2QF0A

Structure of the delta pdz truncation of the degs protease
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
202
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLNTEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 44
structure length 202
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf0A02
3TLOA 4NA8A 4D7FA 1A3EH 5HXFA 1TNKA 3PM3A 1O0DH 2XWAA 1EZQA 3V12A 2BXUH 3GY5A 1BUIA 4X1NU 1DSUA 3K65B 3P92A 2BOKA 3U1IB 1CGHA 1ZJKA 4AGKA 2BMGB 1NESE 1CHOF 3VXEH 1EP6A 1CU1A 4F49A 1V2RT 1TYNA 1V2VT 2SGQE 5DGJA 1UTKA 2ZHQH 3EDXB 2A45B 2QIQA 1VR1H 5AFYH 2BD9A 1AUTC 4X6PA 1ARCA 1LDTT 2FXRA 3SV2H 1O3MA 2J38A 4GPGA 1P2NA 4X6OA 3ZZ4A 1BTPA 1D9IA 2GGVB 1IQFA 2R3UA 1GI5A 2PV9B 1V2KT 3C27B 1GJBB 1ELCA 4RKOB 5IYTA 1PJPA 1LKBA 1ETRH 3RXSA 2SNWA 1EB1H 5LGOA 1ZMNA 2UUKB 4BTIB 1KXBA 1DWEH 1TNHA 1CA0B 2BY5X 1E37B 5I25A 1SGYE 1Z7KA 1GI7B 3F6UH 3UUZA 1Y5BT 5JBBS 4A7IB 1O3GA 3ZYEA 5JYIA 1QB9A 3LGIA 2Z9JA 2PTCE 3QN7A 1NFWA 2PKAB 3E8LA 2ZNKH 4FU9A 1VZQH 2FYQA 1S84A 1TRNA 2EI6A 3A7WA 4JZEH 2GT8A 2W3KA 5GXPA 1DM4B 1BCUH 1JBUH 4MTBA 2OLGA 1NPMA 2F9VA 1GJDB 5GDSH 1T8OA 1TX6A 1YGCH 4GSOA 4IC5A 1AD8H 1MKXK 1X7AC 1B0EA 1ZZZA 1IQEA 2F9BH 4ABAA 1LPZB 2GX4A 1NU7B 5JPMH 5EPNA 2GKVE 2Z94A 1TMBH 2F9UA 2FTMA 1ACBE 4E05H 1GJ6A 2ZHDA 4GHQA 1KXFA 1Z1IA 1ELDE 3BTFE 3UREA 2B9LA 2CGAA 5T6DA 1OWDA 1J16A 1G3DA 1TQ0B 3UR6A 1MKXH 1JWTA 1ELVA 1EXFA 3DA9B 1C2FA 1RJXB 3SJKA 3QO6A 1W12U 5F8XA 3S69A 3T62A 1QL9A 2VU8E 3UFAA 1E0FD 2ULLA 1GDQA 1W7GH 2CMYA 2BXTH 1AFQB 2Y82A 4NFFA 3BTDE 3BEUA 1AMHA 1CE5A 1GHAG 1UTLM 4H6SB 3ELAH 4FUJA 2QXJA 5DP7A 1YKTA 1PPHE 1PPZA 2ZDVH 1ELGA 1MD7A 1O3KA 3DD2H 1T32A 3A81A 3M7TA 1OSSA 2A7JA 2AS9A 2Y5HA 2Q6GA 4PROA 2GDDA 4WVPE 3NK8A 4IC6A 2XXLA 5FBEA 1FV9A 3SQHE 4Y10E 2ZI2H 5G4BA 1EAUA 3MH4A 3BN9A 2VWMA 5ESTE 3TJOA 1MU6B 1Y5AT 1YCPH 2ZDNA 3QZQA 1TMTH 4I33A 3LH1A 1XXDA 2ZGXH 3E0PB 4ZHAA 3RXPA 3WY8A 2WPJS 5E8EH 1BJVA 1DLKB 1UCYH 2BLVA 3SU2A 2VJ1A 5T3HA 3RXCA 1QQUA 3M5OA 1HYLA 2BDBA 1GL0E 1NFXA 2EI8A 3RMNH 2H9HA 2QF0A 4MPXA 4O3UA 3SU1A 1SGTA 3MI4A 1VCWA 2OBOA 1PQAA 1FY5A 2A7CA 1PPCE 1EB2A 4O9VA 5FPTA 2PGBB 1ZHMA 1G32B 1T8NA 2AMQA 2LPRA 2WPMS 1AO5A 1O3CA 3E91A 4LOYH 1P9UA 2PTNA 4U30A 2OCVB 1L2EA 2WYJA 1IQNA 1FN8A 2AMPA 1GHAF 1GJAB 1KIGH 1T8LA 2AYWA 4H42U 3GCTF 2Y5FA 1G2LA 1GMHF 2ZKSA 3MNCA 1NRSH 4MDSA 3RU4E 2H9TH 5DG6A 1XUFA 1BIOA 1AVGH 1XUHA 3SJIA 4RKJB 2C8ZB 2PSXA 1QRXA 8ESTE 5I46H 4K5ZA 1RTLA 2Y81A 4QT8C 3ZVBA 3MNXA 3BTTE 2G51A 4AB8A 1HAVA 1GVKB 1HJAB 1S6HA 4AG1A 1OWIA 2F91A 2WPLS 3ZVFA 3SNAA 2J9NA 1C1UH 2TPIZ 2OBQA 6GCHG 1NZQH 1GCTB 4IBLH 4MPWA 2B7DH 3T28A 1MCVA 3SV6A 1UJ1A 5CHAB 1WAYB 4AFUA 5AF9H 1GBLA 1BA8B 1WYKA 1BMAA 1HAPH 1TRYA 3BG4B 1KXEA 4NZLA 1O33A 4FUIA 1Z8RA 3A89A 4FXGH 1SLXB 1HGTH 1NN6A 2F9NA 1ANEA 3A8DA 1A46H 3TNTA 4CBNA 1FONA 1THPB 1LMWB 2HGTH 2R0LA 3PLBA 1O3AA 1WOFA 1NRQH 2O8MA 4AYYB 1MBQA 2BD8A 3VB5A 5GJ4B 3KQBA 1H8IH 1ZTLA 1P06A 1O31A 2ZQ1A 2ZDLA 2ALPA 1EZSC 1QR3E 1DXWA 1J17T 2VWOA 3ZVEA 1QA0A 1SGPE 2TIOA 3EA9A 4F4OC 4J2YB 1IQKA 3G01A 1W11U 4UDWH 3A7YA 3E1XB 1GJCB 1S0QA 4ISNA 1Z6JH 1P10A 2OTVA 2PGQB 2W5EA 2ZDAH 3PO1B 4MLFB 1P2MA 3MNSA 9ESTA 1LVMA 3FP6E 3BF6H 6CHAB 2F83A 3ZVCA 3LIWA 3H5CB 1BITA 1XUKA 1O34A 4JYUH 1ZRBA 1YYY1 1K1PA 2P59A 1HAYB 1GHZA 1IHTH 2ZG0H 1C1MA 2ZIQH 3A88A 3AVZA 1HLTH 1ANDA 1EAWA 5EXLA 1C2IA 1C5VA 4Y6DA 3SGAE 1O35A 4BNRA 3RXJA 2ZQ2A 1AKSA 2ILNA 1CHGA 2XCFA 3ZZ3A 4WWYA 1WSSH 3KQEA 5C2ZA 3VGCB 1EP5A 3SQEE 4XOJA 3SU6A 1BMMH 3ATMA 1A0HB 2W3IA 2O8TA 2BZ6H 1P09A 3M36A 3ODFA 5CMXH 1DPOA 1O5EH 4OS7A 4CRAA 1CT0E 2ANYA 2SNVA 1GHBG 3LONA 5E0JA 2G52A 3VB3A 1QA7A 4JZ1A 4I8JA 4B75A 2WYGA 2JH0D 3KNXA 1HXEH 1V2TT 1GMCG 4D8NA 5GPIB 4TY6A 2ODPA 1JRTA 2FI3E 3N7OA 3P8GA 1GBIA 3MH5A 5E0HA 2H9EH 4X2XA 5HGGA 3A8BA 1O2YA 3RC6A 1TPOA 3BEFB 4E7RG 3IG6B 3STIA 5A0AE 1EZXC 2FP7B 3RMLH 4OGYA 3UPEA 1HDTH 4DGJA 5EQSA 3S7KB 1GBEA 4Z0KA 2FM2A 1TBQH 4B2AA 3GY3A 1BBRH 4ZKSU 1SLWB 1LCYA 4X2YA 2ESTE 3FANA 1TONA 1O2HA 2J92A 4B1TA 4B2BA 4CRDA 1AQ7A 2OP9A 1PPEE 2FYRA 2CHAC 2R0KA 2ZPQA 1JIRA 3H7OA 1DWBH 5FXLA 1TNGA 1BB0B 2A0QB 3RXFA 2QA9E 3I78A 3RXDA 5C5OA 3R0FA 4LXBH 2XYAA 3U98H 4FVBA 2G5VA 1W8BH 1DVAH 3SUGA 1UCYK 1GHVH 5FAHA 2BQ7B 2ZCHP 2FX6A 5EODA 1PPFE 4AZ2B 1O2QA 1KTTB 3RXIA 2A2XH 5GCHG 1AWHB 1ZYOA 2FOMB 1TBRH 1DE7H 2D26C 1A2CH 2THFB 1ELEE 2J34A 1P2JA 4AGJA 3IITA 3UQVA 1GMCF 1GBJA 1NC6A 4FUDA 1C1WH 3GCNA 3UWIA 4A1XA 3M61U 1QJ6B 5DKMA 2AGIX 1O3PB 2WPIS 2ZFTA 1TNJA 3NXPA 4WXVA 4JZIA 3LPRA 3W95A 2W7SA 2IN2A 2PWXA 3LC5A 1MUEB 2BY7X 2D8WA 3B23B 3HK3B 2ZU4A 3FZZA 2VIOA 1P2OA 4MNXA 2NU1E 1O3HA 1QFKH 3ENSB 4OS5A 5DPAA 1DS2E 5J4SA 2A7HA 1NRNH 3TK9A 1GWAA 1K1OA 1UO6A 2STBE 3MO9A 2Z3CA 1O2WA 4FUCA 1GDUA 2AEIH 5A09A 2PW8H 2EEKA 2SGFE 2TGDA 1C5WB 2XRCA 3EAJA 4CREA 1O38A 3TGIE 1RGQA 3JZ2B 1Y3VA 2BDCA 2AMDA 1TGTA 2ZECA 5L30H 1MU8B 3FZDA 4X1SU 3U8TH 2BD5A 1ETSH 1O2OA 1D6RA 4A1TA 4WJG2 1K2I1 1K1MA 1SMFE 1N8OB 1L4DA 3E6PH 2XCNA 2BD3A 3ESTA 1QHRB 2XBXA 1QL8A 1TAWA 3TH4H 4TWYA 3SNEA 1N6YA 1T4UH 3VXFH 3FP8E 3OY5U 3LC3A 1Z8IB 4I31A 2P16A 