2QEXV

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qexV00
3CCJV 1VQPV 3G6EV 3CC2V 5DM6V 1YITV 4WFAV 3CXCU 3CMAV 1VQOV 3CCSV 1YHQV 1Q81W 1QVGU 1K9MW 1M1KW 3CD6V 3G4SV 2QEXV 3CPWU 1M90W 3CCEV 1Q7YW 3I56V 1YIJV 1YJWV 3CCQV 2QA4V 1VQKV 1VQ9V 1QVFU 1VQ4V 4WF9V 3G71V 1VQ7V 1YI2V 1W2BU 1Q86W 1YJ9V 1KQSU 1VQ6V 3CCRV 3I55V 1Q82W 1VQ5V 4WFBV 3CCLV 1VQNV 3CC7V 1JJ2U 1NJIW 3OW2U 2OTLV 3CCMV 4WCEV 1VQLV 3CMEV 1N8RW 1VQMV 1VQ8V 3CC4V 3CCUV 1R73A 1K73W 1KC8W 1S72V 2OTJV 1K8AW 1KD1W 3CCVV 1YJNV 2D3OW
chains in the Genus database with same CATH superfamily
1QU7A 1XEQA 4JASA 3HB3B 4I50B 3AG1B 4KHPO 4DV1B 3SJCC 4DR1B 3RYFA 4LBEC 1V55B 2NN4A 2ZR3A 4ASUG 4DV0O 4X1YB 3P3PA 4NXMO 3CE2A 1G8MA 4PI0A 2LJ2A 3FYIB 4KUMA 2ZNJA 3T4ZA 1MA1A 3STLC 4LWSB 2X6AA 2Q0AA 2CH7B 2HR3A 1SQPH 3ABMC 1I5XA 1HNZB 3APQA 2FYUH 3BEHA 2A06H 3ZBHA 2OIGA 5L3EA 1Y74B 3E89A 4N23A 1S0VA 1H8HG 4DK0A 1VQ8V 4YY3O 4C7UA 2QWNB 1E79G 2DE0X 4H37A 1FFXA 3G6EV 4LF6B 3F7YC 5AG2A 4FIPC 2JJ2G 1ZL8B 2Q69A 2UUCB 5EC2C 4B3MB 3JASB 3OM3B 1ZL8A 1JX9A 4X1YA 4CH5A 2EZPA 3NR7A 4IYIA 4WBNB 1AJPA 2Q68A 4IIJA 2WLHA 4O4JB 2Y48A 3CB2A 3JD3A 3QO8A 1M90W 2NLJC 2P4KA 5JVDB 5CA1B 4RUEA 3M7MX 4H33A 4GKKB 5BXZA 4IHJA 1AROP 2RQ6A 2DJVA 5L3DA 5IYDO 1JFFA 3VQXA 3JAMN 1WP8A 5BMVB 2IJHA 3WG7C 1YJNV 3LDDA 4FM2A 1R3JC 1OCCB 4B3SB 2Q67A 3MDSA 1EFRG 3ZN0A 2M6YA 4JI6B 4ZBMA 1WPBA 4EB6A 3ASOB 4CH3A 3A0RA 2JEXA 5B1BC 5LP6A 4XBFA 2Y4UA 2QTSA 4MVOA 2HFEC 5TISZ 3ETDA 1DF4A 2HP8A 1E1RG 5ITZB 1KC8W 3ZS8C 1F7YA 2UXBB 2A7WA 3K08A 4UV8A 3JATA 1AR5A 3CRRA 2CE4A 4WFGA 2WLIB 2PI5A 1K4CC 4UCRA 1GM8A 4ZKIA 1V9PA 4UB8Z 3B8NA 4I7ZB 2AHZA 1XL4A 1WPXA 4WFEA 2OCHA 3CMEV 3A0BZ 1WB7A 3CXHF 5LGNA 4X20B 3CRMA 4UV9A 3CCSV 1OCRB 1M1KW 1V54B 1I0HA 3JAWB 4QE9A 4WF9V 3BFRA 4J80A 1GN2A 3J80N 3F5TA 4Z1MG 4W4KA 4LH6A 3B09A 4JI0O 5CB4B 3P3NA 3W7TA 4RWUA 1WA8B 1ZUQA 3DXRB 2WA3A 1JPXA 1XNRB 1K8AW 3ZMVA 2YS8A 2R9AA 4GKJO 2XT9A 5H9CA 4AHCA 1KUQA 2WLLB 2YUAA 4JI5B 4X66O 5KMGB 1V54C 1FFTB 3PJSK 2QKSA 4F6RB 3RFRA 3JALA 1Q82W 3ZMTA 5LYJA 3LNNA 4TWKA 1IZ3A 1GKFA 3FD9A 4JI3O 3UQ8A 2HHHB 3E22A 1PL4A 2FL4A 1MOFA 2DN9A 3E8HA 1K9MW 1L0LH 1XHXA 5LHHA 4AQYO 4LF9B 3BA8A 4LFCO 2CK3G 3FB7C 1XUQA 2OTLV 1KMIZ 4I4TA 2VQEB 1FXVA 4YJ3A 4K35A 5DM6V 2EJ7A 5EIBD 2DWEC 2QWRB 3STZC 4I4TB 4B7KA 1COWG 3ZHTA 3SR2C 1URFA 1RM1C 3CC7V 4DXWA 3K5NA 5JQGB 1JA8A 3AG4C 3ASNC 2CGNA 2QM8A 2Z0AA 1QNMA 2DYSB 4JTAB 1SQGA 1PNLA 5EIBC 2LGWA 3SPIA 2AZ2A 2QM4A 5LA6A 4TV9B 1YF2A 1W0JG 4CC5A 1GN3A 2ODMA 2Y0IA 1H2SB 3K0GA 3N2KA 4BW9A 3L74H 4YHHO 4YIPA 2RNBA 2JS5A 2JGDA 3LNMB 3CHXA 3N27A 4DV3O 4FFKA 3CC4V 1IXBA 1VQMV 3IFXA 5KHHA 5IJ0A 3SPCA 1Q43A 3CYOA 2Q7HA 3DSQA 3R66A 5CA1A 5JVDA 4LF5B 2F43G 3LUTB 1QLNA 2YEVA 2QSAA 4UCUA 5FPRA 2OIEA 2LO1A 1YJ9V 4PV1B 3HR0A 2Y4TA 2F93B 3SPGA 1JCHA 1G4YB 1R3LC 3CRCA 4FM0A 3S3XA 2W0FC 4RQEA 3W7SA 2LFSA 4I55A 2LFRA 3CCVV 1TGOA 1VMGA 3J81N 5L3CA 1VF6C 1XREA 4CZZA 3LSUA 2H94A 5EBLC 5EC1C 4GLXA 1WLEA 2E75B 3H1LH 2JK5C 1BCCH 1R6TA 1MABG 2WAMA 1N4CA 3SYPA 1VQ5V 5A9GA 1EN6A 1O9HA 4UCVA 2ZE7A 3K58A 2DMXA 5DEDA 2GUZA 5LXTB 2MK3A 1ENVA 2WSSG 2VQEO 1YTFD 1XNQB 1B3QA 3K0DA 1KYOF 2BSKA 2QEXV 4O4HA 4MVRA 2YIAA 2VS0A 5CB4A 4GX2A 1NR1A 1WN7A 3BVOA 1HR0B 4CC6A 3ABKB 3Q4HB 1JVMA 1JFFB 3AG7A 1P4RA 2DYSC 1OHHG 3D3QA 2P5OA 3E2EA 4XDKA 3GWKC 3OTOB 4DV7O 4UXNA 4QNHB 2Q7EA 4HZ3A 5J2UA 1IBMO 1I94O 1M4UA 4PELA 4LNUB 5E79Z 1QBZA 1SQBH 1ZTEA 4IGGA 3BHPA 1J5EO 2Q5ZA 4PA7A 4DR1O 3TXSA 4JI7O 5J9PC 2HJDA 4J7JA 2FTKA 5D5QA 1H2LA 4LWSA 2HVJC 1AILA 2HEPA 4QGPA 4N21A 3AEIA 4KP4A 4FLXA 3T1YB 2OCCC 3EFFK 1BQZA 2Q7GA 3CRQA 2HKOA 3K06A 3CEIA 2GTSA 1W0KG 4GZRB 1J5EB 2E5LB 1PP9H 3JD1A 1ZWIC 4I0XA 3CCRV 4JTCB 3JAKB 4JI0B 3OW2U 3ABLB 3H1JH 2OT5A 4I0XB 3RYFB 2BTQB 2OYQA 5JJJB 4LF4O 3IC7A 4FFBB 3ZRWB 1PNKA 3QF7A 5KX5A 2RMKB 1FJGB 3CPWU 4DUYB 2ZE6A 4MVZA 5KHIA 2M7WA 4NB5A 2HJFC 5LXTA 2KKWA 3X2QB 1TVKB 1JQ0A 4MS2A 1HNZO 3B4SA 3WB0A 3QVNA 1O9GA 4JAAA 1FJGO 2HHHO 4ZHQA 4O4IB 1S72V 2OTJV 4K3AA 3E35A 3K3WA 3CC2V 4R8CA 1G1XB 4IT5A 4JI1B 5K1XA 1D5AA 1AR4A 2ETNA 2CGOA 1OCOC 1XMQO 2JGDB 2UXBO 3QO7A 1AJNA 5CA3A 3B77A 4YJ2A 3KZIZ 3H9VA 3JD2A 1WAZA 3I55V 1BE3H 1AJQA 3WFVA 2E76B 5GONB 3MAQA 4UVAA 3ZIAG 1B6QA 1KKDA 2OWOA 2R70A 5IWAO 4U3JB 5DN6G 3NXSA 1Q6IA 4MTGA 5C8YB 3HKCB 4UCSA 1VQKV 4LFBO 2AW9A 4IIJB 4HAMA 4RAIA 4JI8B 2HVKC 2NNUA 3ETGA 2X7RB 5LMNO 1YTFB 3G67A 3JSNA 1RSOA 1EN4A 2JDIG 4YJ2B 3B8MA 1IVSA 4JZ2A 4B3MO 1HDJA 4FLWA 3SPJA 4DR4O 5BMVA 1KQSU 4U7NA 5B1OA 3CCLV 4LF6O 2P67A 2H3OA 1SA0A 3ETQA 5FL7G 1WP7A 2ZNIA 4DRXA 4JI4B 1K7DA 5IDJA 3OTOO 4J9YB 5C93A 5EYPA 1BS3A 1NTZH 4X9QA 3AG3B 1P49A 5CA0B 3OR6C 4WBNA 4OX9B 1H2NA 2IBZH 4OXSA 4A5UB 3G80A 3UO3A 4DR4B 4JI4O 2QWPB 4I55B 2KSDA 1TUBA 4B3RO 2LP7A 1IXMA 2ZCEA 2JRIA 3K5LA 5IYZB 1DF5A 2QA4V 4LF4B 4DV1O 1QVFU 1Y4MA 2XAFA 1RPRA 5CMUA 3QO5A 5HFMA 2JJ1G 4AQYB 5BR8B 4DV0B 2KG7A 5LMNB 4DV5B 2WA4A 3M99B 2G38A 4K0KO 3ICXA 1CP9A 1Y6XA 2XAJA 3E86A 1VQPV 4X88A 3DGEA 1TA8A 2QE7G 2UXNA 4B3TB 1FXHA 4I9QA 4E2LA 3IAYA 2PI4A 1YDXA 4LCUC 5J2TA 4BAYA 5H6RA 1AP5A 1BSMA 1WNSA 1N36B 3T1HO 1K5SA 2EIKB 4Q6GA 4O4HB 1EZJA 3U10A 2WLNA 5LBQA 2B9ZA 3RWRD 3ABKC 2QWOB 2EILC 5FLXN 4UFZA 3HKEA 2CH7A 5BR8O 4NR1A 2KG7B 1SERA 2Z5UA 1IBMB 3RT3C 3SDLA 3AK1A 4YHHB 1U97A 3ZMUA 1Q3EA 3AK2A 2FMLA 4NKGB 2YXHA 4H13B 