2QEXV

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qexV00
3CD6V 1K8AW 3I55V 3CXCU 1YJ9V 1M90W 1VQPV 3G6EV 1Q82W 1Q7YW 2OTLV 3CPWU 2D3OW 1QVFU 1VQ9V 4WCEV 1M1KW 1KQSU 1KD1W 1VQ5V 1JJ2U 1VQ8V 3CCRV 3CC7V 3CC2V 2OTJV 4WFBV 4WFAV 3CCVV 1Q86W 1YHQV 3CCSV 3I56V 1W2BU 1YI2V 1K73W 3CCLV 3OW2U 4WF9V 1YJNV 1R73A 1YIJV 3CCJV 1QVGU 1N8RW 1KC8W 3G71V 3G4SV 3CMEV 1VQ4V 3CC4V 3CCEV 1VQMV 1YJWV 2QEXV 2QA4V 1NJIW 3CCQV 3CCUV 1VQNV 1VQOV 1YITV 1Q81W 1VQKV 5DM6V 1K9MW 3CMAV 1VQ6V 3CCMV 1S72V 1VQ7V 1VQLV
chains in the Genus database with same CATH superfamily
5LOVB 1S77D 1XHZA 4NVPA 3APQA 1Q82W 2X0LA 3JD0A 1MNGA 5B1AC 1Q6UA 1HNZB 5CA0A 3K58A 1H2GA 1IURA 5KA5A 1SZXA 1BT8A 1CEZA 4JI0O 3KCXA 3Q4HB 3K0DA 1GM7A 1S5HC 1BZKA 1KUQA 2A79B 1K9MW 2VS0A 1D2DA 2PGGA 4F6RB 4JV5B 4PJ0Z 2WSSG 4JI5O 3SPCA 4IIJA 3TETA 4FFBA 4UCVA 1QLEC 3MHHC 4JI3B 3VQVA 4JF3A 1JFFA 2WLLB 3QO5A 2NLJC 1OCRB 2Q68A 3CSXA 1BCCH 3J80N 3G6EV 4XDJA 1I0HA 3JD4A 2X6BA 1NVPD 4ASUG 1K5SA 2HFEC 2ODMA 2QWPB 2AZ2A 1Y6XA 2UXBB 4UCUA 2JS3A 2ZM6O 3A0BZ 1PNMA 4UXNA 1V54C 3JATA 5KAIZ 3H01A 3N2KB 4FFBB 3X2QB 1H2SB 2XAQA 1XMQO 1S5JA 5CBGA 1KQSU 2V1DA 3SJQC 4B7KA 3EXAA 5LA6A 4U3JA 1H2LA 2C2AA 3C3TA 1I7FA 4LF7B 1RSOA 2WWWA 3OFNG 1IX9A 1G1XB 1SA0B 1Q8IA 1JMKC 2GV9A 5KHHA 2YXYA 1OCOC 4ZIBA 4GKJO 3JCZA 2CGNA 3H1KH 3CPWU 1JCHA 3IFXA 4BIOA 4X20B 1AI6A 4J7ZA 4MW8A 4PD4F 2QWNB 3EHBB 3CCLV 1EBOA 1PM9A 4O2AB 2Q69A 2YEVB 2DYSB 1UJWB 3QO8A 4NXNO 1NU1H 4D6TH 4DRXA 1VQLV 2B5UA 2ZQMA 3SJAC 2VWJA 3JSNA 5EIBD 3JAKA 4EKWA 4X1KA 4HZ3A 4DV1B 5JVDB 4YY3O 2DQ0A 3MDSA 3RYIA 4O4LA 4O4HB 3ZIAG 2PI4A 3T1YO 3CX5F 2Y48A 1SQXH 3OMAB 5L3GA 3VQYA 1YJWV 1R6KA 4MTXA 2ZDIC 1KB9F 2JK5C 4CC6A 2P67A 3D3QA 4P9PA 4UCSA 3HR0A 4EB6B 3TGUH 3RYHB 5CB4B 5CBHA 4CH4A 1Q7YW 1SETA 2ZIMA 3IAYA 2YI8A 4LBEC 1JX9A 4YHHB 4TV9B 4BW9A 4WF9V 3TXSA 3B77A 3UO3A 1PKXA 3G6BA 4JI6O 3FFQA 4HNAB 3ABKB 3E2EA 4CC5A 4JI8O 1BHBA 2ITDC 1XMOO 3K5MA 4FLUA 2LP7A 5LHIA 3AG3C 1U96A 4IHJB 5IY5B 4DV3B 4DR2O 1VQ9V 2ZINA 4YIPA 4JYAB 3SDLA 4I4TA 4K35A 1I5XA 3TK1A 3ZRWB 2CTPA 1NS1A 1BL8A 2CE4A 1W59A 5BMVA 2FL4A 4I50A 4LF5O 1TVKA 1GK9A 1GM8A 4U3FH 3I56V 4U7OA 5JJJB 3P3PA 1QVGU 1T5EA 2AZ0A 2ZE5A 3KKYA 3F7VC 2V4DA 2QWRB 3SYQA 3DC6A 2OIGA 4I4TB 4CS4A 4JI3O 4X1YA 4TWKA 2XUMA 5LGTA 1Z5VA 1HDJA 2LJ2A 4DV3O 2OYQA 3UT5B 2UU9O 4PDRA 5JJNB 4GZRB 2XAGA 3P3NA 2YDEA 3B4SA 1PNLA 3GWOA 5IWAO 4CBCA 1AI5A 5KHGA 2FTKA 1H2KA 2PTMA 2XTAA 2VQFO 4P30A 2IBZH 2HJDA 2EINB 1OCZC 4KFMA 5LYJA 4X1IB 4NYKA 4JZ2A 3M8AA 5IJ9B 4DV4B 4DK0A 2FMLA 2IH1C 2X6AA 4ABMA 4X66O 5KA6A 1RFYA 1QLEB 3ASOC 4PHZA 3A0HZ 4UVCA 2IJJA 1WJZA 1JOYA 2RMKB 4NR1A 4WFFA 3CRRA 1DLBA 2QM8A 3UKMA 3JASA 1SQFA 4KXRA 1PNKA 3LDDA 4MVOA 1IBLB 1AI7A 2HP8A 3MD0A 4K0KO 3CXHF 3RVZA 3CCMV 1WP8A 2UU9B 1FFTB 4FLWA 1QHTA 1P7BA 2KSDA 2N05A 1SQQH 3RN4A 4LF9B 4DR3O 3K5NA 4DR4O 5E1AC 1TUBA 1JQ0A 1F51A 3G71V 4IYIA 1W0JG 2ZXWC 3STZC 4D7TA 5IY5C 2BSKB 2BOBC 1G4YB 4TSFG 4B3TO 3L73H 2NR5A 3JARA 2UUCO 1S5LZ 4G2KA 3D8CA 3FYIB 3FB5C 4MVZA 3CRCA 3B40A 1YHQV 1N36O 2H94A 2HKOA 3KG2A 3CMEV 1OCCB 3W7TA 2YEVA 4KHPO 2UXNA 3H1HH 3E35A 1AP6A 3JCUZ 2CTQA 2XAJA 4BAYA 4TOIA 1EZVH 1LNQA 4FM1A 4JI7B 4AILC 2HG5C 3GWKC 1HNWO 2EJRA 5C8YB 1PL0A 2GSMB 3ZCCA 1HR0B 4LP8A 2Q67A 1FD9A 3OM3B 4GYCB 2XT9A 5LOVA 5LBQA 1JPXA 1J95A 1F7YA 2QKSA 4KHPB 4FLYA 4Z2WA 4W4LA 1NVPB 4P2ZA 1X4TA 1N32B 2P7TC 3QTCA 1VQMV 4OXSA 2GTAA 4TV8A 2B9ZA 4LFBO 2UXDO 2NNUA 2EILB 4MW3A 3ABMB 5C8YA 3AG7A 2W6IG 4LF5B 3AG3B 5BZBA 5J2TA 3TXQA 3ABLB 3WB2A 1NI8A 1US6A 3W7UA 4DV6B 3SGIA 4K8ZA 3AK2A 4FM0A 5H5NA 3OEEG 4X64B 4EEQA 2FKXA 1K4CC 2HHHB 4FK5C 5E79Z 3T1HO 1WN7A 2H3OA 3B09A 4W4KA 2JJ1G 4DV4O 2KB1A 5TISZ 4DUYO 2L6LA 3LDCA 1Y74B 2V7QG 1D5NA 1NR1A 1U97A 3NXSA 4B3MO 1K3EA 4MTGA 1KECA 3HKCA 1RP3B 2D3OW 2YXLA 1Y67A 3ZS8C 2X6CA 4X1YB 1WP7A 1AP5A 5H9CA 2FYUH 4N23A 5IJ0A 1R73A 3SYAA 2L35A 1CP9A 3SPGA 1KU9A 1VF6A 3SYPA 3OUFA 5KUMA 2UXCB 3HKBB 3PJSK 2ILMA 1QNMA 3ZX6A 4DV6O 4LF6B 3K9AA 4X9QA 1DTOA 1K33A 3BA8A 1VF6C 5B3SB 2PYJA 3RW0A 1H38A 2PF4E 3F5WC 3J7AU 4RO2A 1R6TA 1TA8A 3E22A 4AHCA 2QR4A 3SYOA 4PDLA 4FJCC 3UCSC 3WB1A 5JJEB 3RYCA 1EN6A 1URFA 2DJVA 3HPLC 5J2UA 4CS2A 3OUSA 1YXBA 2HVJC 1G8MA 3ZHUA 1YI2V 4UB8Z 1YJNV 5LP6C 3OE7G 1N8RW 2YUAA 3G4SV 4X65B 1ZL8A 3ZHVA 4NTXA 4DR6O 2ZE6A 4DR1B 4XDKA 3SPJA 1LR1A 3A0RA 5LP6A 3IJ4A 1KD1W 2LGQA 1XUQA 3K0GA 1L0NH 3OR7C 5IYDO 4PELA 1RPRA 3APOA 3BHPA 4J7KA 4TV9A 3ASNC 3Q4HA 4JTCB 1W0KG 2P4VA 2BSKA 3BCCH 1NJIW 4FFKA 4YY3B 4O2BB 1WAZA 4DV1O 4NXNB 5KX5A 4JGSA 2BOCC 4PA9A 2QJ1A 2QGNA 4JYBA 4QPJA 4CS3A 4H37A 4YJ2B 4NB5A 4WFBV 1L1FA 4LCUC 2WLHA 5KMGA 3CRQA 1QQCA 4FZ0A 2AHZA 1H8HG 2IU0A 1FXVA 3CJHB 1ORQC 4DV2O 2QA4V 3THOA 5J9PC 1Q81W 2A3QA 1LUWA 3ZN1A 1OV9A 1FJGB 2WLIA 5BXZA 3A8TA 1XQ8A 1VQ5V 3CCRV 1PD3A 3BRCA 3OEHG 4QPKA 1Q86W 1I08A 4LFAB 2QTSA 2RN9A 3OT7A 1DF4A 3CB2A 1FFXA 2ZE7A 1COWG 3OR6C 1R3LC 1SQVH 4A5UB 3JYCA 1K8AW 3CXCU 4QNHB 5CA1A 4JI1O 2E5LO 4J10A 1Z5WA 1I5YA 4DR5O 1KYOF 5EYPA 3K79A 1SC5B 4JV5O 1QBZA 2EBOA 3KZIZ 4FLVA 1XNRO 1PL4A 1DK1A 5IYBO 5HFMA 4OGQB 3OAAG 3RYFA 1GM9A 4I7ZB 1GAXA 4K0KB 4ZHQB 5L3BA 3H1JH 2GBOA 4G28B 5K1XA 3AEIA 2R9RB 4LFCO 3W7XA 4XDLA 4J9ZB 3JASB 2QE7G 2GDSA 2F43G 2Q0AA 3UQ8A 2HHHO 3ASOB 2QM7A 4DV5O 1P7GA 4B3TB 1K34A 4OX9B 1PPJH 5IJ0B 3OTOO 2F4VO 1M90W 1PV0A 4B3MB 