4ESTE 1CSOE 4MNVA 2HPQH 1DWDH 3B8JA 1E36B 5EXNA 4YLUA 1ZJDA 3BTGE 4KTCA 4M7GA 2CF8H 1T8MA 1A61H 4IN1A 2TGAA 1A5GH 2PKSB 1QGFA 1ELAA 3GICB 3RLYH 1UCYE 2TBSA 2AERH 3ZZ6A 3RMMH 3ZVGA 3A85A 2ZZUH 1GBDA 4AYVB 4ZAEA 1Y3WA 1FIZA 4MNYA 4U2WA 4B74A 1MKWK 1QY6A 4CBOA 2C4FH 2GVFA 3NZIA 4K1TA 1BJUA 4J1YA 1NRRH 1YP9A 1LHGH 2A4OA 5FPYA 2BYAX 3TITA 4ASHA 3M3TA 4BANB 2BLWA 1BMLA 1NU9A 2G00A 4LZ1H 2PUXB 3TPIZ 1TGSZ 5EPYA 1N1LA 1EZUC 1GG6C 2BB4A 5A0BA 2XNIA 1C2JA 2D1JA 1LVOA 4LK4A 2RG3A 1T7CA 1QURH 4AORA 4Y71A 2BZAA 3KCGH 1O2RA 3HPTB 3OSYA 1GI8B 1Z1JA 3MYWA 3QZRA 3DFLA 1IQMA 3RU4D 2QGRA 4NG9H 1WU1A 1XVOA 1O5GH 4OS2A 1QRZA 2ZU1A 3SJ9A 4D9RA 4AX9H 1A3BH 1G3EA 2GP9B 1C5LH 1DOJA 4X0WU 3RXEA 1IQLA 1WQSA 1O2GH 3QGNB 4DCDA 1O3FA 3MU5A 3M37A 1A0LA 1EOJA 2F3CE 3RXOA 2ZGCA 1TABE 1T31A 2BDGA 3H7TA 2OC7A 4K3JA 5AVDA 4DIIH 4WMFA 1O36A 2BVSH 2ALVA 1MTWA 1O5AB 3ODDA 3TU7H 3TNSA 1ARBA 5T6GA 5C3NA 5LH8A 3F9EA 3QUMP 1HPGA 3MNBA 3VPKA 4ABEA 1HJAC 1XKBC 4I8GA 5DP8A 5ETXA 1V2UT 2JH6D 1MTSA 1P02A 4FU8A 3A80A 1AGJA 1W3CA 4U32A 1GBTA 1KY9A 2BTCE 3PWCA 3VGCC 5C20A 1UVTH 3ZVAA 3LJJA 3ZZBA 3OYPA 2BY8X 5DP5A 3S0NA 2DE8A 3URCA 2HNTE 4YZUA 4ZHMU 1RFNA 3ZYDA 4B76A 1BRCE 1C5UA 3HKIB 1K9OE 3TK5A 3M35A 4H6TA 4FUFA 1P3EA 4CR9A 4XFQA 3PTBA 1TNIA 4YLQH 5C5NA 1Z6EA 2EC9H 2PUQH 5JB8S 2HWLB 1HAGE 2Z7FE 1YPKH 2QV1A 5L2ZH 1FZZA 1SC8U 1UVUH 2NWNA 1D3TB 1P05A 2VINA 1Z8GA 2EI7A 1AIXH 2R2WU 4KTSA 3SV8A 3TK6A 1YPLH 1LQDB 3HK6B 1TWXB 3KQDA 2ZU2A 2FIRH 1V2WT 4ZHLU 4WXIA 2H6MA 3PO1C 1OOKB 6LPRA 1UTQA 5JBTA 4XBBA 3GISB 5E0GA 1W14U 1UTJA 1GJ4H 1HV7A 1W0YH 1MZAA 2HRVA 8GCHG 4GHTA 2VH6A 3K6YA 1GJ8B 4NFEA 5HYOA 1KLIH 1RTKA 3LU9B 1F5RA 2G4TA 3T26A 3S9CA 1BT7A 5JDUB 5DP3A 1ZGIA 4AFQA 3P8FA 4R0IA 1O2JA 1F5LA 3SUDA 1WCZA 2ZGHA 3OX7U 2PKSC 1DY8A 2BM2A 1IOEA 4NSVA 1YC0A 2GZ8A 2AH4X 1L1NA 1TX8A 3CS0A 3MH6A 1TGBA 4ZUHA 3U8RH 4B73A 1VITF 1TGCA 1OWHA 1VITG 2B8OH 5LPFA 1FQ3A 1BTUA 2V6NA 4BAOB 1H1BA 4D9QA 3T2NA 1DUAA 1OWJA 1AFQC 2FMJA 2ANMH 2FWWA 1C2MA 1O2MA 5CHAC 1QBOA 3P95A 4XBDA 5F03A 1T4VH 3QTVH 1C1PA 1VJAU 3E3TA 1O2XA 2VWLA 1RD3B 2H5CA 3B9FH 3E16B 4MPUA 1DXPA 2J95A 2GMTB 3SNCA 1K28D 4WY3A 1TIOA 3U1JB 1H8DH 1SOZA 2QXGA 1F92A 2HALA 5GCHF 2O8WA 1KYNA 3GCTG 3TIUA 2IOTA 3LGVA 4TY7A 1O3EA 2FOBA 1BBRE 1QJ1B 2VIPA 1P2IA 2ANWA 1CT4E 1BRAA 1CBWB 4I8KA 3MO6A 3KN2A 1OS8A 4OS4A 1FMGA 1C1RA 4CR5A 2A5KA 2IJOB 1ZMJA 4ZKNU 2QCYA 1CVWH 2V35A 3QDZB 4DY7B 1IQIA 1ABJH 4GCHF 4NWLA 3D49H 2AIQA 1O3DA 3GY7A 5E2OA 1S83A 1QB6A 5L6NH 4FUEA 2F9PA 1V2QT 3Q3YA 4ABHA 2ANKH 1BZXE 1O3OA 1HCGA 3F68H 4FU7A 3SHCH 2I6QA 2QF3A 5CE1A 1GI3A 2Z9GA 1P11E 1BOQA 3PTNA 3Q77A 3RP2A 3SZNA 2NU4E 2Q6DA 1BDAA 1DT2A 1HAZB 1RS0A 4HZHA 4YO9A 1OKXA 1OYQA 1YPJH 1CA0C 1ZPBA 1QQ4A 1WBGB 2A4RA 2TGTA 1EOLA 5EQRA 1A4WH 3RXQA 4DG4A 4ABJA 3ZZ7A 1J9CH 1MBMA 3A7ZA 3S9AA 1OP0A 3W94A 1GBKA 1J8AA 1PQ5A 4DOQA 1P01A 1UVOA 3T5FH 1BQYA 1G3BA 5AFZH 3U69H 2AIPA 4ZMAH 3STJA 1TPSA 4Q7YA 4I8LA 3SGBE 1MH0A 4Y8XA 3LKWA 1GBMA 4DIHH 1V2PT 1GBHA 2RA3A 3RXAA 2V3HH 2P93A 3LGWA 3MU1A 1BTZA 1GGDB 3EE0B 2ODQA 1TX7A 2F9OA 5DK1A 2QY0B 3RC5A 1AHTH 1HXFH 1C1OA 2VGCC 3SGQE 1UTNA 2CJIA 1DY9A 1KXAA 4THNH 4X1QU 1AU8A 2OC8A 2W26A 1ELBA 2PKAA 5J4QA 2HOBA 2ZFFH 2W7UA 1DFPA 4NSYA 5FX6A 2FOGA 3ZVDA 5TCCA 5JB9S 1G36A 1SR5C 2GT7A 2FODA 3UOPA 1DICA 4K1EA 1O2LA 3RXHA 4BOHA 2FLRH 1AWFH 4AFSA 1IQGA 4KGAA 4X2WA 2GCTB 1UVPA 1SGDE 2UWLA 2C3SA 1SSXA 2HLCA 3AW0A 5EQQA 3GCHB 2Z3DA 2CF9H 5HM2A 4CHAC 4ISOA 4X1PU 4A5TS 4MPVA 1GI6A 1H4WA 2BVXH 1L4ZA 1GI9B 3PB1E 1SB1H 1CHOG 4INKA 1NFUA 1MTUA 1W7XH 4BXSA 2OC0A 2FOCA 2SGAA 1THSH 3L3TA 4UFDH 3ZV9A 2FO9A 1C2LA 4Y11E 4BXWA 1QIXB 1ZOMA 3RUOA 3RM2H 5K7RA 4JZFH 2FS8A 1RXPA 1FNIA 1K22H 1DX5M 3ATKA 3SI3H 3MWIU 1UK2A 4K8YA 3C1KA 3UR9A 1XXFA 4K69A 1FY8E 3F9FA 3SNBA 3A86A 3QLPH 1O2VA 4O97A 3AAVA 4JK6A 4Y8ZA 2XTTB 4KKDA 1S85A 3BTKE 3F1SB 2Z9LA 1P0SH 5DO4H 5EOKA 1PPBH 2NU0E 4JYVH 4AB9A 1C5QA 3D65E 2UUYA 3BEIB 2BLOA 1ZGVA 2HNTF 4ABIA 1EASA 3GCOA 3QK1A 5EW1H 2C8XB 1MTNB 2YNAA 1MKWH 1D3DB 4YOIA 4XDEA 1E35B 1UHBA 2XC4A 2OUAA 3ATIA 2BQ6B 4Z6AH 3BV9B 1SPJA 3SU5A 3I29A 2VVCA 4X2VA 1N6XA 2FLBH 1AB9C 2H1UA 3NUMA 2PFEA 2CHAB 1C5MD 1GHWH 3CP7A 2A1DB 2XWBI 1F5KU 3DT0H 1H9LB 2BD4A 2G81E 3T27A 1SVPA 1C9PA 4CH2B 2AGGX 1PQ8A 4TPIZ 2ASUB 4GVUA 4R8TB 2RA0A 5SGAE 1O3JA 1ETTH 1IQHA 1BTHH 3T25A 3SJ8A 1CO7E 3KF2A 3RXMA 2TRMA 2VH0A 1C1SA 1AE5A 4IGDA 2SGPE 4ABDA 1GCDA 4WMEA 4X8VH 2QC2A 5A8YA 1XUGA 1UK4A 2FOHA 2ZFRH 1MTVA 2VVUA 3DFJA 3TJUA 5DP4A 1P2QA 3SBKA 3ATLA 2GTBA 1F7ZA 1SL3A 1D3QB 1O3BA 1K1NA 1HJ9A 2A5IA 1XMNB 4DW2U 4CH8B 2SFAA 4X8TH 1AZZA 2C8WB 2M5TA 2P8OC 1NTPA 3TJVA 3O8DA 1GI1A 1S0RA 4DURA 1V2ST 1YBWA 7KMEH 1QTFA 5T6FA 3BIUH 4OGXA 2VNTA 2FDAA 1OPHB 1O39A 1IQJA 3ZZAA 1FLEE 3TH3H 1VCPA 1FI8A 2G8TA 1GGDC 2C8YB 4B71A 2V3OH 3GDVA 2ZGJA 1ESAA 3PMAB 2BDYA 1SHHB 2WPHS 3KIDU 1O37A 5IDKA 2QXIA 4ABBA 6CHAC 1O2SA 1C5OH 3U8OH 1YLDA 1GJ9B 1WTHD 5A0CA 2FEQH 1FDPA 3PMBB 1C9TA 1SQTA 2FX4A 1ZLRA 3ZZ8A 1O2TA 4AG2A 1GHXH 4HTCH 1W0ZU 1DUEA 1HAHH 1LHFH 2VWNA 2NU3E 1K1IA 7GCHF 5JBAS 3SU4A 2UWPA 