2QEXQ

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2qexQ00
1W2BP 3CPWP 3G71Q 3CMAQ 3CMEQ 3I55Q 1Q82R 1VQ9Q 1Q7YR 1VQ8Q 3CC7Q 3CXCP 1YIJQ 3I56Q 3CCMQ 3G6EQ 1VQ7Q 3CC4Q 1VQOQ 1KD1R 1YJNQ 3CCSQ 1NJIR 1M1KR 1VQKQ 3CC2Q 1N8RR 3CCLQ 3CCVQ 1Q86R 1VQLQ 2OTJQ 3CCEQ 1VQ5Q 3CCUQ 3G4SQ 1YJ9Q 2QEXQ 1YI2Q 1S72Q 1Q81R 1VQMQ 1JJ2P 1KQSP 3OW2P 1QVFP 1VQNQ 3CCQQ 1K8AR 1VQ6Q 3CCRQ 1KC8R 1YHQQ 1K9MR 1K73R 1VQPQ 1QVGP 1YJWQ 2OTLQ 2QA4Q 1YITQ 3CD6Q 1M90R 1VQ4Q 3CCJQ
chains in the Genus database with same CATH superfamily
2CP7A 2DXCA 1PKTA 2VXEA 2NUPA 2QXFA 4HCCA 4M75E 5CIUA 2QTVA 4Z8AA 1WIEA 5LJ5j 4FSSA 1GBQA 1AVZC 1K0SA 4C5HA 4QQ6A 4ELYC 4FT4A 2KBTA 3CMEA 4J7FA 4FL6A 3RDVA 4M78E 3HHTB 1WQ7A 1ZA1B 4KUIA 2KE9A 3A8GB 2RPNA 4D8KA 4MZPA 5I21A 2ZCFB 3J80E 2XDPA 3QIIA 1NPPA 2ENMA 4PJOE 5HK0A 2CT4A 4NL2A 2NUPB 3VRZA 2RF0A 1U06A 2HQEA 3X20B 1OPLA 4M4ZA 1G3TA 2EYQA 4GBQA 1Q86C 4J9GA 4JRPA 4X1VA 1WFWA 4AG2C 4LN2A 2O31A 3M59A 4OF1A 2YUPA 3O5ZA 2DYBA 1OULA 4IURA 1S1NA 1JBMA 1U8RA 3HSBA 4LXCA 3JCMW 2HCKA 2FVUA 4B9XA 4A4FA 4XTVA 5LJ5e 2BUDA 1K1ZA 1ZUKA 2DL4A 2L8DA 2LCLA 4D8DA 4LDVA 4YTLA 4E47A 2ATCB 3H0HA 1CKAA 3I35A 5GAOq 4JRQA 5GJVB 1SPKA 5GAMd 2EYWA 2KYBA 3QWYA 1MV0B 2KQWA 1OQKA 4J83A 2PUKB 2O9SA 1YITQ 1BKBA 4M7AE 2QG9B 3PVQA 1NG2A 1IREB 1Q82U 3CCMQ 5GAN4 2KYMA 1NJIR 2CP0A 1EZZB 4JLIA 1ZSGA 2RQWA 1VQNQ 2MWOA 2NWMA 2VB6A 2K5IA 1H92A 2E12A 2JZ2A 1BK2A 1QKWA 3BW1A 1AWWA 1QVGS 1U1SA 3FB9A 4RG8A 2K57A 3V7RA 4ZN1A 2CP6A 1W2BS 3LW5E 1W4SA 5J26A 4DBFA 3I55T 2AZSA 1YNZA 3UWNA 4JZ4A 5FROA 3CCMT 1MGQA 3QG1A 3M0TA 1UDLA 2YRDA 3E9GA 4AFQC 4LD6A 4BDYA 1Y71A 5CKFA 3PGGA 3JB9D 2BZYA 3GOXA 2ECZA 5LJ5h 4J6YA 4AT1B 2VGMA 4O6JA 4QKUA 2J7IA 4PJOA 3M4YA 2EJGA 1QKXA 1FMKA 3M57A 2FL7A 2PVGB 5M9OA 4MDXA 3OBYA 2KK4A 1AHJB 1QMCA 3QHSA 1KC8C 4JDSA 5J39A 2RHZA 4LNPA 5GAN8 4M7DF 1Y7XA 1BIBA 1KQ1A 4PJOB 1N27A 4JLGA 3OYFA 1IO6A 1GRIA 4ZGJB 4E7ZA 4KGZB 3VKIA 2LQ8A 2EGAA 1ACMB 1T3LA 2VYTA 4OGCA 3S3NA 3MP8A 1WHHA 4F7UE 3LH5A 4E7LA 1D0XA 4R56A 4M7AA 2FZCB 1VQKA 2JVVA 2XIDA 2AT1B 1QVFA 1JXMA 2LCSA 2L0AA 3OYKA 4XTYA 3ASKA 2RQRA 1R0CB 4C92A 2LP5A 1M1GA 3OS2A 2COYA 2WSFE 3P8DA 3I56A 3S3MA 1I8FA 2PNIA 2W0ZA 1IGUA 2D6FA 1B34A 2QYZA 3OMGA 3UF4A 4PJMA 1OU8A 1PSFA 4CC2A 3RR6A 4M7AB 1LOJA 2RHYA 3EFSA 2X4WA 1ZQ1A 5FWCA 3OYHA 1JJ2S 2LQKA 3Q1JA 8AT1B 2FPFA 3SWNA 2RJEA 4F04B 3C12A 2YSQA 3L2QA 1UGRB 2DF6A 1XTDA 2JS2A 1FWZA 5KE2A 2AK5A 2P4TA 2RQVA 4C92B 1TXQA 3EAEA 3JCMe 4J8OA 2XDDA 5LJ3f 2MWPA 4J7IA 5IT9E 2COZA 2VC8A 5CAIA 2C0OA 3QPHA 2DXBA 1B34B 1FYNA 3MKDA 2H8HA 2K7AA 1KC8R 3LH0A 2O4XA 2QQSA 3UDCA 5GAOl 2OTLT 1PRLC 2HKQB 1X2KA 1M1KC 3OYMA 4XU1A 2X3WD 3REBB 1M90U 1G3YA 2K9GA 2X4XA 2VGNA 1QP2A 3OYNA 1M4ZA 5A0DA 1WNLA 2MYSA 2PZ1A 4C5GA 4AFUC 4OGEA 3GNGA 1Y07A 3L1AA 2K6DA 5AYFA 1TSFA 4M77G 1PD0A 1VQPT 4C8QF 1M3AA 1SSFA 3M58A 2KT8A 2ZPHB 2YRVA 4JUVA 3JB9H 3EGDA 1NZ9A 3M54A 1NEBA 3M55A 3FJPA 3E2UA 1K4US 2O4XB 2K3BA 1CKBA 1UTIA 1WJSA 2RI2A 1B3QA 3EFRA 1NYFA 2B86A 3TU4K 3VS5A 1Q95G 4QVZA 1R0BG 1N9SA 2B8AA 2F2WA 2A36A 1VQ7A 3EG3A 3EHRA 1TH7A 1KD1C 2QDYB 4L5GA 3SDZA 4C92C 2ZPFB 3CBMA 2YLBA 3JCMh 2DTOA 3I5SA 4OMQA 3HKSA 5C6SA 1JEGA 4AFZC 1OOTA 2COWA 3EGDB 4J6XA 2ROLA 2BZ8A 4O5VA 3I55A 2DVEA 4E6RA 4IUTA 4OMFB 4KH0B 2V1RA 4M78F 2LJ0A 3CMAQ 2AKLA 1M3BA 1Z9QA 3MO8A 1VOMA 4M7DG 2YUOA 3QYGB 3GF5A 4Z02A 4PNOA 3HPWA 2EWNA 5KCHA 1UGPB 5ECAA 4PJOF 5KYYA 1VQ9A 3HRSA 3RBBB 1HXDA 3QKJA 3AHUA 4JJCA 1VQ4T 3CMAT 3CBOA 4BE2A 5IN1A 1M1KR 2DX1A 2QQ9A 4OMPA 3WVDB 3I5RA 1YJWA 4II1A 1IRXA 3NPFA 3L2VA 3DKMA 3CXCA 2DTHA 4FYXB 3EH2A 2KI7A 3DLLA 3ME9A 3RKXA 3U23A 2RHUA 1YCSB 2YDLA 5KCOA 4DEYA 5KYUA 5CR2A 1QP3A 2V8JA 2WSEE 5KYYB 2EQMA 2E1HA 3LGLA 4XU2A 4B9WA 3EGUA 4LDWA 4A63B 4EMKC 1RAIB 5LJ3d 3FJ5A 2BIVA 2Y4YA 3MEUA 2XG8D 4RTXA 3MEVA 2RJFA 1W1FA 2KEAA 2KAFA 1H8KA 3EG1A 2ZPBB 4RTUA 2DBMA 4M7AF 4RCBA 1KD1R 5A2QE 3CCVT 4CC3A 1UUEA 3PIOA 4FSXA 3LGFA 1R8OB 1N6AA 1WI7A 3FLGA 1QVFP 3OW2P 5KYUB 1KQSS 4DBHA 5IXBA 1JQQA 3H0FA 2DL7A 2CP5A 2FB7A 4C92F 1OZ3A 3GBQA 4BACA 2BTTA 3L2ZA 1VQ5A 3FRNA 3VUBA 1Q7YU 1VQ6A 4IIMA 1BI3A 4AMCA 1GFDA 2QGFB 1VQKQ 2E41A 1SRLA 1WHMA 3EHQA 3THKA 3NGPA 2FHDA 3MP1A 2CKKA 