3L71H 3EVKA 5JQGB 1HNXB 4MS2A 3BAAA 5EK0A 3OGIB 4LWSB 4U7NA 3JSLA 4HNAA 2E76B 4DR7B 3T1CA 1KMIZ 1OHHG 1XNQB 3CRMA 2UXXA 4WBNA 1VQ6V 1WNSA 2Y0PA 3ZN0A 2QEXV 1Y66A 1SERA 2LGWA 2YC0A 4Q20A 1VEWA 3VQWA 4G27B 1N0NA 2OT5A 4WFEA 3JATB 2EIMB 4QE9A 2XAHA 4LFCB 2G38A 5EBWC 2Q5ZA 1YDXA 3CCEV 4H44B 3CYOA 2CAZC 4BIUA 1OCOB 5ITZA 2E74B 4NKGB 2EZOA 1ZWIC 4PA7A 3I55V 2PY5A 3RGBA 3IC9A 2BCCH 2YIBD 1Q6HA 4WCEV 3HKEB 2ZD9A 1GO3F 1K5QA 2YIBA 5EBMC 2W6JG 2XAFA 4LF4O 1IBMO 3JD3A 1MSDA 4GX2A 3E22B 2DQ3A 5DM6V 3RBZA 2PI5A 2E3CA 4B3RO 2BTQA 4LFBB 4JYCA 4O4IA 2UUAO 4YHHO 2ZE8A 3STLC 5GW7A 1JFFB 1I94B 4CH5A 4ZHQA 4JTAB 4QE7A 1XOUA 2EIJC 2QDOA 1ENVA 3U0ZA 3LDEA 4YJ2A 2DW4A 3B8NA 1Z2GA 5CBFA 1FKAO 4CZZA 1O9HA 3BVOA 3O9OA 3AG4C 3G80A 1FJGO 2UUAB 2JEXA 3HB3B 3ABLC 3ABTA 5LMNB 5CMUA 4LH6A 4H33A 4U3JB 1L8DA 4LC1A 3D36A 3JALA 5JH7A 1XI1A 3VOUA 3CC7V 3RYIB 1N33B 3IC7A 3K57A 2QTOA 3ZBHA 1F4MA 2PUSA 3CJHA 4LFAO 3CCUV 1HNWB 2EULA 4NXMB 3E83A 3ASNB 1S3JA 3FAVB 5EYPB 4I0XA 1TUBB 2IW5A 2DYRC 4KP4A 4R7CA 1K92A 3CCJV 2CH7B 2JDIG 1IDSA 3ZHQA 2CDYA 2EX3A 3RWRD 2ZKOA 2AHYA 2LW7A 1R3IC 2Q4PA 3AG2C 4JASA 4PI2A 4DW0A 4ICGA 2Y0IA 2Z3YA 2DMXA 4HYOA 3FD9A 2ZT9B 5FL7G 5EBLC 5JCOA 4YIOA 4YJ3B 2PZSA 1UPGA 4DR2B 2ZCEA 1XBLA 4JYAO 4FLXA 4BW5A 3FX7A 1N0JA 2WA4A 3ZHSA 1J5EO 4KUMA 5CA0B 2Q7EA 4LWSA 4HAMA 2ADPA 4IHJA 5H2FZ 1ZX3A 3SYCA 4UFZA 1P4RA 3CC2V 2ADQB 3SJCC 3CCVV 2UUBB 3H9VA 4I9WA 3OD4A 1KC8W 4UCTA 3JAWB 1FYJA 1K7DA 2Q9LA 3ABKC 2IJHA 4GKKB 1YCIA 5BR8B 5D5QA 4D7SA 2WAMA 5BMVB 1GN2A 4JAUA 1NKDA 1SRYA 3RYFB 2CTWA 1Y76B 2MK3A 1VARA 4TUYA 4UVAA 1K73W 2Q6AA 1M4UA 5IT9N 4MVRA 5EZYA 4Z1VA 5IYCO 3E8BA 1BGYH 3WB0A 2UXCO 1OCRC 4NTWA 5LXTA 4O4HA 1RM1B 1TUEB 1XREA 4I5SA 5H6QA 4CH6A 1VQPV 1VF5B 5LP6B 1OZ0A 2P22C 5DEDA 3LSUA 4IT5A 3W7SA 3ZEDA 4J9YB 3L75H 3DGEA 4ZKIA 2OCHA 1FAFA 2R72A 2EJ7A 3AG2B 3ICXA 2JVDA 1XILA 1VQKV 2CK3G 1IBMB 1IBKB 4E2LA 2P6JA 1OJHA 4J7JA 3K3WA 4HBNA 1YTFB 3K04A 2OTLV 1SQPH 5KHIA 3T1YB 1JJ2U 4EFEA 2P5OA 2ZNIA 2EILC 3AG1B 5AG2A 1VF7A 4DR6B 2A06H 1NT2B 4RUEA 1NTMH 1AJNA 1FS0G 2WPDG 4FPPA 4PI0A 4J42A 1AILA 4MVSA 1WA8A 3UM7A 4DUZO 1N33O 2VRZA 3MHSC 3OW2U 5GONB 4FLTA 4UCOA 1TVKB 4EFBA 2EIJB 1GTOA 2M6YA 1O9GA 1KKDA 2ETNA 1NR7A 1ZL8B 3JALB 4WFHA 5JH7B 3ZRSA 5KAFZ 3HKCB 5C93A 1Q43A 3E8HA 1YIJV 1VQ4V 3ZRXA 2QWOB 4O4IB 2WLKA 2F23A 5FPOA 1MSWD 4X8AA 1VQ7V 1S72V 2CH7A 2RQ6A 3LNNA 1XMQB 1RSOB 4ZBMA 1XDCA 1QR9A 4J41A 5CN0A 1X59A 4RQEA 4X64O 3CCSV 2ZM6B 2DYRB 2D2CB 1VP7A 4JI1B 3WG7B 1GKFA 5L3DA 1QR8A 3QG5A 3AK3A 4ZOLB 1A32A 2QM4A 1TAEA 3ZMVA 5J2TB 2ZNJA 4X20A 4LR3A 3CWBH 5J2UB 2AW9A 5FNVA 3C3SA 4PA4A 1IZ3A 4DR5B 4UVBA 1F23A 1GRJA 3TJTA 4I9QA 2M7WA 5B1BC 4GKJB 4JI7O 5IWAB 3B8MA 1CPYA 4GLXA 2RNBA 2DN9A 3E8FA 1JJOA 4LF6O 1AVMA 5BR8O 2RCVA 3T4DA 3JAWA 2A9HA 5LMUO 2OWOA 4ZOLA 1AR4A 2IM9A 2VQEO 2DE0X 1ZUQA 4DV5B 3OTFA 2P90A 4GUNA 1AJQA 1N32O 2UUBO 1FXKB 1KKCA 4I0XB 2OCCB 2VWKA 1HNXO 4RAIA 4F6EA 2WLIB 4J80A 4QIWF 4RUFA 1H2NA 4F4LA 2F4VB 2CTRA 4PA3A 2LQTA 2XNDG 2N04A 1S76D 5JWPA 2YIDA 2RDCA 4X66B 4AQYB 3QVNA 3CMAV 3NR7A 5B66Z 5A2QN 5H6RA 4O2AA 4XBFA 1RPOA 1N4CA 3WFVA 2LO1A 1R6NA 3SJBC 3ABMC 2A7WA 2K1EA 4IL6Z 3HKDB 4X62B 3ZMSA 1WPXA 4JPRA 4UCRA 4DR4B 2WA3A 3DXRA 5IYZA 3RT3C 3M7MX 5DECA 3CP1A 2EZPA 2QKAA 4O4LB 3D36C 2GUZB 4JI4O 1KP3A 2HEPA 3DC5A 4MT8A 1BQ0A 2JJ2G 2KQXA 3K9SA 2AGAA 1MOFA 3ZHTA 3LNMB 1W2BU 4JYYA 3M99B 1JVMA 4I55A 4LNUA 1PP9H 3HKBA 3B2EE 3BABA 4MSWC 4I50B 2XHBA 4DK1A 1THZA 1VQ8V 3N27A 1OCZB 5ITZB 4Q6GA 4B7EA 4MTOA 5FPRA 1B3QA 3E86A 2DWEC 2GHYA 4PA6A 2Q7HA 2E5LB 2CUGA 2JGDA 2W0XA 2LW1A 4DYLA 4I55B 5B3SC 1Q90D 1M1KW 1SF9A 3FB8C 1MA1A 5LMNO 1ZAUA 2BTQB 3ZJZA 5LA6B 3ML0A 1HW7A 1FPOA 2ITCC 1XNRB 1XMOB 2IJIA 4DO2A 4FM2A 4MVUA 1WB8A 3ETQA 4JI6B 2F95B 2ZXWB 3PN1A 2VQFB 3ZRVA 2IH3C 4J11A 2ZR2A 1MG1A 3L70H 5EC2C 4R6ZA 5F2VO 5JVDA 1HWYA 2O57A 1Y74A 2YI9A 1GMGA 3L9DA 5CA1B 5B1AB 4NXMO 1V9PA 2ZR3A 2ZDIA 1MMMA 1JR9A 2XASA 4JTDB 1IVSA 1WA8B 1QCEA 3F5TA 1BS3A 3K5OA 4EB6A 1DGSA 4DV0O 4DR7O 1SQGA 2Y4UA 2EIMC 4BR6A 1QVFU 4DV7B 4TT3G 4TUYB 1N34B 3JARB 5K1PA 1M57C 4TV8B 5KMGB 1P84F 2FB5A 2KKWA 3K59A 1F4NA 3LUTB 1NTKH 4GX5A 5KLVH 3ETGA 1GN6A 4YXWG 5LYJB 4K8XA 1IXMA 4FZ1A 2OIEA 4IIJB 1J5EB 1K97A 1P49A 3FB6C 1WB7A 4JAVA 4FVMA 3P30A 1KP2A 2VQEB 3X2QC 3JAKB 1V55B 3VBBA 4UB6Z 2JRIA 2WLLA 2DYSC 1SESA 1AJPA 1AROP 4OPAA 2OCCC 5LHHA 4JI2O 3QF7A 5L3FA 5FLXN 5EC1C 1OCCC 4LF8O 1E79G 4DUZB 1ZTEA 2EINC 1XL4A 4IYHA 3WU2Z 4DV7O 1B06A 4X65O 4JI0B 4C7UA 2LFSA 4B3RB 4O4JA 3CEIA 3FYEB 5B1OA 3AG1C 1MABG 4TQFA 2NN4A 3DXRB 2F93B 2MW2B 1G6UA 1DF5A 3AG4B 4H13B 1M56B 4JI5B 3R66A 1AR1B 4B08A 3JD1A 2EIKC 2ATKC 3SR2C 3R65A 3P32A 1YVWA 1BE3H 1V54B 3ABUA 3G67A 2Y69B 2R9IA 3EFFK 5B1NA 1VQOV 1Q3EA 3J81N 1IBLO 2HJFC 5DN6G 2ARHA 3BFRA 3IGAC 4UV8A 3T2MA 4LH7A 3L74H 4X1IA 3ETEA 3VQXA 1YTFD 4LF9O 4B3SO 4LF8B 4OPHA 4JI8B 1WPBA 2UXBO 1QU7A 1L0LH 3U10A 1TGOA 4LNUB 1XNQO 1H2MA 1VIBA 4WFGA 4Z1MG 1M5IA 2BE3A 1GN3A 4QGPA 2XOKG 2JIZG 3F7YC 2EIKB 2GTSA 4BIZA 1NQTA 4JAAA 4L8JA 3D3IA 4WBNB 4DV2B 4P9OA 1M56C 1R3KC 5LL6Y 1N36B 1B6QA 5IJ9A 4PDMA 2KG7A 4FIPC 2H8PC 3FB7C 2B1IA 3T1HB 4DRXB 3BEHA 3ZMUA 4IGGA 4MTFA 4RWUA 1WLEA 1XL6A 3UT5A 1Q6IA 4X1KB 3A2FA 1HP8A 1KBHA 3L72H 5KHKA 4AI8A 4E4EA 2HLDG 1D5AA 2JEUA 1GN4A 3QO7A 4B3SB 5KUKA 1BMFG 3HKEA 3RFRA 3K5LA 