3QGJA 1J14A 1MTNC 1LTOA 2R2MB 3BTWE 3LH3A 3P8NA 1O3LA 1QNJA 3M3VA 4UONA 1GBAA 2UWOA 3GY2A 1O3NA 1ABIH 4K60A 1BTWA 2A32A 4FUHA 3TJNA 1GI2A 1SLUB 3PMJA 1EPTC 4MNWA 3A8CA 1EKBB 4WH6A 3S9BA 1KLTA 4DVAU 2SGDE 4UFFH 3SNDA 1CBWC 4NA7A 1EAIA 1AVWA 1V2LT 4VGCB 1YCPK 1DLEA 3KL6A 3LT3A 3RXGA 3BG8A 2GCTC 1Y59T 1CGJE 1BBRK 3LOXA 1SQOA 4AOQA 1O2PA 2WV4A 4O03A 1DSTA 1C2DA 1LHEH 3MU8A 1AKSB 4INHA 5L2YH 2Z9KA 4CRFA 3VFEA 1SGIB 1XX9A 3SOSA 5A2MH 3HGNA 1SHYA 3ZV8A 2ZC9H 4H4FA 3HATH 3ZZCA 3EA7A 3GCHC 4BAMB 1J15A 1UK3A 2ZHFH 1HB0B 4A6LA 1E34B 1QBVH 6ESTA 1C5TA 3EQ0H 3QWCH 2ZPSA 3IWMA 1VCQA 2O9QA 2P94A 3BSQA 4DJZB 3RMOH 1O2NA 1C2KA 3E90B 3RM0H 1F2SE 1SFQB 2VGCB 3RXTA 1JXPA 2FPZA 2ZP0H 4YESB 2QXHA 3TVJB 4NZQA 2FS9A 4GUXA 3AAUA 3SORA 2JH5D 4JCNA 3P17H 1OWKA 1S82A 3RC4A 4K8BA 1Q31A 2C90B 1QJ7B 1VITH 2H5DA 2PSYA 3QTOH 4Q7XA 3RXVA 3TH2H 2FZZA 2WUCA 4WMDA 4AN7A 1DANH 1AB9B 3M7UA 1YLCA 2Z6BD 1KDQA 1C4V2 3MH7A 2Y80A 1UTMA 4NIWA 1FXYA 4ZXXH 1DDJA 2V0BA 1YPMH 1UTPA 1C5YB 1GL1A 4TWWA 1K1JA 2JKHA 5FHTA 5HM9A 3MTYA 1CQQA 3V3MA 2CV3A 1C5ZB 1V2MT 1TGNA 3AW1A 4UFGH 1B0FA 1EUFA 3AASA 5LPEA 1NFYA 4MVNA 3S7HB 3TGKE 1FY3A 4I8HA 3Q76A 2PHBA 1QL7A 1HAXB 2Y7XA 1HAIH 3NPSA 3VB7A 2BY9X 2OQ5A 2ZDMA 3MHWU 3UQOA 2BOHB 5JBCS 1G3CA 2TGPZ 3SW2B 1W13U 1IAUA 4ZKRU 4O3TA 2ZCKP 1PFXC 1P03A 4FVDA 1FAKH 3DHKH 3T29A 2OQUA 3BIVH 3K6ZA 4KP0A 3MMGA 3BG4C 3M5MA 4YOJA 3L6PA 1JRSA 1G30B 4YT7H 1C1NA 1D4PB 1EQ9A 2ZFSA 3GYMA 2VIQA 2D2DA 2GCHG 1GPZA 3KQCA 1O5DH 4IW4E 4XSKU 4IN2A 2Y5GA 2OD3B 4XBCA 1ZHRA 3OTJE 3M5NA 1C4U2 2BVRH 4X6MA 2I6SA 1C1VH 4ZH8A 1JIMA 1TMUH 4UEHH 1XUIA 3NWUA 4HFPB 4YM9A 1O2KA 1LHCH 1SOTA 1HAOH 1YPHC 2CXVA 1RTFB 1Q3XA 4NGAH 3SUEA 2GCHF 1PYTC 1GHBF 2WV5A 2GZ7A 1SGFA 3ITIA 2B5TB 3EGKH 2NU2E 2ZU5A 2UUFB 3GYLB 4Q7ZA 4E06H 5DJ7A 1AN1E 2VIWA 2A31A 3EYDA 2O8UA 3PMHB 4KELA 1ESBA 1IHSH 1MCTA 1A5HA 5PTPA 2BDAA 1NO9H 1S5SA 1MZDA 2FOAA 5K0HA 3P6ZB 3Q3KA 3RXKA 4ZKOU 4IMZA 1B5GH 3RXLA 3QX5H 4MQAA 1SI5H 1BTYA 3A82A 1SGFG 4BAKB 7LPRA 3PLKA 2G5NA 3A87A 1FIWA 1P2KA 1ZTKA 2GZ9A 1OP8A 1A5IA 1TA6A 2GV6A 2ZHWH 3CS7A 1ZR0A 4GCHG 1NRPH 1Y3UA 2WPKS 1LQEA 3MOCA 1ZPCA 1YCPM 4Q2KA 5EG4A 1V2NT 3SV9A 2A2QH 2BHGA 4IS5A 1ZTJA 1S81A 1P8VC 1UTOA 3BTHE 3K9XB 1O32A 5AHGH 3O8CA 2WUBA 1P57B 3KEEA 1EAXA 3FP7E 4SGBE 4GLYA 1YPHE 1AY6H 2UUJB 5GIBA 1DWCH 1GBBA 1AVXA 1PPGE 1YPGH 1UHBB 2BQWB 1HJ8A 3V0XA 3D23A 1XUJA 2R9PA 1P04A 1MQ5A 2A4GA 1FY4A 3PLPA 1LVBA 1KXDA 1GMHG 4INLA 2ZWLH 4JYTA 1C2GA 3PWBA 1EJMA 2ZU3A 4B2CA 2VIVA 1G37A 2OINA 5C1XA 1RRKA 3MO3A 4E7NA 2OC1A 1HBTH 1A1RA 1WTGH 5F6MA 1VGCC 1F0RA 1KTSB 1YM0A 5EGMA 1V2JT 1KSNA 3FAOA 5C1UA 3A8AA 4D76A 1HUTH 4CRCA 1K1LA 3SUFA 5EU8A 1GHYH 2ZA5A 3MU0A 4FUBA 3SJOA 4TPYA 1ESTA 2STAE 1ZSKA 1TB6H 3GY6A 2FOEA 1B7XB 4Y79A 1BHXB 3SO3A 1C2HA 1O2ZA 3HKJB 1NY22 2ZTXA 1YF4A 4DT7B 1ZMLA 2Z3EA 5TCAA 4X1RU 2H2ZA 3RDZA 5GWZA 1GI0A 3SV7A 1GI4A 2BD7A 4ZROA 3RXBA 1L1GA 2ZO3H 3SU0A 6GCHF 4LZ4B 1TPPA 2P3UB 1SQAA 3ZZDA 3Q3XA 1C1QA 8KME2 1GVLA 2C93B 2GD4B 3MU4A 1FUJA 1LPKB 3KHVA 2FI4E 3CENA 1TNLA 1P3CA 1HNEE 3UNSA 2ZGBH 1C5XB 1LVYA 1VJ9U 3JZ1B 3BTME 3PROA 4VGCC 1QB1A 3DUXH 1HIAA 3GDSA 3VB6A 2QN5T 4I7YH 3A83A 2J2UA 1K21H 2YOLA 1BRUP 5FX5A 1SLVB 1SGRE 5F8ZA 4ISLA 3D62A 3VEQB 2P3FH 5DP6A 3MFJA 3UTUH 4BAHB 3VB4A 4ABFA 1Y8TA 5BRRE 4NIVA 1G2MA 3A84A 1F0UA 1C1TA 2FTLE 3SI4H 1LPGB 3ATWA 1D3PB 4A1VA 1W10U 1F0TA 1FPCH 2ZPRA 2R3YA 5FPSA 1UVSH 1QCPA 2ZFPH 1ANCA 4OS6A 1V3XA 1ORFA 5F8TA 1AE8H 4IMQA 4I32A 1MMJN 2DE9A 4HI3A 3V13A 2RCEA 1O5CB 1HRTH 2P95A 1HAVB 2GDEH 4OS1A 2GV7A 1CA8B 1OXGA 8LPRA 1EJNA 4Q80A 1JMOH 1INCA 1GJ7B 2VIDA 1C5SA 3RXRA 1Y3YA 4YOGA 2QYIA 2FESH 4NCYA 2ZF0H 1GG6B 2VVVA 1HIAB 3I77A 4D7GA 4K2YA 4TYDA 1QRWA 1KLJH 3SU3A 2ODYB 1O2IA 3GOVB 1PQ7A 1GMDG 1TALA 1TLDA 3O8RA 1ZRKA 3OY6U 1FY1A 1Z8JB 1TBZH 2PR3A 3LGYA 2ZFQH 1HFDA 3U9AH 3SHAH 1M9UA 5EXMA 5FBIA 1CGIE 4K1SA 1TQ7B 3L33A 2VB0A 3UY9A 1E38B 1MD8A 5BPEA 2ZEBA 1C5NH 4RN6A 1AUJA 3GDUA 3M3SA 1D6WA 9LPRA 1XKAC 1ZPZA 1LO6A 1AZ8A 1GBCA 1L0ZA 1TFXA 4NIYA 1P12E 3SN8A 1TOMH 1XVMA 2AGEX 5C1YA 2ZHEH 1SFIA 2KAIA 1ANBA 1NS3A 4Y0YE 1UMAH 4UD9H 4YTAA 1EX3A 1NM6A 3R3GB 1EPTA 5B6OA 3GY8A 4BTTB 3URDA 4JMYA 4ISIH 1FAXA 1F0SA 3PV4A 3PYHA 1BHXF 1W2KH 2P8OB 2Z9IA 3NKKA 1WV7H 3M7QA 1NT1A 3GY4A 1OYTH 4BTUB 1ZHPA 2BD2A 1AI8H 1OWEA 4Y0ZE 1LKAA 1P9SA 3ZZ9A 1ID5H 2HVXA 3ZZ5A 4JK5A 3KGPA 1O5FH 1NROH 4GAWA 1Q2WA 2WINI 1BTXA 2G4UA 4HGCA 1EATA 3V7TA 3K2UA 2BDIA 3LDXH 3LJOA 4NIXA 1A7SA 3NCLA 2ZCLP 1C5RA 1S6FA 4Y8YA 4MG3A 2Y7ZA 1EJAA 2FI5E 2KAIB 4KTUA 5ESBA 4UFEH 3LGUA 1U6QA 2BDHA 2G55A 1EPTB 1O2UA 2AFQB 4A92A 1WUNH 3P70B 3RXUA 2ZDKA 1ZSJA 2JETC 3A7XA 2B0FA 1TE0A 1MQ6A 1SG8B 4ZXYH 4X6NA 1VGCB 4U01A 2YNBA 1LHDH 2DUCA 1OX1A 7GCHG 7ESTE 8GCHF 4YT6H 5C67A 1O3IA 2Q1JA 2A5AA 4WF8A 1A0JA 2HNTC 2P3TB 3EA8A 5FCRA 2LNCA 1RIWB 3HGPA 4X8SH 5HMAA 2Y6TA 4JZDH 3UWJH 3RLWH 3F9GA 5TJXA 2FOFA 1H9HE 2ZTYA 1V2OT 4CRBA 1C5PA 1SGEE 1GJ5H 5FCKA 1ZSLA 3O8BA 4Y7BA 3TGJE 2EA3A 2OXSA 4X8UH 1MAXA 1O5BB 2XBVA 4Y76A 1RIWC 1WQVH 2XC5A 1L1JA 1G9IE 2JETB 1TA2A 3BTQE 2ZTZA 1GBFA 1C4Y2 1ELFA 2XW9A 3FVFB 1THRH 1H9IE 2RDLA 3E0NB 3Q00A 3UNQA 1Y3XA 2J4IA 3BTEE 2A4QA 5LPRA 1TPAE 1MAYA 1ELTA 1SGNE 1AFEH 3UOUA 1OP2A 1V6DA 1SGQE 4RSPA 4AFZA 1PYTD 2BX4A 3A7VA 1GVZA 3A7TA 5E2PA 3M5LA 4CHAB 1TRMA 5A8XA 4NWKA 4WH8A 1GCTC 1TOCB 1SBWA 2Q6FA 4NA9H 5DP9A 4FUGA 1BRBE 1XM1A 3OU0A 2XBWA 2IPHA 5H4IB 2K1QA 1GMDF 5EW2H 2BY6X 1Y5UT 4ABGA 1KDQB 2SGEE 1DITH 1N8OC 4UE7H 5ABWA 2BLQA 4ISHH 2HPPH 1O30A 3UIRA 4BAQB 2J94A 1QBNA 2QAAA 4Y7AA 1FN6A 2O8LA 1Z71A 5A8ZA 3UNRA 1GDNA 2XBYA 1KXCA 1SGCA 3LGTA 3RU4T 2XC0A 2GMTC 3F9HA 3FFGA 1FJSA 2PLXA 1BMNH 1FPHH 1YPEH 2CN0H 1C2EA 1CT2E 2BX3A 4XE4A 4CRGA 4SGAE 3P8OA 1JOUB
