2QEXV

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qexV00
1Q81W 1Q7YW 4WFAV 3CXCU 3CCEV 1YHQV 2OTJV 3CCVV 1VQ8V 3CC4V 4WF9V 3CPWU 3CCSV 2D3OW 3CMAV 1K73W 4WFBV 1M1KW 1KD1W 1VQLV 1JJ2U 1YJ9V 3I56V 1NJIW 2OTLV 1VQNV 1YJWV 1VQ7V 2QEXV 3CCLV 1VQMV 1Q86W 1K8AW 3CCUV 5DM6V 3G4SV 3CC7V 1VQKV 1VQOV 1YITV 1S72V 1W2BU 1M90W 1QVFU 3G6EV 3OW2U 1VQPV 1VQ4V 3CCMV 3CCQV 3CMEV 1YIJV 1VQ9V 3CC2V 1KC8W 1Q82W 1YI2V 1QVGU 1K9MW 3CCRV 1KQSU 1YJNV 1N8RW 3CD6V 3G71V 3CCJV 1R73A 4WCEV 3I55V 2QA4V 1VQ6V 1VQ5V
chains in the Genus database with same CATH superfamily
1FJGO 4RUFA 1XMQB 2UUCB 4DRXB 3CC4V 2WPDG 1NTMH 1FD9A 3JD0A 2CTRA 5IYBO 5JQGB 1S77D 4H44B 1TVKA 3G6EV 2UXBO 2CTQA 3DGEA 4B08A 4ZKIA 1MZEA 5IDJA 2A06H 3ICXA 3H1IH 4QPKA 2Q68A 1GAXA 4DV0B 4BW5A 1OZ0A 2YSUB 1FXKB 2ADQB 1HR0B 1OV9A 1PPJH 3B4SA 5J2UB 2QDOA 3MHHC 1N0JA 3G67A 2ZDIA 4AILC 1NKDA 1TA8A 3HKDA 4MT8A 3D36A 3EVKA 1F4NA 4LFAB 3BCCH 4LF9O 1BGYH 4WFEA 1VQ6V 2QGNA 3OMIB 2AGAA 4PDVA 3WB2A 3RYIA 3P3NA 2LGQA 2P4KA 2GHYA 2QM4A 2DWEC 1UPGA 2X6CA 5CBHA 3ZHVA 4IYHA 4DUZO 3ZMUA 1MMMA 4O4IA 5LOVB 2RMKB 3LDEA 4X88A 3H9VA 4TOIA 2ZIMA 3OEEG 1AP6A 2E76B 3K59A 1PV0A 3QVNA 4NXNO 4FFBA 3BHPA 1QLNA 5LP6A 5L3FA 5LYJB 5DM6V 4JYBA 1XNQO 1AI4A 4DW0A 1KUQA 4H37A 3RBZA 1BCCH 4GX2A 2RN9A 1FFXB 1JX9A 4JAAA 4F6RA 1YZBA 3AK2A 4GKKO 1K73W 1XI1A 5L3DA 5KHGA 5JJEB 4F6EA 4I55B 4MW8A 5IYDO 1R3JC 3L75H 4WBNA 5B1BB 3ASOB 4AQYB 1TVKB 3K0GA 2EILC 3BAAA 3CSXA 3ZIAG 3VQYA 2BTQB 3K03A 2QTSA 4J7ZA 4JI0B 4O4HB 5HFMA 1AJPA 3K5MA 1P7GA 5JJNB 5KLVH 2OIGA 2Q4PA 2Y69C 3TETA 4CH4A 1HDJA 2HFEC 4BAYA 1H8EG 4BIOA 4DR3B 4GX0A 3J80N 1XUQA 4I7ZB 2HEPA 3B2EE 1GH6A 5FPOA 4MTOA 4YIPA 5CBGA 3C3TA 5JWPA 2VQFO 1SQQH 3ZHQA 1DF4A 3H1JH 4O2BA 4PI2A 4I4TB 4UVAA 4X65O 1RM1C 3RYIB 3L73H 1EN6A 1QU7A 2F4VB 4IL6Z 4JI1O 3WFVA 3RVYA 4L8JA 1LUVA 3AG4C 1L1FA 2YXYA 3SYCA 1SQPH 2VRZA 2ZM6O 2YDEA 4O4IB 4DR4O 4E4EA 1VQNV 3JAKA 1LNQA 1J5EO 1XEQA 1SQBH 1OCCB 1OCZB 1AP5A 4FK5C 1S72V 3EXAA 1AJNA 1Z5WA 3SYPA 4FFBB 5LP6B 2CGNA 3ETGA 1S76D 2RJZA 1GN6A 3ZMZA 1W0JG 4G28B 2P4VA 4JI7O 4PD4F 1BS3A 5LMNO 2F93B 2D3OW 5CBFA 1FAFA 5CA1A 1RPOA 2XHBA 3MD0A 2IH1C 1KBHA 3KG2A 3ABMB 4JI3O 4F6RB 1N34O 1Y76A 4K35A 4GKJO 3E8GA 1F23A 2Y48A 2XAJA 1L8DA 1JFFA 1V55B 2PI5A 5GW7A 2EBOA 2EIKB 1R6TA 5C8YA 1CEZA 1BZKA 2OCCC 3TK1A 1K3EA 4J80A 4WBNB 1G6UA 4JYYA 4DV1B 1K8AW 4RAIA 5IE9A 3H01A 2PZSA 1FKAO 4FJCC 2EIMC 4UCRA 3AG2B 1MNGA 3CRAA 2ZNIA 1VF6C 1S5HC 1B06A 3X2QC 4FLYA 1WB8A 4K8ZA 3OUFA 1VQ8V 1KP3A 2UXNA 4UCVA 1K34A 2IJIA 1R3LC 2WSSG 4UXNA 3DXRA 4FM1A 3B77A 1ZSPA 2EJ7A 2LFSA 1K33A 3E86A 4DO2A 2JVDA 2QM8A 4K0KO 1EM1A 4R8CA 4O2BB 4JI4B 1YEWA 1XREA 4FMTA 5IY5C 2E5LO 5LA6A 4W4LA 1XBLA 4IHJA 4CH3A 3JARA 3S3XA 2CE4A 5EC1C 4B3MB 4LF4O 1S5LZ 3IC7A 3EFFK 3JCZA 3JAKB 5EBMC 1WA8B 4DR1B 3CYOA 1KQSU 1R6KA 1PL4A 2VWJA 1R73A 1QHTA 1M57B 4FZ0A 3QTCA 1B3QA 3D3IA 1IBLB 2Z0AA 2Q5ZA 1OCOC 3ML0A 2Q8VA 3DC6A 2XAGA 1HNZO 3SYOA 1BE3H 2G38A 2F43G 2QEXV 4U7OA 1EZJA 5CA1B 1K4DC 5BR8O 1YIJV 3BPZA 4TQDA 1N8RW 4LBEC 2JS5A 1Y76B 4HBNA 2ILMA 4DR5O 3ETEA 3RT3C 1K5QA 3HKBA 3OUSA 1M93A 2LFRA 3ASNC 1IBKO 2P7TC 4GX5A 3RW0A 2OTLV 1WLEA 3OT7A 3K5OA 5C8YB 2A0LA 2YIAA 2HKOA 1W2BU 3MHSC 1R3IC 5KUKA 1R1BA 2VQEB 1VQ4V 1M9NA 3B09A 4BR6A 4JZ2A 1KC8W 1XHXA 3LNNA 5JH7B 5LGTA 1K7DA 3RYFA 3CCVV 1PD3A 4KP4A 3W7SA 1H2NA 5J2TB 4HYOA 3BRCA 3CJHA 1M56C 1IXBA 4OXSA 1COWG 5D5QA 3DXRB 1BT8A 4HNAA 1KMIZ 3HKCB 2BSKA 4X1YA 2EJRA 4JYAB 3APOA 1EBOA 5GONB 3ZHSA 3CHXA 4FIPC 5IYCO 1JA8A 4JI8B 1KECA 3K06A 3IAYA 3AK1A 1ORQC 4EB6A 3ZRVA 4IHJB 4P9OA 2DMXA 1S5JA 2KQXA 3FFQA 2M7WA 1HNXO 1NQTA 3WB1A 2WA3A 5EBWC 4LF8B 4I50B 2NNUA 2ZR3A 2P67A 3ZHRA 4XDJA 1BSMA 3RYCA 5K1PA 4LFBO 2NR5A 4H13B 3SJQC 1JQ0A 1L0NH 2GUZA 5L3CA 1RP3B 2VS0A 3I56V 4OX9B 4PELA 3CCLV 4DYLA 5KAFZ 2YUAA 1ZWIC 3WU2Z 5LL6Y 1NZ6A 2MK3A 1YJNV 3WB0A 4DRXA 2V1DA 4DV7O 2UUBO 1WJZA 2X7RB 1HNWO 5L3BA 4QPJA 4UCOA 2KB1A 2AHYA 1JVMA 3F5TA 1KU9A 3OMAB 3OM3B 2IJJA 1GN3A 1ZX3A 4ABMA 4QJFB 1XNRB 1TUEB 1J95A 1Q43A 3PN1A 5AG2A 4YHHB 2OIEA 2XAHA 5KUMA 4IIJA 2IM9A 1B6QA 1EN4A 3QO8A 3FAVA 2ODMA 3SPIA 2OCHA 2D2CB 1MA1A 4X9QA 4BIZA 1VQOV 1FS0G 4HAMA 1IBMB 2CTPA 5FPRA 3CJHB 1X4TA 3K9AA 1XMOO 3TGUH 3GVMA 4HNAB 3WG7C 4FLZA 2AXTZ 2BSKB 1I7FA 2OYQA 4X1YB 3JD3A 4KUMA 1VQMV 3NR7A 3OFNG 1IXMA 5E79Z 1SF9A 4DR6O 1ZUQA 4J41A 5LOVA 1GM8A 1Q6IA 4MSWC 4CH5A 5KA5A 3CWBH 1IDSA 4PV1B 1AI7A 5D5PA 4EB6B 1TUBA 1WAZA 4CS4A 4LFCO 2DJVA 4CS2A 2UUAB 1Q81W 5LYJA 1D2DA 3AG3B 3R65A 1Y66A 3UCSC 4R50A 3K08A 1VQ7V 4PJ0Z 2FMLA 3OEHG 1W59A 4KFMA 4MVRA 2GUZB 2LW1A 5B1AB 2XUMA 2HHHO 2ZD9A 3KZIZ 4B3SO 1Q82W 4E2LA 3W7UA 3EHBB 3E8HA 1AVMA 3CXHF 5CA0A 2W6IG 2UXDO 4I55A 1Y74A 5B3SC 3AEIA 1DF5A 3VOUA 2ZCEA 2Q7EA 3FB8C 4JTDB 4UVCA 2JS3A 4UB8Z 5FLXN 2EINB 1YDXA 3JATB 1VQ9V 4X62B 1SZTA 1BL8A 3AK3A 1WB7A 2N74A 4JTAB 4JV5B 2BTQA 2Y4TA 2XTAA 1KKDA 2WLHA 1QLEB 4O4HA 1JJ2U 3M99B 4CS3A 2PUSA 1QR8A 1ZTEA 2QWPB 2ZNJA 4N23A 1V54B 4DV3O 4FFKA 4R7CA 4IIJB 4YY3B 3FAVB 2FTKA 1EFRG 4FLWA 1QVGU 1N32B 5IYZA 1LR1A 1YCIA 2LP7A 1SKVA 1IVSA 2WWWA 4KHPO 4I4TA 2YIDA 4B3RB 1VMGA 3K0DA 5BMVA 3O65A 2EIJB 2W6JG 2CAZC 4DV5B 4MTFA 1G8MA 2YXHA 4X64B 1OHHG 2FB5A 4DV4O 2NLJC 2JRIA 2QWRB 2LJ2A 4NYKA 5KHJA 3K57A 1TUBB 2ZXWB 4J11A 1SZXA 4LF7B 1URFA 3VQVA 4NKGB 3LSQA 3T1YO 1WP8A 1VF5B 3P32A 