PA 1M8OB 3TGUJ 3V6IA 2N5IA 1NTKG 2A45H 1URQA 2JDIH 1OZHA 3H1LE 3L36A 1UIXA 2OTJP 1M1JA 2ZXEB 1AUMA 4PH1A 1LGHB 2JYGA 1BCCE 1R5SA 2O1JA 2N1TA 2KP8A 1NKZB 3E1IA 2HODB 2KOGA 3M0AA 1NTME 3HYBA 1N8RQ 2R5BA 4HH2A 2FQ0A 1SQBD 2R5DA 1NTZJ 2BUOA 1JNMA 2B87B 3RL0D 3L71D 4N3YB 1L0HA 2IX7C 4PXHB 2BEQD 2OTLP 2WSSH 3HE4B 1JY2P 3W67A 1X79B 4PH0A 1JY2O 1BE3E 4PD4I 2E74C 2H7HA 3GF3A 4U0DA 3CXHD 1VQ7P 3BCCD 2J58A 1HY8A 3A0HE 1JTHA 3Q5SA 2ERHA 2YMKA 1EMVA 1DIPA 1HJ0A 3RG2A 1N7SB 1RE3C 3U1CA 2Q7CA 3AE1C 3TGUG 1T8ZA 3A0BE 2NRGA 3IN6A 1NU1E 3P32A 1SQQJ 2IZ0A 3M91A 1P84E 3HRNA 4I1LA 5GTIE 1HGZA 1KILB 3AEEC 5AVTB 3AE9C 4UB6H 2ZAEB 1E0HA 1PIXA 1KYOE 1GW3A
chains in the Genus database with same CATH topology
3G4SP 3H4EA 2BHVA 4XFZA 2QEXP 4M0IA 4U0AA 3CCJP 3CC2P 5HGMA 2LF4A 1JJ2O 3CC7P 3CCVP 2PEOA 5F2NA 1Q7YQ 3HZQA 1VQ8P 3CCSP 1M74A 4IPYA 3HYBA 3G26A 3P05A 1YITP 1N8RQ 2EG5A 1QVFO 1YI2P 1E6JP 3DS3A 5BS1A 1VQ5P 4U0EA 2E1MA 2PEMA 3DTJA 3CMAP 2BUOA 3CCLP 4XFYA 3CD6P 3G0VA 2PENA 4GR6A 2M8PA 1M6NA 2PEKA 2Z45A 3DPHA 3E2DA 1NJIQ 3M1MA 3CCEP 2OTLP 5DCKA 2PEIA 1PEQA 3NTEA 1EIAA 3DS2A 3CCUP 1YJ9P 3G1GA 2OARA 1M90Q 4PH0A 1VQ4P 4COCA 5HGLA 3LRYA 2Z44A 4GR2A 3CXCO 1A8OA 1QRJA 2XV6A 3WBHA 3G6EP 2XT1A 4U0DA 2PEJA 1K8AQ 3CPWO 1VQLP 1VQ7P 1PEMA 3CMEP 1QVGO 4U0BA 5HGNA 1PEOA 2PY8A 3CCMP 1VQNP 5I4TG 3G21A 4U0FA 3DS1A 3DS0A 3G1IA 3DS4A 1VQOP 1Q81Q 1K73Q 3H0DA 3I55P 3G28A 4QNBA 4WYMA 5JPAA 2JO0A 3OW2O 3H47A 2CWOA 2QA4P 2EFJA 3B5IA 5BS2A 1KQSO 3G29A 3I56P 1PEUA 2M8NA 4COPA 3G71P 2DGYA 1K30A 2Z46A 3DS5A 3Q20A 4XFXA 1KC8Q 1VQ6P 1RO2A 5HGOA 2JYLA 1YIJP 1Q86Q 3MGEA 3CCQP 1M6EX 2PEQA 2L6EA 2ONTA 1RO0A 1W2BO 1IUQA 3CC4P 3VRLC 1RNIA 2M8LA 3RG6C 2XXMA 1K9MQ 1VQKP 1YJWP 4U0CA 1VQPP 1BAJA 3CCRP 1VQ9P 2BQ1E 1S72P 4XROA 1VQMP 2P9XA 1ZMBA 1YHQP 1M1KQ 2EIAA 1A43A 1Q82Q 1KD1Q 5F2KA 1EOQA 4XRQA 2OTJP 2KODA 1YJNP 1AUMA 5F2OA 4PH1A 2JYGA 1D1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  1W2B O;  3CC4 P;  2QEX P;  3CCM P;  3CC2 P;  3CCJ P;  1VQN P;  1Q81 Q;  1JJ2 O;  3CCV P;  1VQO P;  1K73 Q;  1NJI Q;  3CCE P;  3CC7 P;  1Q7Y Q;  3I55 P;  1K9M Q;  1VQK P;  1VQ8 P;  3CCS P;  1YJW P;  3OW2 O;  2QA4 P;  1KQS O;  3CCU P;  3I56 P;  1YJ9 P;  1VQP P;  1VQ9 P;  1M90 Q;  3G71 P;  1YIT P;  1N8R Q;  1VQ4 P;  1S72 P;  1YI2 P;  1QVF O;  1VQM P;  1KC8 Q;  1VQ5 P;  1VQ6 P;  3CXC O;  1YHQ P;  1M1K Q;  3G6E P;  1K8A Q;  1Q82 Q;  1KD1 Q;  3CPW O;  3CMA P;  1VQL P;  1YIJ P;  2OTL P;  1Q86 Q;  2OTJ P;  3CCQ P;  1YJN P;  1VQ7 P;  3CCL P;  3CME P;  3CCR P;  3CD6 P;  1QVG O; 