3I5DA 5LGUA 1MZFA 3QNEA 3CHXA 2JGDB 2CGOA 3ZHRA 3AK1A 2KG7B 4GX1A 2OTJV 3S3XA 1I94O 4JZGA 5EIBC 3K08A 2QSAA 4ZI7B 2W0FC 1Q5OA 4DV0B 3CC4V 3U11A 1EZJA 1HNZO 1E1QG 4QJFB 5JQGA 3K03A 1IXBA 3DTUB 5BY1A 4PV1B 2YIAA 3C90A 3GVMA 2PYLA 4KL1A 4DW1A 3E89A 1CXZB 1AI4A 3E8GA 4TQDA 3BPZA 2UXDB 3ZMZA 1YZBA 5L3EA 4GT1A 1JA8A 2K9PA 2Z5UA 3UO2A 2RJZA 2QWQB 2ZIOA 3CE2A 3GB7C 1NZ6A 1SKVA 2DWDC 4DR1O 4PDVA 4ZI7A 1FXHA 4JI2B 3WG7C 2R70A 2LFRA 3FAVA 1YSCA 5B1BB 3H1LH 3JD2A 5GONA 1M57B 5LHGA 2IU3A 3K06A 2WLNA 4BWAA 3O65A 4GX0A 2R9AA 4UUJC 3N2GA 3MAQA 3CCQV 1H8EG 1YITV 2Q0OC 1XEQA 1B04A 5KX5B 2QKCA 3CD6V 1FXKC 1YJ9V 5LMUB 2A0LA 2Z0AA 3FKSG 1MZEA 4DUYB 5A9GA 5CA3A 1NTZH 5GTHZ 5IDJA 5L3CA 3OGCC 2F66C 5B5EZ 3BY6A 4DR3B 1GH6A 2YXHA 3RYHA 2Q7GA 2YS8A 2P06A 1QLNA 1M93A 1EN4A 4CH3A 1SS3A 1RM1C 3S3WA 2Q8VA 4K3AA 5D5PA 1AR5A 1ROPA 3CS5A 2DOSA 4LF7O 1FFXB 1VMGA 3DSQA 4X88A 2HR3A 2HVKC 2UUCB 2JS5A 1IBKO 4H0LB 4AQYO 2AXTZ 1SQBH 1EM1A 4LF4B 1EFRG 2WLMA 4N21A 4GCZA 3TCUA 1NH2B 3KCYA 1M9NA 2Y69C 4O4JB 4X89A 4YJ3A 1V55C 4DXWA 5KHJA 5CB4A 1XHXA 1ZSPA 1YEWA 2B1GA 4UV9A 4GKKO 1K4DC 1NBMG 3BA9A 3CRAA 4O2BA 3OMIB 3W7WA 1YF2A 2IJKA 3ZMTA 1S0VA 3JAMN 4X62O 5JCOC 1LUVA 3ETDA 4JI4B 4R50A 1ZLZA 1AB3A 4R8CA 2F1MA 1HR0O 1NH2D 1N34O 4WFAV 3N2KA 4NTYA 1BSMA 4FMTA 5FNVB 2P4KA 1EN5A 2X7RB 4MVMA 1BHAA 1FXKA 5EZYB 4MVQA 5HFLA 3LSQA 5LGNA 3HKDA 1VQNV 1Y76A 3T4ZA 3RYCB 2Q73A 1SZTA 2YSUB 3OTOB 1R1BA 1UFIA 3OMNB 3LSSA 4FLZA 1SA0A 5IE9A 5IYZB 3RVYA 5LXTB 3N2GB 3SPHA 2N74A 2GUZA 2WLJA 4OX9O 2JGUA 2Y4TA 4RQFA 3H1IH 1Y4MA 3SPIA 2BTOA 5GTIZ 1E1RG 2E75B 1BQZA 4F6RA 4L87A 1R3JC 2YICA 3ZRWA
chains in the Genus database with same CATH topology
1S77D 3ZRVA 2IH3C 2NNUA 2ZR2A 2EILB 1MG1A 1Q82W 5EC2C 2X0LA 3E83A 3JD0A 4R6ZA 3ASNB 4MW3A 3ABMB 1S3JA 1HWYA 5B1AC 2IW5A 1H2GA 2DYRC 1GMGA 4KP4A 4R7CA 2W6IG 5KA5A 1K92A 1CEZA 3CCJV 3AG3B 5BZBA 5B1AB 2JDIG 3K0DA 1GM7A 1S5HC 3ABLB 2ZR3A 2ZDIA 2XASA 4JTDB 2AHYA 2A79B 1QCEA 1R3IC 3AG2C 1K9MW 4JASA 3W7UA 2Z3YA 2EIMC 3OEEG 4HYOA 1QVFU 1K4CC 4FK5C 2WSSG 4TT3G 5FL7G 5EBLC 3SPCA 1M57C 3TETA 1QLEC 3MHHC 2JJ1G 2KB1A 1F4NA 4JF3A 3LUTB 4BW5A 4GX5A 3LDCA 4KUMA 3ETGA 2V7QG 2WLLB 4YXWG 3QO5A 2NLJC 1NR1A 4HAMA 3NXSA 1OCRB 1K3EA 4MTGA 2Q68A 1KECA 3G6EV 4XDJA 2D3OW 1IXMA 3JD4A 2X6BA 3SYCA 1P4RA 1K97A 1NVPD 3CC2V 4ASUG 2X6CA 3FB6C 3CCVV 5H9CA 1K5SA 2HFEC 4I9WA 4N23A 1R73A 1KC8W 4JAVA 3SYAA 3P30A 1KP2A 3X2QC 1K7DA 1CP9A 1V55B 3SPGA 3VBBA 1PNMA 3ABKC 4UXNA 3SYPA 2WLLA 1V54C 2DYSC 1SESA 1AJPA 1AROP 2IJHA 3OUFA 5KUMA 3H01A 3PJSK 2OCCC 3X2QB 5LHHA 2XAQA 5L3FA 2WAMA 5EC1C 1OCCC 5CBGA 1E79G 1KQSU 4JAUA 3K9AA 1NKDA 1DTOA 1K33A 1SRYA 2V1DA 2MK3A 3SJQC 2EINC 5B3SB 1XL4A 4UVAA 1K73W 2Q6AA 3RW0A 2C2AA 1H38A 4MVRA 5IYCO 2WWWA 3E8BA 3F5WC 3OFNG 4RO2A 2LFSA 3FYEB 1OCRC 5B1OA 3AG1C 1MABG 1OCOC 1TUEB 1RM1B 3SYOA 4I5SA 5H6QA 3JCZA 4PDLA 4FJCC 1VQPV 3HPLC 3CPWU 1JCHA 1OZ0A 3IFXA 1DF5A 1AI6A 3AG4B 1M56B 3OUSA 4MW8A 2HVJC 1G8MA 3W7SA 3EHBB 1YI2V 3CCLV 1AR1B 3JD1A 1YJNV 1EBOA 2ATKC 2EIKC 3OE7G 4J9YB 3G4SV 2Q69A 1N8RW 3DGEA 3R65A 3P32A 4ZKIA 2YEVB 1V54B 2DYSB 1UJWB 3ABUA 2Y69B 3AG2B 3QO8A 2R9IA 3EFFK 5B1NA 1VQOV 1VQKV 4XDKA 2CK3G 2HJFC 3SPJA 2B5UA 5DN6G 2ZQMA 4E2LA 1VQLV 2P6JA 3K3WA 3A0RA 1YTFB 3K04A 2OTLV 4EKWA 4HZ3A 1KD1W 3IGAC 4UV8A 1JJ2U 3T2MA 3K0GA 3OR7C 5IYDO 2DQ0A 3ETEA 4PELA 1YTFD 1RPRA 3ZIAG 2PI4A 2EILC 3ASNC 2Y48A 4JTCB 3AG1B 1W0KG 3OMAB 5L3GA 1YJWV 1R6KA 4MTXA 1NJIW 2ZDIC 2JK5C 4WFGA 2P67A 4Z1MG 4P9PA 4RUEA 4JGSA 2BOCC 4PA9A 4JYBA 4QPJA 5CBHA 1AJNA 2XOKG 1SETA 1Q7YW 1FS0G 2JIZG 2WPDG 4FPPA 3F7YC 4H37A 4MVSA 3UM7A 2EIKB 4WFBV 4LBEC 4LCUC 3MHSC 1JX9A 2WLHA 1NQTA 1L1FA 4BIZA 3D3IA 3OW2U 4P9OA 4WF9V 1M56C 2AHZA 3B77A 1H8HG 2IU0A 1FXVA 1PKXA 1R3KC 1ORQC 1B6QA 3ABKB 3E2EA 4PDMA 2QA4V 1BHBA 2ITDC 2EIJB 4FIPC 5J9PC 1Q81W 1GTOA 2H8PC 3FB7C 2B1IA 3ZN1A 1KKDA 2LP7A 1NR7A 5LHIA 3BEHA 4WFHA 3AG3C 3ZMUA 2WLIA 4MTFA 3ZRSA 5IY5B 1WLEA 1XL6A 1VQ9V 1VQ5V 5C93A 3CCRV 1PD3A 3OEHG 4QPKA 1Q86W 3E8HA 1YIJV 2HLDG 1DF4A 1VQ4V 3ZRXA 1COWG 3OR6C 2JEUA 1I5XA 1R3LC 2WLKA 3QO7A 5KUKA 1BMFG 1MSWD 3TK1A 5LGUA 3ZRWB 3JYCA 4X8AA 1VQ7V 1S72V 3QNEA 1BL8A 1K8AW 3CXCU 4QNHB 4ZBMA 1QR9A 1I5YA 5CN0A 4GX1A 2OTJV 1GK9A 3K79A 4RQEA 1GM8A 3CCSV 3I56V 1QBZA 2EBOA 3K08A 2DYRB 4U7OA 1QVGU 2W0FC 5IYBO 3WG7B 1GKFA 5HFMA 3CC4V 3F7VC 3OAAG 5L3DA 1EZJA 1GM9A 1QR8A 1E1QG 4QJFB 3K03A 3DTUB 5L3BA 3SYQA 3ZMVA 4G28B 3AEIA 3E89A 2R9RB 1AI4A 3E8GA 3W7XA 3ZMZA 4XDLA 4J9ZB 4TWKA 2QE7G 5L3EA 5LGTA 4GT1A 2F43G 4PA4A 4UVBA 1F23A 3ASOB 2Z5UA 2M7WA 2QM7A 5B1BC 3GB7C 4PDRA 3B8MA 1CPYA 1K34A 3E8FA 2DWDC 2XAGA 4PDVA 1PNLA 3GWOA 1FXHA 4CBCA 1AI5A 2FTKA 3WG7C 1M90W 3T4DA 2A9HA 2LFRA 1YSCA 5B1BB 3JD2A 4P30A 2EINB 1OCZC 1M57B 4KFMA 5LHGA 2IU3A 3K06A 4MS2A 2WLNA 5EK0A 2P90A 4U7NA 4GX0A 1AJQA 1FXKB 3T1CA 2IH1C 2X6AA 4UUJC 1OHHG 3CCQV 5KA6A 1H8EG 2UXXA 2OCCB 1YITV 4RAIA 1VQ6V 3ZN0A 1QLEB 2QEXV 3CD6V 1Y66A 1FXKC 3ASOC 4UVCA 1SERA 1YJ9V 2WLIB 2A0LA 2IJJA 4Q20A 3FKSG 4QIWF 4RUFA 1JOYA 4G27B 4F4LA 2OT5A 4WFEA 4WFFA 5CA3A 4PA3A 5IDJA 1DLBA 2EIMB 2QM8A 5L3CA 3OGCC 2XAHA 4QE9A 3UKMA 2XNDG 3BY6A 5EBWC 1PNKA 3CCEV 3LDDA 1S76D 4MVOA 1QLNA 3CYOA 1AI7A 4BIUA 1OCOB 1RM1C 3MD0A 2EZOA 3CMAV 3RVZA 3CCMV 1ROPA 1FFTB 1ZWIC 4PA7A 3I55V 5H6RA 2HVKC 4XBFA 1RPOA 2HR3A 4X88A 1P7BA 