1XOVA 1OU9A 4X9DA 3JAME 1O9SA 3HTRA 5D6WA 1O75A 3OYIA 1QCNA 2LX7A 3QZ5B 1MMDA 2DL5A 3UPUA 1H641 2DIGA 3CPWS 2VUBA 3I56Q 5GANg 4ESRA 3X28B 4C8QG 2KY9A 4E7JA 1UHFA 2FYKA 2FZKB 1SEMA 1MUZA 2EQUA 7AT1B 4PFPA 4J9FA 1UE9A 2KXDA 2L2PA 4RCCA 4LD9K 1OZ2A 3C4SA 1NJIC 3GLXA 2EKOA 2RMOA 2PQWA 1JB0E 1YN8A 4ATOA 2CDTA 4ZGEB 1PC0A 3NFCA 2L3PA 4OB1B 3I56T 1ABQA 3LWHA 3V8LA 4LE9A 4N0AA 2OTLA 2A28A 4OP0A 4LUEA 1Q86U 4IKFA 4A54A 5GAMj 1D09B 5GAN2 2V8KA 3CC4A 3P8HA 4M75G 3PMIA 3JB9I 2HSEB 2HEQA 5CO7A 3GNFB 3L2RA 3BDUA 5IHKA 3OYDA 1NLPC 2XK0A 4UC4A 4WF2A 1VQPA 4M78G 4RTVA 1C1AA 1X6BA 2DJZA 5DLQE 4F7UF 3VJPA 1WHGA 4Y91A 3J81E 4BI3A 1TTHB 4PJOG 4RTZA 4BE0A 1QCFA 3QWXX 3PMTA 2E3IA 2CZ0B 1K73C 1HD3A 3L2UA 2KT1A 1N5ZA 4AFSC 1M2VA 1Q81R 5GAOm 2KSSA 1U3OA 4PL6A 2DEQA 1K8AU 1SF9A 1WXBA 3NHNA 4XAXB 4Q5WA 5GJWB 4MMLA 1WLPB 1VQ7Q 5GAMe 2LX9A 1FX7A 2D8HA 2JW4A 1M30A 3VYHB 1ZSZC 3DB4A 1UHCA 1BBZA 4PJLA 1PHTA 4LDUA 2DYIA 3L42A 2W10A 4FIBA 5GAN7 1M2VB 3VS2A 3I55Q 2DZCA 1WHJA 3H41A 2XKOC 2HNIA 5IH2A 5LJ5d 1VQ7T 3OS1A 2DEUA 5FRMA 1MNDA 4JZ3A 1VQ4A 4M7AG 2JTFA 1YHQT 1RAEB 3CMAA 1KIKA 3CBPA 4N0AC 4C92E 2VWFA 3DB3A 4M77D 1LVKA 3HFNA 2VASA 1RAFB 1I0CA 1VQ9Q 3JCMb 3CXCP 4KULA 2LQNA 4DQ2A 1M27C 5FRNA 4HA8A 4ZTFA 1JO8A 5A0GA 5I22A 3CD6A 1KQ2A 2ED0A 2E10A 1RLQC 3CEYA 4MMKA 3EG0A 4HKEA 6AT1B 4OB0B 3TEEA 2LRQA 1YJWQ 4HT9A 1K9MU 2AHJB 1QQJA 1BYMA 3TVTA 4C0GA 3RKWA 4OMMA 2R5MA 1VQ9T 2CS7A 2M0YA 1QW1A 2VV5A 3JCMf 5DY9A 1VUBA 1WXUA 3R6OA 5GAMg 2XI9A 2PU9B 5CKEA 1SSHA 1Q82C 1K73R 3M4GA 1YJWT 1D0ZA 3TSWA 3ER0A 1HYOA 2JN0A 2CP3A 5CCAA 2EFIA 3CCJT 1K0XA 3CCVA 3FEOA 3A8LB 1UB4A 3JB9F 2BE9B 1PNJA 4KUDK 2F1LA 2GQVA 5HK3A 1MMNA 3D7SB 4K11A 2KVQG 2RA2A 3G7ZA 4L59A 2HDAA 4FYYB 4XQ3A 2NLUA 4E7IA 5CKBA 2QK0A 2PVOB 4EMHA 2XU8A 4DBRA 4V2SA 2AIRB 3WXMB 3SEMA 1MMGA 1M9SA 3QZ9B 1WXTA 2VKNA 2JUFA 4F14A 5GAOn 1SKUB 4EPCA 1I5OB 1M2OA 4MZTA 2D1XA 3G4ST 1VQ5Q 3C94A 2E3HA 2A08A 4JS4A 3O8VA 3MCAB 4LDXA 1NYGA 5CQXA 1VQ6Q 4FT2A 2QQRA 1NLOC 4ZGDB 9ATCB 4J9HA 3TREA 3FC3A 2M9UA 2DERA 3OW2A 1X27A 1Z9ZA 1RABB 1U1TA 4F7UG 3VU3C 2HZYA 5FU6C 1N8RU 1VQ5T 5I11A 5EG2A 4C5EA 1VQ6T 2HQXA 1Y96A 1YCYA 3M0SA 4JRIA 1MNEA 4CC4B 1NM7A 2E64A 4EDUA 2DAQA 3ZEHA 4LUDA 3A8MB 8ATCB 2VVKA 3META 1UJ0A 2JNGA 3GP8A 3CCRA 4RTYA 2DK3A 4M75C 3BE3A 5EC7A 2QI2A 5L8RE 1OI1A 5D7UA 3JB9J 1YP5A 2J6OA 2KRNA 1D0YA 2E65A 2E6NA 3OS0A 2DMOA 2HL3A 1WA7A 2OTLQ 3VS6A 2F69A 2X51A 2DVJA 2D8JA 4CC7A 1LPLA 2DD5A 4FYWB 1Q82R 2O2OA 3V7SA 1Y96B 1EIFA 2JS0A 3C95A 3UATA 2YT6A 3CC4Q 1A0NB 3JCMP 3RESA 1BIAA 2M0OA 3E1SA 2BKDN 2YUQA 2D0QB 3V8KA 3EGXA 3QO3A 1YJ9T 4X9CA 2V8IA 2JTMA 1OV3A 3CC7A 4R55A 3TQ7P 1VQPQ 1QVGP 1EFNA 2P84A 1UECA 5KYXA 4OMOA 3JV3A 1LNXA 4Z88A 3JCMQ 1GFCA 3CC4T 3I9QA 3PT9A 3JCMd 1KSWA 1NPRA 1AD5A 5IHIA 3RNJA 1QVFS 2L89A 3F70A 2GQIA 4ANJA 2WACA 5GAOr 2RN8A 4BD3A 4J5YA 2QA4T 2HBPA 4BB7A 2RHXA 2RO0A 3EGXB 2CGHA 4EMKA 3LYIA 3ZFJA 3OB9A 5KYXB 2X4YA 1U5SA 2RQUA 2NUZA 4KH1B 4ME7A 4XTXA 4IUQA 2LJ3A 2DETA 1Y0MA 4KT0E 2RNAA 2L3QA 2ZPIB 3EG2A 4M75D 4FCYA 3QBYA 1YHQA 2KRSA 1AZGB 2R5AA 5GANj 1P92A 1V1CA 2LTOA 3EFOA 1M90C 3JB9G 4EMKB 1I1JA 2ZZDA 1K76A 3QSUA 2J05A 1ABOA 2X4JA 2QGGA 3V8JA 1VQ4Q 3CCLA 3ZL7C 4BI4A 5GMKj 1VIEA 2EIFA 1V76A 1LCKA 1WPYA 2EW3A 2DM1A 5FWBA 1YJNQ 1PG5B 1F1BB 2RD1A 2O88A 1IXDA 1RAAB 2JMAA 4ELZC 1WDXA 3OYBA 5CKHA 1UEBA 3E19A 2EJ9A 3C0CA 2L3SA 2A37A 4IUPA 1B07A 2Z0WA 3CD6Q 2G3RA 3EFOB 2DL8A 2RH2A 2DZ9A 2M1HA 3OYYA 1YJNT 2XHCA 4BE1A 2CREA 1TG0A 3CCET 2YRCA 2GFUA 1YI2T 3CCJA 2DBKA 4DBQA 1AZEA 2DPPB 3CD6T 1PWTA 1KHIA 4DOWA 5GANe 5FU7B 3LX7A 2K2VA 2A7YA 2EQJA 2L3RA 3SFMA 3CCVQ 4MDWA 2DNUA 2Y4XA 1C6VX 3UA6A 3PIPA 1FMVA 1JJ2P 2FG0A 3OSSC 3OYJA 5GMKe 1WJRA 4M77A 2DL3A 2KDSA 3OYAA 2CH4A 1YFNA 2LNVA 3G4SA 4HCKA 1UGSB 4F17A 4IIOA 4QVCA 2QAZA 2GGRA 1PM3A 1BI0A 1RACB 1I4K1 3MHXA 1X6GA 2PUOB 2G6FX 2K5FA 1X01A 2CZ6B 5KH6A 3LWIA 2I0NA 1YWOA 4PFOA 1WHKA 5DLOA 1M90R 2M16A 1G8XA 1JU5C 1T3SA 1RLPC 4KBMB 2EGCA 5LJ5f 3G6ET 1VA7A 3R6NA 2MAMA 4M77B 4C0DC 3OYLA 1Q81C 4XU0A 1NJIU 3OMCA 2GTJA 4ZTJA 2E5KA 4LDYA 3M5AA 4XTZA 1VIFA 4E7SA 4C5IA 1M5Q1 2AKKA 5FU7C 2LZ6B 3CXCS 2KNBB 5GANh 2AZVA 4FM4B 1ZSZA 2CSQA 3M0QA 