#chains in the Genus database with same CATH topology
 2M8R A;  1H89 A;  2YXQ B;  2YKP A;  5HGM A;  1HQB A;  2IZ1 A;  5F2N A;  1FS0 E;  1SQV G;  1LT9 B;  2D2C B;  1SQP D;  2WPQ A;  4HB1 A;  1M56 D;  1YTZ I;  3EJE A;  3AEF C;  5CJ0 A;  2H8P D;  2W6J H;  3S1K A;  3DPH A;  3E2D A;  1NOH A;  2M5A A;  2KG6 A;  1YJ9 P;  3H1H G;  2NPS B;  2Z4E A;  2FVF A;  2SPZ A;  2QJK B;  1YQ4 C;  4ASV A;  1VQL P;  3RL0 g;  2KK7 A;  1IFM A;  1VHN A;  1QL1 A;  2A45 I;  3CCM P;  4BPF A;  4GIF A;  3L74 D;  4OGQ D;  3B5I A;  2BEZ F;  2AEJ A;  1CZQ A;  2DGY A;  1SQX J;  1K30 A;  3MZW B;  1RO2 A;  3V4Q A;  4ASW A;  3U1A A;  5KLV K;  1BDC A;  2FHS C;  2E76 B;  5KP8 B;  3BRV B;  1SQQ G;  2E5T A;  2HPC A;  3VMZ A;  4U3F E;  2IBZ D;  4D6T D;  1LTJ B;  1CEI A;  2XZ0 D;  2WIT A;  2JKV A;  3H1L J;  1OX3 A;  1LWU B;  1U7M A;  4IFF A;  2EHS A;  3A0H H;  1KIL E;  1L0N D;  3L73 G;  3KYQ A;  5KJ7 C;  1RE4 C;  2B87 A;  1BCC J;  3AEC C;  1KN7 A;  3L72 G;  3H4E A;  3VP8 A;  4XFZ A;  4M0I A;  5TJH A;  2PEO A;  1OVV A;  2KZI A;  1NTM J;  1KIL C;  1N7S D;  1LT1 A;  3TNU A;  3GZM A;  5C39 A;  3ITK A;  2LXC B;  5AW3 B;  2J5U A;  3WUU A;  1IJD B;  1FDI A;  1P84 H;  2BAS A;  5GTI H;  3M1M A;  2VLQ A;  1EZV E;  1Y8A A;  1NQ4 A;  4PV1 D;  1NKN A;  2LML A;  1JOC A;  1DNY A;  3MGN A;  2XV6 A;  2XT1 A;  3WU2 E;  1N7S A;  3D70 A;  3CME P;  1QVG O;  4EYY Q;  2K2Q A;  2JBG A;  2D2C D;  2RN0 A;  4JF7 A;  3G28 A;  5CCG A;  4PD4 E;  2NPS C;  5KLV E;  1SQX G;  2KYV A;  2KNC B;  1AV1 A;  2GDX A;  5BU8 B;  3NMD A;  5APT A;  3Q20 A;  2O1K A;  1W2E A;  4TLF A;  2ZT9 B;  3CCQ P;  1JEK A;  1NTK D;  1EDI A;  3FXD A;  2PAJ A;  2FYU K;  3H1I D;  2CK3 H;  1OW8 A;  5KAI E;  2OQQ A;  2FXO A;  2FYZ A;  4QKO A;  2XXM A;  2AVA A;  2POH A;  2YXR B;  3HE5 A;  1YJW P;  2KS1 A;  1S5L X;  1YQ3 C;  1BAJ A;  2KOS A;  1FZF A;  5CCH C;  1X0T A;  2WSF H;  2AXT H;  1LTS C;  1MKM A;  2GDW A;  1ACP A;  1A43 A;  3AE7 C;  2LPK A;  1OVR A;  3OAK A;  5CBN A;  3G4S P;  2WT7 A;  1LTJ C;  3V4W A;  4JBZ A;  2QM8 A;  1KLP A;  3HZQ A;  3OA7 A;  4W80 A;  5APU A;  2AF8 A;  2E76 D;  2K9J B;  4L74 A;  2AEM A;  3H25 A;  3VYI A;  1BGY G;  2KB7 P;  3CXH I;  3USS A;  2VLO A;  1JUN A;  1IZN B;  4LGD E;  2LIW A;  4W7Z A;  3NXS A;  1BE3 G;  1PEQ A;  3KZI H;  1URQ B;  4A7P A;  4COC A;  4BPH A;  1K04 A;  4WVZ A;  4GKG