2QEXV

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qexV00
1VQ9V 3CD6V 1Q82W 5DM6V 3G6EV 1M90W 1YJ9V 2D3OW 3OW2U 1N8RW 1VQNV 1VQLV 3CC2V 1YJWV 1S72V 2QA4V 4WFBV 1VQMV 1QVFU 2QEXV 3G71V 1Q86W 4WCEV 3CC7V 3CCJV 3CMAV 1VQ4V 1YITV 1YIJV 1VQ7V 1VQ8V 3CPWU 1YJNV 3CCVV 4WF9V 3I56V 1YI2V 1NJIW 1Q7YW 1JJ2U 3CCRV 1YHQV 1VQ6V 1VQPV 3CCEV 3CC4V 3CCSV 1KD1W 1VQ5V 2OTLV 1Q81W 2OTJV 3I55V 3CCLV 1VQKV 1R73A 3CCMV 3CCQV 1VQOV 1K8AW 3CMEV 4WFAV 1KC8W 1K9MW 1KQSU 3CXCU 3G4SV 1QVGU 1K73W 1W2BU 1M1KW 3CCUV
chains in the Genus database with same CATH superfamily
4DR6B 1Q6HA 1WJZA 3CWBH 4K0KB 3CJHA 1MA1A 5DN6G 2WWWA 1I5YA 1SERA 1JA8A 1KYOF 1P49A 4TT3G 3FB6C 2YI8A 4GKJB 4JYBA 4JI3O 2HLDG 5LMNB 1WP8A 2B5UA 3J80N 3EHBB 3ETGA 3STZC 4FLXA 4PHZA 2KQXA 2R70A 5CA1A 4I7ZB 1V54B 4LF7O 1Y74A 2L6LA 4K8XA 2N74A 2DOSA 1R6KA 1KU9A 1VQ4V 2A3QA 1VQ7V 5J9PC 4BAYA 4EFBA 3ASNB 1BQZA 4ASUG 4PI2A 1DLBA 3JATB 4DR7O 4LF8B 4JI6O 4JV5B 1NZ6A 4CS4A 2HJFC 2Q9LA 4U7NA 3P32A 1J5EO 4UV8A 4O4HB 2VQFB 2ZDIC 3ZRXA 3D8CA 2XAHA 1URFA 1OCZB 1I94B 1RFYA 2ITDC 2ZIMA 5BR8B 1M93A 5KHIA 1YTFD 1RM1B 2XAFA 1PL0A 1KUQA 5CA0B 1RPOA 1QCEA 1QVGU 4HNAB 2E3CA 1OZ0A 3SJAC 1SF9A 4ZOLA 3ZHTA 2HHHB 1AJQA 1SKVA 3CC7V 1YSCA 3ABLC 2B1IA 1NJIW 2Y0IA 1EM1A 2ZT9B 3ABKB 3ZMZA 2N05A 4QIWF 2EBOA 2ZQMA 1SRYA 1THZA 1Q90D 4JTAB 3ZCCA 4DK0A 4BR6A 1PP9H 3K06A 5IJ0B 1VEWA 2WLHA 4B3MO 3AK1A 4KXRA 4YHHB 1XI1A 4DR2O 4AQYB 5IYBO 4I55A 3OD4A 3THOA 1GM9A 3A0HZ 5C93A 5LHGA 2MW2B 4B7KA 1WA8B 2QWRB 3JALA 1VMGA 2VQEO 1NTZH 1KBHA 4X66B 4DW1A 5FNVB 1FXKB 3IAYA 2QM8A 3APQA 1YITV 5KMGA 4DV4O 1XOUA 4QPKA 2HKOA 2WLMA 3AG3B 3RBZA 4UCSA 4DR3O 5IY5B 3DC6A 3LSUA 5LA6A 2OIEA 3WB2A 4WFFA 5DM6V 1UPGA 1R1BA 3N2GB 3HKBB 4RAIA 2IJIA 4DV0B 5LHHA 1YTFB 5JCOA 5KAIZ 2BTQB 3L70H 3EFFK 3QG5A 4TSFG 5LYJB 2HJDA 2GV9A 1COWG 4TUYB 2RMKB 1M57B 1XNQO 4YIOA 3H1IH 5AG2A 3T4ZA 3D3QA 5EBLC 3QO7A 3G4SV 3SDLA 4GYCB 1W0KG 3CRAA 1Y67A 2HVJC 1B04A 1S5LZ 3OEHG 4XDKA 4LF4B 2EIKB 1EBOA 3EVKA 5KLVH 2JGUA 1PM9A 2X6CA 4JI4B 1OJHA 1ZX3A 3NXSA 4MVSA 3WG7C 2EIMC 5DECA 1H2NA 4LR3A 3QVNA 1I5XA 3N27A 5J2TB 3K04A 1O9HA 3RYFB 1HNWB 3C3TA 1WPBA 1TA8A 4MVQA 3WU2Z 3OMAB 4JYAO 5BMVB 4LWSA 1P4RA 3K03A 1FJGO 3ZIAG 3JATA 2CE4A 1M4UA 3FD9A 2P7TC 4FFKA 1M56B 2CTPA 1NQTA 4X88A 1S72V 3CEIA 2YIDA 4O4HA 2LO1A 2PUSA 3K08A 2GHYA 3SJBC 1V9PA 4JI7O 4UCRA 3K9AA 5LP6C 4ZI7A 5H2FZ 3DXRB 4NXNO 1K5SA 1BMFG 1GAXA 1MOFA 2XT9A 1Z5VA 1HWYA 1IDSA 3UQ8A 5CA0A 5FPOA 4R7CA 5LOVB 4JI5B 1HP8A 5B66Z 2JRIA 3LDEA 2F93B 4IT5A 2XOKG 1O9GA 4QPJA 5GONA 3AG2C 4J11A 3G67A 3CX5F 3ZMSA 3CCUV 2QWNB 4FMTA 5KX5B 1WN7A 5L3BA 2Y4UA 3B77A 5KHJA 1VQNV 2F1MA 4DUYO 3KG2A 3IJ4A 3ZMVA 2A06H 4YIPA 3T1HB 4DV7O 4GT1A 2CTRA 5IJ0A 2DQ0A 1T5EA 2FMLA 3ZMTA 4GKKB 4KUMA 3ZN1A 3SPCA 2ZE7A 1GM7A 1F23A 2YEVB 2XASA 2XAJA 3E8GA 2LFRA 2LJ2A 2FB5A 3AG7A 1JOYA 3DSQA 3W7TA 3UO3A 1ORQC 2G38A 4DR6O 4DR4B 2IH1C 2IU0A 3KKYA 4FLWA 4B3RB 4DR1B 5FNVA 4X65O 3IC7A 3MHSC 4OX9O 2B1GA 1XNRB 2CH7A 3OGCC 2KKWA 1K34A 2EILC 3ZHSA 2VWKA 2DW4A 4ZHQB 1NKDA 4FLZA 2EINB 1P7GA 4U3JB 3N2GA 2DWDC 3D36A 1IBLO 2H94A 2EIJC 1XHZA 1FD9A 2Q67A 2IBZH 3HB3B 1GTOA 2BTQA 5EIBC 3TXQA 4DYLA 3K5LA 3CCMV 2JJ1G 2PYLA 3RVZA 2ZR3A 4TUYA 4FVMA 4R6ZA 2UXXA 3Q4HB 1N36O 1JVMA 1S3JA 4NB5A 5L3EA 4H37A 1SQFA 2P06A 2KB1A 3K0GA 4X8AA 2JS3A 1DF5A 1H2MA 2JEUA 4H13B 2GTAA 4WFAV 1A32A 3FX7A 3LUTB 3CXCU 5BR8O 1H2SB 1XREA 2DE0X 4JASA 2IJHA 3H9VA 1OCOC 1TUBB 2JK5C 3UT5A 2YXHA 1RSOB 2QKCA 4B3TB 1PNLA 1R6NA 1NVPB 4L87A 3ZHRA 4U3FH 4YJ3A 1H2LA 2HHHO 3SYAA 2RNBA 2WAMA 3MHHC 4CH6A 3WG7B 2EIMB 4DV2B 3L75H 1K9MW 2Q7HA 1YCIA 3CYOA 1IXMA 1NR1A 5BMVA 3OAAG 5B3SB 1QQCA 3FB5C 5H6QA 1I7FA 1H2KA 2QA4V 1W0JG 1SA0A 5KUKA 2AZ0A 2ZE5A 4FK5C 1MNGA 1Y4MA 4AQYO 1VQOV 4X20A 4FLTA 4ZOLB 3QTCA 5LMUO 2KG7A 4IL6Z 4X62O 3A8TA 3H1LH 3DTUB 3CXHF 3DXRA 3E8FA 1KP2A 2LGWA 4LFCO 4ZKIA 3OTOB 4L8JA 2ZDIA 2P4VA 2JDIG 2QTSA 4YY3B 1ZLZA 4H0LB 3FFQA 1PL4A 3B4SA 1BCCH 4JGSA 3CCQV 2CAZC 4IGGA 2ITCC 1Y6XA 5EIBD 4DV3B 3JCZA 3LNNA 2YI9A 2OCCB 1N8RW 2QDOA 4FPPA 4MTGA 2E5LO 2RCVA 1GKFA 3CB2A 4G28B 4MT8A 3AG2B 2XTAA 2WLIA 3SPIA 4TWKA 3JD2A 3ZHUA 1K3EA 4JTDB 3RWRD 2RDCA 1NI8A 3C90A 5JQGB 3JARA 4LF9B 4MSWC 5KMGB 3RFRA 2YICA 1SQVH 4JI8O 1KKCA 1D2DA 4JI0B 3F5TA 2X6AA 3ZEDA 4WF9V 3L73H 4BW9A 4IYHA 4DV1O 5JH7A 5IE9A 3D3IA 4LF4O 5LA6B 5IDJA 2OTLV 2OTJV 1K8AW 1R73A 3ML0A 2WLKA 2LP7A 4GUNA 1S0VA 2NNUA 3ETDA 5EC1C 3UCSC 3MD0A 1YEWA 5JJEB 3K58A 2AGAA 3PN1A 2CTQA 4FZ0A 2AW9A 2JJ2G 4U3JA 3SPGA 1BT8A 3OGIB 2QM7A 2AZ2A 2WPDG 3ZN0A 2UUBB 3VQXA 1FPOA 3B40A 3CP1A 1TGOA 2OCHA 3FAVB 3CCJV 1V55C 1SESA 2EIJB 4I0XA 2K1EA 3Q4HA 1VQ8V 1F4NA 5IYZB 3ZBHA 1ZSPA 1IBMB 1MABG 2Z3YA 4EKWA 2Q6AA 2UU9B 1G4YB 4KHPO 1SC5B 3BPZA 2P5OA 1B3QA 1GM8A 5B5EZ 2YIAA 4LFAB 1L0LH 3APOA 3CSXA 1DK1A 1NU1H 4MVZA 5IWAO 1VARA 4LFBO 2ADPA 2QKSA 4DRXB 4UCVA 1TUBA 2VRZA 4LWSB 3BRCA 1RSOA 1FFXA 3CRRA 4I4TB 4TQDA 1Q7YW 3U11A 3ZRWA 4KFMA 4EEQA 2OWOA 5EYPA 5KUMA 2Q68A 1S5HC 1NTMH 1OCOB 2KSDA 1WLEA 1YZBA 1KP3A 4MVRA 3J81N 4I50B 4HZ3A 1XUQA 2DYRC 2ETNA 1EN5A 4OGQB 4WCEV 4PDMA 1HNZO 3P3NA 4X1YA 1N34B 2A0LA 2WLJA 1EZVH 2Q0OC 4ZI7B 1FXHA 5JJJB 1JPXA 4X64B 3T1HO 1WNSA 1GN6A 4JAVA 5L3GA 4I9WA 4UCTA 3W7UA 1IBKO 1M9NA 4FLYA 2D3OW 5LL6Y 1VF7A 4H33A 4AILC 3OT7A 3F7VC 2ZKOA 4IHJB 4LC1A 2F4VO 1FXVA 5GONB 3CRQA 