3K5LA 1N36O 4WFGA 2HR3A 1R3KC 1NVPB 1XOUA 4LWSA 5EZYA 1M5IA 4K3AA 3QO7A 4PA7A 5IJ9A 5CA0B 1ZAUA 1Y74B 3S3WA 3OW2U 3ZS8C 4YJ3A 2LO1A 3CRQA 4XBFA 5LMUO 1H8HG 4DXWA 2DYRC 1YTFD 2DYSC 1LUWA 1PNLA 3ABKC 3T1CA 4JI2B 1SETA 1OCRC 4NXMO 1MSDA 1K92A 1KYOF 2UU9B 4JI5O 1R6NA 3FKSG 4O4LA 1N33O 5B1OA 4RQFA 5IWAB 3F5WC 1SA0A 5IYZB 2IU0A 2JIZG 3A8TA 2EX3A 3BEHA 3H1KH 2OWOA 3CRMA 3A0HZ 1N0NA 2YIBD 5BMVB 5A2QN 5KMGA 2OT5A 4WCEV 3ZHUA 2JK5C 3JD4A 4L87A 3JAMN 4LF5B 4XDLA 3I5DA 2IJHA 3JYCA 1S0VA 1QBZA 1Y4MA 1WA8A 3G4SV 1P4RA 3JSNA 2H94A 4CC5A 1FFTB 5LGUA 3CCQV 5LHGA 1SQFA 2JJ2G 1Q5OA 3E22A 4GUNA 4X66B 1QR9A 3T1HO 3LDDA 4P2ZA 1RSOA 2IU3A 1QQCA 3HKEA 3BY6A 1AI5A 4I9WA 3N2GB 3JASB 2V7QG 4DV2B 4JAVA 4DV6O 4LWSB 5EZYB 1M90W 4IT5A 1QVFU 5H9CA 5IJ9B 1VP7A 4TUYA 2ZIOA 4W4KA 4PDLA 2R70A 1GKFA 2DWDC 1H2LA 3UO3A 2ZINA 4JI6O 4YJ3B 2N04A 4NTYA 1XDCA 4EEQA 2UXCO 3AG1C 1O9GA 4Q6GA 4FM2A 1XMQO 2UUCO 1ZLZA 3TXQA 4RWUA 5JH7A 2YEVA 5KA6A 3H1LH 3G6BA 3ZN0A 4HZ3A 3CC2V 4CC6A 4I0XA 2NN4A 3E83A 4LCUC 4K8XA 1VQ5V 4TT3G 2JGDA 5JCOC 5J2TA 4DR7B 4O4LB 1MSWD 4DV0O 1I5XA 3CRCA 4CH6A 3A2FA 1GTOA 1G1XB 1HR0O 3HKCA 4AI8A 3SYAA 2P90A 1SA0B 5GONA 4FPPA 4B3TB 2GSMB 1YVWA 1B04A 2QKSA 4LFAO 2CUGA 2PF4E 4Z1VA 2A9HA 5KMGB 3JD2A 1AB3A 2A79B 1WN7A 2QWOB 2EILB 4DR2B 2E3CA 3ZJZA 1JCHA 1DLBA 5IJ0B 3SDLA 5LXTB 4I50A 4D7TA 3CMEV 1I94B 3G80A 4X20B 2N05A 1TGOA 1WPBA 1XHZA 3MAQA 2Y69B 3E22B 4LF6B 5IT9N 1VARA 1RFYA 3CS5A 1JJOA 4PA4A 1RSOB 1PL0A 3HKEB 1MG1A 4MVOA 4NVPA 4PHZA 4DUYB 4TSFG 5B1NA 3ABLC 1FJGB 1QCEA 3SYQA 1GRJA 1RM1B 1WP7A 2R9IA 2RQ6A 3CXCU 4UCTA 1V9PA 4TUYB 3ZRXA 2AHZA 1I5YA 2UXBB 3AG4B 1VQKV 2E74B 4YJ2B 2PGGA 1HW7A 4BWAA 1K9MW 2P5OA 1XL4A 2YEVB 1O9HA 1GN4A 4PDRA 1THZA 3STLC 1AILA 4I0XB 4AQYO 1M1KW 4JASA 4GYCB 3FYEB 2JGDB 3N2KA 3PJSK 3L9DA 2Q0OC 4LF9B 1BHBA 3FX7A 2F95B 4JI0O 1KB9F 3TJTA 4DK1A 4ZIBA 4IGGA 1I08A 2YI8A 3E8BA 1I0HA 4NR1A 4J7JA 4IYIA 2DQ0A 1G4YB 5EIBC 4DR3O 3DSQA 5BZBA 3SJAC 3K04A 1PP9H 5KHKA 2OCCB 3JCUZ 3KCXA 4DUZB 4MVZA 4UFZA 4A5UB 5K1XA 2XAQA 1JMKC 5EYPA 1VF7A 3ZCCA 2KG7A 2F4VO 4BW9A 4J7KA 4NXNB 2Z5UA 3CRRA 2EIMB 4FLUA 3CCSV 3CMAV 4WFFA 3QO5A 2QKCA 2RNBA 1XNQB 3X2QB 3CP1A 3K9SA 4DK0A 4ZHQA 3T4DA 3GWKC 1H2KA 4JTCB 1FXKC 4YXWG 1A32A 2GDSA 3IFXA 3R66A 2XOKG 1XILA 4GKKB 3NXSA 1BQZA 1YTFB 2HJDA 2ETNA 4X89A 1DGSA 5KAIZ 3E35A 3JATA 3OAAG 3ZN1A 5E1AC 3F7YC 5IY5B 3E89A 1JOYA 2IBZH 5J9PC 2CK3G 2BCCH 2BOBC 1XL6A 1WPXA 5H5NA 2WA4A 5LGNA 4O2AB 3B8MA 3ZMVA 1GO3F 2WLKA 4MVMA 3ZHTA 4BIUA 4G2KA 4G27B 1CP9A 5JJJB 3CC7V 1OCOB 3SJBC 1EZVH 4DV1O 1E1QG 1D5NA 1M4UA 2Y0PA 1GMGA 2XAFA 3N2KB 3OTOO 1BHAA 2BOCC 2FKXA 3U0ZA 2VQFB 2R9AA 2QM7A 1Z2GA 3L70H 5C93A 4X65B 2F1MA 4D6TH 1NR1A 1Q3EA 4LNUA 1SQVH 4JI1B 3ASNB 3Q4HA 1MOFA 2ZQMA 1NI8A 4UCSA 2ZE6A 2AZ2A 2ZM6B 2FL4A 2Q7GA 4JGSA 1VIBA 3SPGA 1JPXA 4DR4B 4X1IB 1ZL8B 3C3SA 1J5EB 2WLLB 4JI4O 4TWKA 5EYPB 2KG7B 1SC5B 2YC0A 2UXXA 4NTWA 5B1BC 3ASOC 3STZC 3E8FA 4PA6A 4B3MO 4YIOA 1H2GA 4WFHA 1VQPV 4CBCA 5TISZ 4JI7B 4ZHQB 2YI9A 2CH7B 1M56B 3CX5F 5LMNB 4UVBA 4DR1O 3FB5C 4TV8B 3ABUA 3CEIA 1KKCA 4JI3B 3ZMSA 1N34B 4FZ1A 3THOA 4GKJB 1HP8A 1IBLO 2V4DA 1YITV 2ZDIC 3D36C 2AW9A 1U97A 1PM9A 1FPOA 3BVOA 4H0LB 2QA4V 1T5EA 2R72A 2Q67A 2QWQB 3SJCC 4Z2WA 5EK0A 2W0FC 2VWKA 5H2FZ 3ABTA 3ZRWA 1ENVA 5CB4A 1IX9A 3L72H 3L74H 1YI2V 2VQEO 4B7EA 2XNDG 1OCCC 1OCZC 4TV9A 4MS2A 3JALA 1H2MA 2GTAA 2QTOA 1XQ8A 1PKXA 3A0BZ 5LP6C 4K0KB 5CN0A 2YS8A 3SPCA 4Z1MG 1KP2A 2E5LB 1E1RG 4LNUB 4FLTA 4R6ZA 3Q4HB 1AJQA 2XASA 3ABMC 3LNMB 2QJ1A 4P9PA 2QWNB 4LF4B 2F66C 1GM9A 4JYAO 3OR7C 4WF9V 3ZRSA 2JGUA 1P49A 1V55C 3CB2A 2Z3YA 1YXBA 4JI8O 5H6QA 2EIKC 1Y67A 3AG7A 4OPHA 2WLIA 4X8AA 3N2GA 3JASA 1HNZB 1Z5VA 2PI4A 2P6JA 4LF8O 1NH2D 1ROPA 2HJFC 3JAWA 1YSCA 2ZE7A 3DC5A 1SS3A 4FVMA 5CA3A 5BR8B 1BMFG 3AG2C 3APQA 1GN2A 4OX9O 3WG7B 4GT1A 3SGIA 2X0LA 4DR5B 3CCJV 1IBKB 3P30A 3QF7A 2F23A 4WFAV 2XT9A 5BXZA 3N27A 3UKMA 4J9YB 1YJ9V 2IW5A 4QIWF 4J42A 1W0KG 3L71H 3J7AU 2ZT9B 2ITCC 4F4LA 4LC1A 3MDSA 2HVJC 3OTFA 3W7TA 2QSAA 3K5NA 1XNRO 3GB7C 3ZRWB 5CB4B 5KX5A 1Q7YW 4YHHO 2K9PA 3VQXA 5FNVA 4UV8A 3JSLA 3UT5A 3OMNB 4TV9B 3JALB 1M57C 5B3SB 3BABA 1DK1A 4LH6A 2W0XA 1IBMO 1SERA 1NU1H 3HKDB 1FXHA 4UUJC 3UO2A 3CCEV 2PTMA 5IJ0A 5EC2C 4WFBV 5LXTA 5DECA 3TCUA 3KCYA 1HNXB 4X20A 1HWYA 2PYLA 5ITZA 4QNHB 2B1IA 4LFBB 4J9ZB 1FXVA 2DE0X 2H3OA 5DN6G 2EZPA 2UUAO 2WLIB 2IJKA 3B8NA 3KKYA 3IC9A 3IJ4A 5JVDA 1SESA 2CTWA 3F7VC 4U3FH 4DV7B 3JAWB 2UUBB 2BE3A 1NS1A 2EZOA 1HNWB 3K3WA 3J81N 3OD4A 3QG5A 3ZEDA 4GLXA 1U96A 3C90A 1CPYA 4GCZA 1YF2A 2GBOA 3CPWU 3VQWA 4YJ2A 4JZGA 3HB3B 1N4CA 1YJWV 2FYUH 4U7NA 1RPRA 5KHHA 4CZZA 1DTOA 5EIBD 3H1HH 4MVUA 4Q20A 1GK9A 1UJWB 3P3PA 4X62O 2GTSA 3ETDA 3FB7C 4JV5O 5CMUA 2GV9A 4LH7A 4UCUA 2Q7HA 5KX5B 1S3JA 1BQ0A 4ZI7A 4UB6Z 3FD9A 3OTOB 3OR6C 5FNVB 2ZE8A 4YY3O 3UT5B 5L3EA 1XMOB 3LSUA 4J10A 1N32O 4I9QA 4ASUG 3D3QA 4I5SA 2X6BA 3K79A 4DR6B 2M6YA 2DYRB 5B5EZ 2DYSB 4B3RO 2ATKC 1PNMA 3ABKB 3T2MA 4LFCB 1OCRB 2EULA 2YICA 2DQ3A 1OJHA 4DV5O 1F51A 2MW2B 2ARHA 4X64O 1VF6A 4MW3A 5JCOA 5ITZB 1D5AA 4X1KA 1KD1W 3RYHA 4XDKA 2K1EA 4PA9A 2HHHB 2YXLA 1WNSA 5DEDA 2LW7A 4B3SB 2P22C 1NR7A 4RQEA 4LF7O 4RO2A 3CCMV 4JAUA 5JVDB 2UXDB 1AR1B 5F2VO 3ZMTA 3VBBA 1VEWA 5GTHZ 1P7BA 2KSDA 4EFEA 3ETQA 3RVZA 2HLDG 2QR4A 4QE9A 4O2AA 3RGBA 2X6AA 4U3JA 1K4CC 1H38A 