chains in the Genus database with same CATH superfamily
3TLOA 4NA8A 4D7FA 1A3EH 5HXFA 1TNKA 3PM3A 1O0DH 5CHBA 2XWAA 1YLNA 1EZQA 3V12A 2BXUH 3GY5A 1BUIA 4X1NU 1DSUA 3K65B 3P92A 2BOKA 3U1IB 1CGHA 1ZJKA 4AGKA 2BMGB 1NESE 3CNRA 1CHOF 3VXEH 1EP6A 1CU1A 4F49A 1V2RT 1TYNA 1V2VT 2SGQE 5DGJA 1UTKA 2ZHQH 3EDXB 2A45B 2QIQA 1VR1H 1COWD 5AFYH 2BD9A 1AUTC 4X6PA 1ARCA 1LDTT 2FXRA 3SV2H 1O3MA 3FN8A 2J38A 4GPGA 1P2NA 4X6OA 3ZZ4A 1BTPA 1D9IA 2GGVB 1IQFA 2R3UA 1GI5A 2PV9B 1V2KT 3C27B 4RT0A 1GJBB 1ELCA 4RKOB 5IYTA 1PJPA 1LKBA 1ETRH 3RXSA 2SNWA 1EB1H 5LGOA 1ZMNA 2UUKB 4BTIB 1KXBA 1DWEH 1TNHA 1CA0B 2BY5X 1E37B 5I25A 1SGYE 1Z7KA 1GI7B 3F6UH 3UUZA 1Y5BT 5JBBS 4YXWD 4A7IB 1O3GA 3ZYEA 5JYIA 1QB9A 3LGIA 2KR7A 2Z9JA 2PTCE 3QN7A 1NFWA 2PKAB 1E1RD 3E8LA 2ZNKH 4FU9A 1VZQH 2FYQA 1S84A 1TRNA 2EI6A 3A7WA 4JZEH 2GT8A 2W3KA 5GXPA 1DM4B 3PV5A 1BCUH 1JBUH 4MTBA 2OLGA 1NPMA 2F9VA 1GJDB 5GDSH 1T8OA 1TX6A 1YGCH 4GSOA 2KZ4A 4IC5A 1AD8H 1MKXK 1X7AC 3SZEA 1B0EA 1ZZZA 1IQEA 2F9BH 4ABAA 1LPZB 2GX4A 4Q4LA 1NU7B 5JPMH 5EPNA 2GKVE 2Z94A 1TMBH 2F9UA 2FTMA 1ACBE 4E05H 1GJ6A 2ZHDA 4GHQA 1KXFA 1Z1IA 1ELDE 3BTFE 3UREA 3F2HA 2B9LA 2HLDD 2CGAA 5T6DA 1OWDA 1J16A 1G3DA 1TQ0B 3UR6A 1MKXH 1JWTA 1ELVA 1EXFA 3DA9B 1C2FA 1RJXB 3SJKA 3QO6A 1W12U 5F8XA 3S69A 3T62A 1QL9A 2VU8E 3UFAA 1E0FD 2ULLA 1GDQA 1W7GH 2CMYA 2BXTH 1AFQB 2Y82A 4NFFA 3BTDE 3BEUA 1AMHA 1CE5A 1GHAG 1UTLM 4H6SB 3ELAH 4FUJA 2QXJA 5DP7A 1YKTA 1PPHE 1PPZA 2ZDVH 1ELGA 1MD7A 1O3KA 3DD2H 1T32A 3A81A 3M7TA 1OSSA 2A7JA 2AS9A 2Y5HA 3WW7A 2Q6GA 4PROA 2GDDA 4WVPE 3NK8A 4IC6A 2XXLA 5FBEA 1FV9A 3SQHE 4Y10E 2ZI2H 5G4BA 1EAUA 2J97A 3MH4A 3BN9A 3PRBA 2VWMA 5ESTE 3TJOA 1MU6B 1Y5AT 1YCPH 2ZDNA 3QZQA 1TMTH 4I33A 3LH1A 1XXDA 2ZGXH 3E0PB 4ZHAA 3RXPA 3WY8A 2WPJS 5E8EH 1BJVA 1DLKB 1UCYH 2BLVA 3SU2A 2VJ1A 5T3HA 3RXCA 1QQUA 3M5OA 1HYLA 2BDBA 1GL0E 1NFXA 2EI8A 3RMNH 2H9HA 2QF0A 4MPXA 4O3UA 3SU1A 1SGTA 3MI4A 1VCWA 2OBOA 1PQAA 1FY5A 2A7CA 1PPCE 1EB2A 4O9VA 4DT4A 5FPTA 4Z1MD 2PGBB 1ZHMA 4B6EA 1G32B 1T8NA 2AMQA 2LPRA 2WPMS 1AO5A 1O3CA 3E91A 4LOYH 1P9UA 2PTNA 4U30A 2OCVB 1L2EA 2WYJA 1IQNA 1FN8A 2AMPA 1GHAF 5EJZA 1GJAB 1KIGH 1T8LA 2AYWA 4H42U 3GCTF 2Y5FA 1G2LA 1GMHF 2ZKSA 3MNCA 1NRSH 4MDSA 3RU4E 2H9TH 5DG6A 1XUFA 1BIOA 4TT3D 1AVGH 1XUHA 2RFKC 3SJIA 4RKJB 2C8ZB 2PSXA 1QRXA 8ESTE 5I46H 4K5ZA 1RTLA 2Y81A 4QT8C 3ZVBA 3MNXA 3BTTE 2G51A 4AB8A 1HAVA 1GVKB 1HJAB 1S6HA 4AG1A 1OWIA 2F91A 2WPLS 3ZVFA 3SNAA 2J9NA 1C1UH 2TPIZ 2OBQA 6GCHG 1NZQH 1GCTB 4IBLH 4MPWA 2B7DH 3T28A 1MCVA 3SV6A 1UJ1A 5CHAB 1WAYB 4AFUA 5AF9H 1GBLA 1BA8B 1WYKA 1BMAA 1HAPH 1TRYA 3BG4B 1KXEA 4NZLA 1O33A 4FUIA 1Z8RA 3A89A 4FXGH 1SLXB 1H8HD 1HGTH 1NN6A 2F9NA 1ANEA 3A8DA 1A46H 3TNTA 4CBNA 1FONA 1THPB 3FKSD 1LMWB 2HGTH 2R0LA 3PLBA 1O3AA 1WOFA 1NRQH 2O8MA 4AYYB 1MBQA 2BD8A 3VB5A 5GJ4B 3KQBA 1H8IH 1ZTLA 1P06A 1O31A 2ZQ1A 2ZDLA 2ALPA 1EZSC 2JJ2D 1QR3E 1DXWA 1J17T 2VWOA 3F2FA 3ZVEA 1QA0A 1SGPE 2TIOA 3EA9A 4F4OC 4J2YB 1IQKA 3G01A 1W11U 4UDWH 3A7YA 3E1XB 1GJCB 1S0QA 4ISNA 1Z6JH 1P10A 2OTVA 2PGQB 2W5EA 2ZDAH 2F43B 3PO1B 4MLFB 1E79D 1P2MA 3MNSA 3PRDA 9ESTA 1LVMA 3FP6E 3BF6H 6CHAB 2F83A 3ZVCA 3LIWA 3H5CB 1BITA 1XUKA 1O34A 4JYUH 1ZRBA 1YYY1 1K1PA 2P59A 1HAYB 1KMHB 1GHZA 1W0KD 1IHTH 2ZG0H 1C1MA 2ZIQH 3A88A 3AVZA 1HLTH 1ANDA 1EAWA 5EXLA 1C2IA 1C5VA 4Y6DA 3SGAE 1O35A 4BNRA 3RXJA 2ZQ2A 1AKSA 2ILNA 1CHGA 2XCFA 3ZZ3A 4WWYA 1WSSH 5T1VA 3KQEA 5C2ZA 3VGCB 1EP5A 3SQEE 4XOJA 3SU6A 1BMMH 3ATMA 1A0HB 5EIYA 2W3IA 2O8TA 2BZ6H 1P09A 3M36A 3ODFA 5CMXH 1DPOA 1O5EH 4OS7A 2V3MA 4F48B 4CRAA 3F0OA 1CT0E 2ANYA 2SNVA 1GHBG 3LONA 4HG6A 5E0JA 2G52A 3VB3A 1QA7A 4JZ1A 4B6FA 4I8JA 4B75A 2WYGA 2JH0D 3KNXA 1HXEH 1V2TT 5B6LA 1GMCG 4D8NA 5GPIB 4TY6A 2ODPA 1JRTA 2FI3E 3N7OA 3P8GA 1GBIA 3MH5A 5E0HA 2H9EH 4X2XA 5HGGA 3A8BA 1O2YA 3RC6A 1TPOA 3BEFB 3OE7D 4E7RG 3IG6B 3STIA 5A0AE 1EZXC 2FP7B 3RMLH 4OGYA 3UPEA 1HDTH 4DGJA 5EQSA 3S7KB 1GBEA 1S6LA 4Z0KA 2FM2A 1TBQH 4B2AA 3GY3A 1BBRH 4ZKSU 1SLWB 1LCYA 2EQNA 4X2YA 2ESTE 3FANA 5KGOA 1TONA 1O2HA 2J92A 4B1TA 4B2BA 4CRDA 1AQ7A 2OP9A 1PPEE 2FYRA 2CHAC 2R0KA 2ZPQA 1JIRA 3H7OA 1DWBH 5FXLA 1TNGA 1BB0B 2A0QB 3RXFA 2QA9E 3I78A 3RXDA 5C5OA 3R0FA 4LXBH 2XYAA 3U98H 4FVBA 2G5VA 1W8BH 1DVAH 3SUGA 1UCYK 1GHVH 5FAHA 2BQ7B 2ZCHP 2FX6A 5EODA 1PPFE 4AZ2B 1O2QA 1KTTB 3RXIA 2A2XH 5GCHG 1AWHB 1ZYOA 2FOMB 1TBRH 1DE7H 2D26C 1A2CH 2THFB 1ELEE 2J34A 2EY4C 1P2JA 4AGJA 3IITA 3UQVA 1GMCF 1GBJA 1NC6A 4FUDA 1C1WH 3GCNA 3UWIA 