2QF0A

Structure of the delta pdz truncation of the degs protease
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
202
Chain Sequence
b'QFDSTDETPASYNLAVRRAAPAVVNVYNRGLNTEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 44
structure length 202
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf0A02
3A82A 1LVOA 1HAOH 2PKSB 1Z1IA 2FYRA 2OXSA 1K1NA 1YF4A 6CHAB 3VB7A 3QTVH 2A7HA 2VH6A 3BG4C 1H9LB 4OS7A 1YLCA 1J14A 1GG6C 3ZZ4A 4NWLA 5K0HA 1BTWA 5DP5A 4BAOB 1C1PA 3B8JA 1GJ6A 3KL6A 5HXFA 1HAIH 2FEQH 4K60A 3OYPA 1XKBC 1B5GH 1C5ZB 3URDA 1O3NA 1OWKA 1GHWH 3MU1A 2XW9A 1FDPA 1C5WB 5DP4A 3V12A 4XSKU 1Z1JA 4BNRA 1O2OA 3OY5U 2B0FA 2YNAA 4B76A 1ZRBA 3A81A 1O3KA 4CHAB 1SGQE 1GBTA 3CS7A 5F8TA 2OINA 4Z0KA 1AB9B 3LC5A 5GDSH 1BT7A 1AE8H 1C2HA 1O36A 1XVMA 3B23B 4Y8ZA 1CT0E 3ATLA 3NKKA 1H8DH 3RM0H 4X2WA 1MD7A 1D6WA 1OWDA 1SGNE 1V2KT 1ZGIA 2VWOA 3RM2H 1TGSZ 2C4FH 2CN0H 3GOVB 5DP7A 5HM2A 4XBBA 1QL7A 4UFGH 1LHFH 2BVRH 1FAKH 1J15A 1VCWA 1TYNA 3STIA 3K6YA 2H9TH 3VFEA 3T26A 2HPPH 4AB9A 1AE5A 3QGJA 4J2YB 1RGQA 5EG4A 3S7KB 5E0JA 1FAXA 3ELAH 1YPEH 3BEUA 1C5MD 1MZAA 1WCZA 5L2YH 3FP8E 3M61U 1BZXE 2ZHDA 4JZEH 2SGEE 1WOFA 1MH0A 5H4IB 2F9PA 4TPYA 1A61H 1ZMJA 1O2WA 5ESTE 5DGJA 3UREA 1WV7H 3S7HB 3PROA 3TJVA 1TQ7B 2ZHQH 4Y7AA 1SLUB 4GCHG 1Y5AT 1AZ8A 2KAIA 2VIVA 5LPEA 1O2LA 3U1JB 3P8GA 2ZCLP 4Y8XA 2ILNA 3SN8A 3GYLB 1C1RA 2FX4A 1GBFA 3SU1A 1HXEH 2W5EA 2A4QA 1E0FD 3T29A 4YOIA 1GBAA 1BCUH 3PV4A 5C67A 1GL0E 2H9EH 5C2ZA 2ASUB 2DE8A 1LPGB 2V3HH 1GHZA 3OTJE 1HPGA 1SMFE 4YOJA 4JYVH 1O5AB 1FQ3A 1A4WH 5TCAA 3SJKA 3H7OA 1TPSA 4ABDA 3KQBA 3RXBA 2PGBB 1QB6A 1QB9A 4YESB 4ZUHA 4AGKA 1W7GH 2BY9X 2EI6A 2TIOA 1HV7A 1VGCB 2ALVA 3SV6A 1KXCA 2G8TA 4E7RG 4UD9H 4ZKOU 2Y7XA 1Y59T 4IC6A 1YPLH 2A45B 2Z9KA 1TGNA 3LGVA 1UK3A 1PYTD 4VGCB 2PKSC 2OQ5A 4X0WU 2XNIA 1AHTH 4LK4A 4ISOA 3Q3YA 5F03A 1XVOA 1SGIB 4DJZB 3RU4T 3GDUA 4CH8B 2W26A 4BAMB 2SNVA 2B5TB 1QY6A 1GMHF 3A85A 3A87A 2BDHA 4FUJA 1EJAA 3M35A 1E34B 2BD4A 1NS3A 1O2GH 2FI3E 1P2MA 5A8ZA 4ABHA 5A0CA 1QL8A 1VCPA 9ESTA 3Q3XA 1OWHA 1EZUC 3K65B 1ELBA 2ZWLH 4E7NA 1PPBH 4YZUA 3RP2A 1IQEA 2BD9A 2ZA5A 1ACBE 1DOJA 4MG3A 4NA7A 4CHAC 1TBZH 2IJOB 3SV9A 1AB9C 1VJ9U 3R3GB 2B9LA 4IC5A 1BTYA 1S83A 2J92A 1W3CA 2ZCHP 1QBOA 4NIYA 8GCHF 4X6PA 1TLDA 1DX5M 4AB8A 4Y10E 2KAIB 3IG6B 5ETXA 1Z6JH 2ZG0H 5EQQA 3GCOA 2ZHFH 1E35B 1NFUA 3UPEA 1YPJH 1IHTH 3IWMA 3LH1A 1UK2A 3F9EA 1C1NA 2QXGA 1AFQC 5ESBA 1TE0A 1BHXF 1EJNA 3LGIA 1CU1A 1IQKA 5C5NA 1P2JA 3G01A 2UWOA 2UWLA 1ANEA 1UCYK 2QC2A 3MMGA 1GDQA 3ZVAA 2XC0A 3VB3A 1P04A 2VIDA 1NC6A 2HPQH 1FIZA 2J4IA 4MPXA 1NU9A 3MYWA 1CE5A 1KLTA 2GZ7A 2FP7B 1QQUA 2GMTB 2Q6GA 3UFAA 3S9BA 1S82A 1FIWA 1DWDH 