2PI5A 2ZM6B 3ZHVA 4GX0A 1ROPA 4QJFB 2IU3A 1QLNA 4J41A 3G6BA 4DR4O 1VQ5V 4A5UB 4RUEA 2EZOA 4MVUA 4B3RO 3G80A 4DR1O 1MZFA 1N33B 4XDJA 5LP6A 3MAQA 3OEEG 3AG1C 2YUAA 3S3XA 2GTSA 3E8HA 3P3PA 4LH7A 3RYIB 4GX5A 1NBMG 2K9PA 2MK3A 4U7OA 2UUCB 1VIBA 3J7AU 3SYCA 2UXBB 1QHTA 1FAFA 4CH3A 3TK1A 4JTCB 1SZXA 5IYDO 1P84F 5DEDA 1NH2D 1XEQA 4JYCA 4O2BB 1K7DA 1N0JA 3OE7G 4OPAA 4DV5O 4B7EA 1ZTEA 4FLVA 5JQGA 4NXMO 1OV9A 3HPLC 5B1OA 3ZRVA 4ICGA 2CH7B 2X0LA 2B9ZA 1PV0A 1JJOA 4NVPA 3OMNB 4EFEA 4Z2WA 1M1KW 3CE2A 1P7BA 2DYSB 3LSQA 3E83A 3K79A 5CBHA 1QLEB 1CP9A 1FFTB 2FL4A 2QWQB 3JASA 1SS3A 1CPYA 4PV1B 4CZZA 2FTKA 3GB7C 2AXTZ 4QE9A 3VQWA 2ZD9A 4BIUA 1N32B 5K1PA 4DV2O 5KA5A 1K97A 4J9ZB 1K92A 1GN2A 3K5MA 5BY1A 3T1YO 1MMMA 3E89A 4DUZB 4RQFA 3FAVA 3HKDA 3CC4V 1XMQB 1RPRA 3AK3A 5IYZA 3GWKC 3UT5B 3CS5A 2BTOA 2V1DA 4YJ3B 4TV8B 4GZRB 4O4LA 5C8YA 2YIBA 5ITZA 5IYCO 2GSMB 1XILA 4MTOA 4DRXA 3OTOO 4LNUA 4UV9A 1JFFB 5EZYA 5KAFZ 2UXDO 2Y69C 1ENVA 1R3KC 4TQFA 1NH2B 4BWAA 4DR5O 4I4TA 2UXCB 3AEIA 1OHHG 1BQ0A 2IH3C 3IGAC 1SA0B 1HR0O 4PDLA 5EK0A 4LP8A 3K3WA 1J95A 1JX9A 4PA4A 4JI2O 2NLJC 4I50A 2Q69A 4X20B 4E2LA 5K1XA 2KG7B 2ZINA 4B3SO 1KD1W 3AK2A 1X4TA 3WB1A 4OXSA 4K8ZA 5CMUA 1WPXA 4O2AB 1YDXA 2E76B 4I9QA 1Y76A 4QNHB 3KCXA 3OR6C 2QEXV 4JI3B 3ETEA 4KP4A 1LNQA 4DW0A 1XDCA 1JJ2U 2WLNA 5TISZ 4BW5A 4F4LA 4IHJA 4JI0O 3MDSA 1BS3A 4LF7B 4PELA 2QKAA 4UB8Z 3TETA 4FFBA 2EJ7A 4JPRA 2UUAO 4ABMA 1YJWV 2GDSA 4DR7B 1HW7A 1X59A 3ABLB 3T1CA 3BFRA 2WLIB 2A7WA 1AP5A 1N4CA 2IW5A 1J5EB 1GO3F 3RYIA 3JARB 4DV6O 3W7XA 4P9OA 3T4DA 4O4IA 2UUBO 3CHXA 5A9GA 2WLLB 4UFZA 5JH7B 2BSKB 4K0KO 3AG4C 4O2BA 4JF3A 1VF5B 2ADQB 5LXTA 4W4LA 4UXNA 4GKJO 1N0NA 1HNXB 4RQEA 2CK3G 5LMNO 1QNMA 4PI0A 3JCUZ 3ZS8C 2E75B 2VWJA 1GRJA 1YJNV 3OUSA 3SYOA 2ZXWC 3RT3C 3CCEV 4B3MB 2E74B 5KHHA 4X1IB 4DR2B 1PD3A 2A9HA 4LF8O 1GH6A 4JV5O 4I0XB 3VQYA 1R6TA 3G71V 1TUEB 3CMAV 1YIJV 2VQFO 4ZIBA 2HVKC 1NTKH 1I94O 2NN4A 2P6JA 3LSSA 4R8CA 5IJ9A 2F43G 3CMEV 3M8AA 3W7SA 4X64O 5HFLA 4DV4B 3LNMB 4LBEC 1FFXB 3OTFA 3SJCC 2YXLA 4PD4F 3RGBA 3ZRWB 4TV8A 5EYPB 4DR3B 2F23A 3B2EE 3ASNC 5KHKA 4UVAA 5FL7G 2YSUB 2DQ3A 2ZM6O 4F6EA 4HBNA 4HYOA 1GN4A 1JFFA 1MZEA 3H1KH 4DK1A 4X1YB 2Q7EA 4X89A 1SQQH 1AB3A 1QVFU 3E2EA 1B6QA 1EN6A 3F5WC 3ICXA 1AI5A 3FYIB 3UM7A 3OFNG 1RP3B 2Y69B 3BEHA 1K33A 4YHHO 3SPHA 1AJNA 4CBCA 3CCLV 3PJSK 2HG5C 1FKAO 4RO2A 1BE3H 4YJ2A 4J7JA 2UXBO 1AJPA 1E1RG 4GX1A 4O2AA 3BVOA 3FB7C 2H8PC 3E86A 4EB6A 4X66O 1PKXA 1G6UA 1QU7A 2RN9A 5LP6B 3ABKC 4X1KA 5EBMC 2BOCC 1QR8A 2EJRA 3A0RA 1GMGA 5D5QA 1GK9A 3U10A 2GUZB 5B1BC 4WFBV 2Y4TA 3B8MA 4JYAB 2YIBD 2ATKC 4I5SA 2Q4PA 1WB8A 4DV0O 2PI4A 5CB4B 3P30A 1Q81W 1H8HG 1HDJA 1LUVA 4XBFA 1LR1A 3JD3A 3SJQC 2QWPB 5H6RA 2R9RB 2JGDA 1FXKC 4CC5A 4AI8A 3B8NA 2R9AA 1QBZA 4J7KA 2WLLA 3L71H 2BSKA 3LDDA 1L0NH 1IURA 1L1FA 2EZPA 1TVKB 3QO8A 2W6IG 4QE7A 1JCHA 4WFEA 4JI4O 1BHBA 3NR7A 3STLC 2QM4A 3JD4A 4D7SA 4QGPA 1OCCC 1AR5A 5L3DA 3L72H 2D2CB 3JASB 5JJNB 2IJJA 2X7RB 2ZR2A 1Q5OA 2M6YA 5FLXN 5IT9N 1E1QG 1M57C 4WBNB 3I55V 1HNWO 1IVSA 2IM9A 3RW0A 3TJTA 2EILB 1E79G 4G27B 1ZL8B 4DV7B 1Q82W 4LF6B 4N23A 2CGOA 1Q6IA 2QGNA 1Q3EA 4X1IA 2PF4E 2OIGA 5BZBA 5GTIZ 1PPJH 1VF6C 2EIKC 3HKDB 2ZXWB 3E35A 3VOUA 1WAZA 4TV9A 1M5IA 1H8EG 1BSMA 3SPJA 2Q73A 2N04A 3DC5A 3HKCB 3JYCA 2C2AA 4O4LB 4P9PA 5C8YB 5ITZB 1AI4A 4MTFA 4Z1MG 1I0HA 4G2KA 4JZGA 1AI7A 2HEPA 4X65B 1MSDA 2XUMA 4LNUB 4OX9B 5EZYB 1Y66A 2BE3A 4JI1B 1AROP 1S76D 4JI5O 1XMOB 1B06A 4LH6A 2DMXA 1XHXA 1IBLB 5D5PA 3R65A 1M56C 3JAWB 5KA6A 3RYCB 4MTXA 3I56V 5JVDA 4UVCA 2Z0AA 2ZCEA 1N36B 1DGSA 3O65A 4GKKO 1Y76B 3IFXA 1R3IC 4FM2A 3H1JH 4IYIA 3HKEB 2OYQA 1L8DA 2QJ1A 1EN4A 4WFGA 2LW1A 3KCYA 2JVDA 1ZAUA 1UJWB 4FJCC 4PA6A 2YC0A 4PA3A 4K3AA 1VQ6V 4FFBB 3OUFA 2Y0PA 3JAKB 3H01A 1SETA 1KC8W 3B09A 4PJ0Z 4RWUA 2JIZG 2FYUH 1TAEA 3CD6V 1XNRO 2WSSG 2QE7G 2P22C 1HNXO 4W4KA 5J2UB 2CGNA 2DN9A 2GUZA 1BL8A 4PA9A 4DO2A 3TGUH 1R3LC 2RQ6A 2FKXA 2RJZA 1YF2A 4CH5A 2F66C 4O4IB 3ABUA 1U96A 1VQ9V 5CB4A 5B1BB 3QNEA 4BIZA 2DWEC 2XNDG 5LXTB 5LMUB 3ABMC 3HR0A 1SQGA 4X62B 4CS3A 5KHGA 4LF5B 2P90A 1OCRC 4JAAA 5GTHZ 3GWOA 3SR2C 4LFCB 2Q8VA 2ARHA 4F6RA 3BABA 4NKGB 1K73W 4NTYA 2R9IA 3G6EV 1YJ9V 1TVKA 4UCOA 2EINC 2XAQA 1DTOA 3F7YC 4P30A 5LGTA 4B3TO 3A0BZ 4LCUC 3BHPA 2L35A 3LDCA 1JR9A 4MW8A 5H9CA 2X6BA 3EXAA 1FYJA 3TCUA 4WBNA 1NR7A 2E5LB 1Z5WA 3C3SA 1AILA 3CRMA 1OCCB 1ZL8A 1WB7A 1AVMA 3I5DA 3BY6A 3L74H 2WA4A 3ETQA 5LGNA 1NS1A 4BIOA 5IJ9B 3WFVA 3IC9A 1WP7A 1AP6A 2WA3A 4MS2A 2ZNJA 2LGQA 1MG1A 2P67A 4JYYA 4JI8B 1W2BU 1PNKA 2QSAA 2QWOB 4J80A 2ZNIA 3HKCA 1IX9A 4IIJA 4NYKA 4DV1B 3JD0A 1V55B 3M7MX 4TOIA 1US6A 2M7WA 1Z2GA 4KL1A 2PYJA 3E22B 4X9QA 3OM3B 1CXZB 4WFHA 1NT2B 4C7UA 4YY3O 2DJVA 4FM0A 1S5JA 2CTWA 1Q43A 3TXSA 2LFSA 5B3SC 1Q6UA 4UUJC 2Q0AA 3N2KB 4DV3O 2XAGA 1ZUQA 4J7ZA 5CA3A 1QR9A 1F4MA 3JAWA 2XHBA 2BCCH 5B1NA 4YJ2B 3RYCA 3RVYA 1G8MA 1BHAA 2DYRB 3JSLA 4EB6B 3H1HH 1VQMV 3HKEA 3UKMA 4X1KB 4KHPB 1LUWA 2EX3A 4LF9O 3FKSG 2A79B 4GX2A 5FPRA 5IWAB 1KQSU 4LFBB 3X2QC 3JAKA 4CC6A 2OCCC 4K35A 1BZKA 4HNAA 3GVMA 2W6JG 4JI6B 1H38A 3T2MA 3L9DA 1AR1B 3K0DA 4GLXA 5J2UA 3K57A 4RUFA 2W0XA 3ZHQA 2Y48A 1AI6A 3AG1B 2YDEA 1HNZB 2AHYA 2JEXA 2JGDB 4FM1A 2P4KA 2BOBC 2V7QG 3UO2A 3FYEB 4LF6O 3ASOC 3ZX6A 4P2ZA 2HP8A 4O4JB 4PA7A 2NR5A 2PTMA 3OMIB 1NVPD 1IBKB 4J10A 1Q8IA 