4A1XA 3M61U 1QJ6B 5DKMA 2AGIX 1O3PB 2XNDD 2WPIS 2ZFTA 1TNJA 3NXPA 2WHXA 4WXVA 4JZIA 3LPRA 3W95A 2W7SA 1QZ8A 2IN2A 2PWXA 3LC5A 1MUEB 2BY7X 2D8WA 3B23B 3HK3B 2ZU4A 3FZZA 2VIOA 4M9FA 1P2OA 4MNXA 2NU1E 5DN6D 1O3HA 1QFKH 3ENSB 4OS5A 5DPAA 1DS2E 5J4SA 2A7HA 1NRNH 3TK9A 1GWAA 1K1OA 4P02A 1UO6A 2STBE 5FL7D 3MO9A 2Z3CA 1O2WA 4FUCA 1GDUA 2AEIH 5A09A 2PW8H 2EEKA 2SGFE 2TGDA 1C5WB 2XRCA 3EAJA 4CREA 1O38A 3TGIE 1RGQA 3JZ2B 1Y3VA 2BDCA 2AMDA 1TGTA 2ZECA 5L30H 1MU8B 3FZDA 4X1SU 3U8TH 2BD5A 1ETSH 1O2OA 1D6RA 4A1TA 4WJG2 1K2I1 1K1MA 1SMFE 1N8OB 1L4DA 3E6PH 2XCNA 2BD3A 3ESTA 1QHRB 2KM0A 2XBXA 1QL8A 1TAWA 3TH4H 4TWYA 3SNEA 4FOUC 1N6YA 1T4UH 3VXFH 3FP8E 3OY5U 3LC3A 1Z8IB 3OEHD 4I31A 2P16A 2YMSD 4ESTE 1CSOE 4MNVA 2HPQH 1DWDH 3B8JA 1E36B 5EXNA 3F3BA 4YLUA 1ZJDA 3BTGE 4KTCA 4M7GA 2CF8H 1T8MA 1A61H 4IN1A 2TGAA 1A5GH 2PKSB 3WWFA 1QGFA 1ELAA 3GICB 3RLYH 1UCYE 2TBSA 2AERH 3ZZ6A 3RMMH 3ZVGA 3A85A 2ZZUH 1GBDA 4AYVB 4ZAEA 1Y3WA 1FIZA 4MNYA 4U2WA 4B74A 1MKWK 1QY6A 4CBOA 2C4FH 2GVFA 3NZIA 4K1TA 1BJUA 4J1YA 1NRRH 1YP9A 1LHGH 2A4OA 5FPYA 2BYAX 3TITA 5IK2D 4ASHA 3M3TA 4BANB 2BLWA 4RI0A 1BMLA 1NU9A 1SQRA 2G00A 4LZ1H 2PUXB 3TPIZ 1TGSZ 5EPYA 1N1LA 1EZUC 1GG6C 2BB4A 5A0BA 2XNIA 1C2JA 2D1JA 1LVOA 2KCPA 4LK4A 2RG3A 2QF5A 1T7CA 1QURH 4AORA 4Y71A 2BZAA 3KCGH 1O2RA 2QF4A 3HPTB 3OSYA 1GI8B 1Z1JA 3MYWA 3QZRA 3DFLA 1IQMA 1VKYA 3RU4D 2QGRA 4NG9H 1WU1A 1XVOA 1O5GH 4OS2A 1QRZA 2ZU1A 3NRLA 4TSFD 3F2GA 3SJ9A 4AX9H 1A3BH 1G3EA 4D9RA 2GP9B 1C5LH 1DOJA 4X0WU 3RXEA 1IQLA 1WQSA 1O2GH 3QGNB 4DCDA 1O3FA 3MU5A 3M37A 1A0LA 1EOJA 2F3CE 3RXOA 2ZGCA 1TABE 1T31A 2BDGA 3H7TA 2OC7A 4K3JA 5AVDA 4DIIH 4WMFA 2IJD1 1O36A 2BVSH 2ALVA 1MTWA 2PP6A 1O5AB 3ODDA 3TU7H 3TNSA 1ARBA 5T6GA 5C3NA 5LH8A 3F9EA 3QUMP 1HPGA 1YWUA 3MNBA 3VPKA 4ABEA 1HJAC 1XKBC 4I8GA 4XD7D 5DP8A 5ETXA 1V2UT 2JH6D 4OM9A 1MTSA 1P02A 4FU8A 3A80A 1AGJA 1W3CA 4U32A 1GBTA 1KY9A 2BTCE 2CK3D 3PWCA 3VGCC 5C20A 1UVTH 3ZVAA 3LJJA 3ZZBA 3OYPA 2BY8X 5DP5A 3S0NA 2DE8A 3URCA 2HNTE 4YZUA 4ZHMU 1RFNA 3ZYDA 4B76A 1BRCE 1C5UA 3HKIB 1K9OE 3TK5A 3M35A 4H6TA 4FUFA 1P3EA 4CR9A 4XFQA 3PTBA 1TNIA 4YLQH 5C5NA 2KCAA 1Z6EA 2EC9H 2PUQH 5JB8S 2HWLB 1HAGE 2Z7FE 2WV9A 1YPKH 2QV1A 5L2ZH 1FZZA 2NWNA 1SC8U 1UVUH 1D3TB 1P05A 4XRNA 2VINA 1Z8GA 2EI7A 1AIXH 2R2WU 4KTSA 3SV8A 3TK6A 1YPLH 1LQDB 3HK6B 1TWXB 3KQDA 2ZU2A 2FIRH 1V2WT 4ZHLU 4WXIA 2H6MA 3PO1C 1NBMD 1OOKB 6LPRA 1UTQA 5JBTA 4XBBA 3GISB 5E0GA 1W14U 1UTJA 1GJ4H 1HV7A 1W0YH 1MZAA 2HRVA 8GCHG 4GHTA 3N7DA 2VH6A 3K6YA 1GJ8B 4NFEA 5HYOA 1KLIH 1RTKA 3LU9B 1F5RA 2G4TA 3T26A 3S9CA 1BT7A 5JDUB 5DP3A 1ZGIA 4AFQA 3P8FA 4R0IA 1O2JA 2KCOA 1F5LA 3SUDA 1WCZA 3WWBA 2ZGHA 3OX7U 2PKSC 1DY8A 2BM2A 1IOEA 4NSVA 1YC0A 2GZ8A 2AH4X 1L1NA 1TX8A 2RDEA 3CS0A 1TGBA 3MH6A 4ZUHA 3U8RH 4B73A 1VITF 1TGCA 1OWHA 1VITG 2B8OH 5LPFA 1FQ3A 1BTUA 2V6NA 4BAOB 1H1BA 4D9QA 3T2NA 1DUAA 1OWJA 1AFQC 2FMJA 2ANMH 2FWWA 1C2MA 1O2MA 5CHAC 1QBOA 3P95A 4XBDA 5F03A 1T4VH 3QTVH 1C1PA 1VJAU 3E3TA 1O2XA 2VWLA 1RD3B 2H5CA 3B9FH 3E16B 4MPUA 1DXPA 2J95A 2GMTB 3SNCA 1K28D 4WY3A 1TIOA 3U1JB 1H8DH 1SOZA 2QXGA 1F92A 2HALA 5GCHF 2O8WA 1KYNA 3GCTG 3TIUA 2IOTA 3LGVA 4TY7A 1O3EA 2FOBA 1BBRE 1QJ1B 2VIPA 1P2IA 2ANWA 1CT4E 1BRAA 1OHHD 1CBWB 4I8KA 3MO6A 3KN2A 1OS8A 4OS4A 1FMGA 1C1RA 4CR5A 2A5KA 2IJOB 1ZMJA 4ZKNU 2QCYA 1CVWH 2V35A 3QDZB 4DY7B 1IQIA 1ABJH 4GCHF 4NWLA 3D49H 2AIQA 1O3DA 3GY7A 5E2OA 1S83A 1QB6A 5L6NH 3ZIAD 4FUEA 2F9PA 1FX0B 1V2QT 3Q3YA 4ABHA 2ANKH 1BZXE 1O3OA 1HCGA 2IPQX 3F68H 5HIYA 4FU7A 3SHCH 3KYFA 2I6QA 2QF3A 5CE1A 1GI3A 2Z9GA 1P11E 1BOQA 3PTNA 3Q77A 3RP2A 3SZNA 2NU4E 2Q6DA 1BDAA 1DT2A 1HAZB 1RS0A 4HZHA 4YO9A 1OKXA 1OYQA 1YPJH 1CA0C 1ZPBA 1QQ4A 1WBGB 2A4RA 2TGTA 1EOLA 5EQRA 1A4WH 3RXQA 4DG4A 4ABJA 3ZZ7A 1J9CH 1MBMA 3A7ZA 3S9AA 5GNDA 1OP0A 3W94A 1GBKA 1J8AA 1PQ5A 4DOQA 1P01A 1UVOA 3T5FH 1BQYA 3F0PA 1G3BA 5AFZH 3U69H 2AIPA 4ZMAH 3STJA 1TPSA 4Q7YA 4I8LA 3SGBE 3OTPA 1MH0A 4Y8XA 3LKWA 1GBMA 4DIHH 1V2PT 1GBHA 2RA3A 3RXAA 2V3HH 2P93A 3LGWA 3MU1A 1BTZA 1GGDB 3EE0B 2ODQA 1TX7A 2F9OA 5DK1A 2QY0B 3RC5A 1AHTH 1HXFH 1C1OA 2VGCC 3SGQE 3MQKC 1UTNA 2CJIA 1DY9A 1KXAA 4THNH 4X1QU 1AU8A 3OEED 2OC8A 2W26A 1ELBA 2PKAA 5J4QA 2HOBA 2ZFFH 2W7UA 5C94A 1DFPA 4NSYA 5FX6A 2FOGA 3ZVDA 5TCCA 5JB9S 1G36A 1SR5C 2GT7A 1H8ED 2FODA 3UOPA 1DICA 4K1EA 1O2LA 3RXHA 4BOHA 2FLRH 1AWFH 4AFSA 1IQGA 4KGAA 4X2WA 2GCTB 1UVPA 1SGDE 2UWLA 2C3SA 1SSXA 2HLCA 3AW0A 5EQQA 3GCHB 2Z3DA 2CF9H 5HM2A 4CHAC 4ISOA 4X1PU 4A5TS 4MPVA 1GI6A 1H4WA 2BVXH 1L4ZA 1GI9B 3PB1E 1SB1H 3UB0A 1CHOG 4INKA 1NFUA 1MTUA 1W7XH 4BXSA 2OC0A 2FOCA 2SGAA 1THSH 3L3TA 4UFDH 3ZV9A 2FO9A 1C2LA 4Y11E 4BXWA 1QIXB 1ZOMA 3RUOA 3RM2H 5K7RA 5F53A 4JZFH 2FS8A 1RXPA 1FNIA 1K22H 1DX5M 3ATKA 3SI3H 3MWIU 1UK2A 4K8YA 3C1KA 3UR9A 2WPDD 1XXFA 4K69A 1FY8E 3F9FA 3SNBA 3A86A 3QLPH 1O2VA 4O97A 3AAVA 4JK6A 4Y8ZA 2XTTB 4KKDA 1S85A 3BTKE 3F1SB 2Z9LA 1P0SH 5DO4H 5EOKA 1PPBH 2NU0E 4JYVH 4AB9A 2GJGA 1C5QA 3D65E 2UUYA 3BEIB 2BLOA 1ZGVA 2HNTF 4ABIA 1EASA 3GCOA 3QK1A 5EW1H 2C8XB 1MTNB 2YNAA 1MKWH 1D3DB 4YOIA 4XDEA 1E35B 1UHBA 2XC4A 2OUAA 3ATIA 2BQ6B 4Z6AH 