3WFVA 4WCEV 1R6NA 2ZD9A 3ABMC 2K1EA 1GO3F 5E1AC 1EFRG 2WLMA 1JQ0A 4N21A 1F51A 4GCZA 3TCUA 1K5QA 1NH2B 3ZMSA 1WPXA 3G71V 5EBMC 1W0JG 2ZXWC 3STZC 5IY5C 4JPRA 2W6JG 2XAFA 3JD3A 1M9NA 2BOBC 1G4YB 4TSFG 2Y69C 4GX2A 2DQ3A 3CP1A 4X89A 5DM6V 3RBZA 2PI5A 1V55C 2EZPA 4DXWA 1KP3A 4G2KA 4JYCA 4MT8A 2JJ2G 3FYIB 2B1GA 4UV9A 1MOFA 3FB5C 4MVZA 3STLC 1K4DC 1NBMG 3LNMB 5GW7A 3OMIB 1YHQV 3W7WA 1W2BU 2H94A 2IJKA 4JTAB 3M99B 3ZMTA 1S0VA 2HKOA 3KG2A 3CMEV 1JVMA 4QE7A 1OCCB 3W7TA 2YEVA 3ETDA 2EIJC 4R50A 2UXNA 4R8CA 3E35A 1ENVA 4MSWC 3LDEA 2DW4A 3B8NA 1THZA 5CBFA 1VQ8V 2XAJA 4BAYA 1NH2D 1OCZB 4WFAV 4CZZA 4FMTA 4MTOA 3AG4C 3E86A 2X7RB 4MVMA 1BHAA 1LNQA 1FXKA 2DWEC 2GHYA 4MVQA 5HFLA 2JEXA 2HG5C 3HB3B 3LSQA 4PA6A 5LGNA 2EJRA 1PL0A 1VQNV 3ABLC 3ABTA 2GSMB 5CMUA 3T4ZA 4H33A 3ZCCA 1SZTA 2YSUB 2Q67A 4LP8A 3OMNB 4LC1A 3OM3B 3D36A 3LSSA 5B3SC 5LBQA 1JPXA 1M1KW 3VOUA 1J95A 3RVYA 3CC7V 2QKSA 3FB8C 3IC7A 3SPHA 2WLJA 3ZJZA 1NVPB 2QTOA 3ML0A 4P2ZA 1F4MA 4RQFA 1Y4MA 2P7TC 1VQMV 3SPIA 4OXSA 1E1RG 2ITCC 2IJIA 4DO2A 4L87A 3CCUV 4MVUA 1R3JC 2ZXWB 3ZRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 V;  1K8A W;  3I55 V;  3CXC U;  1YJ9 V;  1M90 W;  1VQP V;  3G6E V;  1Q82 W;  1Q7Y W;  2OTL V;  3CPW U;  2D3O W;  1QVF U;  1VQ9 V;  4WCE V;  1M1K W;  1KQS U;  1KD1 W;  1VQ5 V;  1JJ2 U;  1VQ8 V;  3CCR V;  3CC7 V;  3CC2 V;  2OTJ V;  4WFB V;  4WFA V;  3CCV V;  1Q86 W;  1YHQ V;  3CCS V;  3I56 V;  1W2B U;  1YI2 V;  1K73 W;  3CCL V;  3OW2 U;  4WF9 V;  1YJN V;  1R73 A;  1YIJ V;  3CCJ V;  1QVG U;  1N8R W;  1KC8 W;  3G71 V;  3G4S V;  3CME V;  1VQ4 V;  3CC4 V;  3CCE V;  1VQM V;  1YJW V;  2QEX V;  2QA4 V;  1NJI W;  3CCQ V;  3CCU V;  1VQN V;  1VQO V;  1YIT V;  1Q81 W;  1VQK V;  5DM6 V;  1K9M W;  3CMA V;  1VQ6 V;  3CCM V;  1S72 V;  1VQ7 V;  1VQL V; 
#chains in the Genus database with same CATH topology
 5LOV B;  1S77 D;  1XHZ A;  4NVP A;  3APQ A;  1Q82 W;  2X0L A;  3JD0 A;  1MNG A;  5B1A C;  1Q6U A;  1HNZ B;  5CA0 A;  3K58 A;  1H2G A;  1IUR A;  5KA5 A;  1SZX A;  1BT8 A;  1CEZ A;  4JI0 O;  3KCX A;  3Q4H B;  3K0D A;  1GM7 A;  1S5H C;  1BZK A;  1KUQ A;  2A79 B;  1K9M W;  2VS0 A;  1D2D A;  2PGG A;  4F6R B;  4JV5 B;  4PJ0 Z;  2WSS G;  4JI5 O;  3SPC A;  4IIJ A;  3TET A;  4FFB A;  4UCV A;  1QLE C;  3MHH C;  4JI3 B;  3VQV A;  4JF3 A;  1JFF A;  2WLL B;  3QO5 A;  2NLJ C;  1OCR B;  2Q68 A;  3CSX A;  1BCC H;  3J80 N;  3G6E V;  4XDJ A;  1I0H A;  3JD4 A;  2X6B A;  1NVP D;  4ASU G;  1K5S A;  2HFE C;  2ODM A;  2QWP B;  2AZ2 A;  1Y6X A;  2UXB B;  4UCU A;  2JS3 A;  2ZM6 O;  3A0B Z;  1PNM A;  4UXN A;  1V54 C;  3JAT A;  5KAI Z;  3H01 A;  3N2K B;  4FFB B;  3X2Q B;  1H2S B;  2XAQ A;  1XMQ O;  1S5J A;  5CBG A;  1KQS U;  2V1D A;  3SJQ C;  4B7K A;  3EXA A;  5LA6 A;  4U3J A;  1H2L A;  2C2A A;  3C3T A;  1I7F A;  4LF7 B;  1RSO A;  2WWW A;  3OFN G;  1IX9 A;  1G1X B;  1SA0 B;  1Q8I A;  1JMK C;  2GV9 A;  5KHH A;  2YXY A;  1OCO C;  4ZIB A;  4GKJ O;  3JCZ A;  2CGN A;  3H1K H;  3CPW U;  1JCH A;  3IFX A;  4BIO A;  4X20 B;  1AI6 A;  4J7Z A;  4MW8 A;  4PD4 F;  2QWN B;  3EHB B;  3CCL V;  1EBO A;  1PM9 A;  4O2A B;  2Q69 A;  2YEV B;  2DYS B;  1UJW B;  3QO8 A;  4NXN O;  1NU1 H;  4D6T H;  4DRX A;  1VQL V;  2B5U A;  2ZQM A;  3SJA C;  2VWJ A;  3JSN A;  5EIB D;  3JAK A;  4EKW A;  4X1K A;  4HZ3 A;  4DV1 B;  5JVD B;  4YY3 O;  2DQ0 A;  3MDS A;  3RYI A;  4O4L A;  4O4H B;  3ZIA G;  2PI4 A;  3T1Y O;  3CX5 F;  2Y48 A;  1SQX H;  3OMA B;  5L3G A;  3VQY A;  1YJW V;  1R6K A;  4MTX A;  2ZDI C;  1KB9 F;  2JK5 C;  4CC6 A;  2P67 A;  3D3Q A;  4P9P A;  4UCS A;  3HR0 A;  4EB6 B;  3TGU H;  3RYH B;  5CB4 B;  5CBH A;  4CH4 A;  1Q7Y W;  1SET A;  2ZIM A;  3IAY A;  2YI8 A;  4LBE C;  1JX9 A;  4YHH B;  4TV9 B;  4BW9 A;  4WF9 V;  3TXS A;  3B77 A;  3UO3 A;  1PKX A;  3G6B A;  4JI6 O;  3FFQ A;  4HNA B;  3ABK B;  3E2E A;  4CC5 A;  4JI8 O;  1BHB A;  2ITD C;  1XMO O;  3K5M A;  4FLU A;  2LP7 A;  5LHI A;  3AG3 C;  1U96 A;  4IHJ B;  5IY5 B;  4DV3 B;  4DR2 O;  1VQ9 V;  2ZIN A;  4YIP A;  4JYA B;  3SDL A;  4I4T A;  4K35 A;  1I5X A;  3TK1 A;  3ZRW B;  2CTP A;  1NS1 A;  1BL8 A;  2CE4 A;  1W59 A;  5BMV A;  2FL4 A;  4I50 A;  4LF5 O;  1TVK A;  1GK9 A;  1GM8 A;  4U3F H;  3I56 V;  4U7O A;  5JJJ B;  3P3P A;  1QVG U;  1T5E A;  2AZ0 A;  2ZE5 A;  3KKY A;  3F7V C;  2V4D A;  2QWR B;  3SYQ A;  3DC6 A;  2OIG A;  4I4T B;  4CS4 A;  4JI3 O;  4X1Y A;  4TWK A;  2XUM A;  5LGT A;  1Z5V A;  1HDJ A;  2LJ2 A;  4DV3 O;  2OYQ A;  3UT5 B;  2UU9 O;  4PDR A;  5JJN B;  4GZR B;  2XAG A;  3P3N A;  2YDE A;  3B4S A;  1PNL A;  3GWO A;  5IWA O;  4CBC A;  1AI5 A;  5KHG A;  2FTK A;  1H2K A;  2PTM A;  2XTA A;  2VQF O;  4P30 A;  2IBZ H;  2HJD A;  2EIN B;  1OCZ C;  4KFM A;  5LYJ A;  4X1I B;  4NYK A;  4JZ2 A;  3M8A A;  5IJ9 B;  4DV4 B;  4DK0 A;  2FML A;  2IH1 C;  2X6A A;  4ABM A;  4X66 O;  5KA6 A;  1RFY A;  1QLE B;  3ASO C;  4PHZ A;  3A0H Z;  4UVC A;  2IJJ A;  1WJZ A;  1JOY A;  2RMK B;  4NR1 A;  4WFF A;  3CRR A;  1DLB A;  2QM8 A;  3UKM A;  3JAS A;  1SQF A;  4KXR A;  1PNK A;  3LDD A;  4MVO A;  1IBL B;  1AI7 A;  2HP8 A;  3MD0 A;  4K0K O;  3CXH F;  3RVZ A;  3CCM V;  1WP8 A;  2UU9 B;  1FFT B;  4FLW A;  1QHT A;  1P7B A;  2KSD A;  2N05 A;  1SQQ H;  3RN4 A;  4LF9 B;  4DR3 O;  3K5N A;  4DR4 O;  5E1A C;  1TUB A;  