1UJ1A 3SQHE 3LOXA 2BZAA 3E0PB 1J16A 1TNJA 4UEHH 2FOMB 1KXAA 4K1EA 1FPHH 1EPTB 1NU7B 1SGCA 2JKHA 4FUGA 2FPZA 2BD2A 1P10A 5E0HA 1ARBA 1AKSB 2ZDNA 1MTUA 3LGUA 4BAQB 5JPMH 3S0NA 1XUHA 3W94A 1XUIA 7ESTE 2W7UA 2WYGA 3NCLA 4F4OC 2A0QB 3SJIA 3EA7A 1OWJA 3E1XB 3NPSA 4CRDA 1LCYA 3QGNB 2HALA 1D3DB 2AMQA 2Z6BD 4XBDA 2EI7A 3M3VA 1T8LA 2Q6DA 1J9CH 1C5VA 1PQAA 2H9HA 2FS9A 2VJ1A 1O2PA 1T31A 1FI8A 1UHBB 1KTSB 4K5ZA 1P3EA 1BTHH 5K7RA 1LVYA 1O39A 1VCQA 1RS0A 1MUEB 1Z8GA 1K28D 3UUZA 1GBJA 2CMYA 4GPGA 2J2UA 1SVPA 2CHAB 1OS8A 3BTME 1VZQH 1T7CA 1MKXK 1C5PA 3QX5H 1V2WT 2ZGJA 1VGCC 2H5CA 4WMDA 1TFXA 4YLUA 1BRAA 3NWUA 5EODA 4B2AA 3O8RA 1JMOH 1O32A 3RMMH 3ZYEA 4A1TA 1EUFA 4VGCC 4Y0ZE 2HNTE 1LHCH 2Z94A 5C5OA 1Y5BT 3SU2A 4HGCA 3PTNA 4U32A 5FCRA 3UWIA 3HGPA 1EZSC 3RU4D 2BQ6B 1DVAH 1W0ZU 3RLWH 4CR9A 5EXNA 5GCHF 1K1JA 1O34A 1AUTC 3PLBA 4AFQA 1N6YA 5FX6A 4BANB 3PLPA 1AZZA 1O3AA 3MHWU 3SUFA 3U8RH 2BD5A 3GICB 1LVBA 1MKWK 4GHTA 1GJAB 1O3BA 3E90B 3BSQA 3HK6B 1ID5H 1EATA 5PTPA 2Z3CA 2R3UA 1A7SA 1Z7KA 3T5FH 2OLGA 3ESTA 4X2YA 1GMHG 2QXHA 2ODYB 2GV7A 3ENSB 2ZFRH 1PPFE 2VGCB 1C4Y2 1GJ5H 1BA8B 1F0SA 1W10U 4ISIH 1P05A 3TLOA 2FYQA 3UY9A 2FMJA 3R0FA 3UNQA 2FDAA 1G30B 2QAAA 1P09A 3LJOA 1PPZA 3MO6A 3SO3A 3IITA 1TRYA 2JH5D 3LONA 2Y7ZA 4AFUA 4AX9H 4MTBA 1IQHA 1GCDA 1OP8A 2TRMA 4AGJA 4BTUB 4LZ4B 1WTHD 1MAYA 1V3XA 1HAVA 1SHHB 1ETSH 5F8XA 2W3KA 1K1LA 4YLQH 1HBTH 1DXPA 3VEQB 1G3BA 2K1QA 1V2NT 1WBGB 1NFWA 2V3OH 1CSOE 1EZXC 1Z71A 1M9UA 4DT7B 1C5OH 1E36B 1TPOA 1QQ4A 4ABBA 3SUDA 1AVWA 3SNEA 3DUXH 3MU4A 1GWAA 3M37A 3SJ8A 1LPZB 4ZXXH 1C4U2 1KYNA 2P3UB 2QXIA 4H42U 1GHBF 3MH4A 2WUBA 1ANCA 1CGHA 4INHA 1KDQA 2BY6X 2VIPA 4UFDH 1Y3UA 4DY7B 2ZU4A 3HPTB 5J4QA 1VR1H 4ZMAH 1T4VH 2WPKS 4MNYA 3M3SA 1SGFA 2STAE 1IQJA 4DW2U 1V2MT 1C1TA 2WPHS 3T62A 8KME2 1EPTC 1GBHA 1S0RA 3TGIE 3A7XA 3SQEE 2SFAA 4NSVA 3RXGA 3TH4H 3QLPH 1QRWA 1BB0B 1QRZA 1FN8A 1YM0A 4KTSA 5IYTA 4OGYA 2AGGX 3RXKA 4AFZA 1VITF 1FONA 1UCYE 1C1OA 4DOQA 3VXEH 1ZZZA 3AAVA 2H5DA 3EA9A 3PO1B 3SU4A 3URCA 5JB9S 2Y5GA 2R3YA 3ZZ9A 1IQGA 2AIPA 1KIGH 2C8WB 1C1QA 1TBQH 2VU8E 3ATWA 3E16B 3RXHA 1NROH 1HAPH 4I8KA 3ATIA 4MNWA 3ZV9A 4ABJA 4K8BA 3SU5A 1C2IA 1HNEE 1EZQA 1TX8A 3S69A 2CHAC 2PSYA 1PPGE 3ZYDA 1V2PT 3AVZA 2FI4E 2Z9LA 2ZDKA 3VPKA 3Q00A 4CR5A 4D9RA 1P2KA 4D76A 4A92A 1F0TA 2GT7A 3E8LA 1Y5UT 4X6MA 2PKAA 3UOUA 1C2DA 2TBSA 4F49A 1A0LA 4DG4A 7GCHG 2M5TA 4CREA 2TGTA 1ESBA 1PPEE 1Y3WA 1MTVA 3SI3H 1IQIA 1GMDF 1MMJN 1GI3A 3PMBB 5EGMA 2GGVB 3BF6H 2FOCA 1V2QT 2IPHA 2VVVA 1DUEA 4CRGA 5T6FA 1DANH 6ESTA 3F9GA 4TWWA 1C1VH 1YLDA 1AU8A 1HDTH 1T8MA 2QV1A 3GYMA 1O2JA 1FLEE 3BIVH 1TBRH 1CQQA 1UTPA 4X2XA 5EPYA 2SNWA 2F9BH 1FNIA 5GCHG 4B73A 