3BV9B 1SPJA 3SU5A 3I29A 2VVCA 4X2VA 1N6XA 2FLBH 1AB9C 2H1UA 2W6JD 3NUMA 2PFEA 2CHAB 1C5MD 1GHWH 3CP7A 2A1DB 2XWBI 1F5KU 3DT0H 1H9LB 2BD4A 2G81E 3T27A 1SVPA 1C9PA 4CH2B 2AGGX 1PQ8A 4TPIZ 2ASUB 4GVUA 4R8TB 2RA0A 5SGAE 1O3JA 3PV2A 1ETTH 1IQHA 1BTHH 3T25A 3SJ8A 1CO7E 3KF2A 3RXMA 2TRMA 2VH0A 1C1SA 1AE5A 4IGDA 2SGPE 4ABDA 1GCDA 4WMEA 4X8VH 2QC2A 5A8YA 1XUGA 1UK4A 2FOHA 2ZFRH 1MTVA 2VVUA 3DFJA 3TJUA 5DP4A 1P2QA 3SBKA 3ATLA 2GTBA 1F7ZA 1SL3A 1D3QB 1O3BA 1K1NA 1HJ9A 2A5IA 1XMNB 4DW2U 4CH8B 2SFAA 4X8TH 1AZZA 2C8WB 2M5TA 2P8OC 1NTPA 3TJVA 3O8DA 1GI1A 1S0RA 4DURA 1V2ST 1YBWA 7KMEH 1QTFA 5T6FA 3BIUH 4OGXA 4Q63A 2VNTA 2FDAA 1OPHB 1O39A 1IQJA 3ZZAA 1FLEE 3TH3H 1VCPA 1FI8A 2G8TA 1GGDC 2C8YB 4B71A 2V3OH 3GDVA 2ZGJA 1ESAA 3PMAB 2BDYA 1SHHB 2WPHS 3KIDU 1O37A 5IDKA 2QXIA 4ABBA 6CHAC 1O2SA 1C5OH 3U8OH 1YLDA 1GJ9B 1WTHD 3SYJA 5A0CA 2FEQH 2L6OA 1FDPA 2JDID 3PMBB 1C9TA 1SQTA 2FX4A 1ZLRA 3ZZ8A 1O2TA 4AG2A 1GHXH 3KQ5A 4HTCH 1W0ZU 1DUEA 1HAHH 1LHFH 2KCYA 2VWNA 2LP6A 2NU3E 1K1IA 7GCHF 5JBAS 3SU4A 2UWPA 3QGJA 1J14A 4F55A 1MTNC 1LTOA 2R2MB 5DSFA 3BTWE 3LH3A 3P8NA 1O3LA 1W0JD 1QNJA 3M3VA 4UONA 1GBAA 2UWOA 3GY2A 5CDFE 2OK5A 1O3NA 1ABIH 4K60A 1BTWA 2A32A 4FUHA 3TJNA 1GI2A 1SLUB 3PMJA 1EPTC 4MNWA 3A8CA 1EKBB 2K0QA 4WH6A 3S9BA 1KLTA 4DVAU 2SGDE 4UFFH 3SNDA 1CBWC 4NA7A 1EAIA 3DSPA 1AVWA 1V2LT 4VGCB 2WSSD 1YCPK 1DLEA 3KL6A 3LT3A 3RXGA 3BG8A 2GCTC 1Y59T 1CGJE 1BBRK 3LOXA 1SQOA 4AOQA 1O2PA 2WV4A 5KECA 4O03A 1DSTA 1C2DA 1LHEH 3MU8A 1AKSB 4INHA 5L2YH 2Z9KA 4AC9A 3VFEA 4CRFA 1SGIB 1XX9A 3SOSA 5A2MH 3AK5A 3HGNA 1SHYA 3ZV8A 2ZC9H 4H4FA 3HATH 3ZZCA 3EA7A 3GCHC 4BAMB 1J15A 1UK3A 2ZHFH 1HB0B 4A6LA 1E34B 1QBVH 6ESTA 1C5TA 3EQ0H 3QWCH 2ZPSA 3IWMA 1VCQA 2O9QA 2P94A 3BSQA 4DJZB 3RMOH 1O2NA 1C2KA 3E90B 2W6ID 1F2SE 1SFQB 3RM0H 2VGCB 3RXTA 1JXPA 2FPZA 2ZP0H 4YESB 2QXHA 3TVJB 4NZQA 2FS9A 4GUXA 3AAUA 5HIZA 3SORA 3W1EA 2JH5D 4JCNA 3P17H 3GS9A 1OWKA 1S82A 1UW7A 3RC4A 4K8BA 1Q31A 2C90B 1QJ7B 1VITH 2H5DA 2PSYA 3QTOH 4Q7XA 3RXVA 3TH2H 2FZZA 3U28C 2WUCA 3N7EA 4WMDA 4AN7A 1DANH 1AB9B 3M7UA 1YLCA 2Z6BD 1KDQA 5C17A 1C4V2 3MH7A 2Y80A 1UTMA 4NIWA 1FXYA 2F4LA 4ZXXH 1DDJA 2V0BA 1YPMH 1UTPA 1C5YB 1GL1A 4TWWA 1K1JA 2JKHA 5FHTA 5HM9A 3MTYA 1CQQA 3V3MA 2CV3A 1C5ZB 1V2MT 1TGNA 3AW1A 2V7QD 4UFGH 1B0FA 1EUFA 3AASA 5LPEA 1NFYA 4MVNA 3S7HB 3TGKE 1FY3A 4I8HA 3Q76A 2PHBA 1QL7A 1HAXB 2Y7XA 1HAIH 3NPSA 3VB7A 2BY9X 2OQ5A 2ZDMA 3MHWU 3UQOA 2BOHB 5JBCS 1G3CA 2TGPZ 3SW2B 1W13U 1IAUA 4ZKRU 4O3TA 2L74A 2ZCKP 1PFXC 1P03A 4FVDA 1FAKH 3DHKH 3T29A 2OQUA 2J5UA 3BIVH 3K6ZA 4KP0A 3MMGA 3BG4C 3M5MA 4YOJA 3L6PA 1JRSA 1G30B 4YT7H 1C1NA 1D4PB 1EQ9A 2ZFSA 3FO8D 3GYMA 2VIQA 2D2DA 2GCHG 2YMSC 1GPZA 3KQCA 1O5DH 4IW4E 4XSKU 4IN2A 2Y5GA 2OD3B 4XBCA 1ZHRA 3OTJE 3M5NA 1C4U2 2BVRH 4X6MA 2I6SA 1C1VH 3DSGA 4ZH8A 1JIMA 1TMUH 4UEHH 1XUIA 3NWUA 4HFPB 4YM9A 1O2KA 1LHCH 1SOTA 1HAOH 1YPHC 2CXVA 1RTFB 1MABB 1Q3XA 4NGAH 3SUEA 2GCHF 1PYTC 2YMSB 1GHBF 2WV5A 2GZ7A 1SGFA 3ITIA 2HVYB 2B5TB 3EGKH 2NU2E 2ZU5A 2UUFB 3GYLB 4Q7ZA 4E06H 5DJ7A 1AN1E 2VIWA 2A31A 3EYDA 2O8UA 3PMHB 4KELA 1ESBA 1IHSH 1MCTA 1A5HA 5PTPA 2BDAA 1NO9H 1S5SA 1MZDA 2FOAA 5K0HA 3P6ZB 3Q3KA 3RXKA 4ZKOU 4IMZA 1B5GH 3RXLA 3QX5H 4MQAA 1SI5H 1BTYA 3A82A 1SGFG 4BAKB 7LPRA 3PLKA 2G5NA 3A87A 1FIWA 4ASUD 1P2KA 1ZTKA 2GZ9A 1OP8A 1A5IA 1TA6A 2GV6A 2ZHWH 3CS7A 1ZR0A 4GCHG 1NRPH 1Y3UA 2WPKS 1LQEA 3MOCA 1ZPCA 1YCPM 4Q2KA 5EG4A 1V2NT 3SV9A 2A2QH 2BHGA 4IS5A 1ZTJA 1S81A 1P8VC 1UTOA 3BTHE 3K9XB 1O32A 5AHGH 3O8CA 2WUBA 2K8IA 1P57B 3KEEA 1EAXA 3FP7E 4SGBE 4GLYA 1YPHE 1AY6H 2UUJB 5GIBA 1DWCH 1GBBA 1AVXA 1PPGE 1SKYE 1YPGH 1UHBB 2BQWB 1HJ8A 3V0XA 4I86A 3D23A 1XUJA 2R9PA 1P04A 1MQ5A 2A4GA 2KFWA 1FY4A 3PLPA 1LVBA 1KXDA 1GMHG 4INLA 2ZWLH 4JYTA 1C2GA 3PWBA 3UAIC 1EJMA 2ZU3A 4ACAA 4B2CA 2VIVA 1G37A 2OINA 5C1XA 1RRKA 3MO3A 4E7NA 3VG8A 2OC1A 1HBTH 1A1RA 1WTGH 5F6MA 1VGCC 1F0RA 1KTSB 1YM0A 5EGMA 1V2JT 1KSNA 3FAOA 5C1UA 3A8AA 3OAAD 4D76A 1HUTH 4CRCA 1K1LA 3SUFA 1BMFD 5EU8A 1GHYH 2ZA5A 3EE7A 3MU0A 4FUBA 3SJOA 4TPYA 1ESTA 2STAE 1ZSKA 1TB6H 3GY6A 2FOEA 1B7XB 4Y79A 1BHXB 3SO3A 1C2HA 1O2ZA 3HKJB 1NY22 2ZTXA 1YF4A 4DT7B 1ZMLA 2Z3EA 5TCAA 4X1RU 2H2ZA 3N99A 3RDZA 5GWZA 1GI0A 3SV7A 1GI4A 2BD7A 2VBCA 4ZROA 3RXBA 1L1GA 2ZO3H 3SU0A 6GCHF 4LZ4B 1TPPA 2P3UB 1SQAA 3ZZDA 3Q3XA 1C1QA 8KME2 1GVLA 2C93B 2GD4B 3MU4A 1FUJA 1LPKB 3KHVA 2FI4E 3CENA 1TNLA 1P3CA 1HNEE 3UNSA 3DCLA 2ZGBH 1C5XB 1LVYA 1VJ9U 2J98B 3JZ1B 3BTME 3PROA 4VGCC 1QB1A 3DUXH 1HIAA 3GDSA 3VB6A 2QN5T 4I7YH 3A83A 2J2UA 1K21H 2YOLA 1BRUP 5FX5A 1SLVB 1SGRE 5F8ZA 4ISLA 3D62A 5EJLA 3VEQB 2P3FH 5DP6A 3MFJA 3UTUH 4BAHB 3VB4A 4ABFA 1Y8TA 5BRRE 4NIVA 1G2MA 3A84A 1F0UA 1C1TA 2FTLE 3SI4H 1LPGB 3ATWA 1D3PB 4A1VA 1W10U 1F0TA 1FPCH 2ZPRA 2R3YA 5FPSA 1UVSH 1QCPA 2ZFPH 1ANCA 4OS6A 1V3XA 1ORFA 5F8TA 1AE8H 1WXRA 4IMQA 4I32A 1NBME 1MMJN 2DE9A 4HI3A 3V13A 2RCEA 1O5CB 1HRTH 2P95A 1HAVB 2GDEH 4OS1A 2GV7A 1CA8B 1OXGA 8LPRA 1EJNA 4Q80A 1JMOH 2WZQA 1INCA 1GJ7B 2VIDA 1C5SA 3RXRA 1Y3YA 4YOGA 2QYIA 2J98A 2FESH 4NCYA 2ZF0H 1GG6B 2VVVA 1HIAB 3I77A 4D7GA 4K2YA 4TYDA 1QRWA 