4DV2O 2ATKC 1JR9A 1VARA 4MVUA 1RPOA 3H1HH 4PA9A 5B1AC 3JCZA 4O2BA 4LR3A 3UT5A 4H0LB 1Y76B 4L87A 1VEWA 3DXRA 4DV2B 2PY5A 3RW0A 1K34A 2JGUA 4LF7O 3A0HZ 1Q8IA 2GUZB 4JYAB 4X89A 4HBNA 2PTMA 3W7XA 3U0ZA 1Q81W 1AI7A 4TUYB 4P9PA 1A32A 3OAAG 4NTXA 1EZVH 2CUGA 5FNVB 1QQCA 4KFMA 2ZD9A 3ZN1A 5JH7A 1N34O 3RYHA 4JZGA 4TV9A 4RUFA 2RDCA 1SC5B 4P30A 2ZM6B 1P7BA 3N2GA 4XDJA 2QDOA 3FFQA 3BPZA 3O9OA 4GUNA 5B1AB 2D3OW 2LQTA 4DR6B 2GBOA 1JOYA 4TOIA 4DR3O 1S5HC 1ZSPA 5J2UB 1Z5WA 4B3TO 1Q7YW 3I56V 1PV0A 1AI4A 2ZXWB 2UUBO 4Q20A 1R6NA 2YXLA 3HKDA 3ZEDA 3BABA 3FX7A 1PL0A 2YEVB 5LMUB 1NT2B 1MZEA 2VWKA 1K92A 1L8DA 4JYCA 4JGSA 3CCJV 2GSMB 2WLIA 3F7VC 3A2FA 1NU1H 3OMNB 2UU9O 4Z2WA 2X6BA 3D3IA 1K5QA 1SESA 4ZHQB 4NTYA 1PKXA 4NXNB 1M5IA 4BWAA 4BIUA 3D36A 1BQ0A 3TCUA 1NH2B 4RQFA 3CCUV 1R73A 2BE3A 4JPRA 3ZHVA 2XOKG 4TV8A 2DQ3A 3LDEA 4OPAA 1M9NA 4F6EA 4X65O 4F4LA 1U96A 4UCOA 5JWPA 1YI2V 5JCOA 1I94B 1XMOO 3BY6A 5LGUA 1OCZB 1VIBA 2UXCO 3UT5B 3JAKA 1VQLV 4DR7O 2P4VA 4LFCB 4EEQA 2EBOA 3JATB 3FB8C 4IL6Z 5LHGA 2LW1A 4LH7A 5F2VO 2EULA 2PUSA 5D5PA 3WU2Z 2UU9B 1GK9A 4JI3B 3RYHB 1NS1A 3N2KB 1I08A 3SYQA 4JI8O 1IBKB 1BZKA 1F23A 4DW0A 5FPOA 1JJOA 2GHYA 1FS0G 3ZX6A 4DV6O 2EIJC 1VQOV 2QWQB 1D5NA 3GVMA 3TETA 1YJWV 3OEHG 2YIBA 1XDCA 3OUSA 4GKJB 1HWYA 1DGSA 2WLKA 5KAFZ 3CCMV 5EYPB 4KXRA 1NVPB 1UPGA 3D36C 3P32A 3L72H 2UUBB 3ML0A 3K59A 3OGCC 3UO2A 3ZCCA 1SETA 4RO2A 3ZHSA 4LF5O 5IJ9A 2IU0A 2AGAA 2GDSA 2ITDC 2ZR2A 3MD0A 1OJHA 4PA4A 4ICGA 2ZKOA 2XTAA 3L73H 1SF9A 3E8FA 2IJKA 5FNVA 1XMOB 5LA6B 4CBCA 2QGNA 1CPYA 4LC1A 3K03A 3RBZA 3RYIB 4R6ZA 4QE7A 5IY5B 2Q8VA 4QPJA 3OR7C 3CJHB 3JALB 2YIBD 3IJ4A 3KKYA 1AP6A 2WLJA 4FK5C 3FB6C 1E1QG 3E22B 1ORQC 3ZHRA 1XI1A 2A79B 1HNXB 1CXZB 1VQ7V 4IYHA 3ABUA 4JTDB 3ZRXA 1P84F 4JV5B 3L9DA 4FMTA 2XAQA 1QHTA 4IHJB 2ZDIC 4B08A 5CBHA 1VF5B 2VQFO 1QLEB 1WA8A 4ZOLB 4JV5O 2CTPA 4TQDA 1VQ9V 1W2BU 3ABLC 2VWJA 1FPOA 4JI7B 4QIWF 5DECA 4K8XA 3WB1A 2YC0A 4TSFG 1Y66A 4X62B 4O2BB 3ZMZA 5LL6Y 2DYRB 1FD9A 2EIJB 4R50A 2QM7A 1M56C 2IH1C 2JVDA 4WFAV 3KCYA 2W6JG 2WLLA 3CS5A 2DWDC 5LYJB 3SGIA 2BCCH 2B1GA 4X65B 2A9HA 1SQVH 2Z3YA 4JF3A 3TGUH 1XQ8A 5GW7A 3ZJZA 2CTWA 4HYOA 4PI2A 1KD1W 1GAXA 2UXDO 4MW3A 1LUWA 4O2AB 4PDMA 1BHBA 1OCZC 3MHSC 4LF8B 1Q86W 5GTIZ 2YIDA 2YSUB 4CS3A 2RN9A 3RYCA 1J95A 1IDSA 2BTOA 1MSWD 3SJAC 1GH6A 4YJ3B 4U3FH 1G6UA 1HW7A 5JJNB 1N0JA 5CBGA 1GN4A 4YXWG 2EX3A 5KHKA 3VQWA 4BIZA 1N36O 3T2MA 1S5JA 5KA5A 3GWOA 1ZAUA 2ZE5A 4LFAO 3CSXA 5B1NA 1AVMA 4FLZA 1EN5A 4EKWA 4DR3B 5LP6B 1XILA 2ZT9B 3JCUZ 4LFAB 1KB9F 1NTMH 1NZ6A 4K0KB 4WCEV 3X2QC 1K73W 4XDLA 5LMUO 1N34B 1DLBA 2N04A 1LNQA 3OT7A 4CH6A 4PDVA 3JD0A 4DR5O 3E8BA 1LR1A 4K8ZA 1SS3A 2JIZG 5EBWC 4OGQB 5E1AC 1YSCA 4LNUA 3RN4A 4DUZB 5IWAB 5B3SC 2JS3A 2UUAB 1IX9A 1PD3A 2FKXA 1M56B 1B04A 1PM9A 4BW5A 1CEZA 5GTHZ 2O57A 2B1IA 3SPHA 1FAFA 1ROPA 1PPJH 5EK0A 1NVPD 1YITV 3CXCU 3N2GB 4YIOA 1YZBA 5L3BA 3AG4B 3ASNB 3CCEV 1TAEA 2ZIOA 2EIMB 3OMAB 2P7TC 2D2CB 3K5MA 1VF7A 3FAVB 1SQFA 5L3FA 1XHZA 2V7QG 1NH2D 2BOCC 5IT9N 4LF8O 4U3JA 3APOA 1S76D 2P06A 1KKCA 1KP3A 2C2AA 2EILB 3L70H 2IJIA 1RFYA 2Y0PA 2PF4E 4U7OA 1QR8A 3S3WA 2E74B 5B3SB 1Y76A 3AG3C 4FLTA 4J11A 2L6LA 3Q4HA 2YXYA 4HNAA 2V4DA 4DR6O 4ZOLA 4J42A 2CAZC 4MVMA 4MW8A 3IGAC 1B06A 5B1BB 4KHPB 1RM1B 3UM7A 2YI8A 1SA0B 4WFBV 1OCOB 2CDYA 1Q5OA 1R1BA 4X1IB 1GRJA 3JASA 4DYLA 4DV3B 5EZYB 1IBLO 3T1YO 4ABMA 3ZRSA 4P9OA 2Y69B 1UJWB 1XMQB 4QJFB 4YY3B 1F4NA 4ZI7B 1MZFA 1VF6A 3VBBA 3CWBH 2IU3A 4NTWA 3T4DA 2EINC 1NI8A 2QTOA 3HKBA 4MVQA 1VP7A 2LGQA 1N33B 3JAWA 5KLVH 3ETEA 1XOUA 3HKBB 1JMKC 5JQGA 1OZ0A 2EZOA 3CCQV 5IE9A 1HR0O 1T5EA 5KUMA 1VQNV 1D2DA 1NQTA 2Q0OC 5IJ9B 4W4LA 3TK1A 3SYCA 2E3CA 3HPLC 2GV9A 2XAHA 1PNMA 1X59A 3QTCA 2UUAO 1RSOB 1XBLA 4OX9O 3I5DA 1ZLZA 5KHJA 1QVGU 1UFIA 1ZX3A 3LSSA 2ZE8A 4UCTA 3HKDB 4DR5B 4FJCC 1NTKH 2H8PC 3OUFA 3CX5F 2R9IA 2CTRA 4DO2A 1N32B 4DUZO 1S3JA 1N8RW 1GM7A 3HKEB 2IJJA 2Q73A 4CS4A 2OCCB 1H2KA 1M57B 1K4DC 3TJTA 1Q90D 1Z5VA 2P90A 1K33A 3K5OA 2NR5A 4G2KA 5IY5C 3QG5A 1X4TA 4FLVA 4J7KA 4GX5A 2AZ0A 4O2AA 4DV4O 4JYBA 2F4VO 1OCRC 3VQVA 3KCXA 4TV8B 1KBHA 4I50A 3QNEA 2DOSA 2UXXA 2W6IG 4GT1A 3AG2C 4UVBA 4R7CA 3R65A 5A2QN 1WB8A 3VQYA 1HNWO 1K3EA 1M57C 5B66Z 3JSLA 4GCZA 2Q6AA 2BTQA 3PN1A 2VQFB 5B5EZ 1YCIA 3AK3A 1JJ2U 1Q6UA 4GYCB 4DR7B 1OCCC 3W7UA 2W0XA 2ZIMA 3DC5A 3D8CA 4BIOA 3SYOA 5LP6C 1LUVA 3JYCA 2ZXWC 1AR1B 3ABTA 4BR6A 4DW1A 4DRXB 2XUMA 1XNQO 4KL1A 5K1PA 1KU9A 3L75H 2DYRC 3JARB 2X0LA 3B40A 2WWWA 2IH3C 4MTFA 2K1EA 5KA6A 4MT8A 5ITZA 1FXKB 2HLDG 3FYEB 1FKAO 3EVKA 1MG1A 3BRCA 1QCEA 3OGIB 1XL6A 3RYIA 1AI5A 3K9AA 3G6BA 2DQ0A 1BGYH 3LDCA 1IURA 2F66C 1L0NH 4FZ0A 3EHBB 3OE7G 2P6JA 3C90A 3H1IH 4FM1A 2FB5A 2E5LO 2AHYA 4PDRA 3K57A 2EIMC 5LHIA 1AI6A 2V1DA 3UKMA 2Q4PA 3TXQA 4D7SA 1HNXO 5C8YA 4FPPA 2KQXA 2XASA 4JI1O 3U11A 3DTUB 1F4MA 5KX5B 2X6CA 5J2TB 1MNGA 1I5YA 4FFBA 3ZRWA 1IBKO 4AI8A 3CMAV 2ADPA 3CRAA 1US6A 3H1KH 4GX1A 4DK1A 1YEWA 2WPDG 1VQ4V 3RVYA 1YVWA 2IM9A 3FB5C 1THZA 4TT3G 3UCSC 4WFHA 5BY1A 2F95B 4O4LB 4J41A 4E4EA 3SJQC 3SYAA 4PA3A 4DR2O 3L71H 5LOVB 4P2ZA 3DC6A 2PYJA 1TVKA 4FZ1A 1FFXB 3OFNG 2A0LA 5L3GA 1Y67A 4NXNO 1WJZA 2ZDIA 4PDLA 2UXCB 2EJRA 5EBMC 3FKSG 4LF7B 3K79A 1S77D 3AG1C 5GONA 2ZINA 2QR4A 2XHBA 2N74A 4NXMB 2HG5C 2CTQA 3THOA 4PD4F 4JAUA 1R3IC 1YXBA 1SZXA 1GN6A 1KP2A 1W59A 4DR2B 