2PSXA 1C5RA 1RJXB 3MTYA 2XCNA 2BDCA 2XBYA 4H6TA 1O37A 2AIQA 4KTCA 4ZH8A 3BG8A 1KDQB 5FHTA 1AI8H 2J38A 1C1SA 1GI8B 3MH7A 1DSUA 3NUMA 1DSTA 4Y71A 4U2WA 2XBXA 2OQUA 4OS1A 1ZMNA 2C3SA 1SBWA 3A84A 2ZTZA 4JZ1A 3OU0A 1P2NA 1T8NA 3D62A 1O30A 2CF8H 2ZC9H 4RSPA 3SJ9A 3EGKH 4D7GA 3O8CA 1QA7A 1O2YA 1ZPZA 1MZDA 4Y0YE 1P11E 8LPRA 2G5NA 1A3BH 1BBRK 2AERH 2ZGHA 3UR6A 1SQTA 1TA6A 1O38A 1ZSJA 4MNVA 1OP2A 1HAHH 1C2MA 2A4RA 1Q2WA 4ZHMU 1G32B 5AFZH 1BTZA 1S5SA 2JH6D 1TGCA 1S84A 3GDVA 1RIWB 1TMTH 1O3FA 3SV2H 2PLXA 2ZU3A 1J17T 1FUJA 2FESH 4JZIA 2XBWA 5A09A 3RXOA 1L1JA 3MOCA 3LGTA 1BMMH 2RG3A 2VINA 1GBMA 1NPMA 3BN9A 3FFGA 1P2IA 1SI5H 2AYWA 1ESAA 2GV6A 2LPRA 1P02A 4OS6A 1GBBA 1F5KU 1C5SA 3GCHC 2FX6A 1RFNA 2Y5FA 3TJNA 2C90B 3RLYH 4I31A 1W14U 3U9AH 1GBEA 8ESTE 3BTGE 2UUKB 1ZTJA 1TMBH 1D6RA 1P2QA 3ZVDA 1PPCE 3T27A 1O2HA 5A8YA 1SFQB 3LIWA 3PO1C 1H1BA 3E0NB 1JOUB 3TIUA 3ITIA 7LPRA 4M7GA 1ARCA 4LOYH 2FLRH 2ZHWH 4A6LA 1SGPE 5F6MA 4WWYA 1UTLM 1Y8TA 4XOJA 3S9CA 3FP6E 1D3QB 1N6XA 1V6DA 1CA0B 4NIVA 5BPEA 3U8TH 1OYTH 2WUCA 4I7YH 2WV4A 1GMCG 1XX9A 5FBIA 1LQDB 4RKJB 1TABE 4I33A 2GKVE 4IMZA 1BTPA 2XCFA 1YCPH 2ZQ2A 1AO5A 1NY22 2BMGB 1GJ4H 1D3PB 4OS2A 4DGJA 1ELTA 1QJ6B 2BTCE 3QWCH 1AVXA 4IN1A 3SGBE 3SV8A 2VVUA 1YPMH 5JBBS 3CP7A 3EE0B 2P16A 3VB5A 2G5VA 3D49H 1KY9A 1P57B 3BTEE 3ZVEA 4FUBA 4WVPE 1AN1E 2FXRA 1O2QA 1HIAA 4IBLH 1GDNA 1GDUA 3M7TA 2FI5E 1UVPA 4NFEA 3RXMA 1LHGH 1NRPH 3LH3A 4DIIH 3BTKE 3F68H 4CRBA 3E3TA 1RRKA 3AW0A 1C2GA 2G55A 4A7IB 5CE1A 4Q2KA 1OYQA 1WSSH 2ZDAH 2AMPA 1K21H 1EOJA 3M5NA 3RXFA 2YOLA 1XUKA 4MNXA 2VB0A 2BM2A 1GGDB 1IAUA 2Z3EA 6CHAC 4I8GA 1THPB 2OD3B 2J34A 3ATKA 4X6NA 1KXFA 4H6SB 2J94A 1O3GA 1QIXB 1XM1A 4OS4A 5DP6A 5DO4H 1G3CA 4DVAU 1O3OA 3KNXA 1O0DH 2BB4A 2D26C 1KXBA 1ELDE 5DP3A 1B0FA 4FUIA 5AHGH 2BZ6H 1OX1A 3STJA 2ALPA 2ZECA 2XC5A 2Q6FA 1S6FA 2SGFE 1MTNB 1NM6A 3GCTF 3M5OA 4GVUA 2QA9E 3RXJA 1V2UT 1DUAA 1N8OB 5C20A 1HCGA 1MU6B 3RXVA 1A3EH 3F9HA 1ZTKA 1ETRH 4OS5A 2BXTH 4NG9H 4Y76A 4BAKB 2XRCA 4Q7XA 3Q77A 2OC1A 4WH6A 1IQLA 1CT4E 2BLQA 2JH0D 1XXFA 5C1YA 4B71A 2ZQ1A 1SLWB 1FY5A 1P9UA 2NU2E 1DXWA 1GVLA 1Z8RA 1C2KA 2BD8A 2PFEA 2AMDA 2ESTE 3BTQE 2F9NA 4HZHA 4Y79A 4IN2A 2P8OB 1GI9B 1H8IH 1HFDA 1TNGA 3TVJB 1E38B 4YOGA 4LZ1H 2A31A 1C5YB 1H9IE 4AG2A 2C8ZB 1AFEH 2ZKSA 1AVGH 3HKJB 1GJCB 1DLKB 2RA3A 3UQVA 4Y6DA 4BAHB 3H7TA 3V7TA 1OWEA 3M3TA 4ABIA 4B74A 1AUJA 1EJMA 3ODFA 3L3TA 4WXIA 1BBRE 2GVFA 4D8NA 2BDAA 2QCYA 1MTWA 4Z6AH 4WMFA 4NGAH 1Y3VA 2BHGA 4TWYA 1TX6A 1T4UH 1BDAA 2ODPA 3BTFE 3LDXH 1C1WH 1F0UA 1CBWB 2BD3A 1G2LA 3VB6A 1DM4B 3HKIB 2HNTF 3RXSA 1CA0C 2VWMA 3D23A 2WYJA 1GI1A 1EAIA 4X8SH 2VVCA 3B9FH 3BEFB 3A7ZA 1P01A 1V2ST 1O3CA 2J95A 