2Q7GA 3RN4A 2IJKA 1VQPV 3E8BA 1IBMO 3WB0A 4N21A 5B1AC 2F4VB 2UU9O 1WA8A 1F51A 5JCOC 1XL4A 1XQ8A 3ZJZA 4LFAO 3ABMB 1D5NA 1FXKA 2GBOA 1YI2V 1K4DC 5BXZA 1OCRB 1YHQV 5EBWC 1W59A 4NTWA 1FS0G 1KMIZ 1XBLA 4JI1O 2LW7A 2ZE8A 4FZ1A 3JD1A 4Q20A 2CUGA 1VQLV 1XMOO 3BA9A 4TV9B 1G1XB 4D7TA 1IXBA 3BCCH 1KKDA 3HKBA 4UVBA 4D6TH 5CN0A 4YXWG 3VBBA 3RYHB 1YVWA 4E4EA 2H3OA 3ZRSA 2VQEB 2CDYA 5LYJA 1N34O 1I08A 1KECA 3CJHB 5F2VO 3OR7C 5CBFA 3DGEA 4DV5B 2PZSA 1EZJA 4NR1A 1SQBH 1JQ0A 5GW7A 4NXMB 3SYPA 3SYQA 1VP7A 2ZIOA 1V54C 2QTOA 2Z5UA 3K59A 1SZTA 1Q86W 2HR3A 1EFRG 4FIPC 1VF6A 5H5NA 2W0FC 3E22A 2QR4A 5CA1B 1Y74B 1BGYH 4UCUA 3K5NA 2LQTA 3ABTA 3KZIZ 5HFMA 3BAAA 2ILMA 1N33O 5JVDB 1OCZC 1XNQB 3K5OA 3CPWU 5J2TA 1K5QA 3JSNA 3N2KA 5CBGA 3RYFA 4OPHA 3VQVA 3QO5A 4Z1VA 1F7YA 4FLUA 1RM1C 1YXBA 1XL6A 3S3WA 3ZMUA 4PDRA 5E79Z 2UUCO 3T1YB 3R66A 2PY5A 2Q5ZA 4ZBMA 4DXWA 1MSWD 2PGGA 3K9SA 4JAUA 3U0ZA 4HAMA 3CRCA 4MVMA 1R3JC 1SQXH 3W7WA 2O57A 4LF5O 5LBQA 4R50A 2AHZA 2UXDB 2YS8A 1FJGB 5E1AC 4DR5B 4Q6GA 4AHCA 4J42A 1KB9F 5LOVA 3CCSV 2VS0A 3X2QB 1HR0B 4MW3A 4B08A 1U97A 1CEZA 4JI2B 1M90W 3CC2V 4I55B 1N32O 4JI7B 4B3SB 5KX5A 4CS2A 1D5AA 4XDLA 2UXNA 4NXNB 4JZ2A 1AR4A 3JALB 4MVOA 4F6RB 3AG3C 1JMKC 4O4JA 3FB8C 1ZWIC 1VQKV 1SQPH 2EULA 4DUZO 5IY5C 5EC2C 5JWPA 2YEVA 3A2FA 1PNMA 1UFIA 5LGUA 5L3FA 1XMQO 1IZ3A 4GCZA 2HFEC 3ASOB 3D36C 3M99B 3JAMN 2DYSC 1DF4A 3AG4B 2OT5A 3BA8A 3CCVV 1QLEC 3CCRV 4PDVA 3O9OA 2UUAB 3QF7A 1K4CC 2JS5A 3SGIA 5B1AB 5LHIA 2F95B 4DUYB 2ZE6A 2V4DA 3OW2U 2UXCO 1H2GA 4UB6Z 4ZHQA 5L3CA 4J9YB 1S77D 5A2QN 2R72A 4DV6B 2YXYA 4CH4A 4H44B 2ODMA 3RYHA 1GN3A 4IIJB 4NTXA
chains in the Genus database with same CATH topology
1NR1A 2R9IA 4JPRA 3G6EV 3OAAG 5B3SB 1YJ9V 3FB5C 5H6QA 5DN6G 1YJWV 2WWWA 2QA4V 1I5YA 2EINC 2XAQA 1SERA 1DTOA 3F7YC 3ABLB 1W0JG 4P30A 3T1CA 4TT3G 5KUKA 2WLIB 3FB6C 2IW5A 5LGTA 4FK5C 4LCUC 4JYBA 1GO3F 2HLDG 1Y4MA 1VQOV 3LDCA 2B5UA 3EHBB 4MW8A 3ETGA 5H9CA 3W7XA 3STZC 2X6BA 3DTUB 4P9OA 3TCUA 3T4DA 1NR7A 3E8FA 1KP2A 1V54B 4ZKIA 1OCCB 2WLLB 2ZDIA 1R6KA 2JDIG 3BY6A 1VQ4V 1VQ7V 5J9PC 4BAYA 5LGNA 3AG4C 3ASNB 4JF3A 3WFVA 4ASUG 1DLBA 4MS2A 4JGSA 2HJFC 1MG1A 3CCQV 2P67A 4U7NA 4UXNA 2ITCC 1W2BU 1PNKA 3P32A 4UV8A 3JCZA 2ZDIC 4RQEA 2CK3G 2OCCB 1N8RW 3ZRXA 2XAHA 4FPPA 3JD0A 1OCZB 1V55B 4MTGA 2ITDC 2M7WA 1YJNV 3OUSA 1GKFA 3SYOA 2ZXWC 4G28B 4MT8A 3AG2B 1YTFD 3CCEV 3OM3B 4WFHA 2WLIA 1RM1B 3SPIA 2XAFA 1PL0A 4TWKA 3JD2A 1RPOA 1QCEA 1K3EA 1QVGU 4JTDB 1PD3A 2A9HA 1OZ0A 2LFSA 4MSWC 1AJQA 5B3SC 4UUJC 3G71V 3CC7V 1TUEB 3CMAV 2XAGA 1YSCA 1YIJV 2X6AA 3ABLC 5CA3A 4WF9V 2B1IA 1QR9A 1NJIW 1F4MA 2HVKC 3D3IA 3ABKB 3ZMZA 5IDJA 4QIWF 2OTLV 5B1NA 2ZQMA 2P6JA 1SRYA 2EBOA 1THZA 3LSSA 1R73A 4R8CA 2F43G 3RVYA 1K8AW 3ML0A 3CMEV 4JTAB 3ZCCA 2WLKA 2LP7A 3W7SA 5HFLA 1G8MA 1S0VA 2NNUA 3ETDA 3LNMB 3K06A 1BHAA 5EC1C 4LBEC 2DYRB 2WLHA 1VQMV 3MD0A 3ZRWB 3UKMA 5IYBO 3FKSG 3ASNC 2JJ2G 2A79B 4UVAA 1GM9A 4GX2A 5FL7G 3SPGA 5C93A 5LHGA 2QM7A 2YSUB 1KQSU 2DQ3A 4HYOA 2WPDG 3ZN0A 3X2QC 2OCCC 4X89A 1FXKB 1QVFU 3CP1A 3E2EA 2QM8A 1B6QA 3CCJV 2W6JG 1V55C 1YITV 1SESA 2EIJB 3F5WC 2K1EA 1H38A 1VQ8V 1AI5A 1F4NA 3FYIB 4QPKA 2HKOA 3OFNG 3UM7A 3T2MA 2WLMA 2Y69B 3AG3B 3BEHA 3RBZA 1K33A 1MABG 2Z3YA 4EKWA 3SPHA 1AJNA 2Q6AA 1AR1B 3K0DA 1G4YB 4CBCA 3CCLV 3PJSK 4RUFA 2HG5C 5IY5B 4RO2A 1GM8A 2Y48A 1AI6A 3AG1B 2AHYA 4WFFA 2JEXA 5DM6V 4MVZA 2BOBC 1AJPA 2V7QG 4RAIA 2IJIA 2QKSA 1E1RG 4GX1A 5LHHA 3FB7C 1YTFB 2H8PC 3E86A 3FYEB 3ASOC 4P2ZA 4PA7A 3EFFK 4TSFG 3OMIB 1PKXA 1NVPD 1Q7YW 1COWG 3ZRWA 4KFMA 3ABKC 5KUMA 1M57B 2Q68A 5EBMC 1S5HC 2BOCC 3T4ZA 1QR8A 5EBLC 2EJRA 3QO7A 1OCOB 3G4SV 2IJKA 3A0RA 1GMGA 1W0KG 1VQPV 3E8BA 4N21A 5B1AC 2HVJC 1GK9A 1WLEA 1KP3A 4MVRA 1F51A 4HZ3A 3OEHG 5B1BC 2DYRC 4WFBV 1XL4A 4XDKA 3ZJZA 3B8MA 4WCEV 2EIKB 4PDMA 1EBOA 2ATKC 3ABMB 2X6CA 2A0LA 2WLJA 4I5SA 1FXKA 1YI2V 1K4DC 1FXHA 1OCRB 1JPXA 5EBWC 1YHQV 2PI4A 3P30A 1Q81W 1H8HG 1FS0G 4JAVA 4XBFA 3NXSA 4MVSA 3WG7C 2EIMC 3JD3A 5L3GA 4I9WA 3SJQC 3W7UA 1M9NA 3JD1A 1I5XA 2D3OW 4Q20A 1VQLV 4H33A 5H6RA 2R9RB 3K04A 1FXKC 3F7VC 3B8NA 1KKDA 4LC1A 1QBZA 1FXVA 4UVBA 2PI5A 5CN0A 4MVQA 4GX0A 1ROPA 4YXWG 3VBBA 2IU3A 2WLLA 4QJFB 1QLNA 3OMAB 3ZRSA 3LDDA 1VQ5V 1P4RA 3K03A 4RUEA 2EZOA 4MVUA 1L1FA 2EZPA 1KECA 3ZIAG 4XDJA 3OR7C 5CBFA 3OEEG 3DGEA 3QO8A 1EZJA 2W6IG 3AG1C 2P7TC 1JQ0A 4QE7A 5GW7A 3SYPA 1JCHA 3E8HA 4WFEA 3SYQA 1BHBA 3STLC 1M56B 3JD4A 1NQTA 4X88A 1S72V 1V54C 2QTOA 2Z5UA 1SZTA 1Q86W 1OCCC 5L3DA 2HR3A 3K08A 1NBMG 1EFRG 4FIPC 4GX5A 2GHYA 2IJJA 2X7RB 2MK3A 2ZR2A 3K9AA 4U7OA 2W0FC 1E1QG 1M57C 3SYCA 3I55V 1K5SA 1BMFG 1MOFA 3RW0A 3TK1A 2EILB 1E79G 4JTCB 4G27B 1HWYA 1Q82W 5IYDO 1NH2D 4N23A 3ABTA 5HFMA 4JYCA 1K7DA 4R7CA 3OE7G 5BZBA 1OCZC 2EIKC 2ZXWB 3HPLC 5B1OA 3ZRVA 3E35A 3CPWU 3VOUA 1K5QA 2X0LA 3LDEA 5CBGA 1H8EG 2XOKG 4QPJA 3SPJA 3AG2C 3JYCA 3QO5A 3OMNB 2C2AA 1RM1C 3ZMSA 1XL6A 4P9PA 1M1KW 3CCUV 3ZMUA 4FMTA 1AI4A 4MTFA 4PDRA 4Z1MG 4G2KA 5L3BA 3B77A 1AI7A 1VQNV 3KG2A 1P7BA 3ZMVA 4ZBMA 2DYSB 4DXWA 3LSQA 4GT1A 1MSWD 1Y66A 2DQ0A 3E83A 3K79A 3ZMTA 5CBHA 4JAUA 1QLEB 1CP9A 1FFTB 4KUMA 3ZN1A 1AROP 3SPCA 4HAMA 1S76D 1CPYA 1GM7A 1F23A 1R3JC 4MVMA 4CZZA 2YEVB 2FTKA 3GB7C 2XASA 4QE9A 2ZD9A 4BIUA 2XAJA 3E8GA 2LFRA 3W7WA 1JOYA 3W7TA 5KA5A 4R50A 5LBQA 1ORQC 2AHZA 1M56C 3R65A 1K97A 4J9ZB 1K92A 5KA6A 