1M93A 4EFEA 3K9SA 5IJ0B 4FVMA 4HNAB 4TQFA 1S5LZ 3GB7C 3KG2A 1FYJA 3HKCA 1TUEB 5KUKA 2QKCA 1K97A 4PA6A 2PYLA 4MVSA 1H2MA 1F51A 5CBFA 4LF9O 2EIKC 3ABMB 2YDEA 5JCOC 4TUYA 4X66B 2JEUA 2K9PA 5JJEB 1SZTA 3C3SA 4JI5O 5IYBO 5JH7B 4JYAO 4I9WA 3BA9A 3FAVA 3OMIB 4PHZA 2QJ1A 5KAIZ 1H8EG 3W7WA 2ZQMA 2IW5A 3OTFA 4O4JA 3ZRVA 1DTOA 3SJBC 2N05A 2UUCO 1R3KC 1MSDA 1Z2GA 5KHGA 1N32O 2B5UA 4DV7B 1FXKC 5H2FZ 1DK1A 1QLEC 2PGGA 5EZYA 1HP8A 1BHAA 1I7FA 4FLYA 1BL8A 3M8AA 1HNWB 3G71V 4G27B 1Q6HA 4MTXA 2DW4A 4D6TH 3J7AU 3H01A 4B7EA 2UXDB 2F4VB 1EM1A 4EB6B 4J7ZA 2R72A 1SKVA 5LGTA 1YHQV 3JARA 5H5NA 2WLMA 3O65A 4JI6O 2F1MA 2LW7A 2MW2B 4X20A 4LP8A 4JAVA 1NKDA 3B2EE 2VRZA 2A3QA 4DV4B 4CS2A 2RCVA 4X1KB 1XNRO 1N0NA 3AG2B 2AXTZ 2ITCC 4MSWC 2QKAA 4O4IA 1NR7A 4JI2O 1NBMG 4OPHA 2ARHA 3JD4A 2XNDG 4J9ZB 2YICA 4DV6B 5LOVA 1GTOA 2ADQB 2F23A 2ILMA 2GTAA 2YI9A 2P22C 1TUBB 2R9RB 3WB2A 4AILC 4Z1VA 3OEEG 3T1HB 4DV5O 4FLUA 4D7TA 4X1KA 4JYYA 4G28B 3IC9A 1YIJV 1V55C 3EXAA 3RYCB 2ZM6O 2PZSA 3CJHA 4MTOA 1NJIW 4X1IA 4X64O 3A8TA 2L35A 2BSKB 1FXKA 4EFBA 2Y69C 4L8JA 1H38A 2KB1A 3CD6V 1RP3B 4UVCA 5IYZA 5H6QA 5BZBA 4J10A 4PJ0Z 1OV9A 5HFLA 4DUYO 4QPKA 3F5WC 3E83A 4F6RA 1GMGA 4NYKA 1BT8A 1VQ6V 1R6KA 4B3RB 1IBLB 1EBOA 2RJZA 1SQXH 3ASOC 3LSQA 3T1CA 1P7GA 1N33O 4H44B 4X8AA 4CH4A 2XAGA 2BOBC 1KECA 1SRYA 4X64B 3OD4A 3CP1A 4NVPA 4GX0A 2Q9LA 5CA0A 4UUJC 3ZHUA 3RGBA 3C3TA 1AB3A 1SQQH 1GO3F 4GKKO 5KMGA 3BCCH 3ZHQA 1GM9A 4ZI7A 1QR9A 3WG7B 3E8GA 4I5SA 3G4SV 3BAAA 3RVZA 4X62O 4O4LA 2EINB 4LFBB 5IYCO 1L1FA 4B3SO 1BMFG 3P30A 1Y74A 3VOUA 1MMMA 3MHHC 4JI2B 3K04A 4UB6Z 4WFFA 4ZIBA 1H2GA 3ZMSA 5CN0A
chains in the Genus database with same CATH topology
3QNEA 3P32A 1W0KG 2UXXA 2W6IG 4GT1A 3AG2C 4JASA 3ML0A 4UVBA 3HB3B 4R7CA 3R65A 1K3EA 1M57C 3OGCC 4GCZA 3AG1B 2Q6AA 3JD1A 4LBEC 1V55B 1ZWIC 2ZR3A 3ZCCA 1SETA 4RO2A 4ASUG 3CCRV 4JTCB 1JJ2U 2IU0A 2ITDC 2ZR2A 3OW2U 3MD0A 3ABLB 1OCCC 1G8MA 4PA4A 3W7UA 2OT5A 3FYIB 3E8FA 2IJKA 4KUMA 3IC7A 3ZRWB 1PNKA 3T4ZA 3SYOA 4CBCA 3STLC 2X6AA 1CPYA 3JYCA 4LC1A 3CPWU 2ZXWC 4MVZA 3ABTA 2HR3A 1AR1B 2M7WA 2HJFC 3K03A 3ABMC 3RBZA 1I5XA 3X2QB 3BEHA 1JQ0A 4MS2A 4R6ZA 4QE7A 5L3EA 3E89A 2DYRC 5IY5B 4N23A 1S0VA 4QPJA 1H8HG 3OR7C 1VQ8V 1E79G 1S72V 2OTJV 3E35A 2X0LA 4H37A 3K3WA 2WLJA 2WWWA 2IH3C 4FK5C 3G6EV 3CC2V 3FB6C 1E1QG 2K1EA 4MT8A 4MTFA 5KA6A 1ORQC 4R8CA 1FXKB 2HLDG 3FYEB 3F7YC 4FIPC 2A79B 2JJ2G 1OCOC 1MG1A 3QO7A 1AJNA 1VQ7V 1QCEA 2Q69A 3B77A 5CA3A 1XL6A 3ABUA 1AI5A 4JTDB 3K9AA 5EC2C 3JD2A 2DQ0A 3I55V 3ZRXA 3OM3B 1AJQA 3LDCA 1JX9A 3WFVA 2EZPA 4UVAA 4FMTA 1AJPA 2Q68A 3ZIAG 2XAQA 2WLHA 1B6QA 1KKDA 2ZDIC 2Y48A 5DN6G 3EHBB 3NXSA 5CBHA 3JD3A 4MTGA 3OE7G 3QO8A 1M90W 1QLEB 2NLJC 2P6JA 4RUEA 1VQKV 1VQ9V 2AHYA 4H33A 1W2BU 3ABLC 4PDRA 4HAMA 4RAIA 1AROP 4QIWF 5L3DA 2HVKC 2EIMC 2NNUA 1AI6A 5LHIA 2V1DA 3ETGA 2X7RB 4TSFG 1Y66A 3UKMA 5IYDO 1YTFB 4FPPA 2XASA 3DTUB 3ZMZA 2DYRB 2EIJB 4R50A 1F4MA 2IJHA 2JDIG 2QM7A 3WG7C 2X6CA 1YJNV 1I5YA 3LDDA 3ZRWA 1M56C 3B8MA 1R3JC 1OCCB 2Q67A 2IH1C 4WFAV 1EFRG 3CMAV 3ZN0A 2W6JG 2WLLA 4GX1A 2DWDC 2B1GA 4ZBMA 2WPDG 1VQ4V 3SPJA 2A9HA 3ASOB 3RVYA 1KQSU 2Z3YA 3A0RA 2JEXA 3FB5C 4JF3A 1THZA 4TT3G 4U7NA 4WFHA 5B1BC 5B1OA 4XBFA 3CCLV 4MVOA 2P67A 5GW7A 2HFEC 3SJQC 3SYAA 3ZJZA 4PA3A 3ETDA 1DF4A 4HYOA 5FL7G 4P2ZA 1E1RG 1KC8W 1KD1W 1K7DA 5IDJA 3OFNG 2A0LA 4J9YB 5L3GA 3K08A 4UV8A 5C93A 4MW3A 2ZDIA 4PDLA 2EJRA 3AG3B 4PDMA 4WFGA 1BHBA 2WLIB 2PI5A 1K4CC 5EBMC 1OCZC 3FKSG 3MHSC 3OR6C 1Q86W 3K79A 1GM8A 2YSUB 1S77D 3AG1C 4ZKIA 3B8NA 1J95A 4OXSA 2AHZA 1WPXA 4WFEA 3CMEV 2HG5C 1MSWD 5LGNA 4JAUA 1R3IC 4UV9A 1KP2A 3CCSV 1OCRB 2LP7A 1IXMA 1M1KW 1V54B 1DF5A 5CBGA 4QE9A 2QA4V 1QVFU 1Y4MA 4WF9V 2XAFA 4YXWG 1RPRA 5CMUA 4Z1MG 3QO5A 5HFMA 4BIZA 2JJ1G 3GB7C 3KG2A 3T2MA 5KA5A 3W7TA 3GWOA 1TUEB 5KUKA 3M99B 1K97A 1JPXA 4PA6A 1K8AW 3ZMVA 1CP9A 4MVSA 1F51A 2XAJA 5CBFA 3E86A 2EIKC 5H9CA 4X88A 5B1NA 1VQPV 3DGEA 3ABMB 2QE7G 2UXNA 4EKWA 2WLLB 2JEUA 1FXHA 4E2LA 1SZTA 2PI4A 1V54C 4LCUC 1FFTB 3PJSK 5H6RA 4BAYA 2QKSA 5IYBO 1Q82W 3ZMTA 1K5SA 2EIKB 4I9WA 4WCEV 4TWKA 3X2QC 1EZJA 3OMIB 2WLNA 5LBQA 1K73W 1GKFA 4XDLA 3ABKC 2EILC 1DLBA 1MOFA 3E8HA 1K9MW 5LHHA 1LNQA 1H8EG 4PDVA 3W7WA 1SERA 2Z5UA 2ZQMA 3JD0A 3E8BA 2IW5A 3ZRVA 2JIZG 3ZMUA 1DTOA 5EBWC 1R3KC 5E1AC 1YSCA 2CK3G 3FB7C 5B3SC 2OTLV 2B5UA 1PD3A 1M56B 1FXKC 1CEZA 4BW5A 2ATKC 1QLEC 2B1IA 3SPHA 1ROPA 1FXVA 5EK0A 1BHAA 5DM6V 1NVPD 1YITV 2DWEC 3CXCU 3STZC 5L3BA 4MVUA 1BL8A 1RPOA 3AG4B 3ASNB 4PA9A 5B1AC 3JCZA 1COWG 3CCEV 2EIMB 3OMAB 3G71V 2P7TC 4G27B 4MTXA 4L87A 1RM1C 2DW4A 5L3FA 3H01A 3CC7V 2V7QG 4DXWA 2BOCC 1NH2D 3RW0A 1K34A 3AG4C 3ASNC 2QM8A 4X89A 2DYSB 4JTAB 3W7XA 5LGTA 1YHQV 1Q81W 1S76D 1PNLA 1AI7A 2WLMA 4P9PA 3SPIA 1KP3A 2C2AA 2EILB 3OAAG 4KFMA 2IJIA 1W0JG 4U7OA 2ZD9A 4LP8A 4JAVA 1QR8A 3ZN1A 1NKDA 5B3SB 3K0GA 3AG3C 3LNMB 4RUFA 3CC4V 1VQMV 4P30A 3IFXA 1P7BA 3AG2B 2ITCC 4MSWC 4XDJA 3SPCA 3CYOA 5B1AB 2D3OW 1JOYA 2F43G 3LUTB 1S5HC 4MVMA 4MW8A 1NR7A 1QLNA 1NBMG 2YEVA 3IGAC 5B1BB 1Q7YW 3I56V 3JD4A 2XNDG 4J9ZB 1RM1B 3UM7A 1YJ9V 1AI4A 2ZXWB 4Q20A 1R6NA 1GTOA 3SPGA 4WFBV 1OCOB 1JCHA 1G4YB 1R3LC 1PL0A 2W0FC 2YEVB 4RQEA 3W7SA 2LFSA 2R9RB 1K92A 2LFRA 4JYCA 3CCVV 4JGSA 3CCJV 2GSMB 2WLIA 3OEEG 3F7VC 3ZRSA 4P9OA 5L3CA 2Y69B 4CZZA 1UJWB 4QJFB 1F4NA 3OMNB 4G28B 1YIJV 1V55C 