A;  4MRT C;  3MIW A;  3L70 E;  2K0X A;  4WBA A;  2FAD A;  2E42 A;  2KOQ A;  2WSF J;  1PEM A;  1NTZ E;  2L9F A;  1CSB A;  1HVV A;  2YKO A;  1IK7 A;  2N1T B;  3G1I A;  2XKM A;  1LTA C;  3PRJ A;  2CWO A;  4YXD C;  3G71 P;  4N78 E;  1KC8 Q;  2HG5 D;  5HGO A;  1NU1 G;  4R4L A;  3C8V A;  2VLN A;  1PGJ A;  3VMY A;  2ZYA A;  2BCC G;  4WY4 D;  3CC4 P;  3U59 A;  1FJK A;  3OJA B;  1L4A B;  1KFM A;  2PNG A;  2W6A A;  1KQL A;  1J1E B;  5EW5 E;  1BDD A;  3N7N A;  4Y28 J;  3CWB E;  5HV8 A;  1P84 I;  5F2O A;  1JY3 P;  1EDJ A;  1GTW A;  3AED C;  3EWK A;  1IK9 A;  2WTY A;  3RL0 B;  4H0L D;  5APY A;  2ZT9 D;  3PLN A;  2GA1 A;  4WY4 A;  2OYO A;  1FZC A;  3VMX A;  3ZDM A;  3NTN A;  2OGU A;  5KAI H;  1RQU A;  1KB9 E;  1MUU A;  1SFC B;  1CI6 B;  2FKW B;  1MZ8 A;  1AJY A;  1F80 D;  3H1H D;  2MVV A;  1DD4 A;  3D6Y A;  5E79 E;  3CCU P;  3HUS A;  1M90 Q;  3LRY A;  3H1I J;  2Q3E A;  2OYI C;  3BRT B;  4HKG A;  2P10 A;  2K3R A;  3BAT A;  1NWQ A;  4L76 A;  2I1J A;  3H1J J;  3L35 A;  1URQ C;  5KLV J;  3DS1 A;  3DS4 A;  3B8E B;  1PP9 E;  4IFM A;  3I56 P;  2K9Y A;  5AVR B;  1M1J C;  4U3F G;  5L8R J;  1Q86 Q;  2KI7 B;  5EFW B;  5AW2 B;  2N1T C;  5BU5 A;  3VRL C;  2KGE A;  1L0L G;  4YTP C;  3RK3 B;  4PJ0 E;  2M5A B;  5AW4 B;  3IFM A;  4U0C A;  1OMI A;  3L73 D;  1JMB A;  1J1D B;  2RMZ A;  2K0Y A;  2FXM A;  4DT0 A;  1GL2 A;  4H44 B;  3L72 D;  1M1K Q;  3Q3D A;  2YIU B;  4C7N B;  4ZNC A;  1GXG A;  4U0A A;  1OR5 A;  1J1E C;  2IFN A;  1Q7Y Q;  1FC2 C;  1PGQ A;  4JPZ B;  1SQB E;  1H88 A;  2QG4 A;  3RK2 D;  1YIT P;  5BS1 A;  3L71 E;  2E1M A;  1L4A D;  2PEM A;  5AVX B;  1SQP K;  3UIA A;  2GM4 A;  5AVQ B;  1M7L A;  2HPC B;  4ZKU A;  3CLQ A;  3RL0 C;  3C1L A;  2FQ1 A;  2Z45 A;  2QIW A;  1EIA A;  4LLH A;  1UNK A;  1DD3 A;  2P2U A;  3CXH E;  3BCC E;  3L70 J;  2B88 A;  3FX0 A;  1EZV I;  1ZNV A;  2GZJ A;  2PEJ A;  2IFM A;  3VMA A;  4OGQ B;  1ZP0 C;  5DJT B;  1ZLL A;  1AQ5 A;  5H2F E;  3WUT A;  1CW5 A;  3BVH A;  1L4A A;  2PRR A;  4QNB A;  2FYU J;  1GPJ A;  1EDK A;  2WWW A;  2XNX A;  1KB9 H;  1SFC D;  2QJP B;  1PZQ A;  3TNU B;  4BRY B;  1N73 C;  2PEQ A;  5E79 H;  5KLI B;  4IL6 E;  1WRG A;  1GMJ A;  4DG9 A;  2MR8 A;  1XTC C;  2I8D A;  3L75 G;  3PHL A;  2KG9 A;  3CWB J;  1YHQ P;  1Q82 Q;  1ZRT D;  1QLE D;  1YBK A;  2Z5I A;  1SFC A;  1CI6 A;  1QX8 A;  1L0N K;  1DEE G;  2QEX P;  2K93 A;  1JJ2 O;  1SQP E;  3GMA A;  1S1C X;  1BGY D;  2L22 A;  1MFZ A;  3G3Z