5L3GA 1Q8IA 3ZX6A 1NVPD 2JEXA 3U11A 4FLVA 2OTJV 1JFFB 4DV3B 1CXZB 2O57A 4ICGA 3SR2C 3QNEA 2B9ZA 3JD1A 4QE7A 2YIBA 3CCUV 5EBLC 4JI2O 2UU9O 4TQFA 2B5UA 2WLNA 3HPLC 2Q0AA 3W7WA 3AG3C 2QKAA 2Y4UA 3CD6V 4GX1A 4KHPB 4ZI7B 1QNMA 1AROP 2HP8A 2Q73A 5B1AC 1JR9A 2RCVA 5IWAO 1Q86W 4DW1A 1IZ3A 3BA9A 3AG1B 4JF3A 4H33A 2AZ0A 4X1IA 4DV4B 1L0LH 1GM7A 1ZL8A 2JJ1G 3RN4A 3CCRV 2WLLA 3M8AA 2C2AA 1Y6XA 2KKWA 3B40A 4ZBMA 2WLMA 2LGWA 2EINC 3A0RA 4PI0A 3T1YB 2Q6AA 4LP8A 1NH2B 3LSSA 4ZOLA 4EFBA 5LA6B 2R9RB 4LF5O 3UQ8A 4O4JA 3T4ZA 3JARB 2HG5C 4X1KB 1N36B 4MTXA 2CH7A 3RYHB 1Q90D 4EKWA 1QLEC 4TV8A 3SPJA 1Q6HA 1Q6UA 2P06A 4GZRB 4NTXA 1V54C 3GWOA 1NTZH 5HFLA 1SRYA 2BTOA 3OGCC 1MZFA 4D7SA 4QGPA 4MVQA 4X66O 2ZKOA 2DOSA 1TAEA 3SPHA 3TXSA 5GTIZ 3UM7A 5H6RA 5B66Z 5LMUB 1H2SB 2CGOA 4KL1A 2RDCA 4DV2O 3RWRD 1SQGA 4LR3A 5LHIA 2H8PC 2LQTA 2WAMA 3BA8A 4OGQB 3RFRA 4B7KA 4U3JB 4PA3A 5JQGA 4NXMB 1AR5A 2EIJC 2L35A 1E79G 1NBMG 1F4MA 4JI5B 1NJIW 3HKBB 3K58A 2PY5A 1N33B 5FL7G 4MTGA 1AI6A 3CE2A 1FXKA 2HVKC 1F7YA 3DTUB 4JPRA 4OPAA 3M7MX 2ZXWC 5J2UA 1K5SA 2Q69A 5KHIA 3O9OA 1AR4A 1YHQV 2DN9A 2CDYA 3ABLB 3RYFB 2Q9LA 3OGIB 2DW4A 4DR7O 1PNKA 3OE7G 1UFIA 2L6LA 3FB6C 1IURA 2ZE5A 4MVSA 2A7WA 3ZBHA 5A9GA 1FYJA 4FM0A 3G71V 1X59A 1EN5A 3BFRA 4B3TO 3W7XA 4C7UA 2IH3C 3U10A 2A3QA 4PDMA 2QE7G 1MABG 1US6A 4FLXA 4KXRA 3FYIB 5BY1A 5LHHA 4DR2O 4ZOLB 1NT2B 2Y0IA 2ZR2A 3D8CA 3T1HB 4O4JB 3LDCA 4NB5A 4JYCA 3E2EA 1I94O 2WLJA 3IGAC 3HR0A 2JDIG 4AHCA 4DV6B 1VQLV 2JEUA 3RYCB 4P30A 4LF6O 2B1GA 1NTKH 1SQXH 4N21A 4UV9A 2ADPA 2PYJA 1FFXA 4RUEA 1K97A 2ITDC 2E75B 4JI6B 1P84F 2UXCB 5LBQA 3I55V 4DUYO 3LUTB
chains in the Genus database with same CATH topology
2P67A 1Q7YW 4XDJA 4RUFA 2A9HA 3SJQC 3CC4V 1JQ0A 3JD2A 2WPDG 5L3CA 3JD0A 3I56V 2A79B 4UV8A 4PELA 5IYBO 2EILB 3CCLV 3OMNB 3ZJZA 1JCHA 1S77D 1DLBA 1M57C 1ZWIC 5B3SB 3G6EV 3DGEA 4ZKIA 3CMEV 5IDJA 2MK3A 1YJNV 2V1DA 1SERA 4QPKA 2Q68A 1FXHA 4UUJC 2X7RB 4BW5A 1OZ0A 2YSUB 1FXKB 5L3BA 3CCEV 4QPJA 5EC2C 2Y69B 4WFBV 2KB1A 2AHYA 1JVMA 3MHHC 3OMAB 4PA4A 3OM3B 2IJJA 3TCUA 1PL0A 4QJFB 2ZDIA 1MG1A 1NKDA 1HWYA 4MT8A 3D36A 1TUEB 4MVOA 1J95A 1F4NA 4TSFG 5B1NA 3ABLC 4QNHB 2B1IA 1QCEA 2XAHA 4J9ZB 4WFEA 3SYQA 1FXVA 1RM1B 2R9IA 1VQ6V 5KUMA 5DN6G 3CXCU 1B6QA 3OMIB 4PDVA 2EZPA 3QO8A 3ZRXA 2AHZA 1I5YA 3SPIA 2WLIB 2IJKA 3B8NA 2GHYA 1SESA 3AG4B 4BIZA 1VQKV 3F7VC 2DWEC 1VQOV 1FS0G 4HAMA 2X6CA 5CBHA 1K9MW 2EZOA 3ZMUA 1XL4A 2YEVB 3K9AA 3K3WA 3LDEA 4X88A 4PDRA 1THZA 3STLC 1CPYA 3OEEG 4GCZA 3WG7C 3CPWU 1M1KW 3HB3B 3JD3A 4JASA 1YJWV 1QLNA 4U7NA 5L3FA 1RPRA 4KUMA 1VQMV 3FYEB 5DM6V 3OFNG 1IXMA 4JYBA 4CZZA 1DTOA 3PJSK 1AI4A 1BHBA 4MVUA 1GM8A 4MSWC 4Q20A 5KA5A 4H37A 3RBZA 1AI7A 1GK9A 1UJWB 4GX2A 3E8BA 1Q81W 1JX9A 3ETDA 3FB7C 2DQ0A 5CMUA 1G4YB 1K73W 3AG3B 5BZBA 3R65A 1Y66A 3K04A 4R50A 5L3DA 3K08A 1VQ7V 1S3JA 3OEHG 2OCCB 4KFMA 4MVZA 4MVRA 3OR6C 5B1AB 4MW8A 5IYDO 2XAQA 2ZD9A 1R3JC 5L3EA 4E2LA 1Q82W 5B1BB 3ASOB 3ZCCA 3K0GA 3EHBB 2EILC 3E8HA 3W7UA 2W6IG 2Z5UA 4ASUG 2EIMB 4I5SA 3ZIAG 5B3SC 3CCSV 2X6BA 3CMAV 3AEIA 3K79A 1DF5A 3VOUA 4WFFA 3K03A 3QO5A 3FB8C 2DYRB 4JTDB 3X2QB 4UVCA 2DYSB 3CP1A 5HFMA 1AJPA 2EINB 3T4DA 2ATKC 1PNMA 3ABKB 1FXKC 4JTCB 1VQ9V 3T2MA 4YXWG 1OCRB 1SZTA 1BL8A 3IFXA 2Y69C 3TETA 2XOKG 4JTAB 2DQ3A 2HFEC 4BAYA 1H8EG 3NXSA 1F51A 4GX0A 4MW3A 1YTFB 1KKDA 2WLHA 1QLEB 4X89A 1JJ2U 3M99B 1KD1W 1QR8A 3E35A 4MTOA 4N23A 3OAAG 1V54B 3ZN1A 5CBGA 4XDKA 2K1EA 4PA9A 4R7CA 5E1AC 3F7YC 1DF4A 5IY5B 3E89A 4UVAA 1JOYA 1RM1C 1NR7A 2FTKA 4RQEA 1EFRG 4RO2A 5J9PC 3CCMV 4JAUA 2CK3G 2BOBC 1QVGU 1XL6A 1WPXA 3WFVA 3RVYA 5LGNA 1AR1B 3B8MA 3ZMVA 1GO3F 2WLKA 2LP7A 4MVMA 3AG4C 1L1FA 3SYCA 4BIUA 3ZMTA 4G2KA 3VBBA 4G27B 2WWWA 1CP9A 1P7BA 1VQNV 1LNQA 1OCCB 3K0DA 1OCZB 4FK5C 3RVZA 2HLDG 3CC7V 1S72V 1AJNA 2EIJB 4QE9A 1OCOB 3SYPA 2W6JG 2X6AA 1E1QG 1K4CC 4MTFA 1G8MA 3ETGA 1S76D 1GMGA 2XAFA 1H38A 5L3GA 1OHHG 3ZMZA 1W0JG 1NVPD 2NLJC 2JEXA 4G28B 1BHAA 2OTJV 2BOCC 2D3OW 2QM7A 5CBFA 5C93A 3QNEA 2ZXWB 1RPOA 3JD1A 3MD0A 4QE7A 1NR1A 2IH1C 3KG2A 3ABMB 3CCUV 3LSQA 5EBLC 3ASNB 3E8GA 1F23A 1MOFA 2Y48A 2ZQMA 2XAJA 3P32A 2B5UA 2WLNA 3HPLC 3W7WA 1V55B 3AG3C 4WFGA 3CD6V 4JGSA 4GX1A 2PI5A 5GW7A 2EBOA 2HR3A 3SPGA 1JPXA 1R3KC 2EIKB 1AROP 1CEZA 1NVPB 2OCCC 2WLLB 3TK1A 4TWKA 1K3EA 5B1AC 3QO7A 4PA7A 2UXXA 1Q86W 1K8AW 4RAIA 5B1BC 3ASOC 3STZC 3E8FA 4PA6A 3H01A 4JF3A 3AG1B 4H33A 1H2GA 4WFHA 3OW2U 1VQPV 4CBCA 1GM7A 4FJCC 4XBFA 1H8HG 2EIMC 2JJ1G 3CCRV 2WLLA 4DXWA 3AG2B 2C2AA 1M56B 4UVBA 4ZBMA 2DYRC 1S5HC 3FB5C 3X2QC 2WLMA 2DYSC 1YTFD 3OUFA 3ABUA 2EINC 1VQ8V 1KP3A 2UXNA 1K34A 2IJIA 3A0RA 3ZMSA 1R3LC 2Q6AA 1PNLA 2WSSG 3ABKC 4LP8A 3T1CA 1NH2B 3LSSA 1SETA 1OCRC 4UXNA 2R9RB 1K92A 3B77A 3T4ZA 1YITV 2LFSA 2HG5C 2ZDIC 1K33A 3E86A 4DO2A 4MTXA 2QM8A 1R6NA 3FKSG 4EKWA 1QLEC 4R8CA 3SPJA 5B1OA 4RQFA 1V54C 3GWOA 2QA4V 5HFLA 1SRYA 4FMTA 3OGCC 5IY5C 2Q67A 4MVQA 3F5WC 2IU0A 2JIZG 5EC1C 5EK0A 3SPHA 2W0FC 3ABTA 3UM7A 5H6RA 3IC7A 3BEHA 3EFFK 3ZRWA 3JCZA 1ENVA 5EBMC 3CYOA 1YI2V 1KQSU 1R6KA 2OT5A 5LHIA 2H8PC 2XNDG 1OCCC 1R73A 4WCEV 1OCZC 2JK5C 3JD4A 1M57B 4L87A 2WAMA 4PA3A 3D3IA 4MS2A 2EIJC 1E79G 1OCOC 3ML0A 4XDLA 1NBMG 2QTOA 2XAGA 1F4MA 1PKXA 2IJHA 3JYCA 3SYOA 1NJIW 1S0VA 1QBZA 2F43G 1Y4MA 2QEXV 4U7OA 3G4SV 1EZJA 1P4RA 5CN0A 5FL7G 2H94A 3SPCA 4MTGA 1AI6A 1FFTB 1K4DC 