2H94A 2X6BA 5EBLC 5EC1C 1WLEA 2JK5C 3VBBA 3D3IA 1MABG 2WAMA 1K5QA 1SESA 2IU3A 1PKXA 3SYPA 3T4DA 4MTOA 1VQ5V 4BIUA 3D36A 1NJIW 3TCUA 1NH2B 2EINC 4RQFA 3CCUV 1R73A 4JPRA 1FXKA 2QTOA 4MVQA 2MK3A 2Y69C 1ENVA 1H38A 2WSSG 1YTFD 3ETEA 2KB1A 2XOKG 3CD6V 3K0DA 2DQ3A 4UVCA 5H6QA 2QEXV 3LDEA 5BZBA 1OZ0A 2EZOA 1M9NA 4MVRA 5HFLA 4F4LA 3CCQV 4QPKA 3F5WC 3E83A 4GX2A 1YI2V 1NR1A 1GMGA 3BY6A 1VQ6V 1R6KA 5LGUA 1OCZB 5KUMA 3ABKB 1VQNV 1NQTA 1EBOA 1JVMA 1P4RA 2DYSC 1VQLV 3ASOC 3LSQA 3T1CA 3TK1A 3SYCA 1OHHG 3E2EA 3HPLC 4XDKA 4X8AA 2XAHA 4UXNA 4QNHB 1PNMA 4HZ3A 2EBOA 1QVGU 2XAGA 2BOBC 3LSSA 1KECA 1SRYA 3FB8C 5LHGA 4PELA 3CP1A 1QBZA 4FJCC 2H8PC 3OUFA 4GX0A 2R9IA 4DO2A 4UUJC 1GK9A 1S3JA 1N8RW 4PA7A 1GM7A 3SYQA 2IJJA 1F23A 2OCCB 1GO3F 5J9PC 2GHYA 1FS0G 1GM9A 1M57B 1QR9A 2EIJC 1K4DC 2P90A 1VQOV 3WG7B 3E8GA 2FTKA 4I5SA 1K33A 3RVZA 3G4SV 2HVJC 3TETA 1YJWV 3OEHG 2EINB 4N21A 4G2KA 5IY5C 3OUSA 3AEIA 5IYCO 4GX5A 1L1FA 4KP4A 2OCCC 1HWYA 3EFFK 2WLKA 1BMFG 3P30A 3ZMSA 3CCMV 3VOUA 3MHHC 4JYBA 3K04A 2HKOA 1OCRC 3K06A 1NVPB 4WFFA 1H2GA 1XL4A 5CN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  1VQP V;  3G6E V;  3CC2 V;  5DM6 V;  1YIT V;  4WFA V;  3CXC U;  3CMA V;  1VQO V;  3CCS V;  1YHQ V;  1Q81 W;  1QVG U;  1K9M W;  1M1K W;  3CD6 V;  3G4S V;  2QEX V;  3CPW U;  1M90 W;  3CCE V;  1Q7Y W;  3I56 V;  1YIJ V;  1YJW V;  3CCQ V;  2QA4 V;  1VQK V;  1VQ9 V;  1QVF U;  1VQ4 V;  4WF9 V;  3G71 V;  1VQ7 V;  1YI2 V;  1W2B U;  1Q86 W;  1YJ9 V;  1KQS U;  1VQ6 V;  3CCR V;  3I55 V;  1Q82 W;  1VQ5 V;  4WFB V;  3CCL V;  1VQN V;  3CC7 V;  1JJ2 U;  1NJI W;  3OW2 U;  2OTL V;  3CCM V;  4WCE V;  1VQL V;  3CME V;  1N8R W;  1VQM V;  1VQ8 V;  3CC4 V;  3CCU V;  1R73 A;  1K73 W;  1KC8 W;  1S72 V;  2OTJ V;  1K8A W;  1KD1 W;  3CCV V;  1YJN V;  2D3O W; 
#chains in the Genus database with same CATH topology
 1QU7 A;  1XEQ A;  4JAS A;  3HB3 B;  4I50 B;  3AG1 B;  4KHP O;  4DV1 B;  3SJC C;  4DR1 B;  3RYF A;  4LBE C;  1V55 B;  2NN4 A;  2ZR3 A;  4ASU G;  4DV0 O;  4X1Y B;  3P3P A;  4NXM O;  3CE2 A;  1G8M A;  4PI0 A;  2LJ2 A;  3FYI B;  4KUM A;  2ZNJ A;  3T4Z A;  1MA1 A;  3STL C;  4LWS B;  2X6A A;  2Q0A A;  2CH7 B;  2HR3 A;  1SQP H;  3ABM C;  1I5X A;  1HNZ B;  3APQ A;  2FYU H;  3BEH A;  2A06 H;  3ZBH A;  2OIG A;  5L3E A;  1Y74 B;  3E89 A;  4N23 A;  1S0V A;  1H8H G;  4DK0 A;  1VQ8 V;  4YY3 O;  4C7U A;  2QWN B;  1E79 G;  2DE0 X;  4H37 A;  1FFX A;  3G6E V;  4LF6 B;  3F7Y C;  5AG2 A;  4FIP C;  2JJ2 G;  1ZL8 B;  2Q69 A;  2UUC B;  5EC2 C;  4B3M B;  3JAS B;  3OM3 B;  1ZL8 A;  1JX9 A;  4X1Y A;  4CH5 A;  2EZP A;  3NR7 A;  4IYI A;  4WBN B;  1AJP A;  2Q68 A;  4IIJ A;  2WLH A;  4O4J B;  2Y48 A;  3CB2 A;  3JD3 A;  3QO8 A;  1M90 W;  2NLJ C;  2P4K A;  5JVD B;  5CA1 B;  4RUE A;  3M7M X;  4H33 A;  4GKK B;  5BXZ A;  4IHJ A;  1ARO P;  2RQ6 A;  2DJV A;  5L3D A;  5IYD O;  1JFF A;  3VQX A;  3JAM N;  1WP8 A;  5BMV B;  2IJH A;  3WG7 C;  1YJN V;  3LDD A;  4FM2 A;  1R3J C;  1OCC B;  4B3S B;  2Q67 A;  3MDS A;  1EFR G;  3ZN0 A;  2M6Y A;  4JI6 B;  4ZBM A;  1WPB A;  4EB6 A;  3ASO B;  4CH3 A;  3A0R A;  2JEX A;  5B1B C;  5LP6 A;  4XBF A;  2Y4U A;  2QTS A;  4MVO A;  2HFE C;  5TIS Z;  3ETD A;  1DF4 A;  2HP8 A;  1E1R G;  5ITZ B;  1KC8 W;  3ZS8 C;  1F7Y A;  2UXB B;  2A7W A;  3K08 A;  4UV8 A;  3JAT A;  1AR5 A;  3CRR A;  2CE4 A;  4WFG A;  2WLI B;  2PI5 A;  1K4C C;  4UCR A;  1GM8 A;  4ZKI A;  1V9P A;  4UB8 Z;  3B8N A;  4I7Z B;  2AHZ A;  1XL4 A;  1WPX A;  4WFE A;  2OCH A;  3CME V;  3A0B Z;  1WB7 A;  3CXH F;  5LGN A;  4X20 B;  3CRM A;  4UV9 A;  3CCS V;  1OCR B;  1M1K W;  1V54 B;  1I0H A;  3JAW B;  4QE9 A;  4WF9 V;  3BFR A;  4J80 A;  1GN2 A;  3J80 N;  3F5T A;  4Z1M G;  4W4K A;  4LH6 A;  3B09 A;  4JI0 O;  5CB4 B;  3P3N A;  3W7T A;  4RWU A;  1WA8 B;  1ZUQ A;  3DXR B;  2WA3 A;  1JPX A;  1XNR B;  1K8A W;  3ZMV A;  2YS8 A;  2R9A A;  4GKJ O;  2XT9 A;  5H9C A;  4AHC A;  1KUQ A;  2WLL B;  2YUA A;  4JI5 B;  4X66 O;  5KMG B;  1V54 C;  1FFT B;  3PJS K;  2QKS A;  4F6R B;  3RFR A;  3JAL A;  1Q82 W;  3ZMT A;  5LYJ A;  3LNN A;  4TWK A;  1IZ3 A;  1GKF A;  3FD9 A;  4JI3 O;  3UQ8 A;  2HHH B;  3E22 A;  1PL4 A;  2FL4 A;  1MOF A;  2DN9 A;  3E8H A;  1K9M W;  1L0L H;  1XHX A;  5LHH A;  4AQY O;  4LF9 B;  3BA8 A;  4LFC O;  2CK3 G;  3FB7 C;  1XUQ A;  2OTL V;  1KMI Z;  4I4T A;  2VQE B;  1FXV A;  4YJ3 A;  4K35 A;  5DM6 V;  2EJ7 A;  5EIB D;  2DWE C;  2QWR B;  3STZ C;  4I4T B;  4B7K A;  1COW G;  3ZHT A;  3SR2 C;  1URF A;  1RM1 C;  3CC7 V;  4DXW A;  3K5N A;  5JQG B;  1JA8 A;  3AG4 C;  3ASN C;  2CGN A;  2QM8 A;  2Z0A A;  1QNM A;  2DYS B;  4JTA B;  1SQG A;  1PNL A;  5EIB C;  2LGW A;  3SPI A;  2AZ2 A;  2QM4 A;  5LA6 A;  4TV9 B;  1YF2 A;  1W0J G;  4CC5 A;  1GN3 A;  2ODM A;  2Y0I A;  1H2S B;  3K0G A;  3N2K A;  4BW9 A;  3L74 H;  4YHH O;  4YIP A;  2RNB A;  2JS5 A;  2JGD A;  3LNM B;  3CHX A;  3N27 A;  4DV3 O;  4FFK A;  3CC4 V;  1IXB A;  1VQM V;  3IFX A;  5KHH A;  5IJ0 A;  3SPC A;  1Q43 A;  3CYO A;  2Q7H A;  3DSQ A;  3R66 A;  5CA1 A;  5JVD A;  4LF5 B;  2F43 G;  3LUT B;  1QLN A;  2YEV A;  2QSA A;  4UCU A;  5FPR A;  2OIE A;  2LO1 A;  1YJ9 V;  4PV1 B;  3HR0 A;  2Y4T A;  2F93 B;  3SPG A;  1JCH A;  1G4Y B;  1R3L C;  3CRC A;  4FM0 A;  3S3X A;  2W0F C;  4RQE A;  3W7S A;  2LFS A;  