A;  2FVA A;  1PPJ D;  1GU4 A;  1IO4 A;  1YI2 P;  5KTB A;  2YIU C;  1XTG B;  3RK3 D;  4PV1 B;  1BE3 D;  4WWI A;  4PJ0 H;  4XFY A;  3G0V A;  3CE7 A;  5AW5 B;  3Q2Y A;  1KQF B;  1M6N A;  4H44 D;  3HE5 B;  3P8C D;  2L4B A;  2KS1 B;  3NY7 B;  1IFN A;  2Q9I A;  2R3C A;  1NTZ G;  4GDO A;  2RH0 A;  2Q6Q A;  2WT7 B;  4U0B A;  5HGN A;  1GW4 A;  3L74 E;  1T3J A;  1ZW0 A;  2R32 A;  2G8Y A;  1PP9 J;  1OIP A;  3ABV C;  5AW7 B;  2C9L Y;  2YO2 A;  2WPT A;  4JQ0 D;  3GG2 A;  1NU1 D;  2A45 G;  1R8E A;  3LID A;  4OGQ C;  2BCC D;  3F89 A;  1LTG C;  4OWF A;  2KW2 A;  2IBZ E;  4C7N A;  1FZE A;  4D6T E;  2HLO A;  1OW6 A;  2K37 A;  2AXT E;  2P58 A;  2HYN A;  2OYH A;  2KOO A;  3CXH H;  1NTK K;  3CWB G;  1L0N E;  1G1J A;  2XND H;  5H2F H;  1ZMB A;  3AE2 C;  3P8M C;  1E79 H;  5BVZ A;  1YJN P;  2IYO A;  1S2E A;  3A7O A;  3RGU A;  5B66 E;  3CC7 P;  3CCV P;  4KT0 J;  1KV4 A;  2AXC A;  3KXD A;  1SQB J;  4I7Z B;  2LOL A;  5CMZ A;  3HD7 B;  3L71 J;  1G2C A;  1N7S C;  2E75 D;  1JCD A;  3JCU H;  1L2P A;  2H43 A;  3KZI E;  1LTB C;  3CX5 D;  3V2P A;  4IL6 H;  1VPC A;  3C9I A;  3F5H A;  2XU6 A;  2HFE D;  1KB9 I;  1USE A;  2IDB A;  3V2R A;  3AE6 C;  3TDK A;  1VF5 B;  1N7L A;  1Y47 A;  3EFF K;  3BCC J;  5HGL A;  3H1K D;  4PV1 C;  4GR2 A;  1NYH A;  2M0B A;  4BRY A;  5CCG D;  3M9Q A;  5APS A;  2GUV A;  5TIS E;  3VP9 A;  1DX7 A;  2N5H A;  5AVZ B;  1VQN P;  3H0D A;  5AVV B;  4Z1M H;  1LT9 C;  2D2C C;  3T97 A;  4WY4 B;  1FZC B;  2WSE H;  2H88 C;  1VL2 A;  1EXI A;  1NTK E;  2JR8 A;  3PJS K;  1L0L D;  3H1I E;  2WPS A;  1M6E X;  1IUQ A;  4XFJ A;  1PGP A;  3B71 A;  3FXE A;  2KGC A;  3H1J E;  4Y99 B;  4F37 A;  4NPE A;  3HUS B;  2A06 D;  1T3U A;  4DCK A;  1VQ9 P;  3A3Y B;  1FZB A;  2QJK C;  3GLM A;  3U43 A;  3I5C A;  1VQM P;  4H0L B;  3GJN A;  1Z6M A;  3B4S A;  1YTZ T;  1SQB G;  2CQ8 A;  4M3L A;  2JQ4 A;  1SQP J;  1N2D C;  1SQV K;  1IC2 A;  3H1L G;  3EJD A;  3D6Z A;  5AW1 B;  4H13 D;  4N6J A;  1HWT C;  3MTU E;  2WMM A;  2WSE J;  2E76 C;  3CMA P;  1ZR4 A;  1BCC G;  1IMQ A;  4OH8 B;  1NTM G;  3R2P A;  1AF8 A;  1IFI A;  5DCK A;  1X22 A;  1FDM A;  1LWU C;  4H2Y C;  2FVE A;  4PD4 D;  1GL2 B;  1HUC A;  2VLP A;  3G6E P;  5AW0 B;  1MV8 A;  5B66 H;  3Q1M A;  2K1A A;  3L74 J;  1KQG B;  3HD7 D;  3B5N D;  3L37 A;  2FFD A;  5KP7 B;  4CPG A;  1K73 Q;  1JCC A;  2KXP B;  3MP7 B;  3SSU A;  4RES B;  2QA4 P;  1KQS O;  1NGM B;  2GZG A;  1KZU B;  2KSE A;  2MVU A;  7CEI A;  