1KLJH 5KEDA 3SU3A 2ODYB 1O2IA 3GOVB 1PQ7A 1GMDG 1TALA 1TLDA 3O8RA 1ZRKA 3OY6U 1FY1A 1Z8JB 1TBZH 2PR3A 3LGYA 2ZFQH 1HFDA 3U9AH 3SHAH 1M9UA 5EXMA 5FBIA 1CGIE 4K1SA 1TQ7B 3L33A 2VB0A 3UY9A 1E38B 1MD8A 5BPEA 2ZEBA 1C5NH 4RN6A 4RT1A 1AUJA 3GDUA 3M3SA 1D6WA 9LPRA 1E1QD 1XKAC 1ZPZA 1LO6A 2QE7D 1AZ8A 1GBCA 1L0ZA 1TFXA 4NIYA 1P12E 3SN8A 1TOMH 2AGEX 1XVMA 1EFRD 5C1YA 2ZHEH 1SFIA 2KAIA 1ANBA 1NS3A 4Y0YE 5EJ1A 1UMAH 4UD9H 4YTAA 1EX3A 1NM6A 3R3GB 1EPTA 5B6OA 3GY8A 4BTTB 3URDA 2M2AA 4JMYA 4ISIH 1FAXA 1F0SA 3PV4A 3PYHA 3DSOA 1BHXF 1W2KH 3KYGA 2P8OB 2Z9IA 3NKKA 5C0UA 1WV7H 3FOAA 1NT1A 3GY4A 1OYTH 3H09A 3M7QA 1ZHPA 2BD2A 4BTUB 1AI8H 1OWEA 4Y0ZE 1LKAA 1P9SA 3ZZ9A 1ID5H 2HVXA 3ZZ5A 4JK5A 3KGPA 1O5FH 2XOKD 1NROH 4GAWA 1Q2WA 2WINI 1BTXA 2G4UA 4HGCA 1EATA 3V7TA 3K2UA 2BDIA 3LDXH 3LJOA 4NIXA 1A7SA 3NCLA 2ZCLP 1C5RA 1S6FA 4Y8YA 4MG3A 2Y7ZA 1EJAA 2FI5E 2KAIB 4KTUA 5ESBA 1K0HA 4UFEH 3LGUA 1U6QA 2BDHA 2G55A 1EPTB 1O2UA 2AFQB 4A92A 1WUNH 3P70B 3RXUA 2ZDKA 1ZSJA 2JETC 3A7XA 2B0FA 1TE0A 1MQ6A 1SG8B 5C0TA 4ZXYH 4X6NA 1VGCB 4U01A 2YNBA 1LHDH 2DUCA 1OX1A 7GCHG 7ESTE 8GCHF 4YT6H 5C67A 1O3IA 2Q1JA 2A5AA 4P00A 1YY3A 4WF8A 1A0JA 2HNTC 2P3TB 3EA8A 5FCRA 2LNCA 1RIWB 3HGPA 4X8SH 5HMAA 2Y6TA 4JZDH 3UWJH 3RLWH 3F9GA 5TJXA 2FOFA 1H9HE 2ZTYA 1V2OT 4CRBA 1C5PA 1SGEE 5HKKD 1GJ5H 5FCKA 1ZSLA 3O8BA 4Y7BA 3TGJE 2EA3A 2OXSA 4X8UH 1MAXA 1O5BB 2JIZD 2XBVA 1RIWC 4Y76A 1WQVH 2XC5A 1L1JA 1G9IE 2JETB 1TA2A 3BTQE 2ZTZA 1GBFA 1C4Y2 1ELFA 2XW9A 3FVFB 1THRH 1H9IE 2RDLA 3E0NB 3Q00A 3UNQA 1Y3XA 2J4IA 3BTEE 2A4QA 5LPRA 1TPAE 1MAYA 1ELTA 1SGNE 1AFEH 3UOUA 1OP2A 1V6DA 1SGQE 4RSPA 4AFZA 1PYTD 2BX4A 3A7VA 1GVZA 3A7TA 5E2PA 3M5LA 4CHAB 1TRMA 5A8XA 4NWKA 4WH8A 1GCTC 1TOCB 1SBWA 2AHME 2Q6FA 4NA9H 5DP9A 4FUGA 1BRBE 2LELA 1XM1A 3OU0A 2XBWA 2IPHA 5H4IB 2K1QA 1GMDF 5EW2H 2BY6X 1Y5UT 4ABGA 1KDQB 2SGEE 1DITH 4ZCNA 1N8OC 4UE7H 5ABWA 2BLQA 4ISHH 2HPPH 1O30A 3OFND 3UIRA 4ACBA 4BAQB 2J94A 1QBNA 2QAAA 4Y7AA 1FN6A 2O8LA 2JJ1D 1Z71A 5A8ZA 3UNRA 1GDNA 2XBYA 1WDIA 1KXCA 1SGCA 3LGTA 3RU4T 2XC0A 2GMTC 3F9HA 3FFGA 1FJSA 2PLXA 1BMNH 1FPHH 2KX4A 1YPEH 2CN0H 1C2EA 1CT2E 2BX3A 4XE4A 4CRGA 4FETA 4SGAE 3P8OA 1JOUB
chains in the Genus database with same CATH topology
3TLOA 4NA8A 4D7FA 1A3EH 5HXFA 1TNKA 3PM3A 1O0DH 2XWAA 1EZQA 3V12A 2BXUH 3GY5A 1BUIA 4X1NU 1DSUA 3K65B 3P92A 2BOKA 3U1IB 1CGHA 1ZJKA 4AGKA 2BMGB 1NESE 1CHOF 3VXEH 1EP6A 1CU1A 4F49A 1V2RT 1TYNA 1V2VT 2SGQE 5DGJA 1UTKA 2ZHQH 3EDXB 2A45B 2QIQA 1VR1H 5AFYH 2BD9A 1AUTC 4X6PA 1ARCA 1LDTT 2FXRA 3SV2H 1O3MA 2J38A 4GPGA 1P2NA 4X6OA 3ZZ4A 1BTPA 1D9IA 2GGVB 1IQFA 2R3UA 1GI5A 2PV9B 1V2KT 3C27B 1GJBB 1ELCA 4RKOB 5IYTA 1PJPA 1LKBA 1ETRH 3RXSA 2SNWA 1EB1H 5LGOA 1ZMNA 2UUKB 4BTIB 1KXBA 1DWEH 1TNHA 1CA0B 2BY5X 1E37B 5I25A 1SGYE 1Z7KA 1GI7B 3F6UH 3UUZA 1Y5BT 5JBBS 4A7IB 1O3GA 3ZYEA 5JYIA 1QB9A 3LGIA 2Z9JA 2PTCE 3QN7A 1NFWA 2PKAB 3E8LA 2ZNKH 4FU9A 1VZQH 2FYQA 1S84A 1TRNA 2EI6A 3A7WA 4JZEH 2GT8A 2W3KA 5GXPA 1DM4B 1BCUH 1JBUH 4MTBA 2OLGA 1NPMA 2F9VA 1GJDB 5GDSH 1T8OA 1TX6A 1YGCH 4GSOA 4IC5A 1AD8H 1MKXK 1X7AC 1B0EA 1ZZZA 1IQEA 2F9BH 4ABAA 1LPZB 2GX4A 1NU7B 5JPMH 5EPNA 2GKVE 2Z94A 1TMBH 2F9UA 2FTMA 1ACBE 4E05H 1GJ6A 2ZHDA 4GHQA 1KXFA 1Z1IA 1ELDE 3BTFE 3UREA 2B9LA 2CGAA 5T6DA 1OWDA 1J16A 1G3DA 1TQ0B 3UR6A 1MKXH 1JWTA 1ELVA 1EXFA 3DA9B 1C2FA 1RJXB 3SJKA 3QO6A 1W12U 5F8XA 3S69A 3T62A 1QL9A 2VU8E 3UFAA 1E0FD 2ULLA 1GDQA 1W7GH 2CMYA 2BXTH 1AFQB 2Y82A 4NFFA 3BTDE 3BEUA 1AMHA 1CE5A 1GHAG 1UTLM 4H6SB 3ELAH 4FUJA 2QXJA 5DP7A 1YKTA 1PPHE 1PPZA 2ZDVH 1ELGA 1MD7A 1O3KA 3DD2H 1T32A 3A81A 3M7TA 1OSSA 2A7JA 2AS9A 2Y5HA 2Q6GA 4PROA 2GDDA 4WVPE 3NK8A 4IC6A 2XXLA 5FBEA 1FV9A 3SQHE 4Y10E 2ZI2H 5G4BA 1EAUA 3MH4A 3BN9A 2VWMA 5ESTE 3TJOA 1MU6B 1Y5AT 1YCPH 2ZDNA 3QZQA 1TMTH 4I33A 3LH1A 1XXDA 2ZGXH 3E0PB 4ZHAA 3RXPA 3WY8A 2WPJS 5E8EH 1BJVA 1DLKB 1UCYH 2BLVA 3SU2A 2VJ1A 5T3HA 3RXCA 1QQUA 3M5OA 1HYLA 2BDBA 1GL0E 1NFXA 2EI8A 3RMNH 2H9HA 2QF0A 4MPXA 4O3UA 3SU1A 1SGTA 3MI4A 1VCWA 2OBOA 1PQAA 1FY5A 2A7CA 1PPCE 1EB2A 4O9VA 5FPTA 2PGBB 1ZHMA 1G32B 1T8NA 2AMQA 2LPRA 2WPMS 1AO5A 1O3CA 3E91A 4LOYH 1P9UA 2PTNA 4U30A 2OCVB 1L2EA 2WYJA 1IQNA 1FN8A 2AMPA 1GHAF 1GJAB 1KIGH 1T8LA 2AYWA 4H42U 3GCTF 2Y5FA 1G2LA 1GMHF 2ZKSA 3MNCA 1NRSH 4MDSA 3RU4E 2H9TH 5DG6A 1XUFA 1BIOA 1AVGH 1XUHA 3SJIA 4RKJB 2C8ZB 2PSXA 1QRXA 8ESTE 5I46H 4K5ZA 1RTLA 2Y81A 4QT8C 3ZVBA 3MNXA 3BTTE 2G51A 4AB8A 1HAVA 1GVKB 1HJAB 1S6HA 4AG1A 1OWIA 2F91A 2WPLS 3ZVFA 3SNAA 2J9NA 1C1UH 2TPIZ 2OBQA 6GCHG 1NZQH 1GCTB 4IBLH 4MPWA 2B7DH 3T28A 1MCVA 3SV6A 1UJ1A 5CHAB 1WAYB 4AFUA 5AF9H 1GBLA 1BA8B 1WYKA 1BMAA 1HAPH 1TRYA 3BG4B 1KXEA 4NZLA 1O33A 4FUIA 1Z8RA 3A89A 4FXGH 1SLXB 1HGTH 1NN6A 2F9NA 1ANEA 3A8DA 1A46H 3TNTA 4CBNA 1FONA 1THPB 1LMWB 2HGTH 2R0LA 3PLBA 1O3AA 1WOFA 1NRQH 2O8MA 4AYYB 1MBQA 2BD8A 3VB5A 5GJ4B 3KQBA 1H8IH 1ZTLA 1P06A 1O31A 2ZQ1A 2ZDLA 2ALPA 1EZSC 1QR3E 1DXWA 1J17T 2VWOA 3ZVEA 1QA0A 1SGPE 2TIOA 3EA9A 4F4OC 4J2YB 1IQKA 3G01A 1W11U 4UDWH 3A7YA 3E1XB 1GJCB 1S0QA 4ISNA 1Z6JH 1P10A 2OTVA 2PGQB 2W5EA 2ZDAH 3PO1B 4MLFB 1P2MA 3MNSA 9ESTA 