4I55 A;  2LFR A;  3CCV V;  1TGO A;  1VMG A;  3J81 N;  5L3C A;  1VF6 C;  1XRE A;  4CZZ A;  3LSU A;  2H94 A;  5EBL C;  5EC1 C;  4GLX A;  1WLE A;  2E75 B;  3H1L H;  2JK5 C;  1BCC H;  1R6T A;  1MAB G;  2WAM A;  1N4C A;  3SYP A;  1VQ5 V;  5A9G A;  1EN6 A;  1O9H A;  4UCV A;  2ZE7 A;  3K58 A;  2DMX A;  5DED A;  2GUZ A;  5LXT B;  2MK3 A;  1ENV A;  2WSS G;  2VQE O;  1YTF D;  1XNQ B;  1B3Q A;  3K0D A;  1KYO F;  2BSK A;  2QEX V;  4O4H A;  4MVR A;  2YIA A;  2VS0 A;  5CB4 A;  4GX2 A;  1NR1 A;  1WN7 A;  3BVO A;  1HR0 B;  4CC6 A;  3ABK B;  3Q4H B;  1JVM A;  1JFF B;  3AG7 A;  1P4R A;  2DYS C;  1OHH G;  3D3Q A;  2P5O A;  3E2E A;  4XDK A;  3GWK C;  3OTO B;  4DV7 O;  4UXN A;  4QNH B;  2Q7E A;  4HZ3 A;  5J2U A;  1IBM O;  1I94 O;  1M4U A;  4PEL A;  4LNU B;  5E79 Z;  1QBZ A;  1SQB H;  1ZTE A;  4IGG A;  3BHP A;  1J5E O;  2Q5Z A;  4PA7 A;  4DR1 O;  3TXS A;  4JI7 O;  5J9P C;  2HJD A;  4J7J A;  2FTK A;  5D5Q A;  1H2L A;  4LWS A;  2HVJ C;  1AIL A;  2HEP A;  4QGP A;  4N21 A;  3AEI A;  4KP4 A;  4FLX A;  3T1Y B;  2OCC C;  3EFF K;  1BQZ A;  2Q7G A;  3CRQ A;  2HKO A;  3K06 A;  3CEI A;  2GTS A;  1W0K G;  4GZR B;  1J5E B;  2E5L B;  1PP9 H;  3JD1 A;  1ZWI C;  4I0X A;  3CCR V;  4JTC B;  3JAK B;  4JI0 B;  3OW2 U;  3ABL B;  3H1J H;  2OT5 A;  4I0X B;  3RYF B;  2BTQ B;  2OYQ A;  5JJJ B;  4LF4 O;  3IC7 A;  4FFB B;  3ZRW B;  1PNK A;  3QF7 A;  5KX5 A;  2RMK B;  1FJG B;  3CPW U;  4DUY B;  2ZE6 A;  4MVZ A;  5KHI A;  2M7W A;  4NB5 A;  2HJF C;  5LXT A;  2KKW A;  3X2Q B;  1TVK B;  1JQ0 A;  4MS2 A;  1HNZ O;  3B4S A;  3WB0 A;  3QVN A;  1O9G A;  4JAA A;  1FJG O;  2HHH O;  4ZHQ A;  4O4I B;  1S72 V;  2OTJ V;  4K3A A;  3E35 A;  3K3W A;  3CC2 V;  4R8C A;  1G1X B;  4IT5 A;  4JI1 B;  5K1X A;  1D5A A;  1AR4 A;  2ETN A;  2CGO A;  1OCO C;  1XMQ O;  2JGD B;  2UXB O;  3QO7 A;  1AJN A;  5CA3 A;  3B77 A;  4YJ2 A;  3KZI Z;  3H9V A;  3JD2 A;  1WAZ A;  3I55 V;  1BE3 H;  1AJQ A;  3WFV A;  2E76 B;  5GON B;  3MAQ A;  4UVA A;  3ZIA G;  1B6Q A;  1KKD A;  2OWO A;  2R70 A;  5IWA O;  4U3J B;  5DN6 G;  3NXS A;  1Q6I A;  4MTG A;  5C8Y B;  3HKC B;  4UCS A;  1VQK V;  4LFB O;  2AW9 A;  4IIJ B;  4HAM A;  4RAI A;  4JI8 B;  2HVK C;  2NNU A;  3ETG A;  2X7R B;  5LMN O;  1YTF B;  3G67 A;  3JSN A;  1RSO A;  1EN4 A;  2JDI G;  4YJ2 B;  3B8M A;  1IVS A;  4JZ2 A;  4B3M O;  1HDJ A;  4FLW A;  3SPJ A;  4DR4 O;  5BMV A;  1KQS U;  4U7N A;  5B1O A;  3CCL V;  4LF6 O;  2P67 A;  2H3O A;  1SA0 A;  3ETQ A;  5FL7 G;  1WP7 A;  2ZNI A;  4DRX A;  4JI4 B;  1K7D A;  5IDJ A;  3OTO O;  4J9Y B;  5C93 A;  5EYP A;  1BS3 A;  1NTZ H;  4X9Q A;  3AG3 B;  1P49 A;  5CA0 B;  3OR6 C;  4WBN A;  4OX9 B;  1H2N A;  2IBZ H;  4OXS A;  4A5U B;  3G80 A;  3UO3 A;  4DR4 B;  4JI4 O;  2QWP B;  4I55 B;  2KSD A;  1TUB A;  4B3R O;  2LP7 A;  1IXM A;  2ZCE A;  2JRI A;  3K5L A;  5IYZ B;  1DF5 A;  2QA4 V;  4LF4 B;  4DV1 O;  1QVF U;  1Y4M A;  2XAF A;  1RPR A;  5CMU A;  3QO5 A;  5HFM A;  2JJ1 G;  4AQY B;  5BR8 B;  4DV0 B;  2KG7 A;  5LMN B;  4DV5 B;  2WA4 A;  3M99 B;  2G38 A;  4K0K O;  3ICX A;  1CP9 A;  1Y6X A;  2XAJ A;  3E86 A;  1VQP V;  4X88 A;  3DGE A;  1TA8 A;  2QE7 G;  2UXN A;  4B3T B;  1FXH A;  4I9Q A;  4E2L A;  3IAY A;  2PI4 A;  1YDX A;  4LCU C;  5J2T A;  4BAY A;  5H6R A;  1AP5 A;  1BSM A;  1WNS A;  1N36 B;  3T1H O;  1K5S A;  2EIK B;  4Q6G A;  4O4H B;  1EZJ A;  3U10 A;  2WLN A;  5LBQ A;  2B9Z A;  3RWR D;  3ABK C;  2QWO B;  2EIL C;  5FLX N;  4UFZ A;  3HKE A;  2CH7 A;  5BR8 O;  4NR1 A;  2KG7 B;  1SER A;  2Z5U A;  1IBM B;  3RT3 C;  3SDL A;  3AK1 A;  4YHH B;  1U97 A;  3ZMU A;  1Q3E A;  3AK2 A;  2FML A;  4NKG B;  2YXH A;  4H13 B;  4DV2 O;  2ATK C;  1JR9 A;  1VAR A;  4MVU A;  1RPO A;  3H1H H;  4PA9 A;  5B1A C;  3JCZ A;  4O2B A;  4LR3 A;  3UT5 A;  4H0L B;  1Y76 B;  4L87 A;  1VEW A;  3DXR A;  4DV2 B;  2PY5 A;  3RW0 A;  1K34 A;  2JGU A;  4LF7 O;  3A0H Z;  1Q8I A;  2GUZ B;  4JYA B;  4X89 A;  4HBN A;  2PTM A;  3W7X A;  3U0Z A;  1Q81 W;  1AI7 A;  4TUY B;  4P9P A;  1A32 A;  3OAA G;  4NTX A;  1EZV H;  2CUG A;  5FNV B;  1QQC A;  4KFM A;  2ZD9 A;  3ZN1 A;  5JH7 A;  1N34 O;  3RYH A;  4JZG A;  4TV9 A;  4RUF A;  2RDC A;  1SC5 B;  4P30 A;  2ZM6 B;  1P7B A;  3N2G A;  4XDJ A;  2QDO A;  3FFQ A;  3BPZ A;  3O9O A;  4GUN A;  5B1A B;  2D3O W;  2LQT A;  4DR6 B;  2GBO A;  1JOY A;  4TOI A;  4DR3 O;  1S5H C;  1ZSP A;  5J2U B;  1Z5W A;  4B3T O;  1Q7Y W;  3I56 V;  1PV0 A;  1AI4 A;  2ZXW B;  2UUB O;  4Q20 A;  1R6N A;  2YXL A;  3HKD A;  3ZED A;  3BAB A;  3FX7 A;  1PL0 A;  2YEV B;  5LMU B;  1NT2 B;  1MZE A;  2VWK A;  1K92 A;  1L8D A;  4JYC A;  4JGS A;  3CCJ V;  2GSM B;  2WLI A;  3F7V C;  3A2F A;  1NU1 H;  3OMN B;  2UU9 O;  4Z2W A;  2X6B A;  3D3I A;  1K5Q A;  1SES A;  4ZHQ B;  4NTY A;  1PKX A;  4NXN B;  1M5I A;  4BWA A;  4BIU A;  3D36 A;  1BQ0 A;  3TCU A;  1NH2 B;  4RQF A;  3CCU V;  1R73 A;  2BE3 A;  4JPR A;  3ZHV A;  2XOK G;  4TV8 A;  2DQ3 A;  3LDE A;  4OPA A;  1M9N A;  4F6E A;  4X65 O;  4F4L A;  1U96 A;  4UCO A;  5JWP A;  1YI2 V;  5JCO A;  1I94 B;  1XMO O;  3BY6 A;  5LGU A;  1OCZ B;  1VIB A;  2UXC O;  3UT5 B;  3JAK A;  1VQL V;  4DR7 O;  2P4V A;  4LFC B;  4EEQ A;  2EBO A;  3JAT B;  3FB8 C;  4IL6 Z;  5LHG A;  2LW1 A;  4LH7 A;  5F2V O;  2EUL A;  2PUS A;  5D5P A;  3WU2 Z;  2UU9 B;  1GK9 A;  4JI3 