3AE3 C;  2Z46 A;  2KIK A;  2L0Q A;  5KAF E;  2KZJ A;  1S9K D;  1SQQ K;  4D6T J;  1VF5 D;  1GDT A;  2JWD A;  2N9Y B;  3L75 D;  1RF0 C;  2LXB A;  1GD2 E;  4WY4 C;  1FZC C;  1L0N J;  2GZE A;  2FYU E;  1VQP P;  1S72 P;  3TGU D;  3HD7 A;  3B5N A;  1MZ9 A;  3JSV C;  5KKZ B;  5TIS H;  2DNW A;  3N4X A;  2AFE A;  2ZJS E;  5CCH A;  3RK2 B;  4JYC A;  2LF4 A;  3M0D A;  3CCS P;  2IPP A;  3S4R A;  4H0L C;  2B89 A;  2ZT9 C;  3H1H E;  1M57 D;  1OFC X;  3R4Y A;  3CCL P;  2IYP A;  1BSN A;  2O01 N;  4EIJ A;  1SQV D;  4NEO A;  1RQV A;  1NTZ D;  5GTH H;  5CBO A;  2PEI A;  3NTE A;  4C46 A;  1W5C E;  2M5R A;  3CI9 A;  2OAR A;  4WB4 A;  1IFD A;  4B86 A;  3RBX A;  2JEE A;  3L74 G;  2ROQ A;  3CPW O;  1JY3 N;  3L4F A;  2X2B A;  3V2N A;  4OVN F;  4KJM A;  1Z56 A;  1S5L E;  1EDL A;  1H0T A;  4NPF X;  2E5Y A;  2FYN B;  3H47 A;  2WQY C;  4JYB A;  2Y0D A;  1NTK J;  1VQ6 P;  5APW A;  1SS1 A;  1UJZ A;  2L6E A;  2ONT A;  2PFX A;  4DZO A;  5M1B A;  2WPV B;  1GL2 D;  2M8L A;  4ZKP A;  3L72 E;  1RF1 A;  2IBZ I;  3MUD A;  2GDY A;  1HTL C;  1NHL A;  1SQQ D;  3FWN A;  1LP1 A;  5AVW B;  5F2K A;  3E7K A;  4HJG H;  2EHT A;  1T2K D;  2XDJ A;  3IR9 A;  2GZF A;  1GK4 A;  2KG8 A;  1VQ8 P;  5B5E E;  2HR3 A;  5KAF H;  5KKZ C;  2N50 A;  3P05 A;  2Q3I A;  1E6J P;  5AVU B;  2E43 A;  4U0E A;  2VRS A;  3RK2 C;  1OVU A;  1U7J A;  3DTJ A;  3GHG A;  1L4A C;  1FAV A;  2W83 C;  3O6Q A;  2OYH B;  1Q2N A;  3PH0 A;  2Y0E A;  1JMM A;  2YMY A;  4K35 A;  1S3J A;  3M9B A;  4GOD A;  4EI2 A;  2XZR A;  1NAF A;  4GOF A;  4BPG A;  1KFN A;  2Z44 A;  2UWJ E;  5APX A;  2OYI A;  1EZV G;  2J59 M;  2VSQ A;  2ZXX A;  5AW6 B;  1DH3 A;  4TT3 H;  2PY8 A;  4MN4 C;  1ZV8 A;  3G21 A;  4U0F A;  1WMK A;  1VQO P;  1JB0 J;  3E1R A;  3H1I G;  3QWO C;  1PEU A;  2O01 H;  1G2C B;  5EJD A;  1SFC C;  1NU1 K;  2LIU A;  3SFD C;  3H1J G;  3GKL C;  1SQX D;  5KLV G;  1NVO A;  1SP4 A;  4L73 A;  2ZFC A;  2FYN C;  2JP3 A;  4IZ6 A;  4I2L C;  2KGD A;  1ZRT E;  1E5W A;  1SQV J;  5KP6 B;  3MHV A;  1KD1 Q;  1S5L H;  2MR7 A;  3K5B A;  3H1L D;  1AFO A;  2E75 B;  3JCU E;  4GOE A;  1BGY E;  1OWA A;  1FJP A;  1PPJ E;  2WPR A;  1MFT A;  1JY2 N;  1BCC D;  1KOR A;  2M3E A;  3T97 B;  1LTI C;  3RK3 E;  3H32 A;  3H1H J;  3AE4 C;  1NTM D;  3BAS A;  2O01 J;  2C0X A;  2NZ2 A;  2LKM A;  3KPE A;  4IOI H;  1ZXG A;  1OW7 A;  3CD6 P;  2PEN A;  3P8C E;  1PV3 A;  1NH4 A;  3RK3 C;  2Y9Z A;  1LJ2 A;  2N6Z A;  2KLV A;  3KQG A;  