4HXJA 5LJ3g 3X25B 3BFMA 5CK9A 5HKCA 5CKDA 3CCRQ 3MEAA 2H3EB 2RK1A 3MP6A 1AEYA 5GMKh 2A3LA 2ZPEB 4AG1C 3CC2A 1QVPA 1RAHB 3V7CA 1LJOA 1ZUYA 2A0FB 1YJ9A 3OYCA 2ESWA 1ZLMA 4XU3A 3VS4A 3OBWA 2QEXT 1YWPA 2K4YA 3G71A 3CCRT 1VQ8A 2OAUA 1ZSZB 4HCZA 4CI0C 3AT1B 3PNWC 4FU6A 1MHNA 2YHTA 1HSQA 1XJWB 2DXUA 2R57A 3CC7Q 1ZX6A 4M77C 3QYHB 3FDRA 4VUBA 2M51A 5GAOp 1D1BA 2Y90A 2QA4A 3JCMc 2MOXA 4PKCC 1RUWA 1IHVA 4A4GA 1AWXA 3BDLA 2QDLA 2MIOA 4JPBW 2L5QA 3KXTA 4QQDA 4DA4A 1S72A 4HVVA 1TUDA 1VQMA 3CC7T 1QVGA 3A98A 2HBWA 5GAN5 1W2BA 1QWEA 2DLPA 3VS1A 2GBQA 1RAGB 1RADB 3QDFA 4HVUA 4J9EA 1GBRA 1H3ZA 2EPDA 5KYWA 2SEMA 2F5KA 1ZA2B 3A8HB 1VQLA 2OTJA 1KG1A 3RKYA 2CZ1B 4JJDA 3CPFA 4C0FA 1VQOQ 2RM4A 1SG5A 2DA9A 1GCPA 3T9NA 3E9FA 4E7HA 2MMPA 3ULRB 1YHQQ 4M7DC 4BY6B 1PCXA 2LCCA 3MEWA 1TOVA 1TWBA 1KK7A 3ZBDA 5L23A 3NMZC 4ZNXA 2EQIA 2J06A 1IZ6A 3RIRA 1E6GA 1XNIA 2IPOB 2JJ9A 2DILA 2FZGB 1WHLA 3CCQA 2DIQA 1VQOT 3REAB 4HT8A 2V1QA 4KGXB 4C8QA 5KYWB 3CCLQ 4JRKA 1CSKA 1KQSP 3LLRA 4MZMA 2ZAEA 1WZOA 1OEBA 1YJNA 2MK5A 4P5NA 3CCEA 2RI3A 1YBYA 4QQGA 2KMTA 1YI2A 1Q7YR 1RL2A 2RHIA 2DXTA 2LDMA 2X35A 1K8AC 1G3SA 3OY9A 4Z89A 3CCLT 5KYNA 3CQTA 4C92G 2F5TX 1G3WA 1N9RA 4ZN3A 5IXFA 1KC8U 1YITT 4OB2B 4C8QB 2DRKA 3CCJQ 3N5BB 3HP9A 2HD0A 4M75A 3CPWP 3MPUB 3NTKA 4M77F 2GF7A 1KJWA 2HMAA 4NL3A 3VUZA 4QVDA 3CCSQ 4QW2A 5GAMh 1MMAA 4RMOA 1VQNT 5FU6B 1BB9A 4M78A 1ZBXA 4HVWA 4BY6C 2I2LA 2K5LA 2LC4A 2RJDA 4KGVB 1MV3A 5AT1B 5D6XA 2DKGA 2HL5C 5LJ5g 4JJNK 3CCST 1SHGA 2MCNA 1QCOA 2ROTA 1Q86R 1H3HA 2WSCE 4M75B 4PLLA 3G4SQ 4M7DD 3WVEB 1GXIE 3M0UA 4RKUE 1FXXA 5FLXE 1YIJA 3G6EA 3VS3A 1B7TA 2GFAA 4TVRA 2CT3A 1NBEB 4M78B 1RI9A 3CCUA 1JJ2A 4BUGA 4CRIA 1OYXA 1I07A 2CUDA 1K9MC 1UG1A 3OQ5A 1X2QA 3IQLA 2K3YA 2EAYA 4GLMA 2EYZA 4C8QC 2XICA 2E6ZA 3SHWA 2XDBA 2FEIA 4Y92A 2LVMA 5GMKl 2HQHA 3QUIA 1M3CA 3GPLA 1I81A 1ARKA 1ZBJA 3H6ZA 2JMCA 1R77A 4JJBA 3RERA 4XTWA 1D3BA 1G83A 5I2SA 1K8AR 2P0QA 1T0JA 2ZGWA 1PKSA 4A4EA 2P4RA 2D9TA 2EKHA 4WTOB 1TS9A 3PE0A 2OAWA 2BZXA 2QEXA 5D6YA 2EBPA 1NE8A 2CP2A 2VXFA 3CC2Q 1C0MA 1T0HA 2K2MA 5A0LA 1M1KU 2DRMA 2K79A 3JCMX 1AWOA 4A4KA 2OJ2A 1YJ9Q 2M02A 1WX6A 1OX8A 2CSIA 4E2FB 4RUGA 4BI8B 4GLKA 2X3XD 1J3TA 4M78C 1AWJA 3G71Q 1D3BB 4D6WA 2FRWA 1VQ8Q 2CUBA 2XMFA 5FW9A 3A5ZB 3CC2T 5J3BA 3M56A 4E7KA 1JXOA 2RK2A 1BI2A 1D1CA 1BCMA 2LT4A 5C0MA 2ABLA 4PJOC 2CZ7B 2QA4Q 1W70A 2YLCA 3H0IA 1W2BP 1N8RC 2QQBA 4OB3B 3G71T 3CMEQ 1VQ8T 5GANf 3OYEA 2FO0A 2HKNA 2QQAA 2JTEA 1KD1U 2RI5A 4HCBA 5GAN6 2O9VA 1XQHA 1EX4A 1S72Q 4FW1A 1VQMQ 4C8QD 1X75C 3OW2S 1RI0A 1W6XA 3M9QA 1SRMA 1ZHIA 1K9MR 5CVIA 2QTXA 4Y28E 3VYGA 1K9AA 3HRTA 4M77E 4PK4A 2P0PA 3X24B 4L6V5 2LMJA 3CMET 2KRMA 3SWNB 3JRZA 3GIBA 4A4HA 3EH1A 2FRYA 1VQLQ 1TUGB 4C0ZA 2OTJQ 4R0KA 3KUFA 3QXEB 1S72T 1QLYA 1VQMT 1AT1B 4IUUA 2NUTA 4J9DA 3PTAA 1M8MA 3NTIA 2H3JA 2J6FA 2E4HA 1UGQB 3PVLA 2KXCA 3HFOA 1VQOA 2YXYA 3JSCA 2MPXC 1QWFA 3FIFA 2DFUA 1KHCA 2EQKA 4M7AC 1VYUA 4EMGA 1E7OA 4DOVA 2CYZB 1BI1A 1DJ7B 3QDRB 4F7UA 5LL6S 2C0IA 1VQLT 2OTJT 2OI3A 5HY6A 1VYVA 3INZA 1GCQA 1TU0B 3EG9A 4N4GA 5LJ3j 3CCQQ 3JCMJ 3S3OA 3TSZA 1G5VA 2O01E 2OX7A 2JM8A 4M78D 2SRCA 2P0KA 2DO3A 1PRMC 2EVRA 3J7AF 3OS5A 2NUTB 2RQTA 2EYXA 4FYVB 3JCMg 1BU1A 4M75F 3H8ZA 3CCEQ 1YITA 4PJOD 4M7DE 1YI2Q 3CCQT 1AOJA 4IUVA 2E5QA 2E70A 3M53A 3CCMA 2HAXA 2EYYA 5HCKA 3OYGA 4F7UB 2DJQA 1IHWA 2FPEA 1ZUUA 1E6HA 2DE0X 1Y57A 3M0PA 3EG9B 3QJ6A 1KQSA 1SHFA 3SWNC 1VQNA 2FPDA 2LNHB 1WJQA 1X69A 2JT4A 2JXBA 4C0DB 5IAYA 1N8RR 3VRYA 1G2BA 3BY7A 2KR3A 4ORZA 1M1FA 3A8OB 2EJFA 2GTOA 5DM7R 4J9CA 3H9NA 5KE3A 4OVAA 3DLMA 3RUXA 3QJYA 1X43A 3CCSA 1UGVA 5I2MA 2XD0A 4KRTA 2PVDB 4B6MA 4RTTA 2D0NA 3NTHA 1HJDA 5LJ3e 3OSVA 3TCJA 3SB2A 2RJCA 1PD1A 3CPWA 2BE7D 1Q81U 2X9HA 1NEGA 4M7AD 5CQYA 2F2VA 4A53A 4J9BA 1OPKA 2GNCA 1YIJQ 3G6EQ 4PJJA 4RG2A 4J9IA 2J6KA 1D1AA 5GANd 3PFSA 4XK8E 4BDZA 1WQWA 1X6OA 4PLIA 3CCUQ 3OA6A 4PFZA 2PTKA 4PJNA 1UFFA 4C92D 2JOYA 3HRUA 1M8VA 2YUNA 3KFVA 1GCQC 2K3XA 2KROA 1FMWA 4NOYA 1WGSA 1YIJT 4OMLA 2YWWA 3L2WA 3M0RA 3S6WA 4GY5A 5GAMf 2C06A 4J6WA 3CCUT 1VYTA 1PSEA 4NS5A 2C0TA 1I5LA 4WCIA 2CH4W 2QASA 2JM9A 5IHNA 3SD4A 4JS5A 4F16A 2DTIA 2IVWA 3VV0A 4X34A 2V26A 4XTUA 2F2XA 5GMKi 3UT1A 5GAN3 4N4HA 1GL5A 3RMQA 1IB8A 3JCMV 4M7DA 3KBGA 5LJ3h 2KGTA 2EGEA 2R58A 1WYXA 4RTWA 2QEXQ 4C8QE 2GCXA 1V29B 2DD4A 2LJ1A 3X26B 3A1PA 3VS7A 2LQWA 1TUCA 4FW2A 3VS0A 3RMSA 5GMKm 3UA7A 1IGQA 1BCOA 4QT7A 3MJXA 2ED1A 3HL8A 4DEXA 1OX9A 2HSPA 1VQKT 2NYSA 1KFZA 3P8BB 2IG0A 2IIMA 1HK9A 4EIKA 2LT1A 2MI6A 4OMNA 4N4IA 1UJYA 2ZPGB 1JRIA 3URGA 1K73U 1Q7YC 4M7DB 3G1JA 2MF2A 2RB6A