1XXDA 2OTVA 1CHOF 2A4OA 1TGTA 2ZIQH 1BOQA 4ISLA 1EX3A 1IOEA 1K1OA 2G4UA 1NZQH 4JZDH 4ASHA 5A0BA 1A5GH 2NU3E 1JIRA 1FMGA 3M7UA 3FVFB 5C1XA 4Q80A 3SZNA 1F2SE 2HLCA 3PB1E 5GJ4B 4X8TH 2R0LA 1ZTLA 3QK1A 2IN2A 4CBOA 1DFPA 4J1YA 1O31A 3U8OH 3ZVGA 1UTKA 1UVUH 2WINI 1EKBB 1TNHA 4E05H 3GDSA 1UTOA 4ISNA 3TK6A 1AGJA 1GHAF 1YPHC 1Z8IB 5C3NA 1GJ9B 2Y5HA 3RC6A 3RXIA 4FUCA 3UWJH 2A5KA 3NK8A 3SBKA 1YPKH 1QGFA 1XUGA 4I8HA 1K9OE 3SNCA 1VITH 3L6PA 2Z7FE 1BHXB 4B1TA 3TPIZ 4FU8A 2XTTB 2ZP0H 1PQ7A 1W2KH 4JCNA 2FWWA 4SGAE 2HWLB 2SGPE 1GBKA 1SC8U 4UDWH 4KKDA 1O2NA 2DUCA 1A46H 1DPOA 1QJ1B 1P03A 4RKOB 2P93A 4XFQA 2GCHF 3O8BA 2Y6TA 3K9XB 1O3PB 1GVKB 3BTWE 1HB0B 3RXLA 1ELAA 3M36A 2FM2A 3QO6A 4H4FA 4AN7A 2ZFSA 1G2MA 5BRRE 1ANDA 1C9PA 3A8BA 2EA3A 1P9SA 5FX5A 5EOKA 1NO9H 1N8OC 2XC4A 5IDKA 1SOZA 5EPNA 2TGDA 3OX7U 5AVDA 1HLTH 2C93B 1CA8B 4A1VA 4KELA 1BMNH 6LPRA 3LGWA 2ANWA 1A5IA 1DS2E 2C8YB 2HRVA 4X1PU 3PLKA 2FS8A 1DY9A 3GCTG 1SGEE 3PMHB 2V35A 5C1UA 1TNLA 2D1JA 2FOGA 4K1TA 1DICA 3P92A 1O5DH 1EB2A 3M7QA 1BRCE 2EC9H 3V3MA 1C5NH 4K8YA 4R8TB 4YO9A 1XMNB 2PWXA 4YM9A 1DY8A 2BY7X 2CF9H 2OC7A 4XBCA 2ZHEH 2PUXB 1GG6B 4I8JA 3SV7A 3A7TA 3KQDA 2Z9GA 1TRMA 8GCHG 3MU5A 4WMEA 2SGAA 3P17H 1CGJE 1F7ZA 2ZDVH 1FY4A 1MCTA 4I32A 1C1UH 1PYTC 4O97A 2BOHB 2ZFPH 2A1DB 1SPJA 3F9FA 2HVXA 3LC3A 1DWCH 1P0SH 5DP9A 1YPGH 3RC4A 3RXRA 1P3CA 2W7SA 2GMTC 1YC0A 1K1PA 1ZGVA 3VXFH 1FY1A 4B75A 2FODA 2TPIZ 1S85A 2H6MA 1DT2A 4Q7YA 1O2TA 1EQ9A 3RXDA 4FUHA 3CENA 2CJIA 4ABAA 1TMUH 1OWIA 4ABEA 3KIDU 1SLVB 1G36A 3DA9B 2F9OA 1INCA 2VIQA 1AIXH 1ELEE 1WYKA 2ZGXH 3DD2H 4YT6H 5LH8A 1NRRH 1O3EA 4JMYA 4AYYB 1FV9A 4FU7A 3UTUH 3GY7A 2Y80A 5EW1H 1MBQA 2CGAA 1MCVA 2WPIS 1MQ5A 3MWIU 1UTQA 5JDUB 5DJ7A 3SJOA 2XWBI 2HOBA 4WJG2 3T28A 1HJAB 1LHDH 1NRSH 4O3TA 1EAUA 4ZAEA 4GCHF 1N1LA 1TAWA 1FZZA 5HMAA 2G4TA 3A80A 3FAOA 1UO6A 1BUIA 4BOHA 3GY5A 1J8AA 1O3JA 1GJBB 3MU8A 2ANMH 4K3JA 2UUJB 4NA8A 4NIWA 1GVZA 2ZDMA 2O8UA 1O5EH 4TY7A 1L4DA 1BTUA 3MNXA 1BITA 4NZQA 1O5BB 1NRNH 1O5CB 4RN6A 3PTBA 3KQEA 3LT3A 3MH6A 2UWPA 3V0XA 5T6GA 5DG6A 5E2OA 4O9VA 4CBNA 5A0AE 1T32A 2I6SA 4Y8YA 1BMAA 3BTDE 3SNAA 2ZGCA 1ELVA 2O8LA 1W11U 5ABWA 3DFLA 3A7YA 1TRNA 1A0HB 1G3DA 3FZDA 1HAVB 4XDEA 1QTFA 1ORFA 2ZI2H 4X6OA 5G4BA 4TPIZ 2D2DA 3SHAH 5FBEA 4ZXYH 1RTKA 1RD3B 3AASA 3RXQA 5E0GA 3JZ1B 2ZFQH 1GI4A 2Z9JA 1O33A 4U01A 5HM9A 2BLWA 1Q31A 3SHCH 1W13U 1ETTH 1GJ8B 4HI3A 2BDYA 2PR3A 3K2UA 5LPFA 1OSSA 2BX4A 2VGCC 2GT8A 2QF3A 4JYUH 2BD7A 3KN2A 5LPRA 2OCVB 1TQ0B 2GCHG 3RMLH 5T3HA 2GCTB 3NZIA 3K6ZA 3SNDA 1UVSH 2BDIA 5AFYH 2PHBA 5GWZA 1MQ6A 2FIRH 2OC8A 4K69A 1ZJKA 1WQSA 1XUFA 3TITA 3SGAE 2GZ8A 3TJUA 3SW2B 3P8FA 3BEIB 4INKA 1ZPCA 4AG1A 