1QGK B;  3MD0 A;  3WUV A;  2KSJ A;  1J1D C;  2Y0C A;  2Q1K A;  2E74 D;  4H44 C;  1VQ4 P;  2N98 A;  3JC2 2;  1TU3 F;  4YPC A;  3II6 A;  2OYH C;  2DW3 A;  5CJ4 A;  2JWA A;  5B5E H;  1SLQ A;  2JU1 A;  4R4M A;  1HH0 A;  1ZR2 A;  2BCC E;  1HGV A;  1JM0 A;  2P67 A;  3IAO A;  2QM7 A;  2EFJ A;  5BS2 A;  3L70 G;  3G29 A;  2C0W A;  1AVO A;  2FAE A;  2JYL A;  4U7J A;  1N73 A;  1YYC A;  5DJU B;  1D7M A;  3L73 J;  1L0L K;  2MD9 A;  1GZL A;  1LTT C;  2FYU G;  2CPB A;  2WVR A;  2O3J A;  1U57 A;  3L72 J;  3VN0 A;  1VQK P;  1X3O A;  4DJG A;  1PFI A;  1FE6 A;  2FAC A;  1PGO A;  1P84 D;  4HYT B;  2QSI A;  4H13 B;  4XRQ A;  4XA4 A;  1DV5 A;  3FWL A;  1RE3 A;  1EC5 A;  2FFD B;  4IFD K;  3SFE C;  3CC2 P;  1KYO D;  1GK6 A;  2QNW A;  1HJB A;  3AEA C;  2QJP C;  2MY5 A;  3Q5P A;  4IPY A;  1S4X A;  2K92 A;  1X8Y A;  3IF4 A;  3CX5 E;  1QVF O;  2GZI A;  3DS3 A;  1FOS E;  3Q5R A;  2E75 C;  2KWL A;  3O8Z A;  5KLI C;  1HF9 A;  3P7K A;  1AA0 A;  2ITA A;  5CHX A;  2JB0 A;  1FBM A;  5K5G B;  1Q90 D;  3H1K E;  1FR2 A;  3DS2 A;  4I6M C;  1RY3 A;  4RJT A;  3B5N B;  2FXP A;  1QRJ A;  3WBH A;  1IFJ A;  4RKU J;  1K8A Q;  4DOJ A;  2JGP A;  2GUS A;  1PEO A;  5CCG C;  2V7Q H;  5I4T G;  1Q81 Q;  2ZYG A;  4BWN A;  2JU2 A;  5JPA A;  2HOD A;  1L0L E;  3EQ2 A;  2KUB A;  3DS5 A;  1AVY A;  1ZN5 A;  4BXL A;  4XE5 B;  3MGE A;  3KDP B;  1FDO A;  1PP9 G;  2A06 E;  1RNI A;  1G1I A;  1PL5 A;  3HE4 A;  1T6A A;  3TYY A;  4U3F D;  1VKU A;  2FBW C;  2BQ1 E;  3FGA D;  3A0B H;  4XRO A;  3QH9 A;  2CGQ A;  5KJ7 D;  2QJY B;  4ZMD A;  2KOD A;  1LNQ A;  1J2J B;  3G9R A;  1D1D A;  1BGY J;  4C7R A;  1KIL D;  2BHV A;  2Y9Y A;  1OXZ A;  1H0T B;  2XV5 A;  2V7Q J;  3B4Q A;  1KYO H;  1BE3 J;  2RKL A;  1IMP A;  1ZME C;  5GTH E;  4H13 C;  1NAY A;  3CL3 D;  5AVS B;  3VOP A;  2YNY A;  2FFD C;  1AQT A;  2C9N Y;  2QVA A;  2AEF A;  4GR6 A;  1NJI Q;  2KOR A;  3AEG C;  1RE4 A;  5KJ7 A;  2L5G B;  2XZ1 C;  3L71 G;  1RF1 B;  1RH5 B;  1FZA A;  1NTZ K;  1VDF A;  1KIL A;  1EZV D;  2I1K A;  3CXC O;  1A8O A;  2JJL A;  1LP1 B;  2W27 A;  3SWY A;  3PTZ A;  4CA3 A;  1NU1 J;  2NPS D;  2PGD A;  3CX5 H;  2BCC J;  4I7Z C;  3BCC G;  3OW2 O;  2W90 A;  3B5N C;  3HD7 C;  4O9B A;  1S9K E;  3H1J D;  5AW8 B;  5KLV D;  1LT9 A;  3SWF A;  2QRX A;  3L75 E;  3HTK B;  3GHG B;  3AEB C;  1BSH A;  3M0D C;  1W2B O;  3O6Q B;  3TF5 A;  1WT6 A;  2K94 A;  1VF5 C;  3RG6 C;  2PP6 A;  3TGU E;  1K05 A;  1Y9B A;  5CCH D;  1QEX