1JQ0 A;  1F51 A;  3G71 V;  4IYI A;  1W0J G;  2ZXW C;  3STZ C;  4D7T A;  5IY5 C;  2BSK B;  2BOB C;  1G4Y B;  4TSF G;  4B3T O;  3L73 H;  2NR5 A;  3JAR A;  2UUC O;  1S5L Z;  4G2K A;  3D8C A;  3FYI B;  3FB5 C;  4MVZ A;  3CRC A;  3B40 A;  1YHQ V;  1N36 O;  2H94 A;  2HKO A;  3KG2 A;  3CME V;  1OCC B;  3W7T A;  2YEV A;  4KHP O;  2UXN A;  3H1H H;  3E35 A;  1AP6 A;  3JCU Z;  2CTQ A;  2XAJ A;  4BAY A;  4TOI A;  1EZV H;  1LNQ A;  4FM1 A;  4JI7 B;  4AIL C;  2HG5 C;  3GWK C;  1HNW O;  2EJR A;  5C8Y B;  1PL0 A;  2GSM B;  3ZCC A;  1HR0 B;  4LP8 A;  2Q67 A;  1FD9 A;  3OM3 B;  4GYC B;  2XT9 A;  5LOV A;  5LBQ A;  1JPX A;  1J95 A;  1F7Y A;  2QKS A;  4KHP B;  4FLY A;  4Z2W A;  4W4L A;  1NVP B;  4P2Z A;  1X4T A;  1N32 B;  2P7T C;  3QTC A;  1VQM V;  4OXS A;  2GTA A;  4TV8 A;  2B9Z A;  4LFB O;  2UXD O;  2NNU A;  2EIL B;  4MW3 A;  3ABM B;  5C8Y A;  3AG7 A;  2W6I G;  4LF5 B;  3AG3 B;  5BZB A;  5J2T A;  3TXQ A;  3ABL B;  3WB2 A;  1NI8 A;  1US6 A;  3W7U A;  4DV6 B;  3SGI A;  4K8Z A;  3AK2 A;  4FM0 A;  5H5N A;  3OEE G;  4X64 B;  4EEQ A;  2FKX A;  1K4C C;  2HHH B;  4FK5 C;  5E79 Z;  3T1H O;  1WN7 A;  2H3O A;  3B09 A;  4W4K A;  2JJ1 G;  4DV4 O;  2KB1 A;  5TIS Z;  4DUY O;  2L6L A;  3LDC A;  1Y74 B;  2V7Q G;  1D5N A;  1NR1 A;  1U97 A;  3NXS A;  4B3M O;  1K3E A;  4MTG A;  1KEC A;  3HKC A;  1RP3 B;  2D3O W;  2YXL A;  1Y67 A;  3ZS8 C;  2X6C A;  4X1Y B;  1WP7 A;  1AP5 A;  5H9C A;  2FYU H;  4N23 A;  5IJ0 A;  1R73 A;  3SYA A;  2L35 A;  1CP9 A;  3SPG A;  1KU9 A;  1VF6 A;  3SYP A;  3OUF A;  5KUM A;  2UXC B;  3HKB B;  3PJS K;  2ILM A;  1QNM A;  3ZX6 A;  4DV6 O;  4LF6 B;  3K9A A;  4X9Q A;  1DTO A;  1K33 A;  3BA8 A;  1VF6 C;  5B3S B;  2PYJ A;  3RW0 A;  1H38 A;  2PF4 E;  3F5W C;  3J7A U;  4RO2 A;  1R6T A;  1TA8 A;  3E22 A;  4AHC A;  2QR4 A;  3SYO A;  4PDL A;  4FJC C;  3UCS C;  3WB1 A;  5JJE B;  3RYC A;  1EN6 A;  1URF A;  2DJV A;  3HPL C;  5J2U A;  4CS2 A;  3OUS A;  1YXB A;  2HVJ C;  1G8M A;  3ZHU A;  1YI2 V;  4UB8 Z;  1YJN V;  5LP6 C;  3OE7 G;  1N8R W;  2YUA A;  3G4S V;  4X65 B;  1ZL8 A;  3ZHV A;  4NTX A;  4DR6 O;  2ZE6 A;  4DR1 B;  4XDK A;  3SPJ A;  1LR1 A;  3A0R A;  5LP6 A;  3IJ4 A;  1KD1 W;  2LGQ A;  1XUQ A;  3K0G A;  1L0N H;  3OR7 C;  5IYD O;  4PEL A;  1RPR A;  3APO A;  3BHP A;  4J7K A;  4TV9 A;  3ASN C;  3Q4H A;  4JTC B;  1W0K G;  2P4V A;  2BSK A;  3BCC H;  1NJI W;  4FFK A;  4YY3 B;  4O2B B;  1WAZ A;  4DV1 O;  4NXN B;  5KX5 A;  4JGS A;  2BOC C;  4PA9 A;  2QJ1 A;  2QGN A;  4JYB A;  4QPJ A;  4CS3 A;  4H37 A;  4YJ2 B;  4NB5 A;  4WFB V;  1L1F A;  4LCU C;  2WLH A;  5KMG A;  3CRQ A;  1QQC A;  4FZ0 A;  2AHZ A;  1H8H G;  2IU0 A;  1FXV A;  3CJH B;  1ORQ C;  4DV2 O;  2QA4 V;  3THO A;  5J9P C;  1Q81 W;  2A3Q A;  1LUW A;  3ZN1 A;  1OV9 A;  1FJG B;  2WLI A;  5BXZ A;  3A8T A;  1XQ8 A;  1VQ5 V;  3CCR V;  1PD3 A;  3BRC A;  3OEH G;  4QPK A;  1Q86 W;  1I08 A;  4LFA B;  2QTS A;  2RN9 A;  3OT7 A;  1DF4 A;  3CB2 A;  1FFX A;  2ZE7 A;  1COW G;  3OR6 C;  1R3L C;  1SQV H;  4A5U B;  3JYC A;  1K8A W;  3CXC U;  4QNH B;  5CA1 A;  4JI1 O;  2E5L O;  4J10 A;  1Z5W A;  1I5Y A;  4DR5 O;  1KYO F;  5EYP A;  3K79 A;  1SC5 B;  4JV5 O;  1QBZ A;  2EBO A;  3KZI Z;  4FLV A;  1XNR O;  1PL4 A;  1DK1 A;  5IYB O;  5HFM A;  4OGQ B;  3OAA G;  3RYF A;  1GM9 A;  4I7Z B;  1GAX A;  4K0K B;  4ZHQ B;  5L3B A;  3H1J H;  2GBO A;  4G28 B;  5K1X A;  3AEI A;  2R9R B;  4LFC O;  3W7X A;  4XDL A;  4J9Z B;  3JAS B;  2QE7 G;  2GDS A;  2F43 G;  2Q0A A;  3UQ8 A;  2HHH O;  3ASO B;  2QM7 A;  4DV5 O;  1P7G A;  4B3T B;  1K34 A;  4OX9 B;  1PPJ H;  5IJ0 B;  3OTO O;  2F4V O;  1M90 W;  1PV0 A;  4B3M B;  3L71 H;  3EVK A;  5JQG B;  1HNX B;  4MS2 A;  3BAA A;  5EK0 A;  3OGI B;  4LWS B;  4U7N A;  3JSL A;  4HNA A;  2E76 B;  4DR7 B;  3T1C A;  1KMI Z;  1OHH G;  1XNQ B;  3CRM A;  2UXX A;  4WBN A;  1VQ6 V;  1WNS A;  2Y0P A;  3ZN0 A;  2QEX V;  1Y66 A;  1SER A;  2LGW A;  2YC0 A;  4Q20 A;  1VEW A;  3VQW A;  4G27 B;  1N0N A;  2OT5 A;  4WFE A;  3JAT B;  2EIM B;  4QE9 A;  2XAH A;  4LFC B;  2G38 A;  5EBW C;  2Q5Z A;  1YDX A;  3CCE V;  4H44 B;  3CYO A;  2CAZ C;  4BIU A;  1OCO B;  5ITZ A;  2E74 B;  4NKG B;  2EZO A;  1ZWI C;  4PA7 A;  3I55 V;  2PY5 A;  3RGB A;  3IC9 A;  2BCC H;  2YIB D;  1Q6H A;  4WCE V;  3HKE B;  2ZD9 A;  1GO3 F;  1K5Q A;  2YIB A;  5EBM C;  2W6J G;  2XAF A;  4LF4 O;  1IBM O;  3JD3 A;  1MSD A;  4GX2 A;  3E22 B;  2DQ3 A;  5DM6 V;  3RBZ A;  2PI5 A;  2E3C A;  4B3R O;  2BTQ A;  4LFB B;  4JYC A;  4O4I A;  2UUA O;  4YHH O;  2ZE8 A;  3STL C;  5GW7 A;  1JFF B;  1I94 B;  4CH5 A;  4ZHQ A;  4JTA B;  4QE7 A;  1XOU A;  2EIJ C;  2QDO A;  1ENV A;  3U0Z A;  3LDE A;  4YJ2 A;  2DW4 A;  3B8N A;  1Z2G A;  5CBF A;  1FKA O;  4CZZ A;  1O9H A;  3BVO A;  3O9O A;  3AG4 C;  3G80 A;  1FJG O;  2UUA B;  2JEX A;  3HB3 B;  3ABL C;  3ABT A;  5LMN B;  5CMU A;  4LH6 A;  4H33 A;  4U3J B;  1L8D A;  4LC1 A;  3D36 A;  3JAL A;  5JH7 A;  1XI1 A;  3VOU A;  3CC7 V;  3RYI B;  1N33 B;  3IC7 A;  3K57 A;  2QTO A;  3ZBH A;  1F4M A;  2PUS A;  3CJH A;  4LFA O;  3CCU V;  1HNW B;  2EUL A;  4NXM B;  3E83 A;  3ASN B;  1S3J A;  3FAV B;  5EYP B;  4I0X A;  1TUB B;  2IW5 A;  2DYR C;  4KP4 A;  4R7C A;  1K92 A;  3CCJ V;  2CH7 B;  2JDI G;  1IDS A;  3ZHQ A;  2CDY A;  2EX3 A;  3RWR D;  2ZKO A;  2AHY