3RDZA 3JZ2B 3SU3A 2ULLA 1DDJA 9LPRA 3KF2A 1SFIA 1EAXA 5EXMA 4FUDA 1EXFA 3LPRA 2Z3DA 1SQAA 2QYIA 4TY6A 5A2MH 1AQ7A 1GCTB 1GHYH 2BX3A 4ESTE 1LHEH 1CGIE 1O2ZA 1SGDE 1V2LT 3A8CA 3L33A 3QUMP 4X1SU 4MDSA 1UVTH 1H9HE 4GHQA 1ZMLA 5JB8S 1V2OT 2PV9B 5FPSA 1KXEA 3M5LA 2QY0B 1P06A 1P2OA 5SGAE 3TNSA 2O8WA 1P8VC 2ZU5A 1G37A 5I25A 1VJAU 1SHYA 1GL1A 2PTCE 2OUAA 4GLYA 2QXJA 2ZF0H 4NIXA 1LO6A 1FY8E 1C5LH 3MNSA 3E6PH 1YKTA 1O2VA 3TGJE 4NZLA 2BY5X 2H2ZA 3OY6U 3BTHE 3ATMA 1BBRH 1GHBG 2EEKA 2UUFB 4WXVA 2BQWB 1LPKB 3PMAB 1A1RA 4X2VA 1DITH 3H5CB 5TJXA 1THRH 4ABGA 4BXSA 1MD8A 2PKAB 1HJ8A 3A83A 5DPAA 1S0QA 5EW2H 2A5IA 1XKAC 3HATH 2BLVA 1YYY1 2PW8H 2P59A 2BOKA 3A86A 5FXLA 2SGQE 1AFQB 4WH8A 1WQVH 1O5GH 3LJJA 2BVXH 1O2XA 4X8VH 1HJAC 3TU7H 4JZFH 1BIOA 4LXBH 2AH4X 2J9NA 3TH3H 1S81A 1V2TT 1O3MA 1G9IE 1B0EA 3D65E 1Y3XA 1IQFA 3C27B 1SQOA 2VIOA 1IQMA 1O2MA 1KLIH 1SGFG 4JK5A 2NWNA 2ODQA 1VITG 3WY8A 1ZR0A 3UIRA 4U30A 3P8OA 1T8OA 2B8OH 4TYDA 2P3FH 1YCPK 3QN7A 1MAXA 3QZRA 3KHVA 4IW4E 3SUGA 5A8XA 1D9IA 4ISHH 1SGRE 3MO3A 1Z8JB 1ZLRA 4ZHLU 2ZFFH 1GBDA 2YNBA 4FXGH 4ZHAA 4AORA 1XUJA 1QBVH 2XWAA 1A0JA 2ZNKH 5CHAB 4A5TS 2AGEX 1YPHE 1ZSKA 4HTCH 1FPCH 2BQ7B 1IQNA 4YTAA 2F9UA 3HK3B 1F0RA 3PMJA 1TB6H 2NU0E 3V13A 2GDEH 1BQYA 2NU1E 1WU1A 2GD4B 3LKWA 3QDZB 5I46H 5L2ZH 2ZTXA 4NWKA 3HGNA 2XBVA 3KGPA 3RXEA 1HXFH 1ZRKA 1EB1H 3GY8A 1P12E 4KP0A 1LKBA 1GMDG 1O2UA 1SL3A 2A5AA 2V0BA 1D3TB 1F5LA 2GDDA 1TGBA 3ZZAA 3TH2H 3PM3A 1KTTB 3UQOA 1ZHRA 2NU4E 1RXPA 4AYVB 1EPTA 2ZPSA 1HAZB 2GCTC 2R2MB 1AY6H 4ZKRU 1F5RA 1BTXA 3EA8A 1GHXH 1SOTA 1AKSA 2ZPQA 3ODDA 1NT1A 5AF9H 3EYDA 4THNH 1TPPA 1ABJH 3ZZBA 2ZU2A 2B7DH 1YCPM 3MNCA 1LKAA 2ZDLA 3F1SB 3MU0A 1UMAH 3PWBA 4A1XA 1W7XH 2R9PA 4YT7H 3T2NA 1GI5A 2BVSH 2Y82A 4UE7H 2A2QH 2ZPRA 1C5TA 2O9QA 5L6NH 1LMWB 1FY3A 4K1SA 1K2I1 4BXWA 4MPUA 1ABIH 1L0ZA 1BMLA 1EOLA 4FUFA 3A89A 2PTNA 1AMHA 1GCTC 1X7AC 1UHBA 2AS9A 5E8EH 2THFB 3Q3KA 4Q7ZA 2GZ9A 1S6HA 2A32A 1DWEH 2FOBA 3U1IB 4O03A 3KEEA 3RUOA 1ZOMA 1JRTA 3MNBA 2W3IA 4UONA 1BJUA 1EP5A 3C1KA 3RXCA 1HJ9A 1OP0A 3QZQA 5B6OA 1K22H 1RIWC 1OXGA 2XYAA 1C1MA 1PPHE 3SORA 2G52A 2GTBA 2FTLE 1TIOA 1QB1A 1C9TA 1MBMA 1O2IA 1C5XB 4ZKSU 1SGYE 5L30H 3Q76A 1TONA 5T6DA 1UK4A 3PWCA 3ZZDA 5EU8A 2P94A 5LGOA 1QRXA 1ELFA 4X1RU 1E37B 1GHVH 1EAWA 1C2LA 1HAXB 3RXTA 3A88A 4MPWA 2I6QA 3MI4A 3GY3A 1UTNA 1FJSA 6GCHF 1O3IA 4GAWA 4ZROA 1AWFH 1OKXA 1LTOA 3EAJA 2FOAA 3FP7E 2PGQB 1HGTH 4NSYA 1A2CH 1FN6A 1CVWH 2VH0A 4JK6A 1O2RA 4PROA 1HIAB 4ZKNU 2QGRA 1GBIA 2D8WA 5EQRA 1NRQH 1TOMH 3E91A 4X1NU 3VB4A 2P3TB 1C4V2 3ZZ3A 1AD8H 5EXLA 2PUQH 1O2SA 1LQEA 1UCYH 5EQSA 2ZEBA 5DK1A 2ZZUH 1SLXB 2Z9IA 1V2VT 3UOPA 4Y7BA 4GSOA 4DURA 5JBTA 2FO9A 