A;  1A02 F;  4H2W C;  2LR2 A;  4R0M A;  4GT1 A;  2KGA A;  2NPS A;  1L0I A;  2Q5U A;  2MKV A;  4K3A A;  1A02 J;  1DEB A;  4UHP B;  2B9B A;  1EOQ A;  2ZYD A;  4LC1 A;  3S9O A;  2OYI B;  2CPS A;  1PPJ G;  2CNR A;  3CCR P;  4EOT A;  3VTP C;  1FOS F;  2QJY C;  2M3B A;  1FZG A;  2KLU A;  1SQV E;  2MJZ A;  3GF7 A;  3RBZ A;  1M1J B;  4AUW A;  2ZVO B;  2MF4 A;  1NO4 A;  1R5L A;  3KHU A;  4RO0 A;  1SQP G;  4UB8 E;  4Y99 C;  2K5X A;  2M8P A;  1SVF A;  1ZOY C;  1HBW A;  3H1K J;  5APQ A;  3WMM 0;  2GYK A;  3HUS C;  1LTJ A;  3G1G A;  4KHX A;  2WZ7 A;  3NFQ A;  3PP5 A;  1GU5 A;  3LW5 H;  1LWU A;  1EXJ A;  2LKI A;  3EFG A;  4W7Y A;  5AVY B;  1QL2 A;  2JAZ A;  4U3F J;  3L70 D;  4AYC A;  2L91 A;  2K0D X;  1RF1 C;  3GZL A;  3DS0 A;  3MUD C;  4WYM A;  1L0L J;  2JO0 A;  1JO5 A;  3TK1 A;  3WU2 H;  4COP A;  3H32 B;  2Z5H A;  2QE7 H;  2JO1 A;  2FYU D;  1YIJ P;  4N78 D;  2W8Z A;  4PD4 H;  2WSC H;  4H2X C;  3M06 A;  1RO0 A;  1JTH B;  2YKQ A;  1JY3 O;  1RHZ B;  2R3S A;  1KYO I;  1SQX K;  1K9M Q;  1RF0 A;  1SQQ E;  2G3A A;  1GL2 C;  2OTK E;  3GHG C;  1IFP A;  5AW9 B;  2P7J A;  2P9X A;  2IBZ G;  2EIA A;  4D6T G;  1GXH A;  2N9B A;  3LW5 J;  3M9H A;  2V4H A;  2ZVN B;  1SQB K;  1USD A;  2R44 A;  4HKZ H;  1H8A A;  2H89 C;  2YO3 A;  3CWB D;  1X9V A;  2CG5 B;  3L73 E;  4AQR D;  3CCJ P;  1L0N G;  3AE8 C;  3AE5 C;  1T2K C;  2AFD A;  1EQ7 A;  2FY8 A;  4L75 A;  1M74 A;  2KNC A;  3G26 A;  1AYI A;  4IL6 X;  2EG5 A;  1VQ5 P;  4PWV B;  5HVC A;  1KTM A;  3EJB A;  1N73 B;  3TSI A;  2E74 B;  3CX5 I;  3H1K G;  1NTM K;  3W68 A;  3V5B A;  1KB9 D;  2WSC J;  2PEK A;  3A2A A;  3CCE P;  3LIE A;  4NPD A;  2LL8 A;  3A5T A;  5CZD B;  2N6Y A;  3LMO A;  2P1J A;  4EDF A;  1KMI Z;  2FQ2 A;  3HTK A;  4YXW H;  1URQ D;  4QMA A;  2KOP A;  4UB6 E;  5APV A;  2LTE A;  2NO8 A;  1N86 A;  3I55 P;  2M8N A;  1BXI A;  1T8K A;  4XFX A;  2K9J A;  3SWK A;  1SQX E;  3L75 J;  1PP9 D;  3D71 A;  2N1T D;  4UB8 H;  2KR5 A;  2W6B A;  1FU1 A;  2A06 G;  2K88 A;  3V2Q A;  3GW6 A;  1UII A;  3H6P A;  1M8O B;  3TGU J;  3V6I A;  2N5I A;  1NTK G;  2A45 H;  1URQ A;  2JDI H;  1OZH A;  3H1L E;  3L36 A;  1UIX A;  2OTJ P;  1M1J A;  2ZXE B;  1AUM A;  4PH1 A;  1LGH B;  2JYG A;  1BCC E;  1R5S A;  2O1J A;  2N1T A;  2KP8 A;  1NKZ B;  3E1I A;  2HOD B;  2KOG A;  3M0A A;  1NTM E;  3HYB A;  1N8R Q;  2R5B A;  4HH2 A;  2FQ0 A;  1SQB D;  2R5D A;  1NTZ J;  2BUO A;  1JNM A;  2B87 B;  3RL0 D;  3L71 D;  4N3Y