A;  2LW7 A;  1R3I C;  2Q4P A;  3AG2 C;  4JAS A;  4PI2 A;  4DW0 A;  4ICG A;  2Y0I A;  2Z3Y A;  2DMX A;  4HYO A;  3FD9 A;  2ZT9 B;  5FL7 G;  5EBL C;  5JCO A;  4YIO A;  4YJ3 B;  2PZS A;  1UPG A;  4DR2 B;  2ZCE A;  1XBL A;  4JYA O;  4FLX A;  4BW5 A;  3FX7 A;  1N0J A;  2WA4 A;  3ZHS A;  1J5E O;  4KUM A;  5CA0 B;  2Q7E A;  4LWS A;  4HAM A;  2ADP A;  4IHJ A;  5H2F Z;  1ZX3 A;  3SYC A;  4UFZ A;  1P4R A;  3CC2 V;  2ADQ B;  3SJC C;  3CCV V;  2UUB B;  3H9V A;  4I9W A;  3OD4 A;  1KC8 W;  4UCT A;  3JAW B;  1FYJ A;  1K7D A;  2Q9L A;  3ABK C;  2IJH A;  4GKK B;  1YCI A;  5BR8 B;  5D5Q A;  4D7S A;  2WAM A;  5BMV B;  1GN2 A;  4JAU A;  1NKD A;  1SRY A;  3RYF B;  2CTW A;  1Y76 B;  2MK3 A;  1VAR A;  4TUY A;  4UVA A;  1K73 W;  2Q6A A;  1M4U A;  5IT9 N;  4MVR A;  5EZY A;  4Z1V A;  5IYC O;  3E8B A;  1BGY H;  3WB0 A;  2UXC O;  1OCR C;  4NTW A;  5LXT A;  4O4H A;  1RM1 B;  1TUE B;  1XRE A;  4I5S A;  5H6Q A;  4CH6 A;  1VQP V;  1VF5 B;  5LP6 B;  1OZ0 A;  2P22 C;  5DED A;  3LSU A;  4IT5 A;  3W7S A;  3ZED A;  4J9Y B;  3L75 H;  3DGE A;  4ZKI A;  2OCH A;  1FAF A;  2R72 A;  2EJ7 A;  3AG2 B;  3ICX A;  2JVD A;  1XIL A;  1VQK V;  2CK3 G;  1IBM B;  1IBK B;  4E2L A;  2P6J A;  1OJH A;  4J7J A;  3K3W A;  4HBN A;  1YTF B;  3K04 A;  2OTL V;  1SQP H;  5KHI A;  3T1Y B;  1JJ2 U;  4EFE A;  2P5O A;  2ZNI A;  2EIL C;  3AG1 B;  5AG2 A;  1VF7 A;  4DR6 B;  2A06 H;  1NT2 B;  4RUE A;  1NTM H;  1AJN A;  1FS0 G;  2WPD G;  4FPP A;  4PI0 A;  4J42 A;  1AIL A;  4MVS A;  1WA8 A;  3UM7 A;  4DUZ O;  1N33 O;  2VRZ A;  3MHS C;  3OW2 U;  5GON B;  4FLT A;  4UCO A;  1TVK B;  4EFB A;  2EIJ B;  1GTO A;  2M6Y A;  1O9G A;  1KKD A;  2ETN A;  1NR7 A;  1ZL8 B;  3JAL B;  4WFH A;  5JH7 B;  3ZRS A;  5KAF Z;  3HKC B;  5C93 A;  1Q43 A;  3E8H A;  1YIJ V;  1VQ4 V;  3ZRX A;  2QWO B;  4O4I B;  2WLK A;  2F23 A;  5FPO A;  1MSW D;  4X8A A;  1VQ7 V;  1S72 V;  2CH7 A;  2RQ6 A;  3LNN A;  1XMQ B;  1RSO B;  4ZBM A;  1XDC A;  1QR9 A;  4J41 A;  5CN0 A;  1X59 A;  4RQE A;  4X64 O;  3CCS V;  2ZM6 B;  2DYR B;  2D2C B;  1VP7 A;  4JI1 B;  3WG7 B;  1GKF A;  5L3D A;  1QR8 A;  3QG5 A;  3AK3 A;  4ZOL B;  1A32 A;  2QM4 A;  1TAE A;  3ZMV A;  5J2T B;  2ZNJ A;  4X20 A;  4LR3 A;  3CWB H;  5J2U B;  2AW9 A;  5FNV A;  3C3S A;  4PA4 A;  1IZ3 A;  4DR5 B;  4UVB A;  1F23 A;  1GRJ A;  3TJT A;  4I9Q A;  2M7W A;  5B1B C;  4GKJ B;  4JI7 O;  5IWA B;  3B8M A;  1CPY A;  4GLX A;  2RNB A;  2DN9 A;  3E8F A;  1JJO A;  4LF6 O;  1AVM A;  5BR8 O;  2RCV A;  3T4D A;  3JAW A;  2A9H A;  5LMU O;  2OWO A;  4ZOL A;  1AR4 A;  2IM9 A;  2VQE O;  2DE0 X;  1ZUQ A;  4DV5 B;  3OTF A;  2P90 A;  4GUN A;  1AJQ A;  1N32 O;  2UUB O;  1FXK B;  1KKC A;  4I0X B;  2OCC B;  2VWK A;  1HNX O;  4RAI A;  4F6E A;  2WLI B;  4J80 A;  4QIW F;  4RUF A;  1H2N A;  4F4L A;  2F4V B;  2CTR A;  4PA3 A;  2LQT A;  2XND G;  2N04 A;  1S76 D;  5JWP A;  2YID A;  2RDC A;  4X66 B;  4AQY B;  3QVN A;  3CMA V;  3NR7 A;  5B66 Z;  5A2Q N;  5H6R A;  4O2A A;  4XBF A;  1RPO A;  1N4C A;  3WFV A;  2LO1 A;  1R6N A;  3SJB C;  3ABM C;  2A7W A;  2K1E A;  4IL6 Z;  3HKD B;  4X62 B;  3ZMS A;  1WPX A;  4JPR A;  4UCR A;  4DR4 B;  2WA3 A;  3DXR A;  5IYZ A;  3RT3 C;  3M7M X;  5DEC A;  3CP1 A;  2EZP A;  2QKA A;  4O4L B;  3D36 C;  2GUZ B;  4JI4 O;  1KP3 A;  2HEP A;  3DC5 A;  4MT8 A;  1BQ0 A;  2JJ2 G;  2KQX A;  3K9S A;  2AGA A;  1MOF A;  3ZHT A;  3LNM B;  1W2B U;  4JYY A;  3M99 B;  1JVM A;  4I55 A;  4LNU A;  1PP9 H;  3HKB A;  3B2E E;  3BAB A;  4MSW C;  4I50 B;  2XHB A;  4DK1 A;  1THZ A;  1VQ8 V;  3N27 A;  1OCZ B;  5ITZ B;  4Q6G A;  4B7E A;  4MTO A;  5FPR A;  1B3Q A;  3E86 A;  2DWE C;  2GHY A;  4PA6 A;  2Q7H A;  2E5L B;  2CUG A;  2JGD A;  2W0X A;  2LW1 A;  4DYL A;  4I55 B;  5B3S C;  1Q90 D;  1M1K W;  1SF9 A;  3FB8 C;  1MA1 A;  5LMN O;  1ZAU A;  2BTQ B;  3ZJZ A;  5LA6 B;  3ML0 A;  1HW7 A;  1FPO A;  2ITC C;  1XNR B;  1XMO B;  2IJI A;  4DO2 A;  4FM2 A;  4MVU A;  1WB8 A;  3ETQ A;  4JI6 B;  2F95 B;  2ZXW B;  3PN1 A;  2VQF B;  3ZRV A;  2IH3 C;  4J11 A;  2ZR2 A;  1MG1 A;  3L70 H;  5EC2 C;  4R6Z A;  5F2V O;  5JVD A;  1HWY A;  2O57 A;  1Y74 A;  2YI9 A;  1GMG A;  3L9D A;  5CA1 B;  5B1A B;  4NXM O;  1V9P A;  2ZR3 A;  2ZDI A;  1MMM A;  1JR9 A;  2XAS A;  4JTD B;  1IVS A;  1WA8 B;  1QCE A;  3F5T A;  1BS3 A;  3K5O A;  4EB6 A;  1DGS A;  4DV0 O;  4DR7 O;  1SQG A;  2Y4U A;  2EIM C;  4BR6 A;  1QVF U;  4DV7 B;  4TT3 G;  4TUY B;  1N34 B;  3JAR B;  5K1P A;  1M57 C;  4TV8 B;  5KMG B;  1P84 F;  2FB5 A;  2KKW A;  3K59 A;  1F4N A;  3LUT B;  1NTK H;  4GX5 A;  5KLV H;  3ETG A;  1GN6 A;  4YXW G;  5LYJ B;  4K8X A;  1IXM A;  4FZ1 A;  2OIE A;  4IIJ B;  1J5E B;  1K97 A;  1P49 A;  3FB6 C;  1WB7 A;  4JAV A;  4FVM A;  3P30 A;  1KP2 A;  2VQE B;  3X2Q C;  3JAK B;  1V55 B;  3VBB A;  4UB6 Z;  2JRI A;  2WLL A;  2DYS C;  1SES A;  1AJP A;  1ARO P;  4OPA A;  2OCC C;  5LHH A;  4JI2 O;  3QF7 A;  5L3F A;  5FLX N;  5EC1 C;  1OCC C;  4LF8 O;  1E79 G;  4DUZ B;  1ZTE A;  2EIN C;  1XL4 A;  4IYH A;  3WU2 Z;  4DV7 O;  1B06 A;  4X65 O;  4JI0 B;  4C7U A;  2LFS A;  4B3R B;  4O4J A;  3CEI A;  3FYE B;  5B1O A;  3AG1 C;  1MAB G;  4TQF A;  2NN4 A;  3DXR B;  2F93 B;  2MW2 B;  1G6U A;  1DF5 A;  3AG4 B;  4H13 B;  1M56 B;  4JI5 B;  3R66 A;  1AR1 B;  4B08 A;  3JD1 A;  2EIK C;  2ATK C;  