2QIQA 1TA2A 2VWLA 2BDGA 3TNTA 4X1QU 1WTGH 3RXUA 1K1MA 2FLBH 1SR5C 4KTUA 3I78A 3SOSA 2UUYA 3P95A 4D9QA 1NFYA 3TJOA 1KLJH 1RTFB 2XXLA 4ABFA 3FANA 3ZVBA 1CHGA 5TCCA 5CHAC 3BTTE 2FOFA 1DWBH 2EI8A 2O8TA 2R0KA 4B2BA 1ELCA 1GI6A 1KXDA 1QBNA 1UTJA 3ZV8A 3I29A 3F6UH 3P70B 5JBCS 1V2RT 2TGPZ 4IGDA 2BXUH 4QT8C 4AFSA 1W12U 1JRSA 2F9VA 1QL9A 2OBQA 3QTOH 1QFKH 1SSXA 2A7CA 1GJDB 3P6ZB 3DFJA 2A4GA 1ELGA 3ZZCA 1NESE 1NFXA 1QR3E 1SG8B 1TOCB 1QURH 3OSYA 1GGDC 1LDTT 7GCHF 2DE9A 3TK9A 4AZ2B 1K1IA 1G3EA 2JETB 1Y3YA 1EASA 3RXPA 1WUNH 2HGTH 2F3CE 3VGCB 3AW1A 4MQAA 1L1GA 1MKXH 1UTMA 5JYIA 4WY3A 1OOKB 3S9AA 1C2JA 1JXPA 2RA0A 1JWTA 1QA0A 1ZSLA 2STBE 2BY8X 2FOHA 3U69H 4AOQA 4R0IA 1H4WA 1U6QA 2AFQB 1MTNC 3GY6A 1GJ7B 4NCYA 1O3LA 1KSNA 5HYOA 2ANKH 2GX4A 2LNCA 1W0YH 4CRCA 2ZCKP 3ZVCA 2QF0A 2ZGBH 4Y11E 3SI4H 3LGYA 2GP9B 3BV9B 3RMNH 3ZZ5A 3NXPA 1F92A 3SNBA 5FAHA 2WV5A 1Z6EA 1MKWH 2RDLA 4DIHH 3KQCA 4IMQA 2ZTYA 1UVOA 1PJPA 1PQ8A 2OBOA 1CO7E 2VNTA 3AAUA 3TK5A 3SU0A 1NN6A 2P8OC 3MO9A 4IS5A 4NA9H 1QNJA 1D4PB 1C2FA 3BG4B 3M5MA 1BRUP 2ZU1A 1CT2E 3EQ0H 3GISB 4HFPB 2IOTA 1ZPBA 2FZZA 3ZZ6A 5F8ZA 1HRTH 2VWNA 1BRBE 1MTSA 3RU4E 4FU9A 3LU9B 4XE4A 3ZVFA 1L1NA 3CS0A 1ANBA 1C5QA 3ZZ8A 5DP8A 1GPZA 5FPYA 2OC0A 5J4SA 1B7XB 2CXVA 1SGTA 2F91A 2BYAX 3MH5A 2AGIX 2G51A 3N7OA 1JIMA 5JBAS 2H1UA 5CMXH 3TGKE 1CBWC 1GI0A 1HYLA 2G81E 1WAYB 1NTPA 1YGCH 1ZJDA 4SGBE 3UR9A 1JBUH 6GCHG 4CRFA 4X8UH 4MLFB 3A7WA 4NFFA 1YP9A 4FVDA 4OGXA 4UFFH 3GY4A 1OPHB 1ESTA 1C5UA 1ZYOA 3SU6A 2BLOA 1QCPA 2FTMA 3GCNA 2G00A 3P8NA 3RMOH 1BJVA 1GI2A 2O8MA 3U98H 3GCHB 4I8LA 1L2EA 3A7VA 2Q1JA 4MVNA 3A8DA 2AEIH 3I77A 4FUEA 4K2YA 4O3UA 1GBCA 1CHOG 4CRAA 2RCEA 1GMCF 4BTTB 1AWHB 1EP6A 1MU8B 1O3DA 4GUXA 3SGQE 1V2JT 4DCDA 1QHRB 1HAGE 3A8AA 3UNRA 3UNSA 1O3HA 2WPMS 2WPJS 4INLA 1O5FH 5GXPA 1RTLA 2BDBA 3MFJA 5GPIB 4MPVA 1O2KA 2A7JA 2F83A 3DT0H 3RXAA 4D7FA 2CV3A 1TWXB 4E06H 2JETC 4KGAA 1THSH 1ZHMA 5HGGA 2FOEA 1GHAG 2ZO3H 3T25A 3EDXB 5FPTA 1GBLA 3VGCC 3O8DA 2ANYA 4UFEH 2P95A 1DE7H 3BIUH 1TNIA 1IHSH 1FXYA 1A5HA 1GI7B 3RC5A 3GY2A 1TALA 1PQ5A 1TX7A 1YBWA 1L4ZA 2VIWA 1TNKA 1Q3XA 2OP9A 4BTIB 1QJ7B 2V6NA 1PFXC 2WPLS 3FZZA 4B2CA 1DLEA 5DKMA 2TGAA 2Y81A 5E2PA 1ZHPA 2HNTC 3W95A 4FVBA 2QN5T 1O35A 4CH2B 1C2EA 2C8XB 5FCKA 3DHKH 1SB1H 1TPAE 7KMEH 1W8BH 1LVMA 1HUTH 3SUEA 5GIBA 2SGDE 3KCGH 4JYTA 2R2WU 2ZFTA 4WF8A 2A2XH 1HAYB 3ZZ7A 3PYHA
chains in the Genus database with same CATH superfamily