chains in the Genus database with same CATH topology
1W2BP 3CPWP 3G71Q 3CMAQ 3CMEQ 3I55Q 1Q82R 1VQ9Q 1Q7YR 1VQ8Q 3CC7Q 3CXCP 1YIJQ 3I56Q 3CCMQ 3G6EQ 1VQ7Q 3CC4Q 1VQOQ 1KD1R 1YJNQ 3CCSQ 1NJIR 1M1KR 1VQKQ 3CC2Q 1N8RR 3CCLQ 3CCVQ 1Q86R 1VQLQ 2OTJQ 3CCEQ 1VQ5Q 3CCUQ 3G4SQ 1YJ9Q 2QEXQ 1YI2Q 1S72Q 1Q81R 1VQMQ 1JJ2P 1KQSP 3OW2P 1QVFP 1VQNQ 3CCQQ 1K8AR 1VQ6Q 3CCRQ 1KC8R 1YHQQ 1K9MR 1K73R 1VQPQ 1QVGP 1YJWQ 2OTLQ 2QA4Q 1YITQ 3CD6Q 1M90R 1VQ4Q 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B P;  3CPW P;  3G71 Q;  3CMA Q;  3CME Q;  3I55 Q;  1Q82 R;  1VQ9 Q;  1Q7Y R;  1VQ8 Q;  3CC7 Q;  3CXC P;  1YIJ Q;  3I56 Q;  3CCM Q;  3G6E Q;  1VQ7 Q;  3CC4 Q;  1VQO Q;  1KD1 R;  1YJN Q;  3CCS Q;  1NJI R;  1M1K R;  1VQK Q;  3CC2 Q;  1N8R R;  3CCL Q;  3CCV Q;  1Q86 R;  1VQL Q;  2OTJ Q;  3CCE Q;  1VQ5 Q;  3CCU Q;  3G4S Q;  1YJ9 Q;  2QEX Q;  1YI2 Q;  1S72 Q;  1Q81 R;  1VQM Q;  1JJ2 P;  1KQS P;  3OW2 P;  1QVF P;  1VQN Q;  3CCQ Q;  1K8A R;  1VQ6 Q;  3CCR Q;  1KC8 R;  1YHQ Q;  1K9M R;  1K73 R;  1VQP Q;  1QVG P;  1YJW Q;  2OTL Q;  2QA4 Q;  1YIT Q;  3CD6 Q;  1M90 R;  1VQ4 Q;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 2CP7 A;  2DXC A;  1PKT A;  2VXE A;  2NUP A;  2QXF A;  4HCC A;  4M75 E;  5CIU A;  2QTV A;  4Z8A A;  1WIE A;  5LJ5 j;  4FSS A;  1GBQ A;  1AVZ C;  1K0S A;  4C5H A;  4QQ6 A;  4ELY C;  4FT4 A;  2KBT A;  3CME A;  4J7F A;  4FL6 A;  3RDV A;  4M78 E;  3HHT B;  1WQ7 A;  1ZA1 B;  4KUI A;  2KE9 A;  3A8G B;  2RPN A;  4D8K A;  4MZP A;  5I21 A;  2ZCF B;  3J80 E;  2XDP A;  3QII A;  1NPP A;  2ENM A;  4PJO E;  5HK0 A;  2CT4 A;  4NL2 A;  2NUP B;  3VRZ A;  2RF0 A;  1U06 A;  2HQE A;  3X20 B;  1OPL A;  4M4Z A;  1G3T A;  2EYQ A;  4GBQ A;  1Q86 C;  4J9G A;  4JRP A;  4X1V A;  1WFW A;  4AG2 C;  4LN2 A;  2O31 A;  3M59 A;  4OF1 A;  2YUP A;  3O5Z A;  2DYB A;  1OUL A;  4IUR A;  1S1N A;  1JBM A;  1U8R A;  3HSB A;  4LXC A;  3JCM W;  2HCK A;  2FVU A;  4B9X A;  4A4F A;  4XTV A;  5LJ5 e;  2BUD A;  1K1Z A;  1ZUK A;  2DL4 A;  2L8D A;  2LCL A;  4D8D A;  4LDV A;  4YTL A;  4E47 A;  2ATC B;  3H0H A;  1CKA A;  3I35 A;  5GAO q;  4JRQ A;  5GJV B;  1SPK A;  5GAM d;  2EYW A;  2KYB A;  3QWY A;  1MV0 B;  2KQW A;  1OQK A;  4J83 A;  2PUK B;  2O9S A;  1YIT Q;  1BKB A;  4M7A E;  2QG9 B;  3PVQ A;  1NG2 A;  1IRE B;  1Q82 U;  3CCM Q;  5GAN 4;  2KYM A;  1NJI R;  2CP0 A;  1EZZ B;  4JLI A;  1ZSG A;  2RQW A;  1VQN Q;  2MWO A;  2NWM A;  2VB6 A;  2K5I A;  1H92 A;  2E12 A;  2JZ2 A;  1BK2 A;  1QKW A;  3BW1 A;  1AWW A;  1QVG S;  1U1S A;  3FB9 A;  4RG8 A;  2K57 A;  3V7R A;  4ZN1 A;  2CP6 A;  1W2B S;  3LW5 E;  1W4S A;  5J26 A;  4DBF A;  3I55 T;  2AZS A;  1YNZ A;  3UWN A;  4JZ4 A;  5FRO A;  3CCM T;  1MGQ A;  3QG1 A;  3M0T A;  1UDL A;  2YRD A;  3E9G A;  4AFQ C;  4LD6 A;  4BDY A;  1Y71 A;  5CKF A;  3PGG A;  3JB9 D;  2BZY A;  3GOX A;  2ECZ A;  5LJ5 h;  4J6Y A;  4AT1 B;  2VGM A;  4O6J A;  4QKU A;  2J7I A;  4PJO A;  3M4Y A;  2EJG A;  1QKX A;  1FMK A;  3M57 A;  2FL7 A;  2PVG B;  5M9O A;  4MDX A;  3OBY A;  2KK4 A;  1AHJ B;  1QMC A;  3QHS A;  1KC8 C;  4JDS A;  5J39 A;  2RHZ A;  4LNP A;  5GAN 8;  4M7D F;  1Y7X A;  1BIB A;  1KQ1 A;  4PJO B;  1N27 A;  4JLG A;  3OYF A;  1IO6 A;  1GRI A;  4ZGJ B;  4E7Z A;  4KGZ B;  3VKI A;  2LQ8 A;  2EGA A;  1ACM B;  1T3L A;  2VYT A;  4OGC A;  3S3N A;  3MP8 A;  1WHH A;  4F7U E;  3LH5 A;  4E7L A;  1D0X A;  4R56 A;  4M7A A;  2FZC B;  1VQK A;  2JVV A;  2XID A;  2AT1 B;  1QVF A;  1JXM A;  2LCS A;  2L0A A;  3OYK A;  4XTY A;  3ASK A;  2RQR A;  1R0C B;  4C92 A;  2LP5 A;  1M1G A;  3OS2 A;  2COY A;  2WSF E;  3P8D A;  3I56 A;  3S3M A;  1I8F A;  2PNI A;  2W0Z A;  1IGU A;  2D6F A;  1B34 A;  2QYZ A;  3OMG A;  3UF4 A;  4PJM A;  1OU8 A;  1PSF A;  4CC2 A;  3RR6 A;  4M7A B;  