2IH1C 2IU0A 5E1AC 4MTXA 3I56V 3E89A 3IC7A 4RQFA 4UVCA 3CC4V 3MHSC 3CCSV 2B1GA 1RPRA 3OGCC 3X2QB 4MW3A 3IFXA 1K34A 2EILC 1CEZA 1R3IC 2V1DA 1M90W 2DW4A 1NKDA 3CC2V 2EINB 4WFGA 5IYCO 2GSMB 4XDLA 2OTJV 4MTOA 2UXNA 2DWDC 3D36A 1UJWB 2H94A 4FJCC 4PA6A 2EIJC 4PA3A 4UV9A 2Q67A 1VQ6V 3HB3B 4MVOA 1GTOA 2Y69C 3AG3C 3OUFA 3FB8C 1ENVA 1R3KC 1ZWIC 3H01A 1VQKV 1NH2B 3CCMV 2JJ1G 1SETA 1KC8W 3RVZA 2ZR3A 5IY5C 3AEIA 1OHHG 2JIZG 5EC2C 3CD6V 2YEVA 1PNMA 4R6ZA 2IH3C 5LGUA 5L3FA 2UXXA 2WSSG 1JVMA 3IGAC 4GCZA 1S3JA 2QE7G 2HFEC 3ASOB 3M99B 4PDLA 5EK0A 4LP8A 3K3WA 4H37A 1J95A 5L3EA 1JX9A 4PA4A 2DYSC 2NLJC 1DF4A 3AG4B 2OT5A 3CCVV 2KB1A 1BL8A 2Q69A 3K0GA 4X8AA 4PA9A 1QLEC 4DO2A 4E2LA 4PDVA 3CCRV 1R3LC 1DF5A 1KD1W 2JEUA 1K4CC 4WFAV 3LUTB 3CXCU 4OXSA 5B1AB 5LHIA 3ABUA 4JASA 5CMUA 2IJHA 1WPXA 1VQ9V 1OCOC 2JK5C 5B1BB 3QNEA 3OW2U 4BIZA 4QNHB 1PNLA 1R6NA 3OR6C 4L87A 1NVPB 2QEXV 1H2GA 2DWEC 3ETEA 4KP4A 5L3CA 2XNDG 4J9YB 1LNQA 1S77D 3SYAA 3ABMC 1JJ2U 2WLNA 4BW5A 2WAMA 3MHHC 4F4LA 2P90A 1OCRC 3WG7B 2EIMB 3GWOA 1K9MW 4PELA 3CYOA 3TETA 1K73W 1IXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 V;  3CD6 V;  1Q82 W;  5DM6 V;  3G6E V;  1M90 W;  1YJ9 V;  2D3O W;  3OW2 U;  1N8R W;  1VQN V;  1VQL V;  3CC2 V;  1YJW V;  1S72 V;  2QA4 V;  4WFB V;  1VQM V;  1QVF U;  2QEX V;  3G71 V;  1Q86 W;  4WCE V;  3CC7 V;  3CCJ V;  3CMA V;  1VQ4 V;  1YIT V;  1YIJ V;  1VQ7 V;  1VQ8 V;  3CPW U;  1YJN V;  3CCV V;  4WF9 V;  3I56 V;  1YI2 V;  1NJI W;  1Q7Y W;  1JJ2 U;  3CCR V;  1YHQ V;  1VQ6 V;  1VQP V;  3CCE V;  3CC4 V;  3CCS V;  1KD1 W;  1VQ5 V;  2OTL V;  1Q81 W;  2OTJ V;  3I55 V;  3CCL V;  1VQK V;  1R73 A;  3CCM V;  3CCQ V;  1VQO V;  1K8A W;  3CME V;  4WFA V;  1KC8 W;  1K9M W;  1KQS U;  3CXC U;  3G4S V;  1QVG U;  1K73 W;  1W2B U;  1M1K W;  3CCU V; 
#chains in the Genus database with same CATH topology
 4DR6 B;  1Q6H A;  1WJZ A;  3CWB H;  4K0K B;  3CJH A;  1MA1 A;  5DN6 G;  2WWW A;  1I5Y A;  1SER A;  1JA8 A;  1KYO F;  1P49 A;  4TT3 G;  3FB6 C;  2YI8 A;  4GKJ B;  4JYB A;  4JI3 O;  2HLD G;  5LMN B;  1WP8 A;  2B5U A;  3J80 N;  3EHB B;  3ETG A;  3STZ C;  4FLX A;  4PHZ A;  2KQX A;  2R70 A;  5CA1 A;  4I7Z B;  1V54 B;  4LF7 O;  1Y74 A;  2L6L A;  4K8X A;  2N74 A;  2DOS A;  1R6K A;  1KU9 A;  1VQ4 V;  2A3Q A;  1VQ7 V;  5J9P C;  4BAY A;  4EFB A;  3ASN B;  1BQZ A;  4ASU G;  4PI2 A;  1DLB A;  3JAT B;  4DR7 O;  4LF8 B;  4JI6 O;  4JV5 B;  1NZ6 A;  4CS4 A;  2HJF C;  2Q9L A;  4U7N A;  3P32 A;  1J5E O;  4UV8 A;  4O4H B;  2VQF B;  2ZDI C;  3ZRX A;  3D8C A;  2XAH A;  1URF A;  1OCZ B;  1I94 B;  1RFY A;  2ITD C;  2ZIM A;  5BR8 B;  1M93 A;  5KHI A;  1YTF D;  1RM1 B;  2XAF A;  1PL0 A;  1KUQ A;  5CA0 B;  1RPO A;  1QCE A;  1QVG U;  4HNA B;  2E3C A;  1OZ0 A;  3SJA C;  1SF9 A;  4ZOL A;  3ZHT A;  2HHH B;  1AJQ A;  1SKV A;  3CC7 V;  1YSC A;  3ABL C;  2B1I A;  1NJI W;  2Y0I A;  1EM1 A;  2ZT9 B;  3ABK B;  3ZMZ A;  2N05 A;  4QIW F;  2EBO A;  2ZQM A;  1SRY A;  1THZ A;  1Q90 D;  4JTA B;  3ZCC A;  4DK0 A;  4BR6 A;  1PP9 H;  3K06 A;  5IJ0 B;  1VEW A;  2WLH A;  4B3M O;  3AK1 A;  4KXR A;  4YHH B;  1XI1 A;  4DR2 O;  4AQY B;  5IYB O;  4I55 A;  3OD4 A;  3THO A;  1GM9 A;  3A0H Z;  5C93 A;  5LHG A;  2MW2 B;  4B7K A;  1WA8 B;  2QWR B;  3JAL A;  1VMG A;  2VQE O;  1NTZ H;  1KBH A;  4X66 B;  4DW1 A;  5FNV B;  1FXK B;  3IAY A;  2QM8 A;  3APQ A;  1YIT V;  5KMG A;  4DV4 O;  1XOU A;  4QPK A;  2HKO A;  2WLM A;  3AG3 B;  3RBZ A;  4UCS A;  4DR3 O;  5IY5 B;  3DC6 A;  3LSU A;  5LA6 A;  2OIE A;  3WB2 A;  4WFF A;  5DM6 V;  1UPG A;  1R1B A;  3N2G B;  3HKB B;  4RAI A;  2IJI A;  4DV0 B;  5LHH A;  1YTF B;  5JCO A;  5KAI Z;  2BTQ B;  3L70 H;  3EFF K;  3QG5 A;  4TSF G;  5LYJ B;  2HJD A;  2GV9 A;  1COW G;  4TUY B;  2RMK B;  1M57 B;  1XNQ O;  4YIO A;  3H1I H;  5AG2 A;  3T4Z A;  3D3Q A;  5EBL C;  3QO7 A;  3G4S V;  3SDL A;  4GYC B;  1W0K G;  3CRA A;  1Y67 A;  2HVJ C;  1B04 A;  1S5L Z;  3OEH G;  4XDK A;  4LF4 B;  2EIK B;  1EBO A;  3EVK A;  5KLV H;  2JGU A;  1PM9 A;  2X6C A;  4JI4 B;  1OJH A;  1ZX3 A;  3NXS A;  4MVS A;  3WG7 C;  2EIM C;  5DEC A;  1H2N A;  4LR3 A;  3QVN A;  1I5X A;  3N27 A;  5J2T B;  3K04 A;  1O9H A;  3RYF B;  1HNW B;  3C3T A;  1WPB A;  1TA8 A;  4MVQ A;  3WU2 Z;  3OMA B;  4JYA O;  5BMV B;  4LWS A;  1P4R A;  3K03 A;  1FJG O;  3ZIA G;  3JAT A;  2CE4 A;  1M4U A;  3FD9 A;  2P7T C;  4FFK A;  1M56 B;  2CTP A;  1NQT A;  4X88 A;  1S72 V;  3CEI A;  2YID A;  4O4H A;  2LO1 A;  2PUS A;  3K08 A;  2GHY A;  3SJB C;  1V9P A;  4JI7 O;  4UCR A;  3K9A A;  5LP6 C;  4ZI7 A;  5H2F Z;  3DXR B;  4NXN O;  1K5S A;  1BMF G;  1GAX A;  1MOF A;  2XT9 A;  1Z5V A;  1HWY A;  1IDS A;  3UQ8 A;  5CA0 A;  5FPO A;  4R7C A;  5LOV B;  4JI5 B;  1HP8 A;  5B66 Z;  2JRI A;  3LDE A;  2F93 B;  4IT5 A;  2XOK G;  1O9G A;  4QPJ A;  5GON A;  3AG2 C;  4J11 A;  3G67 A;  3CX5 F;  3ZMS A;  3CCU V;  2QWN B;  4FMT A;  5KX5 B;  1WN7 A;  5L3B A;  2Y4U A;  3B77 A;  5KHJ A;  1VQN V;  2F1M A;  4DUY O;  3KG2 A;  3IJ4 A;  3ZMV A;  2A06 H;  4YIP A;  3T1H B;  4DV7 O;  4GT1 A;  2CTR A;  5IJ0 A;  2DQ0 A;  1T5E A;  2FML A;  3ZMT A;  4GKK B;  4KUM A;  3ZN1 A;  3SPC A;  2ZE7 A;  1GM7 A;  1F23 A;  2YEV B;  2XAS A;  2XAJ A;  3E8G A;  2LFR A;  2LJ2 A;  2FB5 A;  3AG7 A;  1JOY A;  3DSQ A;  3W7T A;  3UO3 A;  