5LGUA 3CCQV 1YIJV 1FXKA 4Z1MG 2HVKC 1KP2A 5LHGA 2JJ2G 1N8RW 4LBEC 1E1RG 3DTUB 4JPRA 2ZXWC 4R6ZA 1AJQA 2XASA 1K5SA 2Q69A 3ABMC 1QR9A 3LDDA 3LNMB 4P2ZA 2IU3A 3ETEA 4P9PA 1YHQV 1K5QA 3OUSA 1GM9A 2LFRA 3ABLB 3ASNC 3OR7C 4WF9V 2P7TC 4GX5A 3ZRSA 3BY6A 1AI5A 2DW4A 1WLEA 4I9WA 3RW0A 2OTLV 1PNKA 1V55C 2V7QG 3OE7G 2A0LA 3FB6C 4JAVA 2HKOA 4MVSA 1W2BU 3MHSC 2Z3YA 1R3IC 5H6QA 2EIKC 1M90W 5KUKA 1QVFU 5H9CA 1VQ4V 1M9NA 1KC8W 5LGTA 4PDLA 1GKFA 2DWDC 1K7DA 3G71V 2WLIA 4X8AA 3W7XA 2IH3C 3CCVV 2PI4A 2P6JA 3AG1C 1NH2D 1ROPA 2HJFC 1PD3A 1YSCA 4KP4A 2QE7G 4PDMA 1MABG 3W7SA 5CA3A 1BMFG 3AG2C 4HYOA 1M56C 2YEVA 5KA6A 3FYIB 3WG7B 5LHHA 4OXSA 1COWG 4GT1A 3ZN0A 4HZ3A 3CC2V 2X0LA 2ZR2A 2EJRA 3LDCA 3E83A 4JYCA 4LCUC 3CCJV 3E2EA 1EBOA 2WLJA 3P30A 1VQ5V 3IGAC 4TT3G 4WFAV 2JDIG 1MSWD 1I5XA 4FIPC 3UKMA 4J9YB 5IYCO 1VQLV 1YJ9V 2JEUA 2IW5A 1KECA 1GTOA 3K06A 4QIWF 4P30A 1W0KG 1ORQC 2B1GA 3ZRVA 4P9OA 4UV9A 4N21A 3SYAA 2P90A 2ITCC 4FPPA 4RUEA 1K97A 2ITDC 4LC1A 4F4LA 2HVJC 2GSMB 2M7WA 1NQTA 3W7TA 5EBWC 5LBQA 2QKSA 3GB7C 3ZRWB 3I55V 3LUTB 2NNUA 2ZR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 W;  1Q7Y W;  4WFA V;  3CXC U;  3CCE V;  1YHQ V;  2OTJ V;  3CCV V;  1VQ8 V;  3CC4 V;  4WF9 V;  3CPW U;  3CCS V;  2D3O W;  3CMA V;  1K73 W;  4WFB V;  1M1K W;  1KD1 W;  1VQL V;  1JJ2 U;  1YJ9 V;  3I56 V;  1NJI W;  2OTL V;  1VQN V;  1YJW V;  1VQ7 V;  2QEX V;  3CCL V;  1VQM V;  1Q86 W;  1K8A W;  3CCU V;  5DM6 V;  3G4S V;  3CC7 V;  1VQK V;  1VQO V;  1YIT V;  1S72 V;  1W2B U;  1M90 W;  1QVF U;  3G6E V;  3OW2 U;  1VQP V;  1VQ4 V;  3CCM V;  3CCQ V;  3CME V;  1YIJ V;  1VQ9 V;  3CC2 V;  1KC8 W;  1Q82 W;  1YI2 V;  1QVG U;  1K9M W;  3CCR V;  1KQS U;  1YJN V;  1N8R W;  3CD6 V;  3G71 V;  3CCJ V;  1R73 A;  4WCE V;  3I55 V;  2QA4 V;  1VQ6 V;  1VQ5 V; 
#chains in the Genus database with same CATH topology
 1FJG O;  4RUF A;  1XMQ B;  2UUC B;  4DRX B;  3CC4 V;  2WPD G;  1NTM H;  1FD9 A;  3JD0 A;  2CTR A;  5IYB O;  5JQG B;  1S77 D;  4H44 B;  1TVK A;  3G6E V;  2UXB O;  2CTQ A;  3DGE A;  4B08 A;  4ZKI A;  1MZE A;  5IDJ A;  2A06 H;  3ICX A;  3H1I H;  4QPK A;  2Q68 A;  1GAX A;  4DV0 B;  4BW5 A;  1OZ0 A;  2YSU B;  1FXK B;  2ADQ B;  1HR0 B;  1OV9 A;  1PPJ H;  3B4S A;  5J2U B;  2QDO A;  3MHH C;  1N0J A;  3G67 A;  2ZDI A;  4AIL C;  1NKD A;  1TA8 A;  3HKD A;  4MT8 A;  3D36 A;  3EVK A;  1F4N A;  4LFA B;  3BCC H;  4LF9 O;  1BGY H;  4WFE A;  1VQ6 V;  2QGN A;  3OMI B;  2AGA A;  4PDV A;  3WB2 A;  3RYI A;  3P3N A;  2LGQ A;  2P4K A;  2GHY A;  2QM4 A;  2DWE C;  1UPG A;  2X6C A;  5CBH A;  3ZHV A;  4IYH A;  4DUZ O;  3ZMU A;  1MMM A;  4O4I A;  5LOV B;  2RMK B;  3LDE A;  4X88 A;  3H9V A;  4TOI A;  2ZIM A;  3OEE G;  1AP6 A;  2E76 B;  3K59 A;  1PV0 A;  3QVN A;  4NXN O;  4FFB A;  3BHP A;  1QLN A;  5LP6 A;  5L3F A;  5LYJ B;  5DM6 V;  4JYB A;  1XNQ O;  1AI4 A;  4DW0 A;  1KUQ A;  4H37 A;  3RBZ A;  1BCC H;  4GX2 A;  2RN9 A;  1FFX B;  1JX9 A;  4JAA A;  4F6R A;  1YZB A;  3AK2 A;  4GKK O;  1K73 W;  1XI1 A;  5L3D A;  5KHG A;  5JJE B;  4F6E A;  4I55 B;  4MW8 A;  5IYD O;  1R3J C;  3L75 H;  4WBN A;  5B1B B;  3ASO B;  4AQY B;  1TVK B;  3K0G A;  2EIL C;  3BAA A;  3CSX A;  3ZIA G;  3VQY A;  2BTQ B;  3K03 A;  2QTS A;  4J7Z A;  4JI0 B;  4O4H B;  5HFM A;  1AJP A;  3K5M A;  1P7G A;  5JJN B;  5KLV H;  2OIG A;  2Q4P A;  2Y69 C;  3TET A;  4CH4 A;  1HDJ A;  2HFE C;  4BAY A;  1H8E G;  4BIO A;  4DR3 B;  4GX0 A;  3J80 N;  1XUQ A;  4I7Z B;  2HEP A;  3B2E E;  1GH6 A;  5FPO A;  4MTO A;  4YIP A;  5CBG A;  3C3T A;  5JWP A;  2VQF O;  1SQQ H;  3ZHQ A;  1DF4 A;  3H1J H;  4O2B A;  4PI2 A;  4I4T B;  4UVA A;  4X65 O;  1RM1 C;  3RYI B;  3L73 H;  1EN6 A;  1QU7 A;  2F4V B;  4IL6 Z;  4JI1 O;  3WFV A;  3RVY A;  4L8J A;  1LUV A;  3AG4 C;  1L1F A;  2YXY A;  3SYC A;  1SQP H;  2VRZ A;  2ZM6 O;  2YDE A;  4O4I B;  4DR4 O;  4E4E A;  1VQN V;  3JAK A;  1LNQ A;  1J5E O;  1XEQ A;  1SQB H;  1OCC B;  1OCZ B;  1AP5 A;  4FK5 C;  1S72 V;  3EXA A;  1AJN A;  1Z5W A;  3SYP A;  4FFB B;  5LP6 B;  2CGN A;  3ETG A;  1S76 D;  2RJZ A;  1GN6 A;  3ZMZ A;  1W0J G;  4G28 B;  2P4V A;  4JI7 O;  4PD4 F;  1BS3 A;  5LMN O;  2F93 B;  2D3O W;  5CBF A;  1FAF A;  5CA1 A;  1RPO A;  2XHB A;  3MD0 A;  2IH1 C;  1KBH A;  3KG2 A;  3ABM B;  4JI3 O;  4F6R B;  1N34 O;  1Y76 A;  4K35 A;  4GKJ O;  3E8G A;  1F23 A;  2Y48 A;  2XAJ A;  1L8D A;  1JFF A;  1V55 B;  2PI5 A;  5GW7 A;  2EBO A;  2EIK B;  1R6T A;  5C8Y A;  1CEZ A;  1BZK A;  2OCC C;  3TK1 A;  1K3E A;  4J80 A;  4WBN B;  1G6U A;  4JYY A;  4DV1 B;  1K8A W;  4RAI A;  5IE9 A;  3H01 A;  2PZS A;  1FKA O;  4FJC C;  2EIM C;  4UCR A;  3AG2 B;  1MNG A;  3CRA A;  2ZNI A;  1VF6 C;  1S5H C;  1B06 A;  3X2Q C;  4FLY A;  1WB8 A;  4K8Z A;  3OUF A;  1VQ8 V;  1KP3 A;  2UXN A;  4UCV A;  1K34 A;  2IJI A;  1R3L C;  2WSS G;  4UXN A;  3DXR A;  4FM1 A;  3B77 A;  1ZSP A;  2EJ7 A;  2LFS A;  1K33 A;  3E86 A;  4DO2 A;  2JVD A;  2QM8 A;  4K0K O;  1EM1 A;  4R8C A;  4O2B B;  4JI4 B;  1YEW A;  1XRE A;  4FMT A;  5IY5 C;  2E5L O;  5LA6 A;  4W4L A;  1XBL A;  4IHJ A;  4CH3 A;  3JAR A;  3S3X A;  2CE4 A;  5EC1 C;  4B3M B;  4LF4 O;  1S5L Z;  3IC7 A;  3EFF K;  3JCZ A;  3JAK B;  5EBM C;  1WA8 B;  4DR1 B;  3CYO A;  1KQS U;  1R6K A;  1PL4 A;  2VWJ A;  1R73 A;  1QHT A;  1M57 B;  4FZ0 A;  