1LOJ A;  2RHY A;  3EFS A;  2X4W A;  1ZQ1 A;  5FWC A;  3OYH A;  1JJ2 S;  2LQK A;  3Q1J A;  8AT1 B;  2FPF A;  3SWN A;  2RJE A;  4F04 B;  3C12 A;  2YSQ A;  3L2Q A;  1UGR B;  2DF6 A;  1XTD A;  2JS2 A;  1FWZ A;  5KE2 A;  2AK5 A;  2P4T A;  2RQV A;  4C92 B;  1TXQ A;  3EAE A;  3JCM e;  4J8O A;  2XDD A;  5LJ3 f;  2MWP A;  4J7I A;  5IT9 E;  2COZ A;  2VC8 A;  5CAI A;  2C0O A;  3QPH A;  2DXB A;  1B34 B;  1FYN A;  3MKD A;  2H8H A;  2K7A A;  1KC8 R;  3LH0 A;  2O4X A;  2QQS A;  3UDC A;  5GAO l;  2OTL T;  1PRL C;  2HKQ B;  1X2K A;  1M1K C;  3OYM A;  4XU1 A;  2X3W D;  3REB B;  1M90 U;  1G3Y A;  2K9G A;  2X4X A;  2VGN A;  1QP2 A;  3OYN A;  1M4Z A;  5A0D A;  1WNL A;  2MYS A;  2PZ1 A;  4C5G A;  4AFU C;  4OGE A;  3GNG A;  1Y07 A;  3L1A A;  2K6D A;  5AYF A;  1TSF A;  4M77 G;  1PD0 A;  1VQP T;  4C8Q F;  1M3A A;  1SSF A;  3M58 A;  2KT8 A;  2ZPH B;  2YRV A;  4JUV A;  3JB9 H;  3EGD A;  1NZ9 A;  3M54 A;  1NEB A;  3M55 A;  3FJP A;  3E2U A;  1K4U S;  2O4X B;  2K3B A;  1CKB A;  1UTI A;  1WJS A;  2RI2 A;  1B3Q A;  3EFR A;  1NYF A;  2B86 A;  3TU4 K;  3VS5 A;  1Q95 G;  4QVZ A;  1R0B G;  1N9S A;  2B8A A;  2F2W A;  2A36 A;  1VQ7 A;  3EG3 A;  3EHR A;  1TH7 A;  1KD1 C;  2QDY B;  4L5G A;  3SDZ A;  4C92 C;  2ZPF B;  3CBM A;  2YLB A;  3JCM h;  2DTO A;  3I5S A;  4OMQ A;  3HKS A;  5C6S A;  1JEG A;  4AFZ C;  1OOT A;  2COW A;  3EGD B;  4J6X A;  2ROL A;  2BZ8 A;  4O5V A;  3I55 A;  2DVE A;  4E6R A;  4IUT A;  4OMF B;  4KH0 B;  2V1R A;  4M78 F;  2LJ0 A;  3CMA Q;  2AKL A;  1M3B A;  1Z9Q A;  3MO8 A;  1VOM A;  4M7D G;  2YUO A;  3QYG B;  3GF5 A;  4Z02 A;  4PNO A;  3HPW A;  2EWN A;  5KCH A;  1UGP B;  5ECA A;  4PJO F;  5KYY A;  1VQ9 A;  3HRS A;  3RBB B;  1HXD A;  3QKJ A;  3AHU A;  4JJC A;  1VQ4 T;  3CMA T;  3CBO A;  4BE2 A;  5IN1 A;  1M1K R;  2DX1 A;  2QQ9 A;  4OMP A;  3WVD B;  3I5R A;  1YJW A;  4II1 A;  1IRX A;  3NPF A;  3L2V A;  3DKM A;  3CXC A;  2DTH A;  4FYX B;  3EH2 A;  2KI7 A;  3DLL A;  3ME9 A;  3RKX A;  3U23 A;  2RHU A;  1YCS B;  2YDL A;  5KCO A;  4DEY A;  5KYU A;  5CR2 A;  1QP3 A;  2V8J A;  2WSE E;  5KYY B;  2EQM A;  2E1H A;  3LGL A;  4XU2 A;  4B9W A;  3EGU A;  4LDW A;  4A63 B;  4EMK C;  1RAI B;  5LJ3 d;  3FJ5 A;  2BIV A;  2Y4Y A;  3MEU A;  2XG8 D;  4RTX A;  3MEV A;  2RJF A;  1W1F A;  2KEA A;  2KAF A;  1H8K A;  3EG1 A;  2ZPB B;  4RTU A;  2DBM A;  4M7A F;  4RCB A;  1KD1 R;  5A2Q E;  3CCV T;  4CC3 A;  1UUE A;  3PIO A;  4FSX A;  3LGF A;  1R8O B;  1N6A A;  1WI7 A;  3FLG A;  1QVF P;  3OW2 P;  5KYU B;  1KQS S;  4DBH A;  5IXB A;  1JQQ A;  3H0F A;  2DL7 A;  2CP5 A;  2FB7 A;  4C92 F;  1OZ3 A;  3GBQ A;  4BAC A;  2BTT A;  3L2Z A;  1VQ5 A;  3FRN A;  3VUB A;  1Q7Y U;  1VQ6 A;  4IIM A;  1BI3 A;  4AMC A;  1GFD A;  2QGF B;  1VQK Q;  2E41 A;  1SRL A;  1WHM A;  3EHQ A;  3THK A;  3NGP A;  2FHD A;  3MP1 A;  2CKK A;  1XOV A;  1OU9 A;  4X9D A;  3JAM E;  1O9S A;  3HTR A;  5D6W A;  1O75 A;  3OYI A;  1QCN A;  2LX7 A;  3QZ5 B;  1MMD A;  2DL5 A;  3UPU A;  1H64 1;  2DIG A;  3CPW S;  2VUB A;  3I56 Q;  5GAN g;  4ESR A;  3X28 B;  4C8Q G;  2KY9 A;  4E7J A;  1UHF A;  2FYK A;  2FZK B;  1SEM A;  1MUZ A;  2EQU A;  7AT1 B;  4PFP A;  4J9F A;  1UE9 A;  2KXD A;  2L2P A;  4RCC A;  4LD9 K;  1OZ2 A;  3C4S A;  1NJI C;  3GLX A;  2EKO A;  2RMO A;  2PQW A;  1JB0 E;  1YN8 A;  4ATO A;  2CDT A;  4ZGE B;  1PC0 A;  3NFC A;  2L3P A;  4OB1 B;  3I56 T;  1ABQ A;  3LWH A;  3V8L A;  4LE9 A;  4N0A A;  2OTL A;  2A28 A;  4OP0 A;  4LUE A;  1Q86 U;  4IKF A;  4A54 A;  5GAM j;  1D09 B;  5GAN 2;  2V8K A;  3CC4 A;  3P8H A;  4M75 G;  3PMI A;  3JB9 I;  2HSE B;  2HEQ A;  5CO7 A;  3GNF B;  3L2R A;  3BDU A;  5IHK A;  3OYD A;  1NLP C;  2XK0 A;  4UC4 A;  4WF2 A;  1VQP A;  4M78 G;  4RTV A;  1C1A A;  1X6B A;  2DJZ A;  5DLQ E;  4F7U F;  3VJP A;  1WHG A;  4Y91 A;  3J81 E;  4BI3 A;  1TTH B;  4PJO G;  4RTZ A;  4BE0 A;  1QCF A;  3QWX X;  3PMT A;  2E3I A;  2CZ0 B;  1K73 C;  1HD3 A;  3L2U A;  2KT1 A;  1N5Z A;  4AFS C;  1M2V A;  1Q81 R;  5GAO m;  2KSS A;  1U3O A;  4PL6 A;  2DEQ A;  1K8A U;  1SF9 A;  1WXB A;  3NHN A;  4XAX B;  4Q5W A;  5GJW B;  4MML A;  1WLP B;  1VQ7 Q;  5GAM e;  2LX9 A;  1FX7 A;  2D8H