1ORQ C;  2G38 A;  4DR6 O;  4DR4 B;  2IH1 C;  2IU0 A;  3KKY A;  4FLW A;  4B3R B;  4DR1 B;  5FNV A;  4X65 O;  3IC7 A;  3MHS C;  4OX9 O;  2B1G A;  1XNR B;  2CH7 A;  3OGC C;  2KKW A;  1K34 A;  2EIL C;  3ZHS A;  2VWK A;  2DW4 A;  4ZHQ B;  1NKD A;  4FLZ A;  2EIN B;  1P7G A;  4U3J B;  3N2G A;  2DWD C;  3D36 A;  1IBL O;  2H94 A;  2EIJ C;  1XHZ A;  1FD9 A;  2Q67 A;  2IBZ H;  3HB3 B;  1GTO A;  2BTQ A;  5EIB C;  3TXQ A;  4DYL A;  3K5L A;  3CCM V;  2JJ1 G;  2PYL A;  3RVZ A;  2ZR3 A;  4TUY A;  4FVM A;  4R6Z A;  2UXX A;  3Q4H B;  1N36 O;  1JVM A;  1S3J A;  4NB5 A;  5L3E A;  4H37 A;  1SQF A;  2P06 A;  2KB1 A;  3K0G A;  4X8A A;  2JS3 A;  1DF5 A;  1H2M A;  2JEU A;  4H13 B;  2GTA A;  4WFA V;  1A32 A;  3FX7 A;  3LUT B;  3CXC U;  5BR8 O;  1H2S B;  1XRE A;  2DE0 X;  4JAS A;  2IJH A;  3H9V A;  1OCO C;  1TUB B;  2JK5 C;  3UT5 A;  2YXH A;  1RSO B;  2QKC A;  4B3T B;  1PNL A;  1R6N A;  1NVP B;  4L87 A;  3ZHR A;  4U3F H;  4YJ3 A;  1H2L A;  2HHH O;  3SYA A;  2RNB A;  2WAM A;  3MHH C;  4CH6 A;  3WG7 B;  2EIM B;  4DV2 B;  3L75 H;  1K9M W;  2Q7H A;  1YCI A;  3CYO A;  1IXM A;  1NR1 A;  5BMV A;  3OAA G;  5B3S B;  1QQC A;  3FB5 C;  5H6Q A;  1I7F A;  1H2K A;  2QA4 V;  1W0J G;  1SA0 A;  5KUK A;  2AZ0 A;  2ZE5 A;  4FK5 C;  1MNG A;  1Y4M A;  4AQY O;  1VQO V;  4X20 A;  4FLT A;  4ZOL B;  3QTC A;  5LMU O;  2KG7 A;  4IL6 Z;  4X62 O;  3A8T A;  3H1L H;  3DTU B;  3CXH F;  3DXR A;  3E8F A;  1KP2 A;  2LGW A;  4LFC O;  4ZKI A;  3OTO B;  4L8J A;  2ZDI A;  2P4V A;  2JDI G;  2QTS A;  4YY3 B;  1ZLZ A;  4H0L B;  3FFQ A;  1PL4 A;  3B4S A;  1BCC H;  4JGS A;  3CCQ V;  2CAZ C;  4IGG A;  2ITC C;  1Y6X A;  5EIB D;  4DV3 B;  3JCZ A;  3LNN A;  2YI9 A;  2OCC B;  1N8R W;  2QDO A;  4FPP A;  4MTG A;  2E5L O;  2RCV A;  1GKF A;  3CB2 A;  4G28 B;  4MT8 A;  3AG2 B;  2XTA A;  2WLI A;  3SPI A;  4TWK A;  3JD2 A;  3ZHU A;  1K3E A;  4JTD B;  3RWR D;  2RDC A;  1NI8 A;  3C90 A;  5JQG B;  3JAR A;  4LF9 B;  4MSW C;  5KMG B;  3RFR A;  2YIC A;  1SQV H;  4JI8 O;  1KKC A;  1D2D A;  4JI0 B;  3F5T A;  2X6A A;  3ZED A;  4WF9 V;  3L73 H;  4BW9 A;  4IYH A;  4DV1 O;  5JH7 A;  5IE9 A;  3D3I A;  4LF4 O;  5LA6 B;  5IDJ A;  2OTL V;  2OTJ V;  1K8A W;  1R73 A;  3ML0 A;  2WLK A;  2LP7 A;  4GUN A;  1S0V A;  2NNU A;  3ETD A;  5EC1 C;  3UCS C;  3MD0 A;  1YEW A;  5JJE B;  3K58 A;  2AGA A;  3PN1 A;  2CTQ A;  4FZ0 A;  2AW9 A;  2JJ2 G;  4U3J A;  3SPG A;  1BT8 A;  3OGI B;  2QM7 A;  2AZ2 A;  2WPD G;  3ZN0 A;  2UUB B;  3VQX A;  1FPO A;  3B40 A;  3CP1 A;  1TGO A;  2OCH A;  3FAV B;  3CCJ V;  1V55 C;  1SES A;  2EIJ B;  4I0X A;  2K1E A;  3Q4H A;  1VQ8 V;  1F4N A;  5IYZ B;  3ZBH A;  1ZSP A;  1IBM B;  1MAB G;  2Z3Y A;  4EKW A;  2Q6A A;  2UU9 B;  1G4Y B;  4KHP O;  1SC5 B;  3BPZ A;  2P5O A;  1B3Q A;  1GM8 A;  5B5E Z;  2YIA A;  4LFA B;  1L0L H;  3APO A;  3CSX A;  1DK1 A;  1NU1 H;  4MVZ A;  5IWA O;  1VAR A;  4LFB O;  2ADP A;  2QKS A;  4DRX B;  4UCV A;  1TUB A;  2VRZ A;  4LWS B;  3BRC A;  1RSO A;  1FFX A;  3CRR A;  4I4T B;  4TQD A;  1Q7Y W;  3U11 A;  3ZRW A;  4KFM A;  4EEQ A;  2OWO A;  5EYP A;  5KUM A;  2Q68 A;  1S5H C;  1NTM H;  1OCO B;  2KSD A;  1WLE A;  1YZB A;  1KP3 A;  4MVR A;  3J81 N;  4I50 B;  4HZ3 A;  1XUQ A;  2DYR C;  2ETN A;  1EN5 A;  4OGQ B;  4WCE V;  4PDM A;  1HNZ O;  3P3N A;  4X1Y A;  1N34 B;  2A0L A;  2WLJ A;  1EZV H;  2Q0O C;  4ZI7 B;  1FXH A;  5JJJ B;  1JPX A;  4X64 B;  3T1H O;  1WNS A;  1GN6 A;  4JAV A;  5L3G A;  4I9W A;  4UCT A;  3W7U A;  1IBK O;  1M9N A;  4FLY A;  2D3O W;  5LL6 Y;  1VF7 A;  4H33 A;  4AIL C;  3OT7 A;  3F7V C;  2ZKO A;  4IHJ B;  4LC1 A;  2F4V O;  1FXV A;  5GON B;  3CRQ A;  2PI5 A;  2ZM6 B;  3ZHV A;  4GX0 A;  1ROP A;  4QJF B;  2IU3 A;  1QLN A;  4J41 A;  3G6B A;  4DR4 O;  1VQ5 V;  4A5U B;  4RUE A;  2EZO A;  4MVU A;  4B3R O;  3G80 A;  4DR1 O;  1MZF A;  1N33 B;  4XDJ A;  5LP6 A;  3MAQ A;  3OEE G;  3AG1 C;  2YUA A;  3S3X A;  2GTS A;  3E8H A;  3P3P A;  4LH7 A;  3RYI B;  4GX5 A;  1NBM G;  2K9P A;  2MK3 A;  4U7O A;  2UUC B;  1VIB A;  3J7A U;  3SYC A;  2UXB B;  1QHT A;  1FAF A;  4CH3 A;  3TK1 A;  4JTC B;  1SZX A;  5IYD O;  1P84 F;  5DED A;  1NH2 D;  1XEQ A;  4JYC A;  4O2B B;  1K7D A;  1N0J A;  3OE7 G;  4OPA A;  4DV5 O;  4B7E A;  1ZTE A;  4FLV A;  5JQG A;  4NXM O;  1OV9 A;  3HPL C;  5B1O A;  3ZRV A;  4ICG A;  2CH7 B;  2X0L A;  2B9Z A;  1PV0 A;  1JJO A;  4NVP A;  3OMN B;  4EFE A;  4Z2W A;  1M1K W;  3CE2 A;  1P7B A;  2DYS B;  3LSQ A;  3E83 A;  3K79 A;  5CBH A;  1QLE B;  1CP9 A;  1FFT B;  2FL4 A;  2QWQ B;  3JAS A;  1SS3 A;  1CPY A;  4PV1 B;  4CZZ A;  2FTK A;  3GB7 C;  2AXT Z;  4QE9 A;  3VQW A;  2ZD9 A;  4BIU A;  1N32 B;  5K1P A;  4DV2 O;  5KA5 A;  1K97 A;  4J9Z B;  1K92 A;  1GN2 A;  3K5M A;  5BY1 A;  3T1Y O;  1MMM A;  3E89 A;  4DUZ B;  4RQF A;  3FAV A;  3HKD A;  3CC4 V;  1XMQ B;  1RPR A;  3AK3 A;  5IYZ A;  3GWK C;  3UT5 B;  3CS5 A;  2BTO A;  2V1D A;  4YJ3 B;  4TV8 B;  4GZR B;  4O4L A;  5C8Y A;  2YIB A;  5ITZ A;  5IYC O;  2GSM B;  1XIL A;  4MTO A;  4DRX A;  3OTO O;  4LNU A;  4UV9 A;  1JFF B;  5EZY A;  5KAF Z;  2UXD O;  2Y69 C;  1ENV A;  1R3K C;  4TQF A;  1NH2 B;  4BWA A;  4DR5 O;  4I4T A;  2UXC B;  3AEI A;  1OHH G;  1BQ0 A;  2IH3 C;  3IGA C;  1SA0 B;  1HR0 O;  4PDL A;  5EK0 A;  4LP8 A;  3K3W A;  1J95 A;  1JX9 A;  4PA4 