3SR2 C;  3R65 A;  3P32 A;  1YVW A;  1BE3 H;  1V54 B;  3ABU A;  3G67 A;  2Y69 B;  2R9I A;  3EFF K;  5B1N A;  1VQO V;  1Q3E A;  3J81 N;  1IBL O;  2HJF C;  5DN6 G;  2ARH A;  3BFR A;  3IGA C;  4UV8 A;  3T2M A;  4LH7 A;  3L74 H;  4X1I A;  3ETE A;  3VQX A;  1YTF D;  4LF9 O;  4B3S O;  4LF8 B;  4OPH A;  4JI8 B;  1WPB A;  2UXB O;  1QU7 A;  1L0L H;  3U10 A;  1TGO A;  4LNU B;  1XNQ O;  1H2M A;  1VIB A;  4WFG A;  4Z1M G;  1M5I A;  2BE3 A;  1GN3 A;  4QGP A;  2XOK G;  2JIZ G;  3F7Y C;  2EIK B;  2GTS A;  4BIZ A;  1NQT A;  4JAA A;  4L8J A;  3D3I A;  4WBN B;  4DV2 B;  4P9O A;  1M56 C;  1R3K C;  5LL6 Y;  1N36 B;  1B6Q A;  5IJ9 A;  4PDM A;  2KG7 A;  4FIP C;  2H8P C;  3FB7 C;  2B1I A;  3T1H B;  4DRX B;  3BEH A;  3ZMU A;  4IGG A;  4MTF A;  4RWU A;  1WLE A;  1XL6 A;  3UT5 A;  1Q6I A;  4X1K B;  3A2F A;  1HP8 A;  1KBH A;  3L72 H;  5KHK A;  4AI8 A;  4E4E A;  2HLD G;  1D5A A;  2JEU A;  1GN4 A;  3QO7 A;  4B3S B;  5KUK A;  1BMF G;  3HKE A;  3RFR A;  3K5L A;  3I5D A;  5LGU A;  1MZF A;  3QNE A;  3CHX A;  2JGD B;  2CGO A;  3ZHR A;  3AK1 A;  2KG7 B;  4GX1 A;  2OTJ V;  3S3X A;  1I94 O;  4JZG A;  5EIB C;  3K08 A;  2QSA A;  4ZI7 B;  2W0F C;  1Q5O A;  4DV0 B;  3CC4 V;  3U11 A;  1EZJ A;  1HNZ O;  1E1Q G;  4QJF B;  5JQG A;  3K03 A;  1IXB A;  3DTU B;  5BY1 A;  4PV1 B;  2YIA A;  3C90 A;  3GVM A;  2PYL A;  4KL1 A;  4DW1 A;  3E89 A;  1CXZ B;  1AI4 A;  3E8G A;  4TQD A;  3BPZ A;  2UXD B;  3ZMZ A;  1YZB A;  5L3E A;  4GT1 A;  1JA8 A;  2K9P A;  2Z5U A;  3UO2 A;  2RJZ A;  2QWQ B;  2ZIO A;  3CE2 A;  3GB7 C;  1NZ6 A;  1SKV A;  2DWD C;  4DR1 O;  4PDV A;  4ZI7 A;  1FXH A;  4JI2 B;  3WG7 C;  2R70 A;  2LFR A;  3FAV A;  1YSC A;  5B1B B;  3H1L H;  3JD2 A;  5GON A;  1M57 B;  5LHG A;  2IU3 A;  3K06 A;  2WLN A;  4BWA A;  3O65 A;  4GX0 A;  2R9A A;  4UUJ C;  3N2G A;  3MAQ A;  3CCQ V;  1H8E G;  1YIT V;  2Q0O C;  1XEQ A;  1B04 A;  5KX5 B;  2QKC A;  3CD6 V;  1FXK C;  1YJ9 V;  5LMU B;  2A0L A;  2Z0A A;  3FKS G;  1MZE A;  4DUY B;  5A9G A;  5CA3 A;  1NTZ H;  5GTH Z;  5IDJ A;  5L3C A;  3OGC C;  2F66 C;  5B5E Z;  3BY6 A;  4DR3 B;  1GH6 A;  2YXH A;  3RYH A;  2Q7G A;  2YS8 A;  2P06 A;  1QLN A;  1M93 A;  1EN4 A;  4CH3 A;  1SS3 A;  1RM1 C;  3S3W A;  2Q8V A;  4K3A A;  5D5P A;  1AR5 A;  1ROP A;  3CS5 A;  2DOS A;  4LF7 O;  1FFX B;  1VMG A;  3DSQ A;  4X88 A;  2HR3 A;  2HVK C;  2UUC B;  2JS5 A;  1IBK O;  4H0L B;  4AQY O;  2AXT Z;  1SQB H;  1EM1 A;  4LF4 B;  1EFR G;  2WLM A;  4N21 A;  4GCZ A;  3TCU A;  1NH2 B;  3KCY A;  1M9N A;  2Y69 C;  4O4J B;  4X89 A;  4YJ3 A;  1V55 C;  4DXW A;  5KHJ A;  5CB4 A;  1XHX A;  1ZSP A;  1YEW A;  2B1G A;  4UV9 A;  4GKK O;  1K4D C;  1NBM G;  3BA9 A;  3CRA A;  4O2B A;  3OMI B;  3W7W A;  1YF2 A;  2IJK A;  3ZMT A;  1S0V A;  3JAM N;  4X62 O;  5JCO C;  1LUV A;  3ETD A;  4JI4 B;  4R50 A;  1ZLZ A;  1AB3 A;  4R8C A;  2F1M A;  1HR0 O;  1NH2 D;  1N34 O;  4WFA V;  3N2K A;  4NTY A;  1BSM A;  4FMT A;  5FNV B;  2P4K A;  1EN5 A;  2X7R B;  4MVM A;  1BHA A;  1FXK A;  5EZY B;  4MVQ A;  5HFL A;  3LSQ A;  5LGN A;  3HKD A;  1VQN V;  1Y76 A;  3T4Z A;  3RYC B;  2Q73 A;  1SZT A;  2YSU B;  3OTO B;  1R1B A;  1UFI A;  3OMN B;  3LSS A;  4FLZ A;  1SA0 A;  5IE9 A;  5IYZ B;  3RVY A;  5LXT B;  3N2G B;  3SPH A;  2N74 A;  2GUZ A;  2WLJ A;  4OX9 O;  2JGU A;  2Y4T A;  4RQF A;  3H1I H;  1Y4M A;  3SPI A;  2BTO A;  5GTI Z;  1E1R G;  2E75 B;  1BQZ A;  4F6R A;  4L87 A;  1R3J C;  2YIC A;  3ZRW A; 
#chains in the Genus database with same CATH homology
 1S77 D;  3ZRV A;  2IH3 C;  2NNU A;  2ZR2 A;  2EIL B;  1MG1 A;  1Q82 W;  5EC2 C;  2X0L A;  3E83 A;  3JD0 A;  4R6Z A;  3ASN B;  4MW3 A;  3ABM B;  1S3J A;  1HWY A;  5B1A C;  2IW5 A;  1H2G A;  2DYR C;  1GMG A;  4KP4 A;  4R7C A;  2W6I G;  5KA5 A;  1K92 A;  1CEZ A;  3CCJ V;  3AG3 B;  5BZB A;  5B1A B;  2JDI G;  3K0D A;  1GM7 A;  1S5H C;  3ABL B;  2ZR3 A;  2ZDI A;  2XAS A;  4JTD B;  2AHY A;  2A79 B;  1QCE A;  1R3I C;  3AG2 C;  1K9M W;  4JAS A;  3W7U A;  2Z3Y A;  2EIM C;  3OEE G;  4HYO A;  1QVF U;  1K4C C;  4FK5 C;  2WSS G;  4TT3 G;  5FL7 G;  5EBL C;  3SPC A;  1M57 C;  3TET A;  1QLE C;  3MHH C;  2JJ1 G;  2KB1 A;  1F4N A;  4JF3 A;  3LUT B;  4BW5 A;  4GX5 A;  3LDC A;  4KUM A;  3ETG A;  2V7Q G;  2WLL B;  4YXW G;  3QO5 A;  2NLJ C;  1NR1 A;  4HAM A;  3NXS A;  1OCR B;  1K3E A;  4MTG A;  2Q68 A;  1KEC A;  3G6E V;  4XDJ A;  2D3O W;  1IXM A;  3JD4 A;  2X6B A;  3SYC A;  1P4R A;  1K97 A;  1NVP D;  3CC2 V;  4ASU G;  2X6C A;  3FB6 C;  3CCV V;  5H9C A;  1K5S A;  2HFE C;  4I9W A;  4N23 A;  1R73 A;  1KC8 W;  4JAV A;  3SYA A;  3P30 A;  1KP2 A;  3X2Q C;  1K7D A;  1CP9 A;  1V55 B;  3SPG A;  3VBB A;  1PNM A;  3ABK C;  4UXN A;  3SYP A;  2WLL A;  1V54 C;  2DYS C;  1SES A;  1AJP A;  1ARO P;  2IJH A;  3OUF A;  5KUM A;  3H01 A;  3PJS K;  2OCC C;  3X2Q B;  5LHH A;  2XAQ A;  5L3F A;  2WAM A;  5EC1 C;  1OCC C;  5CBG A;  1E79 G;  1KQS U;  4JAU A;  3K9A A;  1NKD A;  1DTO A;  1K33 A;  1SRY A;  2V1D A;  2MK3 A;  3SJQ C;  2EIN C;  5B3S B;  1XL4 A;  4UVA A;  1K73 W;  2Q6A A;  3RW0 A;  2C2A A;  1H38 A;  4MVR A;  5IYC O;  2WWW A;  3E8B A;  3F5W C;  3OFN G;  4RO2 A;  2LFS A;  3FYE B;  1OCR C;  5B1O A;  3AG1 C;  1MAB G;  1OCO C;  1TUE B;  1RM1 B;  3SYO A;  4I5S A;  5H6Q A;  3JCZ A;  4PDL A;  4FJC C;  1VQP V;  