3QTC A;  1B3Q A;  3D3I A;  1IBL B;  2Z0A A;  2Q5Z A;  1OCO C;  3ML0 A;  2Q8V A;  3DC6 A;  2XAG A;  1HNZ O;  3SYO A;  1BE3 H;  2G38 A;  2F43 G;  2QEX V;  4U7O A;  1EZJ A;  5CA1 B;  1K4D C;  5BR8 O;  1YIJ V;  3BPZ A;  4TQD A;  1N8R W;  4LBE C;  2JS5 A;  1Y76 B;  4HBN A;  2ILM A;  4DR5 O;  3ETE A;  3RT3 C;  1K5Q A;  3HKB A;  3OUS A;  1M93 A;  2LFR A;  3ASN C;  1IBK O;  2P7T C;  4GX5 A;  3RW0 A;  2OTL V;  1WLE A;  3OT7 A;  3K5O A;  5C8Y B;  2A0L A;  2YIA A;  2HKO A;  1W2B U;  3MHS C;  1R3I C;  5KUK A;  1R1B A;  2VQE B;  1VQ4 V;  1M9N A;  3B09 A;  4BR6 A;  4JZ2 A;  1KC8 W;  1XHX A;  3LNN A;  5JH7 B;  5LGT A;  1K7D A;  3RYF A;  3CCV V;  1PD3 A;  4KP4 A;  3W7S A;  1H2N A;  5J2T B;  4HYO A;  3BRC A;  3CJH A;  1M56 C;  1IXB A;  4OXS A;  1COW G;  5D5Q A;  3DXR B;  1BT8 A;  4HNA A;  1KMI Z;  3HKC B;  2BSK A;  4X1Y A;  2EJR A;  4JYA B;  3APO A;  1EBO A;  5GON B;  3ZHS A;  3CHX A;  4FIP C;  5IYC O;  1JA8 A;  4JI8 B;  1KEC A;  3K06 A;  3IAY A;  3AK1 A;  1ORQ C;  4EB6 A;  3ZRV A;  4IHJ B;  4P9O A;  2DMX A;  1S5J A;  2KQX A;  3FFQ A;  2M7W A;  1HNX O;  1NQT A;  3WB1 A;  2WA3 A;  5EBW C;  4LF8 B;  4I50 B;  2NNU A;  2ZR3 A;  2P67 A;  3ZHR A;  4XDJ A;  1BSM A;  3RYC A;  5K1P A;  4LFB O;  2NR5 A;  4H13 B;  3SJQ C;  1JQ0 A;  1L0N H;  2GUZ A;  5L3C A;  1RP3 B;  2VS0 A;  3I56 V;  4OX9 B;  4PEL A;  3CCL V;  4DYL A;  5KAF Z;  2YUA A;  1ZWI C;  3WU2 Z;  5LL6 Y;  1NZ6 A;  2MK3 A;  1YJN V;  3WB0 A;  4DRX A;  2V1D A;  4DV7 O;  2UUB O;  1WJZ A;  2X7R B;  1HNW O;  5L3B A;  4QPJ A;  4UCO A;  2KB1 A;  2AHY A;  1JVM A;  3F5T A;  1KU9 A;  3OMA B;  3OM3 B;  2IJJ A;  1GN3 A;  1ZX3 A;  4ABM A;  4QJF B;  1XNR B;  1TUE B;  1J95 A;  1Q43 A;  3PN1 A;  5AG2 A;  4YHH B;  2OIE A;  2XAH A;  5KUM A;  4IIJ A;  2IM9 A;  1B6Q A;  1EN4 A;  3QO8 A;  3FAV A;  2ODM A;  3SPI A;  2OCH A;  2D2C B;  1MA1 A;  4X9Q A;  4BIZ A;  1VQO V;  1FS0 G;  4HAM A;  1IBM B;  2CTP A;  5FPR A;  3CJH B;  1X4T A;  3K9A A;  1XMO O;  3TGU H;  3GVM A;  4HNA B;  3WG7 C;  4FLZ A;  2AXT Z;  2BSK B;  1I7F A;  2OYQ A;  4X1Y B;  3JD3 A;  4KUM A;  1VQM V;  3NR7 A;  3OFN G;  1IXM A;  5E79 Z;  1SF9 A;  4DR6 O;  1ZUQ A;  4J41 A;  5LOV A;  1GM8 A;  1Q6I A;  4MSW C;  4CH5 A;  5KA5 A;  3CWB H;  1IDS A;  4PV1 B;  1AI7 A;  5D5P A;  4EB6 B;  1TUB A;  1WAZ A;  4CS4 A;  4LFC O;  2DJV A;  4CS2 A;  2UUA B;  1Q81 W;  5LYJ A;  1D2D A;  3AG3 B;  3R65 A;  1Y66 A;  3UCS C;  4R50 A;  3K08 A;  1VQ7 V;  4PJ0 Z;  2FML A;  3OEH G;  1W59 A;  4KFM A;  4MVR A;  2GUZ B;  2LW1 A;  5B1A B;  2XUM A;  2HHH O;  2ZD9 A;  3KZI Z;  4B3S O;  1Q82 W;  4E2L A;  3W7U A;  3EHB B;  3E8H A;  1AVM A;  3CXH F;  5CA0 A;  2W6I G;  2UXD O;  4I55 A;  1Y74 A;  5B3S C;  3AEI A;  1DF5 A;  3VOU A;  2ZCE A;  2Q7E A;  3FB8 C;  4JTD B;  4UVC A;  2JS3 A;  4UB8 Z;  5FLX N;  2EIN B;  1YDX A;  3JAT B;  1VQ9 V;  4X62 B;  1SZT A;  1BL8 A;  3AK3 A;  1WB7 A;  2N74 A;  4JTA B;  4JV5 B;  2BTQ A;  2Y4T A;  2XTA A;  1KKD A;  2WLH A;  1QLE B;  4O4H A;  1JJ2 U;  3M99 B;  4CS3 A;  2PUS A;  1QR8 A;  1ZTE A;  2QWP B;  2ZNJ A;  4N23 A;  1V54 B;  4DV3 O;  4FFK A;  4R7C A;  4IIJ B;  4YY3 B;  3FAV B;  2FTK A;  1EFR G;  4FLW A;  1QVG U;  1N32 B;  5IYZ A;  1LR1 A;  1YCI A;  2LP7 A;  1SKV A;  1IVS A;  2WWW A;  4KHP O;  4I4T A;  2YID A;  4B3R B;  1VMG A;  3K0D A;  5BMV A;  3O65 A;  2EIJ B;  2W6J G;  2CAZ C;  4DV5 B;  4MTF A;  1G8M A;  2YXH A;  4X64 B;  1OHH G;  2FB5 A;  4DV4 O;  2NLJ C;  2JRI A;  2QWR B;  2LJ2 A;  4NYK A;  5KHJ A;  3K57 A;  1TUB B;  2ZXW B;  4J11 A;  1SZX A;  4LF7 B;  1URF A;  3VQV A;  4NKG B;  3LSQ A;  3T1Y O;  1WP8 A;  1VF5 B;  3P32 A;  3K5L A;  1N36 O;  4WFG A;  2HR3 A;  1R3K C;  1NVP B;  1XOU A;  4LWS A;  5EZY A;  1M5I A;  4K3A A;  3QO7 A;  4PA7 A;  5IJ9 A;  5CA0 B;  1ZAU A;  1Y74 B;  3S3W A;  3OW2 U;  3ZS8 C;  4YJ3 A;  2LO1 A;  3CRQ A;  4XBF A;  5LMU O;  1H8H G;  4DXW A;  2DYR C;  1YTF D;  2DYS C;  1LUW A;  1PNL A;  3ABK C;  3T1C A;  4JI2 B;  1SET A;  1OCR C;  4NXM O;  1MSD A;  1K92 A;  1KYO F;  2UU9 B;  4JI5 O;  1R6N A;  3FKS G;  4O4L A;  1N33 O;  5B1O A;  4RQF A;  5IWA B;  3F5W C;  1SA0 A;  5IYZ B;  2IU0 A;  2JIZ G;  3A8T A;  2EX3 A;  3BEH A;  3H1K H;  2OWO A;  3CRM A;  3A0H Z;  1N0N A;  2YIB D;  5BMV B;  5A2Q N;  5KMG A;  2OT5 A;  4WCE V;  3ZHU A;  2JK5 C;  3JD4 A;  4L87 A;  3JAM N;  4LF5 B;  4XDL A;  3I5D A;  2IJH A;  3JYC A;  1S0V A;  1QBZ A;  1Y4M A;  1WA8 A;  3G4S V;  1P4R A;  3JSN A;  2H94 A;  4CC5 A;  1FFT B;  5LGU A;  3CCQ V;  5LHG A;  1SQF A;  2JJ2 G;  1Q5O A;  3E22 A;  4GUN A;  4X66 B;  1QR9 A;  3T1H O;  3LDD A;  4P2Z A;  1RSO A;  2IU3 A;  1QQC A;  3HKE A;  3BY6 A;  1AI5 A;  4I9W A;  3N2G B;  3JAS B;  2V7Q G;  4DV2 B;  4JAV A;  4DV6 O;  4LWS B;  5EZY B;  1M90 W;  4IT5 A;  1QVF U;  5H9C A;  5IJ9 B;  1VP7 A;  4TUY A;  2ZIO A;  4W4K A;  4PDL A;  2R70 A;  1GKF A;  2DWD C;  1H2L A;  3UO3 A;  2ZIN A;  4JI6 O;  4YJ3 B;  2N04 A;  4NTY A;  1XDC A;  4EEQ A;  2UXC O;  3AG1 C;  1O9G A;  4Q6G A;  4FM2 A;  1XMQ O;  2UUC O;  1ZLZ A;  3TXQ A;  4RWU A;  5JH7 A;  2YEV A;  5KA6 A;  3H1L H;  3G6B A;  3ZN0 A;  4HZ3 A;  3CC2 V;  4CC6 A;  4I0X A;  2NN4 A;  3E83 A;  4LCU C;  4K8X A;  1VQ5 V;  4TT3 G;  2JGD A;  5JCO C;  5J2T A;  4DR7 B;  4O4L B;  1MSW D;  4DV0 O;  1I5X A;  3CRC