A;  4JI2 O;  2NLJ C;  4I50 A;  2Q69 A;  4X20 B;  4E2L A;  5K1X A;  2KG7 B;  2ZIN A;  4B3S O;  1KD1 W;  3AK2 A;  1X4T A;  3WB1 A;  4OXS A;  4K8Z A;  5CMU A;  1WPX A;  4O2A B;  1YDX A;  2E76 B;  4I9Q A;  1Y76 A;  4QNH B;  3KCX A;  3OR6 C;  2QEX V;  4JI3 B;  3ETE A;  4KP4 A;  1LNQ A;  4DW0 A;  1XDC A;  1JJ2 U;  2WLN A;  5TIS Z;  4BW5 A;  4F4L A;  4IHJ A;  4JI0 O;  3MDS A;  1BS3 A;  4LF7 B;  4PEL A;  2QKA A;  4UB8 Z;  3TET A;  4FFB A;  2EJ7 A;  4JPR A;  2UUA O;  4ABM A;  1YJW V;  2GDS A;  4DR7 B;  1HW7 A;  1X59 A;  3ABL B;  3T1C A;  3BFR A;  2WLI B;  2A7W A;  1AP5 A;  1N4C A;  2IW5 A;  1J5E B;  1GO3 F;  3RYI A;  3JAR B;  4DV6 O;  3W7X A;  4P9O A;  3T4D A;  4O4I A;  2UUB O;  3CHX A;  5A9G A;  2WLL B;  4UFZ A;  5JH7 B;  2BSK B;  4K0K O;  3AG4 C;  4O2B A;  4JF3 A;  1VF5 B;  2ADQ B;  5LXT A;  4W4L A;  4UXN A;  4GKJ O;  1N0N A;  1HNX B;  4RQE A;  2CK3 G;  5LMN O;  1QNM A;  4PI0 A;  3JCU Z;  3ZS8 C;  2E75 B;  2VWJ A;  1GRJ A;  1YJN V;  3OUS A;  3SYO A;  2ZXW C;  3RT3 C;  3CCE V;  4B3M B;  2E74 B;  5KHH A;  4X1I B;  4DR2 B;  1PD3 A;  2A9H A;  4LF8 O;  1GH6 A;  4JV5 O;  4I0X B;  3VQY A;  1R6T A;  3G71 V;  1TUE B;  3CMA V;  1YIJ V;  2VQF O;  4ZIB A;  2HVK C;  1NTK H;  1I94 O;  2NN4 A;  2P6J A;  3LSS A;  4R8C A;  5IJ9 A;  2F43 G;  3CME V;  3M8A A;  3W7S A;  4X64 O;  5HFL A;  4DV4 B;  3LNM B;  4LBE C;  1FFX B;  3OTF A;  3SJC C;  2YXL A;  4PD4 F;  3RGB A;  3ZRW B;  4TV8 A;  5EYP B;  4DR3 B;  2F23 A;  3B2E E;  3ASN C;  5KHK A;  4UVA A;  5FL7 G;  2YSU B;  2DQ3 A;  2ZM6 O;  4F6E A;  4HBN A;  4HYO A;  1GN4 A;  1JFF A;  1MZE A;  3H1K H;  4DK1 A;  4X1Y B;  2Q7E A;  4X89 A;  1SQQ H;  1AB3 A;  1QVF U;  3E2E A;  1B6Q A;  1EN6 A;  3F5W C;  3ICX A;  1AI5 A;  3FYI B;  3UM7 A;  3OFN G;  1RP3 B;  2Y69 B;  3BEH A;  1K33 A;  4YHH O;  3SPH A;  1AJN A;  4CBC A;  3CCL V;  3PJS K;  2HG5 C;  1FKA O;  4RO2 A;  1BE3 H;  4YJ2 A;  4J7J A;  2UXB O;  1AJP A;  1E1R G;  4GX1 A;  4O2A A;  3BVO A;  3FB7 C;  2H8P C;  3E86 A;  4EB6 A;  4X66 O;  1PKX A;  1G6U A;  1QU7 A;  2RN9 A;  5LP6 B;  3ABK C;  4X1K A;  5EBM C;  2BOC C;  1QR8 A;  2EJR A;  3A0R A;  1GMG A;  5D5Q A;  1GK9 A;  3U10 A;  2GUZ B;  5B1B C;  4WFB V;  2Y4T A;  3B8M A;  4JYA B;  2YIB D;  2ATK C;  4I5S A;  2Q4P A;  1WB8 A;  4DV0 O;  2PI4 A;  5CB4 B;  3P30 A;  1Q81 W;  1H8H G;  1HDJ A;  1LUV A;  4XBF A;  1LR1 A;  3JD3 A;  3SJQ C;  2QWP B;  5H6R A;  2R9R B;  2JGD A;  1FXK C;  4CC5 A;  4AI8 A;  3B8N A;  2R9A A;  1QBZ A;  4J7K A;  2WLL A;  3L71 H;  2BSK A;  3LDD A;  1L0N H;  1IUR A;  1L1F A;  2EZP A;  1TVK B;  3QO8 A;  2W6I G;  4QE7 A;  1JCH A;  4WFE A;  4JI4 O;  1BHB A;  3NR7 A;  3STL C;  2QM4 A;  3JD4 A;  4D7S A;  4QGP A;  1OCC C;  1AR5 A;  5L3D A;  3L72 H;  2D2C B;  3JAS B;  5JJN B;  2IJJ A;  2X7R B;  2ZR2 A;  1Q5O A;  2M6Y A;  5FLX N;  5IT9 N;  1E1Q G;  1M57 C;  4WBN B;  3I55 V;  1HNW O;  1IVS A;  2IM9 A;  3RW0 A;  3TJT A;  2EIL B;  1E79 G;  4G27 B;  1ZL8 B;  4DV7 B;  1Q82 W;  4LF6 B;  4N23 A;  2CGO A;  1Q6I A;  2QGN A;  1Q3E A;  4X1I A;  2PF4 E;  2OIG A;  5BZB A;  5GTI Z;  1PPJ H;  1VF6 C;  2EIK C;  3HKD B;  2ZXW B;  3E35 A;  3VOU A;  1WAZ A;  4TV9 A;  1M5I A;  1H8E G;  1BSM A;  3SPJ A;  2Q73 A;  2N04 A;  3DC5 A;  3HKC B;  3JYC A;  2C2A A;  4O4L B;  4P9P A;  5C8Y B;  5ITZ B;  1AI4 A;  4MTF A;  4Z1M G;  1I0H A;  4G2K A;  4JZG A;  1AI7 A;  2HEP A;  4X65 B;  1MSD A;  2XUM A;  4LNU B;  4OX9 B;  5EZY B;  1Y66 A;  2BE3 A;  4JI1 B;  1ARO P;  1S76 D;  4JI5 O;  1XMO B;  1B06 A;  4LH6 A;  2DMX A;  1XHX A;  1IBL B;  5D5P A;  3R65 A;  1M56 C;  3JAW B;  5KA6 A;  3RYC B;  4MTX A;  3I56 V;  5JVD A;  4UVC A;  2Z0A A;  2ZCE A;  1N36 B;  1DGS A;  3O65 A;  4GKK O;  1Y76 B;  3IFX A;  1R3I C;  4FM2 A;  3H1J H;  4IYI A;  3HKE B;  2OYQ A;  1L8D A;  2QJ1 A;  1EN4 A;  4WFG A;  2LW1 A;  3KCY A;  2JVD A;  1ZAU A;  1UJW B;  4FJC C;  4PA6 A;  2YC0 A;  4PA3 A;  4K3A A;  1VQ6 V;  4FFB B;  3OUF A;  2Y0P A;  3JAK B;  3H01 A;  1SET A;  1KC8 W;  3B09 A;  4PJ0 Z;  4RWU A;  2JIZ G;  2FYU H;  1TAE A;  3CD6 V;  1XNR O;  2WSS G;  2QE7 G;  2P22 C;  1HNX O;  4W4K A;  5J2U B;  2CGN A;  2DN9 A;  2GUZ A;  1BL8 A;  4PA9 A;  4DO2 A;  3TGU H;  1R3L C;  2RQ6 A;  2FKX A;  2RJZ A;  1YF2 A;  4CH5 A;  2F66 C;  4O4I B;  3ABU A;  1U96 A;  1VQ9 V;  5CB4 A;  5B1B B;  3QNE A;  4BIZ A;  2DWE C;  2XND G;  5LXT B;  5LMU B;  3ABM C;  3HR0 A;  1SQG A;  4X62 B;  4CS3 A;  5KHG A;  4LF5 B;  2P90 A;  1OCR C;  4JAA A;  5GTH Z;  3GWO A;  3SR2 C;  4LFC B;  2Q8V A;  2ARH A;  4F6R A;  3BAB A;  4NKG B;  1K73 W;  4NTY A;  2R9I A;  3G6E V;  1YJ9 V;  1TVK A;  4UCO A;  2EIN C;  2XAQ A;  1DTO A;  3F7Y C;  4P30 A;  5LGT A;  4B3T O;  3A0B Z;  4LCU C;  3BHP A;  2L35 A;  3LDC A;  1JR9 A;  4MW8 A;  5H9C A;  2X6B A;  3EXA A;  1FYJ A;  3TCU A;  4WBN A;  1NR7 A;  2E5L B;  1Z5W A;  3C3S A;  1AIL A;  3CRM A;  1OCC B;  1ZL8 A;  1WB7 A;  1AVM A;  3I5D A;  3BY6 A;  3L74 H;  2WA4 A;  3ETQ A;  5LGN A;  1NS1 A;  4BIO A;  5IJ9 B;  3WFV A;  3IC9 A;  1WP7 A;  1AP6 A;  2WA3 A;  4MS2 A;  2ZNJ A;  2LGQ A;  1MG1 A;  2P67 A;  4JYY A;  4JI8 B;  1W2B U;  1PNK A;  2QSA A;  2QWO B;  4J80 A;  2ZNI A;  3HKC A;  1IX9 A;  4IIJ A;  4NYK A;  4DV1 B;  3JD0 A;  1V55 B;  3M7M X;  4TOI A;  1US6 A;  2M7W A;  1Z2G A;  4KL1 A;  