B;  3RYH B;  1NS1 A;  3N2K B;  1I08 A;  3SYQ A;  4JI8 O;  1IBK B;  1BZK A;  1F23 A;  4DW0 A;  5FPO A;  1JJO A;  2GHY A;  1FS0 G;  3ZX6 A;  4DV6 O;  2EIJ C;  1VQO V;  2QWQ B;  1D5N A;  3GVM A;  3TET A;  1YJW V;  3OEH G;  2YIB A;  1XDC A;  3OUS A;  4GKJ B;  1HWY A;  1DGS A;  2WLK A;  5KAF Z;  3CCM V;  5EYP B;  4KXR A;  1NVP B;  1UPG A;  3D36 C;  3P32 A;  3L72 H;  2UUB B;  3ML0 A;  3K59 A;  3OGC C;  3UO2 A;  3ZCC A;  1SET A;  4RO2 A;  3ZHS A;  4LF5 O;  5IJ9 A;  2IU0 A;  2AGA A;  2GDS A;  2ITD C;  2ZR2 A;  3MD0 A;  1OJH A;  4PA4 A;  4ICG A;  2ZKO A;  2XTA A;  3L73 H;  1SF9 A;  3E8F A;  2IJK A;  5FNV A;  1XMO B;  5LA6 B;  4CBC A;  2QGN A;  1CPY A;  4LC1 A;  3K03 A;  3RBZ A;  3RYI B;  4R6Z A;  4QE7 A;  5IY5 B;  2Q8V A;  4QPJ A;  3OR7 C;  3CJH B;  3JAL B;  2YIB D;  3IJ4 A;  3KKY A;  1AP6 A;  2WLJ A;  4FK5 C;  3FB6 C;  1E1Q G;  3E22 B;  1ORQ C;  3ZHR A;  1XI1 A;  2A79 B;  1HNX B;  1CXZ B;  1VQ7 V;  4IYH A;  3ABU A;  4JTD B;  3ZRX A;  1P84 F;  4JV5 B;  3L9D A;  4FMT A;  2XAQ A;  1QHT A;  4IHJ B;  2ZDI C;  4B08 A;  5CBH A;  1VF5 B;  2VQF O;  1QLE B;  1WA8 A;  4ZOL B;  4JV5 O;  2CTP A;  4TQD A;  1VQ9 V;  1W2B U;  3ABL C;  2VWJ A;  1FPO A;  4JI7 B;  4QIW F;  5DEC A;  4K8X A;  3WB1 A;  2YC0 A;  4TSF G;  1Y66 A;  4X62 B;  4O2B B;  3ZMZ A;  5LL6 Y;  2DYR B;  1FD9 A;  2EIJ B;  4R50 A;  2QM7 A;  1M56 C;  2IH1 C;  2JVD A;  4WFA V;  3KCY A;  2W6J G;  2WLL A;  3CS5 A;  2DWD C;  5LYJ B;  3SGI A;  2BCC H;  2B1G A;  4X65 B;  2A9H A;  1SQV H;  2Z3Y A;  4JF3 A;  3TGU H;  1XQ8 A;  5GW7 A;  3ZJZ A;  2CTW A;  4HYO A;  4PI2 A;  1KD1 W;  1GAX A;  2UXD O;  4MW3 A;  1LUW A;  4O2A B;  4PDM A;  1BHB A;  1OCZ C;  3MHS C;  4LF8 B;  1Q86 W;  5GTI Z;  2YID A;  2YSU B;  4CS3 A;  2RN9 A;  3RYC A;  1J95 A;  1IDS A;  2BTO A;  1MSW D;  3SJA C;  1GH6 A;  4YJ3 B;  4U3F H;  1G6U A;  1HW7 A;  5JJN B;  1N0J A;  5CBG A;  1GN4 A;  4YXW G;  2EX3 A;  5KHK A;  3VQW A;  4BIZ A;  1N36 O;  3T2M A;  1S5J A;  5KA5 A;  3GWO A;  1ZAU A;  2ZE5 A;  4LFA O;  3CSX A;  5B1N A;  1AVM A;  4FLZ A;  1EN5 A;  4EKW A;  4DR3 B;  5LP6 B;  1XIL A;  2ZT9 B;  3JCU Z;  4LFA B;  1KB9 F;  1NTM H;  1NZ6 A;  4K0K B;  4WCE V;  3X2Q C;  1K73 W;  4XDL A;  5LMU O;  1N34 B;  1DLB A;  2N04 A;  1LNQ A;  3OT7 A;  4CH6 A;  4PDV A;  3JD0 A;  4DR5 O;  3E8B A;  1LR1 A;  4K8Z A;  1SS3 A;  2JIZ G;  5EBW C;  4OGQ B;  5E1A C;  1YSC A;  4LNU A;  3RN4 A;  4DUZ B;  5IWA B;  5B3S C;  2JS3 A;  2UUA B;  1IX9 A;  1PD3 A;  2FKX A;  1M56 B;  1B04 A;  1PM9 A;  4BW5 A;  1CEZ A;  5GTH Z;  2O57 A;  2B1I A;  3SPH A;  1FAF A;  1ROP A;  1PPJ H;  5EK0 A;  1NVP D;  1YIT V;  3CXC U;  3N2G B;  4YIO A;  1YZB A;  5L3B A;  3AG4 B;  3ASN B;  3CCE V;  1TAE A;  2ZIO A;  2EIM B;  3OMA B;  2P7T C;  2D2C B;  3K5M A;  1VF7 A;  3FAV B;  1SQF A;  5L3F A;  1XHZ A;  2V7Q G;  1NH2 D;  2BOC C;  5IT9 N;  4LF8 O;  4U3J A;  3APO A;  1S76 D;  2P06 A;  1KKC A;  1KP3 A;  2C2A A;  2EIL B;  3L70 H;  2IJI A;  1RFY A;  2Y0P A;  2PF4 E;  4U7O A;  1QR8 A;  3S3W A;  2E74 B;  5B3S B;  1Y76 A;  3AG3 C;  4FLT A;  4J11 A;  2L6L A;  3Q4H A;  2YXY A;  4HNA A;  2V4D A;  4DR6 O;  4ZOL A;  4J42 A;  2CAZ C;  4MVM A;  4MW8 A;  3IGA C;  1B06 A;  5B1B B;  4KHP B;  1RM1 B;  3UM7 A;  2YI8 A;  1SA0 B;  4WFB V;  1OCO B;  2CDY A;  1Q5O A;  1R1B A;  4X1I B;  1GRJ A;  3JAS A;  4DYL A;  4DV3 B;  5EZY B;  1IBL O;  3T1Y O;  4ABM A;  3ZRS A;  4P9O A;  2Y69 B;  1UJW B;  1XMQ B;  4QJF B;  4YY3 B;  1F4N A;  4ZI7 B;  1MZF A;  1VF6 A;  3VBB A;  3CWB H;  2IU3 A;  4NTW A;  3T4D A;  2EIN C;  1NI8 A;  2QTO A;  3HKB A;  4MVQ A;  1VP7 A;  2LGQ A;  1N33 B;  3JAW A;  5KLV H;  3ETE A;  1XOU A;  3HKB B;  1JMK C;  5JQG A;  1OZ0 A;  2EZO A;  3CCQ V;  5IE9 A;  1HR0 O;  1T5E A;  5KUM A;  1VQN V;  1D2D A;  1NQT A;  2Q0O C;  5IJ9 B;  4W4L A;  3TK1 A;  3SYC A;  2E3C A;  3HPL C;  2GV9 A;  2XAH A;  1PNM A;  1X59 A;  3QTC A;  2UUA O;  1RSO B;  1XBL A;  4OX9 O;  3I5D A;  1ZLZ A;  5KHJ A;  1QVG U;  1UFI A;  1ZX3 A;  3LSS A;  2ZE8 A;  4UCT A;  3HKD B;  4DR5 B;  4FJC C;  1NTK H;  2H8P C;  3OUF A;  3CX5 F;  2R9I A;  2CTR A;  4DO2 A;  1N32 B;  4DUZ O;  1S3J A;  1N8R W;  1GM7 A;  3HKE B;  2IJJ A;  2Q73 A;  4CS4 A;  2OCC B;  1H2K A;  1M57 B;  1K4D C;  3TJT A;  1Q90 D;  1Z5V A;  2P90 A;  1K33 A;  3K5O A;  2NR5 A;  4G2K A;  5IY5 C;  3QG5 A;  1X4T A;  4FLV A;  4J7K A;  4GX5 A;  2AZ0 A;  4O2A A;  4DV4 O;  4JYB A;  2F4V O;  1OCR C;  3VQV A;  3KCX A;  4TV8 B;  1KBH A;  4I50 A;  3QNE A;  2DOS A;  2UXX A;  2W6I G;  4GT1 A;  3AG2 C;  4UVB A;  4R7C A;  3R65 A;  5A2Q N;  1WB8 A;  3VQY A;  1HNW O;  1K3E A;  1M57 C;  5B66 Z;  3JSL A;  4GCZ A;  2Q6A A;  2BTQ A;  3PN1 A;  2VQF B;  5B5E Z;  1YCI A;  3AK3 A;  1JJ2 U;  1Q6U A;  4GYC B;  4DR7 B;  1OCC C;  3W7U A;  2W0X A;  2ZIM A;  3DC5 A;  3D8C A;  4BIO A;  3SYO A;  5LP6 C;  1LUV A;  3JYC A;  2ZXW C;  1AR1 B;  3ABT A;  4BR6 A;  4DW1 A;  4DRX B;  2XUM A;  1XNQ O;  4KL1 A;  5K1P A;  1KU9 A;  3L75 H;  2DYR C;  3JAR B;  2X0L A;  3B40 A;  2WWW A;  2IH3 C;  4MTF A;  2K1E A;  5KA6 A;  4MT8 A;  5ITZ A;  1FXK B;  2HLD G;  3FYE B;  1FKA O;  3EVK A;  1MG1 A;  3BRC A;  1QCE A;  3OGI B;  1XL6 A;  3RYI A;  1AI5 A;  3K9A A;  3G6B A;  2DQ0 A;  1BGY H;  3LDC A;  1IUR A;  2F66 C;  1L0N H;  4FZ0 A;  3EHB B;  