A;  4CH6 A;  3A2F A;  1GTO A;  1G1X B;  1HR0 O;  3HKC A;  4AI8 A;  3SYA A;  2P90 A;  1SA0 B;  5GON A;  4FPP A;  4B3T B;  2GSM B;  1YVW A;  1B04 A;  2QKS A;  4LFA O;  2CUG A;  2PF4 E;  4Z1V A;  2A9H A;  5KMG B;  3JD2 A;  1AB3 A;  2A79 B;  1WN7 A;  2QWO B;  2EIL B;  4DR2 B;  2E3C A;  3ZJZ A;  1JCH A;  1DLB A;  5IJ0 B;  3SDL A;  5LXT B;  4I50 A;  4D7T A;  3CME V;  1I94 B;  3G80 A;  4X20 B;  2N05 A;  1TGO A;  1WPB A;  1XHZ A;  3MAQ A;  2Y69 B;  3E22 B;  4LF6 B;  5IT9 N;  1VAR A;  1RFY A;  3CS5 A;  1JJO A;  4PA4 A;  1RSO B;  1PL0 A;  3HKE B;  1MG1 A;  4MVO A;  4NVP A;  4PHZ A;  4DUY B;  4TSF G;  5B1N A;  3ABL C;  1FJG B;  1QCE A;  3SYQ A;  1GRJ A;  1RM1 B;  1WP7 A;  2R9I A;  2RQ6 A;  3CXC U;  4UCT A;  1V9P A;  4TUY B;  3ZRX A;  2AHZ A;  1I5Y A;  2UXB B;  3AG4 B;  1VQK V;  2E74 B;  4YJ2 B;  2PGG A;  1HW7 A;  4BWA A;  1K9M W;  2P5O A;  1XL4 A;  2YEV B;  1O9H A;  1GN4 A;  4PDR A;  1THZ A;  3STL C;  1AIL A;  4I0X B;  4AQY O;  1M1K W;  4JAS A;  4GYC B;  3FYE B;  2JGD B;  3N2K A;  3PJS K;  3L9D A;  2Q0O C;  4LF9 B;  1BHB A;  3FX7 A;  2F95 B;  4JI0 O;  1KB9 F;  3TJT A;  4DK1 A;  4ZIB A;  4IGG A;  1I08 A;  2YI8 A;  3E8B A;  1I0H A;  4NR1 A;  4J7J A;  4IYI A;  2DQ0 A;  1G4Y B;  5EIB C;  4DR3 O;  3DSQ A;  5BZB A;  3SJA C;  3K04 A;  1PP9 H;  5KHK A;  2OCC B;  3JCU Z;  3KCX A;  4DUZ B;  4MVZ A;  4UFZ A;  4A5U B;  5K1X A;  2XAQ A;  1JMK C;  5EYP A;  1VF7 A;  3ZCC A;  2KG7 A;  2F4V O;  4BW9 A;  4J7K A;  4NXN B;  2Z5U A;  3CRR A;  2EIM B;  4FLU A;  3CCS V;  3CMA V;  4WFF A;  3QO5 A;  2QKC A;  2RNB A;  1XNQ B;  3X2Q B;  3CP1 A;  3K9S A;  4DK0 A;  4ZHQ A;  3T4D A;  3GWK C;  1H2K A;  4JTC B;  1FXK C;  4YXW G;  1A32 A;  2GDS A;  3IFX A;  3R66 A;  2XOK G;  1XIL A;  4GKK B;  3NXS A;  1BQZ A;  1YTF B;  2HJD A;  2ETN A;  4X89 A;  1DGS A;  5KAI Z;  3E35 A;  3JAT A;  3OAA G;  3ZN1 A;  5E1A C;  3F7Y C;  5IY5 B;  3E89 A;  1JOY A;  2IBZ H;  5J9P C;  2CK3 G;  2BCC H;  2BOB C;  1XL6 A;  1WPX A;  5H5N A;  2WA4 A;  5LGN A;  4O2A B;  3B8M A;  3ZMV A;  1GO3 F;  2WLK A;  4MVM A;  3ZHT A;  4BIU A;  4G2K A;  4G27 B;  1CP9 A;  5JJJ B;  3CC7 V;  1OCO B;  3SJB C;  1EZV H;  4DV1 O;  1E1Q G;  1D5N A;  1M4U A;  2Y0P A;  1GMG A;  2XAF A;  3N2K B;  3OTO O;  1BHA A;  2BOC C;  2FKX A;  3U0Z A;  2VQF B;  2R9A A;  2QM7 A;  1Z2G A;  3L70 H;  5C93 A;  4X65 B;  2F1M A;  4D6T H;  1NR1 A;  1Q3E A;  4LNU A;  1SQV H;  4JI1 B;  3ASN B;  3Q4H A;  1MOF A;  2ZQM A;  1NI8 A;  4UCS A;  2ZE6 A;  2AZ2 A;  2ZM6 B;  2FL4 A;  2Q7G A;  4JGS A;  1VIB A;  3SPG A;  1JPX A;  4DR4 B;  4X1I B;  1ZL8 B;  3C3S A;  1J5E B;  2WLL B;  4JI4 O;  4TWK A;  5EYP B;  2KG7 B;  1SC5 B;  2YC0 A;  2UXX A;  4NTW A;  5B1B C;  3ASO C;  3STZ C;  3E8F A;  4PA6 A;  4B3M O;  4YIO A;  1H2G A;  4WFH A;  1VQP V;  4CBC A;  5TIS Z;  4JI7 B;  4ZHQ B;  2YI9 A;  2CH7 B;  1M56 B;  3CX5 F;  5LMN B;  4UVB A;  4DR1 O;  3FB5 C;  4TV8 B;  3ABU A;  3CEI A;  1KKC A;  4JI3 B;  3ZMS A;  1N34 B;  4FZ1 A;  3THO A;  4GKJ B;  1HP8 A;  1IBL O;  2V4D A;  1YIT V;  2ZDI C;  3D36 C;  2AW9 A;  1U97 A;  1PM9 A;  1FPO A;  3BVO A;  4H0L B;  2QA4 V;  1T5E A;  2R72 A;  2Q67 A;  2QWQ B;  3SJC C;  4Z2W A;  5EK0 A;  2W0F C;  2VWK A;  5H2F Z;  3ABT A;  3ZRW A;  1ENV A;  5CB4 A;  1IX9 A;  3L72 H;  3L74 H;  1YI2 V;  2VQE O;  4B7E A;  2XND G;  1OCC C;  1OCZ C;  4TV9 A;  4MS2 A;  3JAL A;  1H2M A;  2GTA A;  2QTO A;  1XQ8 A;  1PKX A;  3A0B Z;  5LP6 C;  4K0K B;  5CN0 A;  2YS8 A;  3SPC A;  4Z1M G;  1KP2 A;  2E5L B;  1E1R G;  4LNU B;  4FLT A;  4R6Z A;  3Q4H B;  1AJQ A;  2XAS A;  3ABM C;  3LNM B;  2QJ1 A;  4P9P A;  2QWN B;  4LF4 B;  2F66 C;  1GM9 A;  4JYA O;  3OR7 C;  4WF9 V;  3ZRS A;  2JGU A;  1P49 A;  1V55 C;  3CB2 A;  2Z3Y A;  1YXB A;  4JI8 O;  5H6Q A;  2EIK C;  1Y67 A;  3AG7 A;  4OPH A;  2WLI A;  4X8A A;  3N2G A;  3JAS A;  1HNZ B;  1Z5V A;  2PI4 A;  2P6J A;  4LF8 O;  1NH2 D;  1ROP A;  2HJF C;  3JAW A;  1YSC A;  2ZE7 A;  3DC5 A;  1SS3 A;  4FVM A;  5CA3 A;  5BR8 B;  1BMF G;  3AG2 C;  3APQ A;  1GN2 A;  4OX9 O;  3WG7 B;  4GT1 A;  3SGI A;  2X0L A;  4DR5 B;  3CCJ V;  1IBK B;  3P30 A;  3QF7 A;  2F23 A;  4WFA V;  2XT9 A;  5BXZ A;  3N27 A;  3UKM A;  4J9Y B;  1YJ9 V;  2IW5 A;  4QIW F;  4J42 A;  1W0K G;  3L71 H;  3J7A U;  2ZT9 B;  2ITC C;  4F4L A;  4LC1 A;  3MDS A;  2HVJ C;  3OTF A;  3W7T A;  2QSA A;  3K5N A;  1XNR O;  3GB7 C;  3ZRW B;  5CB4 B;  5KX5 A;  1Q7Y W;  4YHH O;  2K9P A;  3VQX A;  5FNV A;  4UV8 A;  3JSL A;  3UT5 A;  3OMN B;  4TV9 B;  3JAL B;  1M57 C;  5B3S B;  3BAB A;  1DK1 A;  4LH6 A;  2W0X A;  1IBM O;  1SER A;  1NU1 H;  3HKD B;  1FXH A;  4UUJ C;  3UO2 A;  3CCE V;  2PTM A;  5IJ0 A;  5EC2 C;  4WFB V;  5LXT A;  5DEC A;  3TCU A;  3KCY A;  1HNX B;  4X20 A;  1HWY A;  2PYL A;  5ITZ A;  4QNH B;  2B1I A;  4LFB B;  4J9Z B;  1FXV A;  2DE0 X;  2H3O A;  5DN6 G;  2EZP A;  2UUA O;  2WLI B;  2IJK A;  3B8N A;  3KKY A;  3IC9 A;  3IJ4 A;  5JVD A;  1SES A;  2CTW A;  3F7V C;  4U3F H;  4DV7 B;  3JAW B;  2UUB B;  2BE3 A;  1NS1 A;  2EZO A;  1HNW B;  3K3W A;  3J81 N;  3OD4 A;  3QG5 A;  3ZED A;  4GLX A;  1U96 A;  3C90 A;  1CPY A;  4GCZ A;  1YF2 A;  2GBO A;  3CPW U;  3VQW A;  4YJ2 A;  4JZG A;  3HB3 B;  1N4C A;  1YJW V;  2FYU H;  4U7N A;  1RPR A;  5KHH A;  4CZZ A;  1DTO A;  5EIB D;  3H1H H;  