2PYJ A;  3E22 B;  4X9Q A;  3OM3 B;  1CXZ B;  4WFH A;  1NT2 B;  4C7U A;  4YY3 O;  2DJV A;  4FM0 A;  1S5J A;  2CTW A;  1Q43 A;  3TXS A;  2LFS A;  5B3S C;  1Q6U A;  4UUJ C;  2Q0A A;  3N2K B;  4DV3 O;  2XAG A;  1ZUQ A;  4J7Z A;  5CA3 A;  1QR9 A;  1F4M A;  3JAW A;  2XHB A;  2BCC H;  5B1N A;  4YJ2 B;  3RYC A;  3RVY A;  1G8M A;  1BHA A;  2DYR B;  3JSL A;  4EB6 B;  3H1H H;  1VQM V;  3HKE A;  3UKM A;  4X1K B;  4KHP B;  1LUW A;  2EX3 A;  4LF9 O;  3FKS G;  2A79 B;  4GX2 A;  5FPR A;  5IWA B;  1KQS U;  4LFB B;  3X2Q C;  3JAK A;  4CC6 A;  2OCC C;  4K35 A;  1BZK A;  4HNA A;  3GVM A;  2W6J G;  4JI6 B;  1H38 A;  3T2M A;  3L9D A;  1AR1 B;  3K0D A;  4GLX A;  5J2U A;  3K57 A;  4RUF A;  2W0X A;  3ZHQ A;  2Y48 A;  1AI6 A;  3AG1 B;  2YDE A;  1HNZ B;  2AHY A;  2JEX A;  2JGD B;  4FM1 A;  2P4K A;  2BOB C;  2V7Q G;  3UO2 A;  3FYE B;  4LF6 O;  3ASO C;  3ZX6 A;  4P2Z A;  2HP8 A;  4O4J B;  4PA7 A;  2NR5 A;  2PTM A;  3OMI B;  1NVP D;  1IBK B;  4J10 A;  1Q8I A;  2Q7G A;  3RN4 A;  2IJK A;  1VQP V;  3E8B A;  1IBM O;  3WB0 A;  4N21 A;  5B1A C;  2F4V B;  2UU9 O;  1WA8 A;  1F51 A;  5JCO C;  1XL4 A;  1XQ8 A;  3ZJZ A;  4LFA O;  3ABM B;  1D5N A;  1FXK A;  2GBO A;  1YI2 V;  1K4D C;  5BXZ A;  1OCR B;  1YHQ V;  5EBW C;  1W59 A;  4NTW A;  1FS0 G;  1KMI Z;  1XBL A;  4JI1 O;  2LW7 A;  2ZE8 A;  4FZ1 A;  3JD1 A;  4Q20 A;  2CUG A;  1VQL V;  1XMO O;  3BA9 A;  4TV9 B;  1G1X B;  4D7T A;  1IXB A;  3BCC H;  1KKD A;  3HKB A;  4UVB A;  4D6T H;  5CN0 A;  4YXW G;  3VBB A;  3RYH B;  1YVW A;  4E4E A;  2H3O A;  3ZRS A;  2VQE B;  2CDY A;  5LYJ A;  1N34 O;  1I08 A;  1KEC A;  3CJH B;  5F2V O;  3OR7 C;  5CBF A;  3DGE A;  4DV5 B;  2PZS A;  1EZJ A;  4NR1 A;  1SQB H;  1JQ0 A;  5GW7 A;  4NXM B;  3SYP A;  3SYQ A;  1VP7 A;  2ZIO A;  1V54 C;  2QTO A;  2Z5U A;  3K59 A;  1SZT A;  1Q86 W;  2HR3 A;  1EFR G;  4FIP C;  1VF6 A;  5H5N A;  2W0F C;  3E22 A;  2QR4 A;  5CA1 B;  1Y74 B;  1BGY H;  4UCU A;  3K5N A;  2LQT A;  3ABT A;  3KZI Z;  5HFM A;  3BAA A;  2ILM A;  1N33 O;  5JVD B;  1OCZ C;  1XNQ B;  3K5O A;  3CPW U;  5J2T A;  1K5Q A;  3JSN A;  3N2K A;  5CBG A;  3RYF A;  4OPH A;  3VQV A;  3QO5 A;  4Z1V A;  1F7Y A;  4FLU A;  1RM1 C;  1YXB A;  1XL6 A;  3S3W A;  3ZMU A;  4PDR A;  5E79 Z;  2UUC O;  3T1Y B;  3R66 A;  2PY5 A;  2Q5Z A;  4ZBM A;  4DXW A;  1MSW D;  2PGG A;  3K9S A;  4JAU A;  3U0Z A;  4HAM A;  3CRC A;  4MVM A;  1R3J C;  1SQX H;  3W7W A;  2O57 A;  4LF5 O;  5LBQ A;  4R50 A;  2AHZ A;  2UXD B;  2YS8 A;  1FJG B;  5E1A C;  4DR5 B;  4Q6G A;  4AHC A;  4J42 A;  1KB9 F;  5LOV A;  3CCS V;  2VS0 A;  3X2Q B;  1HR0 B;  4MW3 A;  4B08 A;  1U97 A;  1CEZ A;  4JI2 B;  1M90 W;  3CC2 V;  4I55 B;  1N32 O;  4JI7 B;  4B3S B;  5KX5 A;  4CS2 A;  1D5A A;  4XDL A;  2UXN A;  4NXN B;  4JZ2 A;  1AR4 A;  3JAL B;  4MVO A;  4F6R B;  3AG3 C;  1JMK C;  4O4J A;  3FB8 C;  1ZWI C;  1VQK V;  1SQP H;  2EUL A;  4DUZ O;  5IY5 C;  5EC2 C;  5JWP A;  2YEV A;  3A2F A;  1PNM A;  1UFI A;  5LGU A;  5L3F A;  1XMQ O;  1IZ3 A;  4GCZ A;  2HFE C;  3ASO B;  3D36 C;  3M99 B;  3JAM N;  2DYS C;  1DF4 A;  3AG4 B;  2OT5 A;  3BA8 A;  3CCV V;  1QLE C;  3CCR V;  4PDV A;  3O9O A;  2UUA B;  3QF7 A;  1K4C C;  2JS5 A;  3SGI A;  5B1A B;  5LHI A;  2F95 B;  4DUY B;  2ZE6 A;  2V4D A;  3OW2 U;  2UXC O;  1H2G A;  4UB6 Z;  4ZHQ A;  5L3C A;  4J9Y B;  1S77 D;  5A2Q N;  2R72 A;  4DV6 B;  2YXY A;  4CH4 A;  4H44 B;  2ODM A;  3RYH A;  1GN3 A;  4IIJ B;  4NTX A; 
#chains in the Genus database with same CATH homology
 1NR1 A;  2R9I A;  4JPR A;  3G6E V;  3OAA G;  5B3S B;  1YJ9 V;  3FB5 C;  5H6Q A;  5DN6 G;  1YJW V;  2WWW A;  2QA4 V;  1I5Y A;  2EIN C;  2XAQ A;  1SER A;  1DTO A;  3F7Y C;  3ABL B;  1W0J G;  4P30 A;  3T1C A;  4TT3 G;  5KUK A;  2WLI B;  3FB6 C;  2IW5 A;  5LGT A;  4FK5 C;  4LCU C;  4JYB A;  1GO3 F;  2HLD G;  1Y4M A;  1VQO V;  3LDC A;  2B5U A;  3EHB B;  4MW8 A;  3ETG A;  5H9C A;  3W7X A;  3STZ C;  2X6B A;  3DTU B;  4P9O A;  3TCU A;  3T4D A;  1NR7 A;  3E8F A;  1KP2 A;  1V54 B;  4ZKI A;  1OCC B;  2WLL B;  2ZDI A;  1R6K A;  2JDI G;  3BY6 A;  1VQ4 V;  1VQ7 V;  5J9P C;  4BAY A;  5LGN A;  3AG4 C;  3ASN B;  4JF3 A;  3WFV A;  4ASU G;  1DLB A;  4MS2 A;  4JGS A;  2HJF C;  1MG1 A;  3CCQ V;  2P67 A;  4U7N A;  4UXN A;  2ITC C;  1W2B U;  1PNK A;  3P32 A;  4UV8 A;  3JCZ A;  2ZDI C;  4RQE A;  2CK3 G;  2OCC B;  1N8R W;  3ZRX A;  2XAH A;  4FPP A;  3JD0 A;  1OCZ B;  1V55 B;  4MTG A;  2ITD C;  2M7W A;  1YJN V;  3OUS A;  1GKF A;  3SYO A;  2ZXW C;  4G28 B;  4MT8 A;  3AG2 B;  1YTF D;  3CCE V;  3OM3 B;  4WFH A;  2WLI A;  1RM1 B;  3SPI A;  2XAF A;  1PL0 A;  4TWK A;  3JD2 A;  1RPO A;  1QCE A;  1K3E A;  1QVG U;  4JTD B;  1PD3 A;  2A9H A;  1OZ0 A;  2LFS A;  4MSW C;  1AJQ A;  5B3S C;  4UUJ C;  3G71 V;  3CC7 V;  1TUE B;  3CMA V;  2XAG A;  1YSC A;  1YIJ V;  2X6A A;  3ABL C;  5CA3 A;  4WF9 V;  2B1I A;  1QR9 A;  1NJI W;  1F4M A;  2HVK C;  3D3I A;  3ABK B;  3ZMZ A;  5IDJ A;  4QIW F;  2OTL V;  5B1N A;  2ZQM A;  2P6J A;  1SRY A;  2EBO A;  1THZ A;  3LSS A;  1R73 A;  4R8C A;  2F43 G;  3RVY A;  1K8A W;  3ML0 A;  3CME V;  4JTA B;  3ZCC A;  2WLK A;  2LP7 A;  3W7S A;  5HFL A;  1G8M A;  1S0V A;  2NNU A;  3ETD A;  3LNM B;  3K06 A;  1BHA A;  5EC1 C;  4LBE C;  2DYR B;  2WLH A;  1VQM V;  3MD0 A;  3ZRW B;  3UKM A;  