3OE7 G;  2P6J A;  3C90 A;  3H1I H;  4FM1 A;  2FB5 A;  2E5L O;  2AHY A;  4PDR A;  3K57 A;  2EIM C;  5LHI A;  1AI6 A;  2V1D A;  3UKM A;  2Q4P A;  3TXQ A;  4D7S A;  1HNX O;  5C8Y A;  4FPP A;  2KQX A;  2XAS A;  4JI1 O;  3U11 A;  3DTU B;  1F4M A;  5KX5 B;  2X6C A;  5J2T B;  1MNG A;  1I5Y A;  4FFB A;  3ZRW A;  1IBK O;  4AI8 A;  3CMA V;  2ADP A;  3CRA A;  1US6 A;  3H1K H;  4GX1 A;  4DK1 A;  1YEW A;  2WPD G;  1VQ4 V;  3RVY A;  1YVW A;  2IM9 A;  3FB5 C;  1THZ A;  4TT3 G;  3UCS C;  4WFH A;  5BY1 A;  2F95 B;  4O4L B;  4J41 A;  4E4E A;  3SJQ C;  3SYA A;  4PA3 A;  4DR2 O;  3L71 H;  5LOV B;  4P2Z A;  3DC6 A;  2PYJ A;  1TVK A;  4FZ1 A;  1FFX B;  3OFN G;  2A0L A;  5L3G A;  1Y67 A;  4NXN O;  1WJZ A;  2ZDI A;  4PDL A;  2UXC B;  2EJR A;  5EBM C;  3FKS G;  4LF7 B;  3K79 A;  1S77 D;  3AG1 C;  5GON A;  2ZIN A;  2QR4 A;  2XHB A;  2N74 A;  4NXM B;  2HG5 C;  2CTQ A;  3THO A;  4PD4 F;  4JAU A;  1R3I C;  1YXB A;  1SZX A;  1GN6 A;  1KP2 A;  1W59 A;  4DR2 B;  1M93 A;  4EFE A;  3K9S A;  5IJ0 B;  4FVM A;  4HNA B;  4TQF A;  1S5L Z;  3GB7 C;  3KG2 A;  1FYJ A;  3HKC A;  1TUE B;  5KUK A;  2QKC A;  1K97 A;  4PA6 A;  2PYL A;  4MVS A;  1H2M A;  1F51 A;  5CBF A;  4LF9 O;  2EIK C;  3ABM B;  2YDE A;  5JCO C;  4TUY A;  4X66 B;  2JEU A;  2K9P A;  5JJE B;  1SZT A;  3C3S A;  4JI5 O;  5IYB O;  5JH7 B;  4JYA O;  4I9W A;  3BA9 A;  3FAV A;  3OMI B;  4PHZ A;  2QJ1 A;  5KAI Z;  1H8E G;  3W7W A;  2ZQM A;  2IW5 A;  3OTF A;  4O4J A;  3ZRV A;  1DTO A;  3SJB C;  2N05 A;  2UUC O;  1R3K C;  1MSD A;  1Z2G A;  5KHG A;  1N32 O;  2B5U A;  4DV7 B;  1FXK C;  5H2F Z;  1DK1 A;  1QLE C;  2PGG A;  5EZY A;  1HP8 A;  1BHA A;  1I7F A;  4FLY A;  1BL8 A;  3M8A A;  1HNW B;  3G71 V;  4G27 B;  1Q6H A;  4MTX A;  2DW4 A;  4D6T H;  3J7A U;  3H01 A;  4B7E A;  2UXD B;  2F4V B;  1EM1 A;  4EB6 B;  4J7Z A;  2R72 A;  1SKV A;  5LGT A;  1YHQ V;  3JAR A;  5H5N A;  2WLM A;  3O65 A;  4JI6 O;  2F1M A;  2LW7 A;  2MW2 B;  4X20 A;  4LP8 A;  4JAV A;  1NKD A;  3B2E E;  2VRZ A;  2A3Q A;  4DV4 B;  4CS2 A;  2RCV A;  4X1K B;  1XNR O;  1N0N A;  3AG2 B;  2AXT Z;  2ITC C;  4MSW C;  2QKA A;  4O4I A;  1NR7 A;  4JI2 O;  1NBM G;  4OPH A;  2ARH A;  3JD4 A;  2XND G;  4J9Z B;  2YIC A;  4DV6 B;  5LOV A;  1GTO A;  2ADQ B;  2F23 A;  2ILM A;  2GTA A;  2YI9 A;  2P22 C;  1TUB B;  2R9R B;  3WB2 A;  4AIL C;  4Z1V A;  3OEE G;  3T1H B;  4DV5 O;  4FLU A;  4D7T A;  4X1K A;  4JYY A;  4G28 B;  3IC9 A;  1YIJ V;  1V55 C;  3EXA A;  3RYC B;  2ZM6 O;  2PZS A;  3CJH A;  4MTO A;  1NJI W;  4X1I A;  4X64 O;  3A8T A;  2L35 A;  2BSK B;  1FXK A;  4EFB A;  2Y69 C;  4L8J A;  1H38 A;  2KB1 A;  3CD6 V;  1RP3 B;  4UVC A;  5IYZ A;  5H6Q A;  5BZB A;  4J10 A;  4PJ0 Z;  1OV9 A;  5HFL A;  4DUY O;  4QPK A;  3F5W C;  3E83 A;  4F6R A;  1GMG A;  4NYK A;  1BT8 A;  1VQ6 V;  1R6K A;  4B3R B;  1IBL B;  1EBO A;  2RJZ A;  1SQX H;  3ASO C;  3LSQ A;  3T1C A;  1P7G A;  1N33 O;  4H44 B;  4X8A A;  4CH4 A;  2XAG A;  2BOB C;  1KEC A;  1SRY A;  4X64 B;  3OD4 A;  3CP1 A;  4NVP A;  4GX0 A;  2Q9L A;  5CA0 A;  4UUJ C;  3ZHU A;  3RGB A;  3C3T A;  1AB3 A;  1SQQ H;  1GO3 F;  4GKK O;  5KMG A;  3BCC H;  3ZHQ A;  1GM9 A;  4ZI7 A;  1QR9 A;  3WG7 B;  3E8G A;  4I5S A;  3G4S V;  3BAA A;  3RVZ A;  4X62 O;  4O4L A;  2EIN B;  4LFB B;  5IYC O;  1L1F A;  4B3S O;  1BMF G;  3P30 A;  1Y74 A;  3VOU A;  1MMM A;  3MHH C;  4JI2 B;  3K04 A;  4UB6 Z;  4WFF A;  4ZIB A;  1H2G A;  3ZMS A;  5CN0 A; 
#chains in the Genus database with same CATH homology
 3QNE A;  3P32 A;  1W0K G;  2UXX A;  2W6I G;  4GT1 A;  3AG2 C;  4JAS A;  3ML0 A;  4UVB A;  3HB3 B;  4R7C A;  3R65 A;  1K3E A;  1M57 C;  3OGC C;  4GCZ A;  3AG1 B;  2Q6A A;  3JD1 A;  4LBE C;  1V55 B;  1ZWI C;  2ZR3 A;  3ZCC A;  1SET A;  4RO2 A;  4ASU G;  3CCR V;  4JTC B;  1JJ2 U;  2IU0 A;  2ITD C;  2ZR2 A;  3OW2 U;  3MD0 A;  3ABL B;  1OCC C;  1G8M A;  4PA4 A;  3W7U A;  2OT5 A;  3FYI B;  3E8F A;  2IJK A;  4KUM A;  3IC7 A;  3ZRW B;  1PNK A;  3T4Z A;  3SYO A;  4CBC A;  3STL C;  2X6A A;  1CPY A;  3JYC A;  4LC1 A;  3CPW U;  2ZXW C;  4MVZ A;  3ABT A;  2HR3 A;  1AR1 B;  2M7W A;  2HJF C;  3K03 A;  3ABM C;  3RBZ A;  1I5X A;  3X2Q B;  3BEH A;  1JQ0 A;  4MS2 A;  4R6Z A;  4QE7 A;  5L3E A;  3E89 A;  2DYR C;  5IY5 B;  4N23 A;  1S0V A;  4QPJ A;  1H8H G;  3OR7 C;  1VQ8 V;  1E79 G;  1S72 V;  2OTJ V;  3E35 A;  2X0L A;  4H37 A;  3K3W A;  2WLJ A;  2WWW A;  2IH3 C;  4FK5 C;  3G6E V;  3CC2 V;  3FB6 C;  1E1Q G;  2K1E A;  4MT8 A;  4MTF A;  5KA6 A;  1ORQ C;  4R8C A;  1FXK B;  2HLD G;  3FYE B;  3F7Y C;  4FIP C;  2A79 B;  2JJ2 G;  1OCO C;  1MG1 A;  3QO7 A;  1AJN A;  1VQ7 V;  1QCE A;  2Q69 A;  3B77 A;  5CA3 A;  1XL6 A;  3ABU A;  1AI5 A;  4JTD B;  3K9A A;  5EC2 C;  3JD2 A;  2DQ0 A;  3I55 V;  3ZRX A;  3OM3 B;  1AJQ A;  3LDC A;  1JX9 A;  3WFV A;  2EZP A;  4UVA A;  4FMT A;  1AJP A;  2Q68 A;  3ZIA G;  2XAQ A;  2WLH A;  1B6Q A;  1KKD A;  2ZDI C;  2Y48 A;  5DN6 G;  3EHB B;  3NXS A;  5CBH A;  3JD3 A;  4MTG A;  3OE7 G;  3QO8 A;  1M90 W;  1QLE B;  2NLJ C;  2P6J A;  4RUE A;  1VQK V;  1VQ9 V;  2AHY A;  4H33 A;  1W2B U;  3ABL C;  4PDR A;  4HAM A;  4RAI A;  1ARO P;  4QIW F;  5L3D A;  2HVK C;  2EIM C;  2NNU A;  1AI6 A;  5LHI A;  2V1D A;  3ETG A;  2X7R B;  4TSF G;  1Y66 A;  3UKM A;  5IYD O;  1YTF B;  4FPP A;  