A;  2JW4 A;  1M30 A;  3VYH B;  1ZSZ C;  3DB4 A;  1UHC A;  1BBZ A;  4PJL A;  1PHT A;  4LDU A;  2DYI A;  3L42 A;  2W10 A;  4FIB A;  5GAN 7;  1M2V B;  3VS2 A;  3I55 Q;  2DZC A;  1WHJ A;  3H41 A;  2XKO C;  2HNI A;  5IH2 A;  5LJ5 d;  1VQ7 T;  3OS1 A;  2DEU A;  5FRM A;  1MND A;  4JZ3 A;  1VQ4 A;  4M7A G;  2JTF A;  1YHQ T;  1RAE B;  3CMA A;  1KIK A;  3CBP A;  4N0A C;  4C92 E;  2VWF A;  3DB3 A;  4M77 D;  1LVK A;  3HFN A;  2VAS A;  1RAF B;  1I0C A;  1VQ9 Q;  3JCM b;  3CXC P;  4KUL A;  2LQN A;  4DQ2 A;  1M27 C;  5FRN A;  4HA8 A;  4ZTF A;  1JO8 A;  5A0G A;  5I22 A;  3CD6 A;  1KQ2 A;  2ED0 A;  2E10 A;  1RLQ C;  3CEY A;  4MMK A;  3EG0 A;  4HKE A;  6AT1 B;  4OB0 B;  3TEE A;  2LRQ A;  1YJW Q;  4HT9 A;  1K9M U;  2AHJ B;  1QQJ A;  1BYM A;  3TVT A;  4C0G A;  3RKW A;  4OMM A;  2R5M A;  1VQ9 T;  2CS7 A;  2M0Y A;  1QW1 A;  2VV5 A;  3JCM f;  5DY9 A;  1VUB A;  1WXU A;  3R6O A;  5GAM g;  2XI9 A;  2PU9 B;  5CKE A;  1SSH A;  1Q82 C;  1K73 R;  3M4G A;  1YJW T;  1D0Z A;  3TSW A;  3ER0 A;  1HYO A;  2JN0 A;  2CP3 A;  5CCA A;  2EFI A;  3CCJ T;  1K0X A;  3CCV A;  3FEO A;  3A8L B;  1UB4 A;  3JB9 F;  2BE9 B;  1PNJ A;  4KUD K;  2F1L A;  2GQV A;  5HK3 A;  1MMN A;  3D7S B;  4K11 A;  2KVQ G;  2RA2 A;  3G7Z A;  4L59 A;  2HDA A;  4FYY B;  4XQ3 A;  2NLU A;  4E7I A;  5CKB A;  2QK0 A;  2PVO B;  4EMH A;  2XU8 A;  4DBR A;  4V2S A;  2AIR B;  3WXM B;  3SEM A;  1MMG A;  1M9S A;  3QZ9 B;  1WXT A;  2VKN A;  2JUF A;  4F14 A;  5GAO n;  1SKU B;  4EPC A;  1I5O B;  1M2O A;  4MZT A;  2D1X A;  3G4S T;  1VQ5 Q;  3C94 A;  2E3H A;  2A08 A;  4JS4 A;  3O8V A;  3MCA B;  4LDX A;  1NYG A;  5CQX A;  1VQ6 Q;  4FT2 A;  2QQR A;  1NLO C;  4ZGD B;  9ATC B;  4J9H A;  3TRE A;  3FC3 A;  2M9U A;  2DER A;  3OW2 A;  1X27 A;  1Z9Z A;  1RAB B;  1U1T A;  4F7U G;  3VU3 C;  2HZY A;  5FU6 C;  1N8R U;  1VQ5 T;  5I11 A;  5EG2 A;  4C5E A;  1VQ6 T;  2HQX A;  1Y96 A;  1YCY A;  3M0S A;  4JRI A;  1MNE A;  4CC4 B;  1NM7 A;  2E64 A;  4EDU A;  2DAQ A;  3ZEH A;  4LUD A;  3A8M B;  8ATC B;  2VVK A;  3MET A;  1UJ0 A;  2JNG A;  3GP8 A;  3CCR A;  4RTY A;  2DK3 A;  4M75 C;  3BE3 A;  5EC7 A;  2QI2 A;  5L8R E;  1OI1 A;  5D7U A;  3JB9 J;  1YP5 A;  2J6O A;  2KRN A;  1D0Y A;  2E65 A;  2E6N A;  3OS0 A;  2DMO A;  2HL3 A;  1WA7 A;  2OTL Q;  3VS6 A;  2F69 A;  2X51 A;  2DVJ A;  2D8J A;  4CC7 A;  1LPL A;  2DD5 A;  4FYW B;  1Q82 R;  2O2O A;  3V7S A;  1Y96 B;  1EIF A;  2JS0 A;  3C95 A;  3UAT A;  2YT6 A;  3CC4 Q;  1A0N B;  3JCM P;  3RES A;  1BIA A;  2M0O A;  3E1S A;  2BKD N;  2YUQ A;  2D0Q B;  3V8K A;  3EGX A;  3QO3 A;  1YJ9 T;  4X9C A;  2V8I A;  2JTM A;  1OV3 A;  3CC7 A;  4R55 A;  3TQ7 P;  1VQP Q;  1QVG P;  1EFN A;  2P84 A;  1UEC A;  5KYX A;  4OMO A;  3JV3 A;  1LNX A;  4Z88 A;  3JCM Q;  1GFC A;  3CC4 T;  3I9Q A;  3PT9 A;  3JCM d;  1KSW A;  1NPR A;  1AD5 A;  5IHI A;  3RNJ A;  1QVF S;  2L89 A;  3F70 A;  2GQI A;  4ANJ A;  2WAC A;  5GAO r;  2RN8 A;  4BD3 A;  4J5Y A;  2QA4 T;  2HBP A;  4BB7 A;  2RHX A;  2RO0 A;  3EGX B;  2CGH A;  4EMK A;  3LYI A;  3ZFJ A;  3OB9 A;  5KYX B;  2X4Y A;  1U5S A;  2RQU A;  2NUZ A;  4KH1 B;  4ME7 A;  4XTX A;  4IUQ A;  2LJ3 A;  2DET A;  1Y0M A;  4KT0 E;  2RNA A;  2L3Q A;  2ZPI B;  3EG2 A;  4M75 D;  4FCY A;  3QBY A;  1YHQ A;  2KRS A;  1AZG B;  2R5A A;  5GAN j;  1P92 A;  1V1C A;  2LTO A;  3EFO A;  1M90 C;  3JB9 G;  4EMK B;  1I1J A;  2ZZD A;  1K76 A;  3QSU A;  2J05 A;  1ABO A;  2X4J A;  2QGG A;  3V8J A;  1VQ4 Q;  3CCL A;  3ZL7 C;  4BI4 A;  5GMK j;  1VIE A;  2EIF A;  1V76 A;  1LCK A;  1WPY A;  2EW3 A;  2DM1 A;  5FWB A;  1YJN Q;  1PG5 B;  1F1B B;  2RD1 A;  2O88 A;  1IXD A;  1RAA B;  2JMA A;  4ELZ C;  1WDX A;  3OYB A;  5CKH A;  1UEB A;  3E19 A;  2EJ9 A;  3C0C A;  2L3S A;  2A37 A;  4IUP A;  1B07 A;  2Z0W A;  3CD6 Q;  2G3R A;  3EFO B;  2DL8 A;  2RH2 A;  2DZ9 A;  2M1H A;  3OYY A;  1YJN T;  2XHC A;  4BE1 A;  2CRE A;  1TG0 A;  3CCE T;  2YRC A;  2GFU A;  1YI2 T;  3CCJ A;  2DBK A;  4DBQ A;  1AZE A;  2DPP B;  3CD6 T;  1PWT A;  1KHI A;  4DOW A;  5GAN e;  5FU7 B;  3LX7 A;  2K2V A;  2A7Y A;  2EQJ A;  2L3R A;  3SFM A;  3CCV Q;  4MDW A;  2DNU A;  2Y4X A;  1C6V X;  3UA6 A;  3PIP A;  1FMV