3HPL C;  3CPW U;  1JCH A;  1OZ0 A;  3IFX A;  1DF5 A;  1AI6 A;  3AG4 B;  1M56 B;  3OUS A;  4MW8 A;  2HVJ C;  1G8M A;  3W7S A;  3EHB B;  1YI2 V;  3CCL V;  1AR1 B;  3JD1 A;  1YJN V;  1EBO A;  2ATK C;  2EIK C;  3OE7 G;  4J9Y B;  3G4S V;  2Q69 A;  1N8R W;  3DGE A;  3R65 A;  3P32 A;  4ZKI A;  2YEV B;  1V54 B;  2DYS B;  1UJW B;  3ABU A;  2Y69 B;  3AG2 B;  3QO8 A;  2R9I A;  3EFF K;  5B1N A;  1VQO V;  1VQK V;  4XDK A;  2CK3 G;  2HJF C;  3SPJ A;  2B5U A;  5DN6 G;  2ZQM A;  4E2L A;  1VQL V;  2P6J A;  3K3W A;  3A0R A;  1YTF B;  3K04 A;  2OTL V;  4EKW A;  4HZ3 A;  1KD1 W;  3IGA C;  4UV8 A;  1JJ2 U;  3T2M A;  3K0G A;  3OR7 C;  5IYD O;  2DQ0 A;  3ETE A;  4PEL A;  1YTF D;  1RPR A;  3ZIA G;  2PI4 A;  2EIL C;  3ASN C;  2Y48 A;  4JTC B;  3AG1 B;  1W0K G;  3OMA B;  5L3G A;  1YJW V;  1R6K A;  4MTX A;  1NJI W;  2ZDI C;  2JK5 C;  4WFG A;  2P67 A;  4Z1M G;  4P9P A;  4RUE A;  4JGS A;  2BOC C;  4PA9 A;  4JYB A;  4QPJ A;  5CBH A;  1AJN A;  2XOK G;  1SET A;  1Q7Y W;  1FS0 G;  2JIZ G;  2WPD G;  4FPP A;  3F7Y C;  4H37 A;  4MVS A;  3UM7 A;  2EIK B;  4WFB V;  4LBE C;  4LCU C;  3MHS C;  1JX9 A;  2WLH A;  1NQT A;  1L1F A;  4BIZ A;  3D3I A;  3OW2 U;  4P9O A;  4WF9 V;  1M56 C;  2AHZ A;  3B77 A;  1H8H G;  2IU0 A;  1FXV A;  1PKX A;  1R3K C;  1ORQ C;  1B6Q A;  3ABK B;  3E2E A;  4PDM A;  2QA4 V;  1BHB A;  2ITD C;  2EIJ B;  4FIP C;  5J9P C;  1Q81 W;  1GTO A;  2H8P C;  3FB7 C;  2B1I A;  3ZN1 A;  1KKD A;  2LP7 A;  1NR7 A;  5LHI A;  3BEH A;  4WFH A;  3AG3 C;  3ZMU A;  2WLI A;  4MTF A;  3ZRS A;  5IY5 B;  1WLE A;  1XL6 A;  1VQ9 V;  1VQ5 V;  5C93 A;  3CCR V;  1PD3 A;  3OEH G;  4QPK A;  1Q86 W;  3E8H A;  1YIJ V;  2HLD G;  1DF4 A;  1VQ4 V;  3ZRX A;  1COW G;  3OR6 C;  2JEU A;  1I5X A;  1R3L C;  2WLK A;  3QO7 A;  5KUK A;  1BMF G;  1MSW D;  3TK1 A;  5LGU A;  3ZRW B;  3JYC A;  4X8A A;  1VQ7 V;  1S72 V;  3QNE A;  1BL8 A;  1K8A W;  3CXC U;  4QNH B;  4ZBM A;  1QR9 A;  1I5Y A;  5CN0 A;  4GX1 A;  2OTJ V;  1GK9 A;  3K79 A;  4RQE A;  1GM8 A;  3CCS V;  3I56 V;  1QBZ A;  2EBO A;  3K08 A;  2DYR B;  4U7O A;  1QVG U;  2W0F C;  5IYB O;  3WG7 B;  1GKF A;  5HFM A;  3CC4 V;  3F7V C;  3OAA G;  5L3D A;  1EZJ A;  1GM9 A;  1QR8 A;  1E1Q G;  4QJF B;  3K03 A;  3DTU B;  5L3B A;  3SYQ A;  3ZMV A;  4G28 B;  3AEI A;  3E89 A;  2R9R B;  1AI4 A;  3E8G A;  3W7X A;  3ZMZ A;  4XDL A;  4J9Z B;  4TWK A;  2QE7 G;  5L3E A;  5LGT A;  4GT1 A;  2F43 G;  4PA4 A;  4UVB A;  1F23 A;  3ASO B;  2Z5U A;  2M7W A;  2QM7 A;  5B1B C;  3GB7 C;  4PDR A;  3B8M A;  1CPY A;  1K34 A;  3E8F A;  2DWD C;  2XAG A;  4PDV A;  1PNL A;  3GWO A;  1FXH A;  4CBC A;  1AI5 A;  2FTK A;  3WG7 C;  1M90 W;  3T4D A;  2A9H A;  2LFR A;  1YSC A;  5B1B B;  3JD2 A;  4P30 A;  2EIN B;  1OCZ C;  1M57 B;  4KFM A;  5LHG A;  2IU3 A;  3K06 A;  4MS2 A;  2WLN A;  5EK0 A;  2P90 A;  4U7N A;  4GX0 A;  1AJQ A;  1FXK B;  3T1C A;  2IH1 C;  2X6A A;  4UUJ C;  1OHH G;  3CCQ V;  5KA6 A;  1H8E G;  2UXX A;  2OCC B;  1YIT V;  4RAI A;  1VQ6 V;  3ZN0 A;  1QLE B;  2QEX V;  3CD6 V;  1Y66 A;  1FXK C;  3ASO C;  4UVC A;  1SER A;  1YJ9 V;  2WLI B;  2A0L A;  2IJJ A;  4Q20 A;  3FKS G;  4QIW F;  4RUF A;  1JOY A;  4G27 B;  4F4L A;  2OT5 A;  4WFE A;  4WFF A;  5CA3 A;  4PA3 A;  5IDJ A;  1DLB A;  2EIM B;  2QM8 A;  5L3C A;  3OGC C;  2XAH A;  4QE9 A;  3UKM A;  2XND G;  3BY6 A;  5EBW C;  1PNK A;  3CCE V;  3LDD A;  1S76 D;  4MVO A;  1QLN A;  3CYO A;  1AI7 A;  4BIU A;  1OCO B;  1RM1 C;  3MD0 A;  2EZO A;  3CMA V;  3RVZ A;  3CCM V;  1ROP A;  1FFT B;  1ZWI C;  4PA7 A;  3I55 V;  5H6R A;  2HVK C;  4XBF A;  1RPO A;  2HR3 A;  4X88 A;  1P7B A;  3WFV A;  4WCE V;  1R6N A;  2ZD9 A;  3ABM C;  2K1E A;  1GO3 F;  5E1A C;  1EFR G;  2WLM A;  1JQ0 A;  4N21 A;  1F51 A;  4GCZ A;  3TCU A;  1K5Q A;  1NH2 B;  3ZMS A;  1WPX A;  3G71 V;  5EBM C;  1W0J G;  2ZXW C;  3STZ C;  5IY5 C;  4JPR A;  2W6J G;  2XAF A;  3JD3 A;  1M9N A;  2BOB C;  1G4Y B;  4TSF G;  2Y69 C;  4GX2 A;  2DQ3 A;  3CP1 A;  4X89 A;  5DM6 V;  3RBZ A;  2PI5 A;  1V55 C;  2EZP A;  4DXW A;  1KP3 A;  4G2K A;  4JYC A;  4MT8 A;  2JJ2 G;  3FYI B;  2B1G A;  4UV9 A;  1MOF A;  3FB5 C;  4MVZ A;  3STL C;  1K4D C;  1NBM G;  3LNM B;  5GW7 A;  3OMI B;  1YHQ V;  3W7W A;  1W2B U;  2H94 A;  2IJK A;  4JTA B;  3M99 B;  3ZMT A;  1S0V A;  2HKO A;  3KG2 A;  3CME V;  1JVM A;  4QE7 A;  1OCC B;  3W7T A;  2YEV A;  3ETD A;  2EIJ C;  4R50 A;  2UXN A;  4R8C A;  3E35 A;  1ENV A;  4MSW C;  3LDE A;  2DW4 A;  3B8N A;  1THZ A;  5CBF A;  1VQ8 V;  2XAJ A;  4BAY A;  1NH2 D;  1OCZ B;  4WFA V;  4CZZ A;  4FMT A;  4MTO A;  3AG4 C;  3E86 A;  2X7R B;  4MVM A;  1BHA A;  1LNQ A;  1FXK A;  2DWE C;  2GHY A;  4MVQ A;  5HFL A;  2JEX A;  2HG5 C;  3HB3 B;  3LSQ A;  4PA6 A;  5LGN A;  2EJR A;  1PL0 A;  1VQN V;  3ABL C;  3ABT A;  2GSM B;  5CMU A;  3T4Z A;  4H33 A;  3ZCC A;  1SZT A;  2YSU B;  2Q67 A;  4LP8 A;  3OMN B;  4LC1 A;  3OM3 B;  3D36 A;  3LSS A;  5B3S C;  5LBQ A;  1JPX A;  1M1K W;  3VOU A;  1J95 A;  3RVY A;  3CC7 V;  2QKS A;  3FB8 C;  3IC7 A;  3SPH A;  2WLJ A;  3ZJZ A;  1NVP B;  2QTO A;  3ML0 A;  4P2Z A;  1F4M A;  4RQF A;  1Y4M A;  2P7T C;  1VQM V;  3SPI A;  4OXS A;  1E1R G;  2ITC C;  2IJI A;  4DO2 A;  4L87 A;  3CCU V;  4MVU A;  1R3J C;  2ZXW B;  3ZRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...