5IYB O;  3FKS G;  3ASN C;  2JJ2 G;  2A79 B;  4UVA A;  1GM9 A;  4GX2 A;  5FL7 G;  3SPG A;  5C93 A;  5LHG A;  2QM7 A;  2YSU B;  1KQS U;  2DQ3 A;  4HYO A;  2WPD G;  3ZN0 A;  3X2Q C;  2OCC C;  4X89 A;  1FXK B;  1QVF U;  3CP1 A;  3E2E A;  2QM8 A;  1B6Q A;  3CCJ V;  2W6J G;  1V55 C;  1YIT V;  1SES A;  2EIJ B;  3F5W C;  2K1E A;  1H38 A;  1VQ8 V;  1AI5 A;  1F4N A;  3FYI B;  4QPK A;  2HKO A;  3OFN G;  3UM7 A;  3T2M A;  2WLM A;  2Y69 B;  3AG3 B;  3BEH A;  3RBZ A;  1K33 A;  1MAB G;  2Z3Y A;  4EKW A;  3SPH A;  1AJN A;  2Q6A A;  1AR1 B;  3K0D A;  1G4Y B;  4CBC A;  3CCL V;  3PJS K;  4RUF A;  2HG5 C;  5IY5 B;  4RO2 A;  1GM8 A;  2Y48 A;  1AI6 A;  3AG1 B;  2AHY A;  4WFF A;  2JEX A;  5DM6 V;  4MVZ A;  2BOB C;  1AJP A;  2V7Q G;  4RAI A;  2IJI A;  2QKS A;  1E1R G;  4GX1 A;  5LHH A;  3FB7 C;  1YTF B;  2H8P C;  3E86 A;  3FYE B;  3ASO C;  4P2Z A;  4PA7 A;  3EFF K;  4TSF G;  3OMI B;  1PKX A;  1NVP D;  1Q7Y W;  1COW G;  3ZRW A;  4KFM A;  3ABK C;  5KUM A;  1M57 B;  2Q68 A;  5EBM C;  1S5H C;  2BOC C;  3T4Z A;  1QR8 A;  5EBL C;  2EJR A;  3QO7 A;  1OCO B;  3G4S V;  2IJK A;  3A0R A;  1GMG A;  1W0K G;  1VQP V;  3E8B A;  4N21 A;  5B1A C;  2HVJ C;  1GK9 A;  1WLE A;  1KP3 A;  4MVR A;  1F51 A;  4HZ3 A;  3OEH G;  5B1B C;  2DYR C;  4WFB V;  1XL4 A;  4XDK A;  3ZJZ A;  3B8M A;  4WCE V;  2EIK B;  4PDM A;  1EBO A;  2ATK C;  3ABM B;  2X6C A;  2A0L A;  2WLJ A;  4I5S A;  1FXK A;  1YI2 V;  1K4D C;  1FXH A;  1OCR B;  1JPX A;  5EBW C;  1YHQ V;  2PI4 A;  3P30 A;  1Q81 W;  1H8H G;  1FS0 G;  4JAV A;  4XBF A;  3NXS A;  4MVS A;  3WG7 C;  2EIM C;  3JD3 A;  5L3G A;  4I9W A;  3SJQ C;  3W7U A;  1M9N A;  3JD1 A;  1I5X A;  2D3O W;  4Q20 A;  1VQL V;  4H33 A;  5H6R A;  2R9R B;  3K04 A;  1FXK C;  3F7V C;  3B8N A;  1KKD A;  4LC1 A;  1QBZ A;  1FXV A;  4UVB A;  2PI5 A;  5CN0 A;  4MVQ A;  4GX0 A;  1ROP A;  4YXW G;  3VBB A;  2IU3 A;  2WLL A;  4QJF B;  1QLN A;  3OMA B;  3ZRS A;  3LDD A;  1VQ5 V;  1P4R A;  3K03 A;  4RUE A;  2EZO A;  4MVU A;  1L1F A;  2EZP A;  1KEC A;  3ZIA G;  4XDJ A;  3OR7 C;  5CBF A;  3OEE G;  3DGE A;  3QO8 A;  1EZJ A;  2W6I G;  3AG1 C;  2P7T C;  1JQ0 A;  4QE7 A;  5GW7 A;  3SYP A;  1JCH A;  3E8H A;  4WFE A;  3SYQ A;  1BHB A;  3STL C;  1M56 B;  3JD4 A;  1NQT A;  4X88 A;  1S72 V;  1V54 C;  2QTO A;  2Z5U A;  1SZT A;  1Q86 W;  1OCC C;  5L3D A;  2HR3 A;  3K08 A;  1NBM G;  1EFR G;  4FIP C;  4GX5 A;  2GHY A;  2IJJ A;  2X7R B;  2MK3 A;  2ZR2 A;  3K9A A;  4U7O A;  2W0F C;  1E1Q G;  1M57 C;  3SYC A;  3I55 V;  1K5S A;  1BMF G;  1MOF A;  3RW0 A;  3TK1 A;  2EIL B;  1E79 G;  4JTC B;  4G27 B;  1HWY A;  1Q82 W;  5IYD O;  1NH2 D;  4N23 A;  3ABT A;  5HFM A;  4JYC A;  1K7D A;  4R7C A;  3OE7 G;  5BZB A;  1OCZ C;  2EIK C;  2ZXW B;  3HPL C;  5B1O A;  3ZRV A;  3E35 A;  3CPW U;  3VOU A;  1K5Q A;  2X0L A;  3LDE A;  5CBG A;  1H8E G;  2XOK G;  4QPJ A;  3SPJ A;  3AG2 C;  3JYC A;  3QO5 A;  3OMN B;  2C2A A;  1RM1 C;  3ZMS A;  1XL6 A;  4P9P A;  1M1K W;  3CCU V;  3ZMU A;  4FMT A;  1AI4 A;  4MTF A;  4PDR A;  4Z1M G;  4G2K A;  5L3B A;  3B77 A;  1AI7 A;  1VQN V;  3KG2 A;  1P7B A;  3ZMV A;  4ZBM A;  2DYS B;  4DXW A;  3LSQ A;  4GT1 A;  1MSW D;  1Y66 A;  2DQ0 A;  3E83 A;  3K79 A;  3ZMT A;  5CBH A;  4JAU A;  1QLE B;  1CP9 A;  1FFT B;  4KUM A;  3ZN1 A;  1ARO P;  3SPC A;  4HAM A;  1S76 D;  1CPY A;  1GM7 A;  1F23 A;  1R3J C;  4MVM A;  4CZZ A;  2YEV B;  2FTK A;  3GB7 C;  2XAS A;  4QE9 A;  2ZD9 A;  4BIU A;  2XAJ A;  3E8G A;  2LFR A;  3W7W A;  1JOY A;  3W7T A;  5KA5 A;  4R50 A;  5LBQ A;  1ORQ C;  2AHZ A;  1M56 C;  3R65 A;  1K97 A;  4J9Z B;  1K92 A;  5KA6 A;  2IH1 C;  2IU0 A;  5E1A C;  4MTX A;  3I56 V;  3E89 A;  3IC7 A;  4RQF A;  4UVC A;  3CC4 V;  3MHS C;  3CCS V;  2B1G A;  1RPR A;  3OGC C;  3X2Q B;  4MW3 A;  3IFX A;  1K34 A;  2EIL C;  1CEZ A;  1R3I C;  2V1D A;  1M90 W;  2DW4 A;  1NKD A;  3CC2 V;  2EIN B;  4WFG A;  5IYC O;  2GSM B;  4XDL A;  2OTJ V;  4MTO A;  2UXN A;  2DWD C;  3D36 A;  1UJW B;  2H94 A;  4FJC C;  4PA6 A;  2EIJ C;  4PA3 A;  4UV9 A;  2Q67 A;  1VQ6 V;  3HB3 B;  4MVO A;  1GTO A;  2Y69 C;  3AG3 C;  3OUF A;  3FB8 C;  1ENV A;  1R3K C;  1ZWI C;  3H01 A;  1VQK V;  1NH2 B;  3CCM V;  2JJ1 G;  1SET A;  1KC8 W;  3RVZ A;  2ZR3 A;  5IY5 C;  3AEI A;  1OHH G;  2JIZ G;  5EC2 C;  3CD6 V;  2YEV A;  1PNM A;  4R6Z A;  2IH3 C;  5LGU A;  5L3F A;  2UXX A;  2WSS G;  1JVM A;  3IGA C;  4GCZ A;  1S3J A;  2QE7 G;  2HFE C;  3ASO B;  3M99 B;  4PDL A;  5EK0 A;  4LP8 A;  3K3W A;  4H37 A;  1J95 A;  5L3E A;  1JX9 A;  4PA4 A;  2DYS C;  2NLJ C;  1DF4 A;  3AG4 B;  2OT5 A;  3CCV V;  2KB1 A;  1BL8 A;  2Q69 A;  3K0G A;  4X8A A;  4PA9 A;  1QLE C;  4DO2 A;  4E2L A;  4PDV A;  3CCR V;  1R3L C;  1DF5 A;  1KD1 W;  2JEU A;  1K4C C;  4WFA V;  3LUT B;  3CXC U;  4OXS A;  5B1A B;  5LHI A;  3ABU A;  4JAS A;  5CMU A;  2IJH A;  1WPX A;  1VQ9 V;  1OCO C;  2JK5 C;  5B1B B;  3QNE A;  3OW2 U;  4BIZ A;  4QNH B;  1PNL A;  1R6N A;  3OR6 C;  4L87 A;  1NVP B;  2QEX V;  1H2G A;  2DWE C;  3ETE A;  4KP4 A;  5L3C A;  2XND G;  4J9Y B;  1LNQ A;  1S77 D;  3SYA A;  3ABM C;  1JJ2 U;  2WLN A;  4BW5 A;  2WAM A;  3MHH C;  4F4L A;  2P90 A;  1OCR C;  3WG7 B;  2EIM B;  3GWO A;  1K9M W;  4PEL A;  3CYO A;  3TET A;  1K73 W;  1IXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...