A;  1JJ2 P;  2FG0 A;  3OSS C;  3OYJ A;  5GMK e;  1WJR A;  4M77 A;  2DL3 A;  2KDS A;  3OYA A;  2CH4 A;  1YFN A;  2LNV A;  3G4S A;  4HCK A;  1UGS B;  4F17 A;  4IIO A;  4QVC A;  2QAZ A;  2GGR A;  1PM3 A;  1BI0 A;  1RAC B;  1I4K 1;  3MHX A;  1X6G A;  2PUO B;  2G6F X;  2K5F A;  1X01 A;  2CZ6 B;  5KH6 A;  3LWI A;  2I0N A;  1YWO A;  4PFO A;  1WHK A;  5DLO A;  1M90 R;  2M16 A;  1G8X A;  1JU5 C;  1T3S A;  1RLP C;  4KBM B;  2EGC A;  5LJ5 f;  3G6E T;  1VA7 A;  3R6N A;  2MAM A;  4M77 B;  4C0D C;  3OYL A;  1Q81 C;  4XU0 A;  1NJI U;  3OMC A;  2GTJ A;  4ZTJ A;  2E5K A;  4LDY A;  3M5A A;  4XTZ A;  1VIF A;  4E7S A;  4C5I A;  1M5Q 1;  2AKK A;  5FU7 C;  2LZ6 B;  3CXC S;  2KNB B;  5GAN h;  2AZV A;  4FM4 B;  1ZSZ A;  2CSQ A;  3M0Q A;  4HXJ A;  5LJ3 g;  3X25 B;  3BFM A;  5CK9 A;  5HKC A;  5CKD A;  3CCR Q;  3MEA A;  2H3E B;  2RK1 A;  3MP6 A;  1AEY A;  5GMK h;  2A3L A;  2ZPE B;  4AG1 C;  3CC2 A;  1QVP A;  1RAH B;  3V7C A;  1LJO A;  1ZUY A;  2A0F B;  1YJ9 A;  3OYC A;  2ESW A;  1ZLM A;  4XU3 A;  3VS4 A;  3OBW A;  2QEX T;  1YWP A;  2K4Y A;  3G71 A;  3CCR T;  1VQ8 A;  2OAU A;  1ZSZ B;  4HCZ A;  4CI0 C;  3AT1 B;  3PNW C;  4FU6 A;  1MHN A;  2YHT A;  1HSQ A;  1XJW B;  2DXU A;  2R57 A;  3CC7 Q;  1ZX6 A;  4M77 C;  3QYH B;  3FDR A;  4VUB A;  2M51 A;  5GAO p;  1D1B A;  2Y90 A;  2QA4 A;  3JCM c;  2MOX A;  4PKC C;  1RUW A;  1IHV A;  4A4G A;  1AWX A;  3BDL A;  2QDL A;  2MIO A;  4JPB W;  2L5Q A;  3KXT A;  4QQD A;  4DA4 A;  1S72 A;  4HVV A;  1TUD A;  1VQM A;  3CC7 T;  1QVG A;  3A98 A;  2HBW A;  5GAN 5;  1W2B A;  1QWE A;  2DLP A;  3VS1 A;  2GBQ A;  1RAG B;  1RAD B;  3QDF A;  4HVU A;  4J9E A;  1GBR A;  1H3Z A;  2EPD A;  5KYW A;  2SEM A;  2F5K A;  1ZA2 B;  3A8H B;  1VQL A;  2OTJ A;  1KG1 A;  3RKY A;  2CZ1 B;  4JJD A;  3CPF A;  4C0F A;  1VQO Q;  2RM4 A;  1SG5 A;  2DA9 A;  1GCP A;  3T9N A;  3E9F A;  4E7H A;  2MMP A;  3ULR B;  1YHQ Q;  4M7D C;  4BY6 B;  1PCX A;  2LCC A;  3MEW A;  1TOV A;  1TWB A;  1KK7 A;  3ZBD A;  5L23 A;  3NMZ C;  4ZNX A;  2EQI A;  2J06 A;  1IZ6 A;  3RIR A;  1E6G A;  1XNI A;  2IPO B;  2JJ9 A;  2DIL A;  2FZG B;  1WHL A;  3CCQ A;  2DIQ A;  1VQO T;  3REA B;  4HT8 A;  2V1Q A;  4KGX B;  4C8Q A;  5KYW B;  3CCL Q;  4JRK A;  1CSK A;  1KQS P;  3LLR A;  4MZM A;  2ZAE A;  1WZO A;  1OEB A;  1YJN A;  2MK5 A;  4P5N A;  3CCE A;  2RI3 A;  1YBY A;  4QQG A;  2KMT A;  1YI2 A;  1Q7Y R;  1RL2 A;  2RHI A;  2DXT A;  2LDM A;  2X35 A;  1K8A C;  1G3S A;  3OY9 A;  4Z89 A;  3CCL T;  5KYN A;  3CQT A;  4C92 G;  2F5T X;  1G3W A;  1N9R A;  4ZN3 A;  5IXF A;  1KC8 U;  1YIT T;  4OB2 B;  4C8Q B;  2DRK A;  3CCJ Q;  3N5B B;  3HP9 A;  2HD0 A;  4M75 A;  3CPW P;  3MPU B;  3NTK A;  4M77 F;  2GF7 A;  1KJW A;  2HMA A;  4NL3 A;  3VUZ A;  4QVD A;  3CCS Q;  4QW2 A;  5GAM h;  1MMA A;  4RMO A;  1VQN T;  5FU6 B;  1BB9 A;  4M78 A;  1ZBX A;  4HVW A;  4BY6 C;  2I2L A;  2K5L A;  2LC4 A;  2RJD A;  4KGV B;  1MV3 A;  5AT1 B;  5D6X A;  2DKG A;  2HL5 C;  5LJ5 g;  4JJN K;  3CCS T;  1SHG A;  2MCN A;  1QCO A;  2ROT A;  1Q86 R;  1H3H A;  2WSC E;  4M75 B;  4PLL A;  3G4S Q;  4M7D D;  3WVE B;  1GXI E;  3M0U A;  4RKU E;  1FXX A;  5FLX E;  1YIJ A;  3G6E A;  3VS3 A;  1B7T A;  2GFA A;  4TVR A;  2CT3 A;  1NBE B;  4M78 B;  1RI9 A;  3CCU A;  1JJ2 A;  4BUG A;  4CRI A;  1OYX A;  1I07 A;  2CUD A;  1K9M C;  1UG1 A;  3OQ5 A;  1X2Q A;  3IQL A;  2K3Y A;  2EAY A;  4GLM A;  2EYZ A;  4C8Q C;  2XIC A;  2E6Z A;  3SHW A;  2XDB A;  2FEI A;  4Y92 A;  2LVM A;  5GMK l;  2HQH A;  3QUI A;  1M3C A;  3GPL A;  1I81 A;  1ARK A;  1ZBJ A;  3H6Z A;  2JMC A;  1R77 A;  4JJB A;  3RER A;  4XTW A;  1D3B A;  1G83 A;  5I2S A;  1K8A R;  2P0Q A;  1T0J A;  2ZGW A;  1PKS A;  4A4E A;  2P4R A;  2D9T A;  2EKH A;  4WTO B;  1TS9 A;  3PE0 A;  2OAW A;  2BZX A;  2QEX A;  5D6Y A;  2EBP A;  1NE8 A;  2CP2 A;  2VXF A;  3CC2 Q;  1C0M A;  1T0H A;  2K2M A;  5A0L A;  1M1K U;  2DRM A;  2K79 A;  3JCM X;  1AWO A;  4A4K A;  2OJ2 A;  1YJ9 Q;  2M02 A;  1WX6 A;  1OX8 A;  2CSI A;  4E2F B;  4RUG A;  4BI8 B;  4GLK A;  2X3X D;  1J3T A;  4M78 C;  1AWJ A;  3G71 Q;  1D3B B;  4D6W A;  2FRW A;  1VQ8 Q;  2CUB A;  2XMF A;  5FW9 A;  3A5Z B;  3CC2 