2XAS A;  3DTU B;  3ZMZ A;  2DYR B;  2EIJ B;  4R50 A;  1F4M A;  2IJH A;  2JDI G;  2QM7 A;  3WG7 C;  2X6C A;  1YJN V;  1I5Y A;  3LDD A;  3ZRW A;  1M56 C;  3B8M A;  1R3J C;  1OCC B;  2Q67 A;  2IH1 C;  4WFA V;  1EFR G;  3CMA V;  3ZN0 A;  2W6J G;  2WLL A;  4GX1 A;  2DWD C;  2B1G A;  4ZBM A;  2WPD G;  1VQ4 V;  3SPJ A;  2A9H A;  3ASO B;  3RVY A;  1KQS U;  2Z3Y A;  3A0R A;  2JEX A;  3FB5 C;  4JF3 A;  1THZ A;  4TT3 G;  4U7N A;  4WFH A;  5B1B C;  5B1O A;  4XBF A;  3CCL V;  4MVO A;  2P67 A;  5GW7 A;  2HFE C;  3SJQ C;  3SYA A;  3ZJZ A;  4PA3 A;  3ETD A;  1DF4 A;  4HYO A;  5FL7 G;  4P2Z A;  1E1R G;  1KC8 W;  1KD1 W;  1K7D A;  5IDJ A;  3OFN G;  2A0L A;  4J9Y B;  5L3G A;  3K08 A;  4UV8 A;  5C93 A;  4MW3 A;  2ZDI A;  4PDL A;  2EJR A;  3AG3 B;  4PDM A;  4WFG A;  1BHB A;  2WLI B;  2PI5 A;  1K4C C;  5EBM C;  1OCZ C;  3FKS G;  3MHS C;  3OR6 C;  1Q86 W;  3K79 A;  1GM8 A;  2YSU B;  1S77 D;  3AG1 C;  4ZKI A;  3B8N A;  1J95 A;  4OXS A;  2AHZ A;  1WPX A;  4WFE A;  3CME V;  2HG5 C;  1MSW D;  5LGN A;  4JAU A;  1R3I C;  4UV9 A;  1KP2 A;  3CCS V;  1OCR B;  2LP7 A;  1IXM A;  1M1K W;  1V54 B;  1DF5 A;  5CBG A;  4QE9 A;  2QA4 V;  1QVF U;  1Y4M A;  4WF9 V;  2XAF A;  4YXW G;  1RPR A;  5CMU A;  4Z1M G;  3QO5 A;  5HFM A;  4BIZ A;  2JJ1 G;  3GB7 C;  3KG2 A;  3T2M A;  5KA5 A;  3W7T A;  3GWO A;  1TUE B;  5KUK A;  3M99 B;  1K97 A;  1JPX A;  4PA6 A;  1K8A W;  3ZMV A;  1CP9 A;  4MVS A;  1F51 A;  2XAJ A;  5CBF A;  3E86 A;  2EIK C;  5H9C A;  4X88 A;  5B1N A;  1VQP V;  3DGE A;  3ABM B;  2QE7 G;  2UXN A;  4EKW A;  2WLL B;  2JEU A;  1FXH A;  4E2L A;  1SZT A;  2PI4 A;  1V54 C;  4LCU C;  1FFT B;  3PJS K;  5H6R A;  4BAY A;  2QKS A;  5IYB O;  1Q82 W;  3ZMT A;  1K5S A;  2EIK B;  4I9W A;  4WCE V;  4TWK A;  3X2Q C;  1EZJ A;  3OMI B;  2WLN A;  5LBQ A;  1K73 W;  1GKF A;  4XDL A;  3ABK C;  2EIL C;  1DLB A;  1MOF A;  3E8H A;  1K9M W;  5LHH A;  1LNQ A;  1H8E G;  4PDV A;  3W7W A;  1SER A;  2Z5U A;  2ZQM A;  3JD0 A;  3E8B A;  2IW5 A;  3ZRV A;  2JIZ G;  3ZMU A;  1DTO A;  5EBW C;  1R3K C;  5E1A C;  1YSC A;  2CK3 G;  3FB7 C;  5B3S C;  2OTL V;  2B5U A;  1PD3 A;  1M56 B;  1FXK C;  1CEZ A;  4BW5 A;  2ATK C;  1QLE C;  2B1I A;  3SPH A;  1ROP A;  1FXV A;  5EK0 A;  1BHA A;  5DM6 V;  1NVP D;  1YIT V;  2DWE C;  3CXC U;  3STZ C;  5L3B A;  4MVU A;  1BL8 A;  1RPO A;  3AG4 B;  3ASN B;  4PA9 A;  5B1A C;  3JCZ A;  1COW G;  3CCE V;  2EIM B;  3OMA B;  3G71 V;  2P7T C;  4G27 B;  4MTX A;  4L87 A;  1RM1 C;  2DW4 A;  5L3F A;  3H01 A;  3CC7 V;  2V7Q G;  4DXW A;  2BOC C;  1NH2 D;  3RW0 A;  1K34 A;  3AG4 C;  3ASN C;  2QM8 A;  4X89 A;  2DYS B;  4JTA B;  3W7X A;  5LGT A;  1YHQ V;  1Q81 W;  1S76 D;  1PNL A;  1AI7 A;  2WLM A;  4P9P A;  3SPI A;  1KP3 A;  2C2A A;  2EIL B;  3OAA G;  4KFM A;  2IJI A;  1W0J G;  4U7O A;  2ZD9 A;  4LP8 A;  4JAV A;  1QR8 A;  3ZN1 A;  1NKD A;  5B3S B;  3K0G A;  3AG3 C;  3LNM B;  4RUF A;  3CC4 V;  1VQM V;  4P30 A;  3IFX A;  1P7B A;  3AG2 B;  2ITC C;  4MSW C;  4XDJ A;  3SPC A;  3CYO A;  5B1A B;  2D3O W;  1JOY A;  2F43 G;  3LUT B;  1S5H C;  4MVM A;  4MW8 A;  1NR7 A;  1QLN A;  1NBM G;  2YEV A;  3IGA C;  5B1B B;  1Q7Y W;  3I56 V;  3JD4 A;  2XND G;  4J9Z B;  1RM1 B;  3UM7 A;  1YJ9 V;  1AI4 A;  2ZXW B;  4Q20 A;  1R6N A;  1GTO A;  3SPG A;  4WFB V;  1OCO B;  1JCH A;  1G4Y B;  1R3L C;  1PL0 A;  2W0F C;  2YEV B;  4RQE A;  3W7S A;  2LFS A;  2R9R B;  1K92 A;  2LFR A;  4JYC A;  3CCV V;  4JGS A;  3CCJ V;  2GSM B;  2WLI A;  3OEE G;  3F7V C;  3ZRS A;  4P9O A;  5L3C A;  2Y69 B;  4CZZ A;  1UJW B;  4QJF B;  1F4N A;  3OMN B;  4G28 B;  1YIJ V;  1V55 C;  2H94 A;  2X6B A;  5EBL C;  5EC1 C;  1WLE A;  2JK5 C;  3VBB A;  3D3I A;  1MAB G;  2WAM A;  1K5Q A;  1SES A;  2IU3 A;  1PKX A;  3SYP A;  3T4D A;  4MTO A;  1VQ5 V;  4BIU A;  3D36 A;  1NJI W;  3TCU A;  1NH2 B;  2EIN C;  4RQF A;  3CCU V;  1R73 A;  4JPR A;  1FXK A;  2QTO A;  4MVQ A;  2MK3 A;  2Y69 C;  1ENV A;  1H38 A;  2WSS G;  1YTF D;  3ETE A;  2KB1 A;  2XOK G;  3CD6 V;  3K0D A;  2DQ3 A;  4UVC A;  5H6Q A;  2QEX V;  3LDE A;  5BZB A;  1OZ0 A;  2EZO A;  1M9N A;  4MVR A;  5HFL A;  4F4L A;  3CCQ V;  4QPK A;  3F5W C;  3E83 A;  4GX2 A;  1YI2 V;  1NR1 A;  1GMG A;  3BY6 A;  1VQ6 V;  1R6K A;  5LGU A;  1OCZ B;  5KUM A;  3ABK B;  1VQN V;  1NQT A;  1EBO A;  1JVM A;  1P4R A;  2DYS C;  1VQL V;  3ASO C;  3LSQ A;  3T1C A;  3TK1 A;  3SYC A;  1OHH G;  3E2E A;  3HPL C;  4XDK A;  4X8A A;  2XAH A;  4UXN A;  4QNH B;  1PNM A;  4HZ3 A;  2EBO A;  1QVG U;  2XAG A;  2BOB C;  3LSS A;  1KEC A;  1SRY A;  3FB8 C;  5LHG A;  4PEL A;  3CP1 A;  1QBZ A;  4FJC C;  2H8P C;  3OUF A;  4GX0 A;  2R9I A;  4DO2 A;  4UUJ C;  1GK9 A;  1S3J A;  1N8R W;  4PA7 A;  1GM7 A;  3SYQ A;  2IJJ A;  1F23 A;  2OCC B;  1GO3 F;  5J9P C;  2GHY A;  1FS0 G;  1GM9 A;  1M57 B;  1QR9 A;  2EIJ C;  1K4D C;  2P90 A;  1VQO V;  3WG7 B;  3E8G A;  2FTK A;  4I5S A;  1K33 A;  3RVZ A;  3G4S V;  2HVJ C;  3TET A;  1YJW V;  3OEH G;  2EIN B;  4N21 A;  4G2K A;  5IY5 C;  3OUS A;  3AEI A;  5IYC O;  4GX5 A;  1L1F A;  4KP4 A;  2OCC C;  1HWY A;  3EFF K;  2WLK A;  1BMF G;  3P30 A;  3ZMS A;  3CCM V;  3VOU A;  3MHH C;  4JYB A;  3K04 A;  2HKO A;  1OCR C;  3K06 A;  1NVP B;  4WFF A;  1H2G A;  1XL4 A;  5CN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...