3A82A 1LVOA 1HAOH 2PKSB 1Z1IA 2FYRA 2OXSA 1K1NA 1YF4A 6CHAB 3VB7A 3QTVH 2A7HA 2VH6A 3BG4C 1H9LB 4OS7A 1YLCA 1J14A 1GG6C 3ZZ4A 4NWLA 5K0HA 1BTWA 5DP5A 4BAOB 1C1PA 3B8JA 1GJ6A 3KL6A 5HXFA 1HAIH 2FEQH 4K60A 3OYPA 1XKBC 1B5GH 1C5ZB 3URDA 1O3NA 1OWKA 1GHWH 3MU1A 2XW9A 1FDPA 1C5WB 5DP4A 3V12A 4XSKU 1Z1JA 4BNRA 1O2OA 3OY5U 2B0FA 2YNAA 4B76A 1ZRBA 4RI0A 3A81A 1O3KA 4CHAB 1SGQE 1GBTA 3CS7A 5F8TA 2OINA 4Z0KA 1AB9B 3LC5A 5GDSH 1BT7A 1AE8H 1C2HA 1O36A 1XVMA 3B23B 4Y8ZA 1CT0E 3ATLA 3NKKA 1H8DH 3RM0H 2WHXA 4X2WA 1MD7A 1D6WA 1OWDA 1SGNE 1V2KT 1ZGIA 2XOKD 2VWOA 3RM2H 1TGSZ 2C4FH 2CN0H 3PRDA 3FN8A 3GOVB 5DP7A 5HM2A 4XBBA 1QL7A 4UFGH 1LHFH 2BVRH 1FAKH 1J15A 1VCWA 1TYNA 3STIA 3K6YA 2H9TH 3VFEA 3T26A 2HPPH 1MABB 4AB9A 1AE5A 3QGJA 4J2YB 1RGQA 5EG4A 3S7KB 5E0JA 3N7EA 1FAXA 3ELAH 1YPEH 3BEUA 1C5MD 1MZAA 1WCZA 5L2YH 3FP8E 3M61U 1BZXE 2ZHDA 4JZEH 2SGEE 1WOFA 1MH0A 5H4IB 2F9PA 4TPYA 1A61H 1ZMJA 1O2WA 5ESTE 5DGJA 3UREA 1WV7H 3S7HB 3PROA 3TJVA 1TQ7B 2ZHQH 4Y7AA 1SLUB 4GCHG 1Y5AT 1AZ8A 2KAIA 2VIVA 5LPEA 1O2LA 3U1JB 5DSFA 3P8GA 2ZCLP 4Y8XA 2ILNA 3SN8A 3GYLB 1C1RA 2FX4A 1GBFA 3SU1A 1VKYA 1HXEH 2W5EA 2A4QA 1E0FD 3T29A 4YOIA 2JJ1D 2F43B 1GBAA 1BCUH 3PV4A 5C67A 1GL0E 2H9EH 5C2ZA 2ASUB 2QE7D 2DE8A 1LPGB 2V3HH 1GHZA 3OTJE 1HPGA 1SMFE 4YOJA 4JYVH 1O5AB 1FQ3A 1A4WH 5TCAA 3SJKA 3H7OA 1TPSA 4ABDA 3KQBA 3RXBA 2PGBB 1QB6A 1QB9A 4YESB 4ZUHA 4AGKA 1W7GH 2BY9X 2EI6A 2TIOA 1HV7A 1VGCB 4M9FA 2ALVA 3SV6A 1KXCA 2G8TA 4E7RG 4UD9H 4ZCNA 4ZKOU 2Y7XA 1Y59T 4IC6A 1YPLH 2A45B 2Z9KA 1TGNA 3LGVA 1UK3A 1PYTD 4VGCB 2PKSC 2OQ5A 4X0WU 2XNIA 1AHTH 4LK4A 4ISOA 3Q3YA 5F03A 1XVOA 1SGIB 4DJZB 3RU4T 3GDUA 4CH8B 2W26A 4BAMB 2SNVA 2B5TB 1QY6A 1GMHF 2KCOA 3A85A 3A87A 2BDHA 4FUJA 1EJAA 3M35A 1E34B 2BD4A 3F3BA 1NS3A 1O2GH 2FI3E 1P2MA 5A8ZA 4ABHA 5A0CA 1QL8A 1VCPA 3UAIC 9ESTA 3Q3XA 1E1RD 1OWHA 2V7QD 1EZUC 3K65B 1ELBA 2ZWLH 4E7NA 1PPBH 4YZUA 3RP2A 1IQEA 2BD9A 2ZA5A 1ACBE 1DOJA 4MG3A 4NA7A 4CHAC 1TBZH 2IJOB 3SV9A 1AB9C 1VJ9U 3R3GB 2B9LA 4IC5A 1BTYA 1S83A 2J92A 1W3CA 2ZCHP 1QBOA 4NIYA 8GCHF 4X6PA 1TLDA 1DX5M 4AB8A 4Y10E 2KAIB 3IG6B 5ETXA 1Z6JH 2ZG0H 5EQQA 2CK3D 3GCOA 2ZHFH 1E35B 1NFUA 3UPEA 1YPJH 1IHTH 3IWMA 3LH1A 1UK2A 3F9EA 1C1NA 2QXGA 1AFQC 2KCPA 3NRLA 5ESBA 1TE0A 1BHXF 1EJNA 3LGIA 1CU1A 1IQKA 5C5NA 1OHHD 1P2JA 3G01A 2UWOA 2UWLA 1ANEA 1UCYK 2QC2A 3MMGA 1GDQA 3ZVAA 1H8HD 2XC0A 3VB3A 1P04A 2VIDA 1NC6A 5C94A 2HPQH 1FIZA 2J4IA 4MPXA 1NU9A 3MYWA 1CE5A 1KLTA 2GZ7A 2FP7B 1QQUA 2GMTB 2Q6GA 3UFAA 3S9BA 1S82A 1FIWA 1DWDH 1UJ1A 3SQHE 3LOXA 2BZAA 3E0PB 1J16A 1TNJA 4UEHH 2FOMB 1KXAA 4K1EA 1FPHH 1EPTB 1NU7B 1SGCA 2JKHA 4FUGA 2FPZA 5HKKD 2BD2A 1P10A 5E0HA 1ARBA 1AKSB 2ZDNA 3WWBA 1MTUA 3LGUA 4BAQB 1FX0B 1K0HA 5JPMH 3S0NA 1XUHA 3W94A 1XUIA 2IJD1 2W7UA 2WYGA 3NCLA 4F4OC 7ESTE 2A0QB 1W0JD 3SJIA 3EA7A 1OWJA 3E1XB 3NPSA 4CRDA 1LCYA 3QGNB 4RT1A 2HALA 1D3DB 2AMQA 2Z6BD 4XBDA 2EI7A 3M3VA 1T8LA 2Q6DA 1J9CH 1C5VA 1PQAA 2H9HA 