T;  5J3B A;  3M56 A;  4E7K A;  1JXO A;  2RK2 A;  1BI2 A;  1D1C A;  1BCM A;  2LT4 A;  5C0M A;  2ABL A;  4PJO C;  2CZ7 B;  2QA4 Q;  1W70 A;  2YLC A;  3H0I A;  1W2B P;  1N8R C;  2QQB A;  4OB3 B;  3G71 T;  3CME Q;  1VQ8 T;  5GAN f;  3OYE A;  2FO0 A;  2HKN A;  2QQA A;  2JTE A;  1KD1 U;  2RI5 A;  4HCB A;  5GAN 6;  2O9V A;  1XQH A;  1EX4 A;  1S72 Q;  4FW1 A;  1VQM Q;  4C8Q D;  1X75 C;  3OW2 S;  1RI0 A;  1W6X A;  3M9Q A;  1SRM A;  1ZHI A;  1K9M R;  5CVI A;  2QTX A;  4Y28 E;  3VYG A;  1K9A A;  3HRT A;  4M77 E;  4PK4 A;  2P0P A;  3X24 B;  4L6V 5;  2LMJ A;  3CME T;  2KRM A;  3SWN B;  3JRZ A;  3GIB A;  4A4H A;  3EH1 A;  2FRY A;  1VQL Q;  1TUG B;  4C0Z A;  2OTJ Q;  4R0K A;  3KUF A;  3QXE B;  1S72 T;  1QLY A;  1VQM T;  1AT1 B;  4IUU A;  2NUT A;  4J9D A;  3PTA A;  1M8M A;  3NTI A;  2H3J A;  2J6F A;  2E4H A;  1UGQ B;  3PVL A;  2KXC A;  3HFO A;  1VQO A;  2YXY A;  3JSC A;  2MPX C;  1QWF A;  3FIF A;  2DFU A;  1KHC A;  2EQK A;  4M7A C;  1VYU A;  4EMG A;  1E7O A;  4DOV A;  2CYZ B;  1BI1 A;  1DJ7 B;  3QDR B;  4F7U A;  5LL6 S;  2C0I A;  1VQL T;  2OTJ T;  2OI3 A;  5HY6 A;  1VYV A;  3INZ A;  1GCQ A;  1TU0 B;  3EG9 A;  4N4G A;  5LJ3 j;  3CCQ Q;  3JCM J;  3S3O A;  3TSZ A;  1G5V A;  2O01 E;  2OX7 A;  2JM8 A;  4M78 D;  2SRC A;  2P0K A;  2DO3 A;  1PRM C;  2EVR A;  3J7A F;  3OS5 A;  2NUT B;  2RQT A;  2EYX A;  4FYV B;  3JCM g;  1BU1 A;  4M75 F;  3H8Z A;  3CCE Q;  1YIT A;  4PJO D;  4M7D E;  1YI2 Q;  3CCQ T;  1AOJ A;  4IUV A;  2E5Q A;  2E70 A;  3M53 A;  3CCM A;  2HAX A;  2EYY A;  5HCK A;  3OYG A;  4F7U B;  2DJQ A;  1IHW A;  2FPE A;  1ZUU A;  1E6H A;  2DE0 X;  1Y57 A;  3M0P A;  3EG9 B;  3QJ6 A;  1KQS A;  1SHF A;  3SWN C;  1VQN A;  2FPD A;  2LNH B;  1WJQ A;  1X69 A;  2JT4 A;  2JXB A;  4C0D B;  5IAY A;  1N8R R;  3VRY A;  1G2B A;  3BY7 A;  2KR3 A;  4ORZ A;  1M1F A;  3A8O B;  2EJF A;  2GTO A;  5DM7 R;  4J9C A;  3H9N A;  5KE3 A;  4OVA A;  3DLM A;  3RUX A;  3QJY A;  1X43 A;  3CCS A;  1UGV A;  5I2M A;  2XD0 A;  4KRT A;  2PVD B;  4B6M A;  4RTT A;  2D0N A;  3NTH A;  1HJD A;  5LJ3 e;  3OSV A;  3TCJ A;  3SB2 A;  2RJC A;  1PD1 A;  3CPW A;  2BE7 D;  1Q81 U;  2X9H A;  1NEG A;  4M7A D;  5CQY A;  2F2V A;  4A53 A;  4J9B A;  1OPK A;  2GNC A;  1YIJ Q;  3G6E Q;  4PJJ A;  4RG2 A;  4J9I A;  2J6K A;  1D1A A;  5GAN d;  3PFS A;  4XK8 E;  4BDZ A;  1WQW A;  1X6O A;  4PLI A;  3CCU Q;  3OA6 A;  4PFZ A;  2PTK A;  4PJN A;  1UFF A;  4C92 D;  2JOY A;  3HRU A;  1M8V A;  2YUN A;  3KFV A;  1GCQ C;  2K3X A;  2KRO A;  1FMW A;  4NOY A;  1WGS A;  1YIJ T;  4OML A;  2YWW A;  3L2W A;  3M0R A;  3S6W A;  4GY5 A;  5GAM f;  2C06 A;  4J6W A;  3CCU T;  1VYT A;  1PSE A;  4NS5 A;  2C0T A;  1I5L A;  4WCI A;  2CH4 W;  2QAS A;  2JM9 A;  5IHN A;  3SD4 A;  4JS5 A;  4F16 A;  2DTI A;  2IVW A;  3VV0 A;  4X34 A;  2V26 A;  4XTU A;  2F2X A;  5GMK i;  3UT1 A;  5GAN 3;  4N4H A;  1GL5 A;  3RMQ A;  1IB8 A;  3JCM V;  4M7D A;  3KBG A;  5LJ3 h;  2KGT A;  2EGE A;  2R58 A;  1WYX A;  4RTW A;  2QEX Q;  4C8Q E;  2GCX A;  1V29 B;  2DD4 A;  2LJ1 A;  3X26 B;  3A1P A;  3VS7 A;  2LQW A;  1TUC A;  4FW2 A;  3VS0 A;  3RMS A;  5GMK m;  3UA7 A;  1IGQ A;  1BCO A;  4QT7 A;  3MJX A;  2ED1 A;  3HL8 A;  4DEX A;  1OX9 A;  2HSP A;  1VQK T;  2NYS A;  1KFZ A;  3P8B B;  2IG0 A;  2IIM A;  1HK9 A;  4EIK A;  2LT1 A;  2MI6 A;  4OMN A;  4N4I A;  1UJY A;  2ZPG B;  1JRI A;  3URG A;  1K73 U;  1Q7Y C;  4M7D B;  3G1J A;  2MF2 A;  2RB6 A; 
#chains in the Genus database with same CATH homology
 1W2B P;  3CPW P;  3G71 Q;  3CMA Q;  3CME Q;  3I55 Q;  1Q82 R;  1VQ9 Q;  1Q7Y R;  1VQ8 Q;  3CC7 Q;  3CXC P;  1YIJ Q;  3I56 Q;  3CCM Q;  3G6E Q;  1VQ7 Q;  3CC4 Q;  1VQO Q;  1KD1 R;  1YJN Q;  3CCS Q;  1NJI R;  1M1K R;  1VQK Q;  3CC2 Q;  1N8R R;  3CCL Q;  3CCV Q;  1Q86 R;  1VQL Q;  2OTJ Q;  3CCE Q;  1VQ5 Q;  3CCU Q;  3G4S Q;  1YJ9 Q;  2QEX Q;  1YI2 Q;  1S72 Q;  1Q81 R;  1VQM Q;  1JJ2 P;  1KQS P;  3OW2 P;  1QVF P;  1VQN Q;  3CCQ Q;  1K8A R;  1VQ6 Q;  3CCR Q;  1KC8 R;  1YHQ Q;  1K9M R;  1K73 R;  1VQP Q;  1QVG P;  1YJW Q;  2OTL Q;  2QA4 Q;  1YIT Q;  3CD6 Q;  1M90 R;  1VQ4 Q;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...