1LVMA 3FP6E 3BF6H 6CHAB 2F83A 3ZVCA 3LIWA 3H5CB 1BITA 1XUKA 1O34A 4JYUH 1ZRBA 1YYY1 1K1PA 2P59A 1HAYB 1GHZA 1IHTH 2ZG0H 1C1MA 2ZIQH 3A88A 3AVZA 1HLTH 1ANDA 1EAWA 5EXLA 1C2IA 1C5VA 4Y6DA 3SGAE 1O35A 4BNRA 3RXJA 2ZQ2A 1AKSA 2ILNA 1CHGA 2XCFA 3ZZ3A 4WWYA 1WSSH 3KQEA 5C2ZA 3VGCB 1EP5A 3SQEE 4XOJA 3SU6A 1BMMH 3ATMA 1A0HB 2W3IA 2O8TA 2BZ6H 1P09A 3M36A 3ODFA 5CMXH 1DPOA 1O5EH 4OS7A 4CRAA 1CT0E 2ANYA 2SNVA 1GHBG 3LONA 5E0JA 2G52A 3VB3A 1QA7A 4JZ1A 4I8JA 4B75A 2WYGA 2JH0D 3KNXA 1HXEH 1V2TT 1GMCG 4D8NA 5GPIB 4TY6A 2ODPA 1JRTA 2FI3E 3N7OA 3P8GA 1GBIA 3MH5A 5E0HA 2H9EH 4X2XA 5HGGA 3A8BA 1O2YA 3RC6A 1TPOA 3BEFB 4E7RG 3IG6B 3STIA 5A0AE 1EZXC 2FP7B 3RMLH 4OGYA 3UPEA 1HDTH 4DGJA 5EQSA 3S7KB 1GBEA 4Z0KA 2FM2A 1TBQH 4B2AA 3GY3A 1BBRH 4ZKSU 1SLWB 1LCYA 4X2YA 2ESTE 3FANA 1TONA 1O2HA 2J92A 4B1TA 4B2BA 4CRDA 1AQ7A 2OP9A 1PPEE 2FYRA 2CHAC 2R0KA 2ZPQA 1JIRA 3H7OA 1DWBH 5FXLA 1TNGA 1BB0B 2A0QB 3RXFA 2QA9E 3I78A 3RXDA 5C5OA 3R0FA 4LXBH 2XYAA 3U98H 4FVBA 2G5VA 1W8BH 1DVAH 3SUGA 1UCYK 1GHVH 5FAHA 2BQ7B 2ZCHP 2FX6A 5EODA 1PPFE 4AZ2B 1O2QA 1KTTB 3RXIA 2A2XH 5GCHG 1AWHB 1ZYOA 2FOMB 1TBRH 1DE7H 2D26C 1A2CH 2THFB 1ELEE 2J34A 1P2JA 4AGJA 3IITA 3UQVA 1GMCF 1GBJA 1NC6A 4FUDA 1C1WH 3GCNA 3UWIA 4A1XA 3M61U 1QJ6B 5DKMA 2AGIX 1O3PB 2WPIS 2ZFTA 1TNJA 3NXPA 4WXVA 4JZIA 3LPRA 3W95A 2W7SA 2IN2A 2PWXA 3LC5A 1MUEB 2BY7X 2D8WA 3B23B 3HK3B 2ZU4A 3FZZA 2VIOA 1P2OA 4MNXA 2NU1E 1O3HA 1QFKH 3ENSB 4OS5A 5DPAA 1DS2E 5J4SA 2A7HA 1NRNH 3TK9A 1GWAA 1K1OA 1UO6A 2STBE 3MO9A 2Z3CA 1O2WA 4FUCA 1GDUA 2AEIH 5A09A 2PW8H 2EEKA 2SGFE 2TGDA 1C5WB 2XRCA 3EAJA 4CREA 1O38A 3TGIE 1RGQA 3JZ2B 1Y3VA 2BDCA 2AMDA 1TGTA 2ZECA 5L30H 1MU8B 3FZDA 4X1SU 3U8TH 2BD5A 1ETSH 1O2OA 1D6RA 4A1TA 4WJG2 1K2I1 1K1MA 1SMFE 1N8OB 1L4DA 3E6PH 2XCNA 2BD3A 3ESTA 1QHRB 2XBXA 1QL8A 1TAWA 3TH4H 4TWYA 3SNEA 1N6YA 1T4UH 3VXFH 3FP8E 3OY5U 3LC3A 1Z8IB 4I31A 2P16A 4ESTE 1CSOE 4MNVA 2HPQH 1DWDH 3B8JA 1E36B 5EXNA 4YLUA 1ZJDA 3BTGE 4KTCA 4M7GA 2CF8H 1T8MA 1A61H 4IN1A 2TGAA 1A5GH 2PKSB 1QGFA 1ELAA 3GICB 3RLYH 1UCYE 2TBSA 2AERH 3ZZ6A 3RMMH 3ZVGA 3A85A 2ZZUH 1GBDA 4AYVB 4ZAEA 1Y3WA 1FIZA 4MNYA 4U2WA 4B74A 1MKWK 1QY6A 4CBOA 2C4FH 2GVFA 3NZIA 4K1TA 1BJUA 4J1YA 1NRRH 1YP9A 1LHGH 2A4OA 5FPYA 2BYAX 3TITA 4ASHA 3M3TA 4BANB 2BLWA 1BMLA 1NU9A 2G00A 4LZ1H 2PUXB 3TPIZ 1TGSZ 5EPYA 1N1LA 1EZUC 1GG6C 2BB4A 5A0BA 2XNIA 1C2JA 2D1JA 1LVOA 4LK4A 2RG3A 1T7CA 1QURH 4AORA 4Y71A 2BZAA 3KCGH 1O2RA 3HPTB 3OSYA 1GI8B 1Z1JA 3MYWA 3QZRA 3DFLA 1IQMA 3RU4D 2QGRA 4NG9H 1WU1A 1XVOA 1O5GH 4OS2A 1QRZA 2ZU1A 3SJ9A 4D9RA 4AX9H 1A3BH 1G3EA 2GP9B 1C5LH 1DOJA 4X0WU 3RXEA 1IQLA 1WQSA 1O2GH 3QGNB 4DCDA 1O3FA 3MU5A 3M37A 1A0LA 1EOJA 2F3CE 3RXOA 2ZGCA 1TABE 1T31A 2BDGA 3H7TA 2OC7A 4K3JA 5AVDA 4DIIH 4WMFA 1O36A 2BVSH 2ALVA 1MTWA 1O5AB 3ODDA 3TU7H 3TNSA 1ARBA 5T6GA 5C3NA 5LH8A 3F9EA 3QUMP 1HPGA 3MNBA 3VPKA 4ABEA 1HJAC 1XKBC 4I8GA 5DP8A 5ETXA 1V2UT 2JH6D 1MTSA 1P02A 4FU8A 3A80A 1AGJA 1W3CA 4U32A 1GBTA 1KY9A 2BTCE 3PWCA 3VGCC 5C20A 1UVTH 3ZVAA 3LJJA 3ZZBA 3OYPA 2BY8X 5DP5A 3S0NA 2DE8A 3URCA 2HNTE 4YZUA 4ZHMU 1RFNA 3ZYDA 4B76A 1BRCE 1C5UA 3HKIB 1K9OE 3TK5A 3M35A 4H6TA 4FUFA 1P3EA 4CR9A 4XFQA 3PTBA 1TNIA 4YLQH 5C5NA 1Z6EA 2EC9H 2PUQH 5JB8S 2HWLB 1HAGE 2Z7FE 1YPKH 2QV1A 5L2ZH 1FZZA 1SC8U 1UVUH 2NWNA 1D3TB 1P05A 2VINA 1Z8GA 2EI7A 1AIXH 2R2WU 4KTSA 3SV8A 3TK6A 1YPLH 1LQDB 3HK6B 1TWXB 3KQDA 2ZU2A 2FIRH 1V2WT 4ZHLU 4WXIA 2H6MA 3PO1C 1OOKB 6LPRA 1UTQA 5JBTA 4XBBA 3GISB 5E0GA 1W14U 1UTJA 1GJ4H 1HV7A 1W0YH 1MZAA 2HRVA 8GCHG 4GHTA 2VH6A 3K6YA 1GJ8B 4NFEA 5HYOA 1KLIH 1RTKA 3LU9B 1F5RA 2G4TA 3T26A 3S9CA 1BT7A 5JDUB 5DP3A 1ZGIA 4AFQA 3P8FA 4R0IA 1O2JA 1F5LA 3SUDA 1WCZA 2ZGHA 3OX7U 2PKSC 1DY8A 2BM2A 1IOEA 4NSVA 1YC0A 2GZ8A 2AH4X 1L1NA 1TX8A 3CS0A 3MH6A 1TGBA 4ZUHA 3U8RH 4B73A 1VITF 1TGCA 1OWHA 1VITG 2B8OH 5LPFA 1FQ3A 1BTUA 2V6NA 4BAOB 1H1BA 4D9QA 3T2NA 1DUAA 1OWJA 1AFQC 2FMJA 2ANMH 2FWWA 1C2MA 1O2MA 5CHAC 1QBOA 3P95A 4XBDA 5F03A 1T4VH 3QTVH 1C1PA 1VJAU 3E3TA 1O2XA 2VWLA 1RD3B 2H5CA 3B9FH 3E16B 4MPUA 1DXPA 2J95A 2GMTB 3SNCA 1K28D 4WY3A 1TIOA 3U1JB 1H8DH 1SOZA 2QXGA 1F92A 2HALA 5GCHF 2O8WA 1KYNA 3GCTG 3TIUA 2IOTA 3LGVA 4TY7A 1O3EA 2FOBA 1BBRE 1QJ1B 2VIPA 1P2IA 2ANWA 1CT4E 1BRAA 1CBWB 4I8KA 3MO6A 3KN2A 1OS8A 4OS4A 1FMGA 1C1RA 4CR5A 2A5KA 2IJOB 1ZMJA 4ZKNU 2QCYA 1CVWH 2V35A 3QDZB 4DY7B 1IQIA 1ABJH 4GCHF 4NWLA 3D49H 2AIQA 1O3DA 3GY7A 5E2OA 1S83A 1QB6A 5L6NH 4FUEA 2F9PA 1V2QT 3Q3YA 4ABHA 2ANKH 1BZXE 1O3OA 1HCGA 3F68H 4FU7A 3SHCH 2I6QA 2QF3A 5CE1A 1GI3A 2Z9GA 1P11E 1BOQA 3PTNA 3Q77A 3RP2A 3SZNA 2NU4E 2Q6DA 1BDAA 1DT2A 1HAZB 1RS0A 4HZHA 4YO9A 1OKXA 1OYQA 1YPJH 1CA0C 1ZPBA 1QQ4A 1WBGB 2A4RA 2TGTA 1EOLA 5EQRA 1A4WH 3RXQA 4DG4A 4ABJA 3ZZ7A 1J9CH 1MBMA 3A7ZA 3S9AA 1OP0A 3W94A 1GBKA 1J8AA 1PQ5A 4DOQA 1P01A 1UVOA 3T5FH 1BQYA 1G3BA 5AFZH 3U69H 2AIPA 4ZMAH 3STJA 1TPSA 4Q7YA 4I8LA 3SGBE 1MH0A 4Y8XA 3LKWA 1GBMA 4DIHH 1V2PT 1GBHA 2RA3A 3RXAA 2V3HH 2P93A 3LGWA 3MU1A 1BTZA 1GGDB 3EE0B 2ODQA 1TX7A 2F9OA 5DK1A 2QY0B 3RC5A 1AHTH 1HXFH 1C1OA 2VGCC 3SGQE 1UTNA 2CJIA 1DY9A 1KXAA 4THNH 4X1QU 1AU8A