B;  1L0H A;  2IX7 C;  4PXH B;  2BEQ D;  2OTL P;  2WSS H;  3HE4 B;  1JY2 P;  3W67 A;  1X79 B;  4PH0 A;  1JY2 O;  1BE3 E;  4PD4 I;  2E74 C;  2H7H A;  3GF3 A;  4U0D A;  3CXH D;  1VQ7 P;  3BCC D;  2J58 A;  1HY8 A;  3A0H E;  1JTH A;  3Q5S A;  2ERH A;  2YMK A;  1EMV A;  1DIP A;  1HJ0 A;  3RG2 A;  1N7S B;  1RE3 C;  3U1C A;  2Q7C A;  3AE1 C;  3TGU G;  1T8Z A;  3A0B E;  2NRG A;  3IN6 A;  1NU1 E;  3P32 A;  1SQQ J;  2IZ0 A;  3M91 A;  1P84 E;  3HRN A;  4I1L A;  5GTI E;  1HGZ A;  1KIL B;  3AEE C;  5AVT B;  3AE9 C;  4UB6 H;  2ZAE B;  1E0H A;  1PIX A;  1KYO E;  1GW3 A; 
#chains in the Genus database with same CATH homology
 3G4S P;  3H4E A;  2BHV A;  4XFZ A;  2QEX P;  4M0I A;  4U0A A;  3CCJ P;  3CC2 P;  5HGM A;  2LF4 A;  1JJ2 O;  3CC7 P;  3CCV P;  2PEO A;  5F2N A;  1Q7Y Q;  3HZQ A;  1VQ8 P;  3CCS P;  1M74 A;  4IPY A;  3HYB A;  3G26 A;  3P05 A;  1YIT P;  1N8R Q;  2EG5 A;  1QVF O;  1YI2 P;  1E6J P;  3DS3 A;  5BS1 A;  1VQ5 P;  4U0E A;  2E1M A;  2PEM A;  3DTJ A;  3CMA P;  2BUO A;  3CCL P;  4XFY A;  3CD6 P;  3G0V A;  2PEN A;  4GR6 A;  2M8P A;  1M6N A;  2PEK A;  2Z45 A;  3DPH A;  3E2D A;  1NJI Q;  3M1M A;  3CCE P;  2OTL P;  5DCK A;  2PEI A;  1PEQ A;  3NTE A;  1EIA A;  3DS2 A;  3CCU P;  1YJ9 P;  3G1G A;  2OAR A;  1M90 Q;  4PH0 A;  1VQ4 P;  4COC A;  5HGL A;  3LRY A;  2Z44 A;  4GR2 A;  3CXC O;  1A8O A;  1QRJ A;  2XV6 A;  3WBH A;  3G6E P;  2XT1 A;  4U0D A;  2PEJ A;  1K8A Q;  3CPW O;  1VQL P;  1VQ7 P;  1PEM A;  3CME P;  1QVG O;  4U0B A;  5HGN A;  1PEO A;  2PY8 A;  3CCM P;  1VQN P;  5I4T G;  3G21 A;  4U0F A;  3DS1 A;  3DS0 A;  3G1I A;  3DS4 A;  1VQO P;  1Q81 Q;  1K73 Q;  3H0D A;  3I55 P;  3G28 A;  4QNB A;  4WYM A;  5JPA A;  2JO0 A;  3OW2 O;  3H47 A;  2CWO A;  2QA4 P;  2EFJ A;  3B5I A;  5BS2 A;  1KQS O;  3G29 A;  3I56 P;  1PEU A;  2M8N A;  4COP A;  3G71 P;  2DGY A;  1K30 A;  2Z46 A;  3DS5 A;  3Q20 A;  4XFX A;  1KC8 Q;  1VQ6 P;  1RO2 A;  5HGO A;  2JYL A;  1YIJ P;  1Q86 Q;  3MGE A;  3CCQ P;  1M6E X;  2PEQ A;  2L6E A;  2ONT A;  1RO0 A;  1W2B O;  1IUQ A;  3CC4 P;  3VRL C;  1RNI A;  2M8L A;  3RG6 C;  2XXM A;  1K9M Q;  1VQK P;  1YJW P;  4U0C A;  1VQP P;  1BAJ A;  3CCR P;  1VQ9 P;  2BQ1 E;  1S72 P;  4XRO A;  1VQM P;  2P9X A;  1ZMB A;  1YHQ P;  1M1K Q;  2EIA A;  1A43 A;  1Q82 Q;  1KD1 Q;  5F2K A;  1EOQ A;  4XRQ A;  2OTJ P;  2KOD A;  1YJN P;  1AUM A;  5F2O A;  4PH1 A;  2JYG A;  1D1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...