4MVU A;  4Q20 A;  1GK9 A;  1UJW B;  3P3P A;  4X62 O;  2GTS A;  3ETD A;  3FB7 C;  4JV5 O;  5CMU A;  2GV9 A;  4LH7 A;  4UCU A;  2Q7H A;  5KX5 B;  1S3J A;  1BQ0 A;  4ZI7 A;  4UB6 Z;  3FD9 A;  3OTO B;  3OR6 C;  5FNV B;  2ZE8 A;  4YY3 O;  3UT5 B;  5L3E A;  1XMO B;  3LSU A;  4J10 A;  1N32 O;  4I9Q A;  4ASU G;  3D3Q A;  4I5S A;  2X6B A;  3K79 A;  4DR6 B;  2M6Y A;  2DYR B;  5B5E Z;  2DYS B;  4B3R O;  2ATK C;  1PNM A;  3ABK B;  3T2M A;  4LFC B;  1OCR B;  2EUL A;  2YIC A;  2DQ3 A;  1OJH A;  4DV5 O;  1F51 A;  2MW2 B;  2ARH A;  4X64 O;  1VF6 A;  4MW3 A;  5JCO A;  5ITZ B;  1D5A A;  4X1K A;  1KD1 W;  3RYH A;  4XDK A;  2K1E A;  4PA9 A;  2HHH B;  2YXL A;  1WNS A;  5DED A;  2LW7 A;  4B3S B;  2P22 C;  1NR7 A;  4RQE A;  4LF7 O;  4RO2 A;  3CCM V;  4JAU A;  5JVD B;  2UXD B;  1AR1 B;  5F2V O;  3ZMT A;  3VBB A;  1VEW A;  5GTH Z;  1P7B A;  2KSD A;  4EFE A;  3ETQ A;  3RVZ A;  2HLD G;  2QR4 A;  4QE9 A;  4O2A A;  3RGB A;  2X6A A;  4U3J A;  1K4C C;  1H38 A;  5L3G A;  1Q8I A;  3ZX6 A;  1NVP D;  2JEX A;  3U11 A;  4FLV A;  2OTJ V;  1JFF B;  4DV3 B;  1CXZ B;  2O57 A;  4ICG A;  3SR2 C;  3QNE A;  2B9Z A;  3JD1 A;  4QE7 A;  2YIB A;  3CCU V;  5EBL C;  4JI2 O;  2UU9 O;  4TQF A;  2B5U A;  2WLN A;  3HPL C;  2Q0A A;  3W7W A;  3AG3 C;  2QKA A;  2Y4U A;  3CD6 V;  4GX1 A;  4KHP B;  4ZI7 B;  1QNM A;  1ARO P;  2HP8 A;  2Q73 A;  5B1A C;  1JR9 A;  2RCV A;  5IWA O;  1Q86 W;  4DW1 A;  1IZ3 A;  3BA9 A;  3AG1 B;  4JF3 A;  4H33 A;  2AZ0 A;  4X1I A;  4DV4 B;  1L0L H;  1GM7 A;  1ZL8 A;  2JJ1 G;  3RN4 A;  3CCR V;  2WLL A;  3M8A A;  2C2A A;  1Y6X A;  2KKW A;  3B40 A;  4ZBM A;  2WLM A;  2LGW A;  2EIN C;  3A0R A;  4PI0 A;  3T1Y B;  2Q6A A;  4LP8 A;  1NH2 B;  3LSS A;  4ZOL A;  4EFB A;  5LA6 B;  2R9R B;  4LF5 O;  3UQ8 A;  4O4J A;  3T4Z A;  3JAR B;  2HG5 C;  4X1K B;  1N36 B;  4MTX A;  2CH7 A;  3RYH B;  1Q90 D;  4EKW A;  1QLE C;  4TV8 A;  3SPJ A;  1Q6H A;  1Q6U A;  2P06 A;  4GZR B;  4NTX A;  1V54 C;  3GWO A;  1NTZ H;  5HFL A;  1SRY A;  2BTO A;  3OGC C;  1MZF A;  4D7S A;  4QGP A;  4MVQ A;  4X66 O;  2ZKO A;  2DOS A;  1TAE A;  3SPH A;  3TXS A;  5GTI Z;  3UM7 A;  5H6R A;  5B66 Z;  5LMU B;  1H2S B;  2CGO A;  4KL1 A;  2RDC A;  4DV2 O;  3RWR D;  1SQG A;  4LR3 A;  5LHI A;  2H8P C;  2LQT A;  2WAM A;  3BA8 A;  4OGQ B;  3RFR A;  4B7K A;  4U3J B;  4PA3 A;  5JQG A;  4NXM B;  1AR5 A;  2EIJ C;  2L35 A;  1E79 G;  1NBM G;  1F4M A;  4JI5 B;  1NJI W;  3HKB B;  3K58 A;  2PY5 A;  1N33 B;  5FL7 G;  4MTG A;  1AI6 A;  3CE2 A;  1FXK A;  2HVK C;  1F7Y A;  3DTU B;  4JPR A;  4OPA A;  3M7M X;  2ZXW C;  5J2U A;  1K5S A;  2Q69 A;  5KHI A;  3O9O A;  1AR4 A;  1YHQ V;  2DN9 A;  2CDY A;  3ABL B;  3RYF B;  2Q9L A;  3OGI B;  2DW4 A;  4DR7 O;  1PNK A;  3OE7 G;  1UFI A;  2L6L A;  3FB6 C;  1IUR A;  2ZE5 A;  4MVS A;  2A7W A;  3ZBH A;  5A9G A;  1FYJ A;  4FM0 A;  3G71 V;  1X59 A;  1EN5 A;  3BFR A;  4B3T O;  3W7X A;  4C7U A;  2IH3 C;  3U10 A;  2A3Q A;  4PDM A;  2QE7 G;  1MAB G;  1US6 A;  4FLX A;  4KXR A;  3FYI B;  5BY1 A;  5LHH A;  4DR2 O;  4ZOL B;  1NT2 B;  2Y0I A;  2ZR2 A;  3D8C A;  3T1H B;  4O4J B;  3LDC A;  4NB5 A;  4JYC A;  3E2E A;  1I94 O;  2WLJ A;  3IGA C;  3HR0 A;  2JDI G;  4AHC A;  4DV6 B;  1VQL V;  2JEU A;  3RYC B;  4P30 A;  4LF6 O;  2B1G A;  1NTK H;  1SQX H;  4N21 A;  4UV9 A;  2ADP A;  2PYJ A;  1FFX A;  4RUE A;  1K97 A;  2ITD C;  2E75 B;  4JI6 B;  1P84 F;  2UXC B;  5LBQ A;  3I55 V;  4DUY O;  3LUT B; 
#chains in the Genus database with same CATH homology
 2P67 A;  1Q7Y W;  4XDJ A;  4RUF A;  2A9H A;  3SJQ C;  3CC4 V;  1JQ0 A;  3JD2 A;  2WPD G;  5L3C A;  3JD0 A;  3I56 V;  2A79 B;  4UV8 A;  4PEL A;  5IYB O;  2EIL B;  3CCL V;  3OMN B;  3ZJZ A;  1JCH A;  1S77 D;  1DLB A;  1M57 C;  1ZWI C;  5B3S B;  3G6E V;  3DGE A;  4ZKI A;  3CME V;  5IDJ A;  2MK3 A;  1YJN V;  2V1D A;  1SER A;  4QPK A;  2Q68 A;  1FXH A;  4UUJ C;  2X7R B;  4BW5 A;  1OZ0 A;  2YSU B;  1FXK B;  5L3B A;  3CCE V;  4QPJ A;  5EC2 C;  2Y69 B;  4WFB V;  2KB1 A;  2AHY A;  1JVM A;  3MHH C;  3OMA B;  4PA4 A;  3OM3 B;  2IJJ A;  3TCU A;  1PL0 A;  4QJF B;  2ZDI A;  1MG1 A;  1NKD A;  1HWY A;  4MT8 A;  3D36 A;  1TUE B;  4MVO A;  1J95 A;  1F4N A;  4TSF G;  5B1N A;  3ABL C;  4QNH B;  2B1I A;  1QCE A;  2XAH A;  4J9Z B;  4WFE A;  3SYQ A;  1FXV A;  1RM1 B;  2R9I A;  1VQ6 V;  5KUM A;  5DN6 G;  3CXC U;  1B6Q A;  3OMI B;  4PDV A;  2EZP A;  3QO8 A;  3ZRX A;  2AHZ A;  1I5Y A;  3SPI A;  2WLI B;  2IJK A;  3B8N A;  2GHY A;  1SES A;  3AG4 B;  4BIZ A;  1VQK V;  3F7V C;  2DWE C;  1VQO V;  1FS0 G;  4HAM A;  2X6C A;  5CBH A;  1K9M W;  2EZO A;  3ZMU A;  1XL4 A;  2YEV B;  3K9A A;  3K3W A;  3LDE A;  4X88 A;  4PDR A;  1THZ A;  3STL C;  1CPY A;  3OEE G;  4GCZ A;  3WG7 C;  3CPW U;  1M1K W;  3HB3 B;  3JD3 A;  4JAS A;  1YJW V;  1QLN A;  4U7N A;  5L3F A;  1RPR A;  4KUM A;  1VQM V;  3FYE B;  5DM6 V;  3OFN G;  1IXM A;  4JYB A;  4CZZ A;  1DTO A;  3PJS K;  1AI4 A;  1BHB A;  4MVU A;  1GM8 A;  4MSW C;  4Q20 A;  5KA5 A;  4H37 A;  3RBZ A;  1AI7 A;  1GK9 A;  1UJW B;  4GX2 A;  3E8B A;  1Q81 W;  1JX9 A;  3ETD A;  3FB7 C;  2DQ0 A;  5CMU A;  1G4Y B;  1K73 W;  3AG3 B;  5BZB A;  3R65 A;  1Y66 A;  3K04 A;  4R50 A;  5L3D A;  3K08 A;  1VQ7 V;  1S3J A;  3OEH G;  2OCC B;  4KFM A;  4MVZ A;  4MVR A;  3OR6 C;  5B1A B;  4MW8 A;  5IYD O;  2XAQ A;  2ZD9 A;  1R3J C;  5L3E A;  4E2L A;  1Q82 W;  5B1B B;  3ASO B;  3ZCC A;  3K0G A;  3EHB B;  2EIL C;  3E8H A;  3W7U A;  2W6I G;  2Z5U A;  4ASU G;  2EIM B;  4I5S A;  3ZIA G;  5B3S C;  3CCS V;  2X6B A;  3CMA V;  3AEI A;  3K79 A;  1DF5 A;  3VOU A;  4WFF A;  3K03 A;  3QO5 A;  3FB8 C;  2DYR B;  4JTD B;  3X2Q B;  4UVC A;  2DYS B;  3CP1 A;  5HFM A;  1AJP A;  2EIN B;  3T4D A;  2ATK C;  1PNM A;  3ABK B;  1FXK C;  4JTC B;  1VQ9 V;  3T2M A;  4YXW G;  1OCR B;  1SZT A;  1BL8 A;  3IFX A;  2Y69 C;  3TET A;  2XOK G;  4JTA B;  2DQ3 A;  2HFE C;  4BAY A;  1H8E G;  3NXS A;  1F51 A;  4GX0 A;  4MW3 A;  1YTF B;  1KKD A;  2WLH A;  1QLE B;  4X89 A;  1JJ2 U;  3M99 B;  1KD1 W;  1QR8 A;  3E35 A;  4MTO A;  4N23 A;  3OAA G;  1V54 B;  3ZN1 A;  5CBG A;  4XDK A;  2K1E A;  4PA9 A;  4R7C A;  5E1A C;  3F7Y C;  1DF4 A;  5IY5 B;  3E89 A;  4UVA A;  1JOY A;  1RM1 C;  1NR7 A;  2FTK A;  4RQE A;  1EFR G;  4RO2 A;  5J9P C;  3CCM V;  4JAU A;  2CK3 G;  2BOB C;  1QVG U;  1XL6 A;  1WPX A;  3WFV A;  3RVY A;  5LGN A;  1AR1 B;  3B8M A;  3ZMV A;  1GO3 F;  2WLK A;  2LP7 A;  4MVM A;  3AG4 C;  1L1F A;  3SYC A;  4BIU A;  3ZMT A;  4G2K A;  3VBB A;  4G27 B;  2WWW A;  1CP9 A;  1P7B A;  1VQN V;  1LNQ A;  1OCC B;  3K0D A;  1OCZ B;  4FK5 C;  3RVZ A;  2HLD G;  3CC7 V;  1S72 V;  1AJN A;  2EIJ B;  4QE9 A;  1OCO B;  3SYP A;  2W6J G;  2X6A A;  1E1Q G;  1K4C C;  4MTF A;  1G8M A;  3ETG A;  1S76 D;  1GMG A;  2XAF A;  1H38 A;  5L3G A;  1OHH G;  3ZMZ A;  1W0J G;  1NVP D;  2NLJ C;  2JEX A;  4G28 B;  1BHA A;  2OTJ V;  2BOC C;  2D3O W;  2QM7 A;  5CBF A;  5C93 A;  3QNE A;  2ZXW B;  1RPO A;  3JD1 A;  3MD0 A;  4QE7 A;  1NR1 A;  2IH1 C;  3KG2 A;  3ABM B;  3CCU V;  3LSQ A;  5EBL C;  3ASN B;  3E8G A;  1F23 A;  1MOF A;  2Y48 A;  2ZQM A;  2XAJ A;  3P32 A;  2B5U A;  2WLN A;  3HPL C;  3W7W A;  1V55 B;  3AG3 C;  4WFG A;  3CD6 V;  4JGS A;  4GX1 A;  2PI5 A;  5GW7 A;  2EBO A;  2HR3 A;  3SPG A;  1JPX A;  1R3K C;  2EIK B;  1ARO P;  1CEZ A;  1NVP B;  2OCC C;  2WLL B;  3TK1 A;  4TWK A;  1K3E A;  5B1A C;  3QO7 A;  4PA7 A;  2UXX A;  1Q86 W;  1K8A W;  4RAI A;  5B1B C;  3ASO C;  3STZ C;  3E8F A;  4PA6 A;  3H01 A;  4JF3 A;  3AG1 B;  4H33 A;  1H2G A;  4WFH A;  3OW2 U;  1VQP V;  4CBC A;  1GM7 A;  4FJC C;  4XBF A;  1H8H G;  2EIM C;  2JJ1 G;  3CCR V;  2WLL A;  4DXW A;  3AG2 B;  2C2A A;  1M56 B;  4UVB A;  4ZBM A;  2DYR C;  1S5H C;  3FB5 C;  3X2Q C;  2WLM A;  2DYS C;  1YTF D;  3OUF A;  3ABU A;  2EIN C;  1VQ8 V;  1KP3 A;  2UXN A;  1K34 A;  2IJI A;  3A0R A;  3ZMS A;  1R3L C;  2Q6A A;  1PNL A;  2WSS G;  3ABK C;  4LP8 A;  3T1C A;  1NH2 B;  3LSS A;  1SET A;  1OCR C;  4UXN A;  2R9R B;  1K92 A;  3B77 A;  3T4Z A;  1YIT V;  2LFS A;  2HG5 C;  2ZDI C;  1K33 A;  3E86 A;  4DO2 A;  4MTX A;  2QM8 A;  1R6N A;  3FKS G;  4EKW A;  1QLE C;  4R8C A;  3SPJ A;  5B1O A;  4RQF A;  1V54 C;  3GWO A;  2QA4 V;  5HFL A;  1SRY A;  4FMT A;  3OGC C;  5IY5 C;  2Q67 A;  4MVQ A;  3F5W C;  2IU0 A;  2JIZ G;  5EC1 C;  5EK0 A;  3SPH A;  2W0F C;  3ABT A;  3UM7 A;  5H6R A;  3IC7 A;  3BEH A;  3EFF K;  3ZRW A;  3JCZ A;  1ENV A;  5EBM C;  3CYO A;  1YI2 V;  1KQS U;  1R6K A;  2OT5 A;  5LHI A;  2H8P C;  2XND G;  1OCC C;  1R73 A;  4WCE V;  1OCZ C;  2JK5 C;  3JD4 A;  1M57 B;  4L87 A;  2WAM A;  4PA3 A;  3D3I A;  4MS2 A;  2EIJ C;  1E79 G;  1OCO C;  3ML0 A;  4XDL A;  1NBM G;  2QTO A;  2XAG A;  1F4M A;  1PKX A;  2IJH A;  3JYC A;  3SYO A;  1NJI W;  1S0V A;  1QBZ A;  2F43 G;  1Y4M A;  2QEX V;  4U7O A;  3G4S V;  1EZJ A;  1P4R A;  5CN0 A;  5FL7 G;  2H94 A;  3SPC A;  4MTG A;  1AI6 A;  1FFT B;  1K4D C;  5LGU A;  3CCQ V;  1YIJ V;  1FXK A;  4Z1M G;  2HVK C;  1KP2 A;  5LHG A;  2JJ2 G;  1N8R W;  4LBE C;  1E1R G;  3DTU B;  4JPR A;  2ZXW C;  4R6Z A;  1AJQ A;  2XAS A;  1K5S A;  2Q69 A;  3ABM C;  1QR9 A;  3LDD A;  3LNM B;  4P2Z A;  2IU3 A;  3ETE A;  4P9P A;  1YHQ V;  1K5Q A;  3OUS A;  1GM9 A;  2LFR A;  3ABL B;  3ASN C;  3OR7 C;  4WF9 V;  2P7T C;  4GX5 A;  3ZRS A;  3BY6 A;  1AI5 A;  2DW4 A;  1WLE A;  4I9W A;  3RW0 A;  2OTL V;  1PNK A;  1V55 C;  2V7Q G;  3OE7 G;  2A0L A;  3FB6 C;  4JAV A;  2HKO A;  4MVS A;  1W2B U;  3MHS C;  2Z3Y A;  1R3I C;  5H6Q A;  2EIK C;  1M90 W;  5KUK A;  1QVF U;  5H9C A;  1VQ4 V;  1M9N A;  1KC8 W;  5LGT A;  4PDL A;  1GKF A;  2DWD C;  1K7D A;  3G71 V;  2WLI A;  4X8A A;  3W7X A;  2IH3 C;  3CCV V;  2PI4 A;  2P6J A;  3AG1 C;  1NH2 D;  1ROP A;  2HJF C;  1PD3 A;  1YSC A;  4KP4 A;  2QE7 G;  4PDM A;  1MAB G;  3W7S A;  5CA3 A;  1BMF G;  3AG2 C;  4HYO A;  1M56 C;  2YEV A;  5KA6 A;  3FYI B;  3WG7 B;  5LHH A;  4OXS A;  1COW G;  4GT1 A;  3ZN0 A;  4HZ3 A;  3CC2 V;  2X0L A;  2ZR2 A;  2EJR A;  3LDC A;  3E83 A;  4JYC A;  4LCU C;  3CCJ V;  3E2E A;  1EBO A;  2WLJ A;  3P30 A;  1VQ5 V;  3IGA C;  4TT3 G;  4WFA V;  2JDI G;  1MSW D;  1I5X A;  4FIP C;  3UKM A;  4J9Y B;  5IYC O;  1VQL V;  1YJ9 V;  2JEU A;  2IW5 A;  1KEC A;  1GTO A;  3K06 A;  4QIW F;  4P30 A;  1W0K G;  1ORQ C;  2B1G A;  3ZRV A;  4P9O A;  4UV9 A;  4N21 A;  3SYA A;  2P90 A;  2ITC C;  4FPP A;  4RUE A;  1K97 A;  2ITD C;  4LC1 A;  4F4L A;  2HVJ C;  2GSM B;  2M7W A;  1NQT A;  3W7T A;  5EBW C;  5LBQ A;  2QKS A;  3GB7 C;  3ZRW B;  3I55 V;  3LUT B;  2NNU A;  2ZR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...