2FS9A 2VJ1A 1O2PA 1T31A 1FI8A 1UHBB 1KTSB 4K5ZA 1P3EA 1BTHH 5K7RA 1LVYA 1O39A 1VCQA 1RS0A 1MUEB 1Z8GA 1K28D 3UUZA 3DCLA 1GBJA 2CMYA 4GPGA 2J2UA 1SVPA 2CHAB 1OS8A 3BTME 1UW7A 1VZQH 1T7CA 2WZQA 1MKXK 1C5PA 3QX5H 1V2WT 2ZGJA 1VGCC 2H5CA 4WMDA 1TFXA 4YLUA 1BRAA 3NWUA 5EODA 4B2AA 3O8RA 1JMOH 1O32A 3RMMH 3ZYEA 4A1TA 1EUFA 4VGCC 4I86A 4Y0ZE 2HNTE 1LHCH 2Z94A 5C5OA 1Y5BT 3SU2A 4HGCA 3PTNA 4U32A 5FCRA 3UWIA 3HGPA 1EZSC 3RU4D 2BQ6B 1DVAH 1W0ZU 3RLWH 4CR9A 5EXNA 5GCHF 1K1JA 1O34A 1AUTC 3PLBA 4AFQA 1N6YA 5FX6A 4BANB 3PLPA 1AZZA 1O3AA 3MHWU 3SUFA 3U8RH 2BD5A 3GICB 1LVBA 1MKWK 4GHTA 1GJAB 1O3BA 3E90B 3BSQA 3HK6B 1ID5H 1EATA 5PTPA 2Z3CA 2R3UA 1A7SA 2KCYA 1Z7KA 3T5FH 2OLGA 3ESTA 4X2YA 1GMHG 2QXHA 2ODYB 2GV7A 3ENSB 2ZFRH 1PPFE 2VGCB 1C4Y2 1GJ5H 1BA8B 1F0SA 1W10U 4ISIH 1P05A 3TLOA 2FYQA 3UY9A 2FMJA 3R0FA 3UNQA 2FDAA 1G30B 2QAAA 1P09A 3LJOA 1PPZA 3MO6A 3SO3A 3IITA 1TRYA 2JH5D 3LONA 2Y7ZA 4AFUA 4AX9H 4MTBA 1IQHA 1GCDA 1OP8A 2TRMA 4AGJA 4BTUB 4LZ4B 1WTHD 2QF5A 1MAYA 1V3XA 1HAVA 1SHHB 1ETSH 5F8XA 2W3KA 1K1LA 4YLQH 1HBTH 1DXPA 3VEQB 1G3BA 2K1QA 1V2NT 1WBGB 1NFWA 2V3OH 1CSOE 1EZXC 1Z71A 1M9UA 4DT7B 1C5OH 1E36B 1TPOA 1QQ4A 4ABBA 3SUDA 1AVWA 3SNEA 3DUXH 3MU4A 1GWAA 3M37A 3SJ8A 1LPZB 4ZXXH 1C4U2 1KYNA 2P3UB 2QXIA 4RT0A 4H42U 1GHBF 2KZ4A 3MH4A 2WUBA 1ANCA 1CGHA 4INHA 1KDQA 2BY6X 2VIPA 4UFDH 1Y3UA 4DY7B 2ZU4A 3HPTB 5J4QA 1VR1H 4ZMAH 1T4VH 2WPKS 4MNYA 3M3SA 1SGFA 2STAE 1IQJA 4DW2U 1KMHB 2LELA 1V2MT 1C1TA 2WPHS 3T62A 8KME2 1EPTC 1GBHA 1S0RA 3TGIE 3A7XA 3SQEE 2SFAA 4NSVA 3RXGA 3TH4H 3QLPH 1QRWA 1BB0B 1QRZA 1FN8A 1SKYE 1YM0A 4KTSA 5GNDA 5IYTA 2KM0A 2AGGX 4OGYA 3RXKA 4AFZA 1VITF 1FONA 1UCYE 1C1OA 4DOQA 3VXEH 1ZZZA 3AAVA 2H5DA 3EA9A 3PO1B 3SU4A 3URCA 1E1QD 5JB9S 2Y5GA 2R3YA 3ZZ9A 1IQGA 2AIPA 5IK2D 1KIGH 2C8WB 1C1QA 3SZEA 1TBQH 2VU8E 3ATWA 2KX4A 3E16B 3RXHA 1NROH 1HAPH 4I8KA 3ATIA 4MNWA 3ZV9A 4AC9A 4ABJA 4K8BA 3SU5A 1C2IA 1HNEE 1EZQA 1TX8A 3S69A 2CHAC 2PSYA 1PPGE 3ZYDA 1V2PT 3AVZA 2FI4E 2Z9LA 2ZDKA 3VPKA 3Q00A 4CR5A 4D9RA 1P2KA 4D76A 4A92A 1F0TA 2GT7A 3E8LA 1Y5UT 4X6MA 2PKAA 3UOUA 1C2DA 2TBSA 4F49A 1A0LA 4DG4A 7GCHG 2M5TA 4CREA 2TGTA 1ESBA 1PPEE 1Y3WA 1MTVA 3SI3H 4P02A 1IQIA 1GMDF 1MMJN 1GI3A 3PMBB 5EGMA 2GGVB 3BF6H 2FOCA 1V2QT 2IPHA 2VVVA 1DUEA 4CRGA 5T6FA 1DANH 6ESTA 3F9GA 4TWWA 1C1VH 1YLDA 1AU8A 1HDTH 1T8MA 2QV1A 3GYMA 1O2JA 3WWFA 1FLEE 3BIVH 1TBRH 1CQQA 1UTPA 4X2XA 5EPYA 2SNWA 2F9BH 1FNIA 5GCHG 4B73A 2PSXA 1C5RA 1RJXB 3MTYA 2XCNA 5KEDA 2JDID 2BDCA 2XBYA 4H6TA 1O37A 2AIQA 4KTCA 4ZH8A 3BG8A 1KDQB 5FHTA 1AI8H 2J38A 1C1SA 1GI8B 3MH7A 1DSUA 3NUMA 1DSTA 4Y71A 4U2WA 2XBXA 2OQUA 4OS1A 1ZMNA 2C3SA 1SBWA 3A84A 2KCAA 2ZTZA 4JZ1A 3OU0A 1P2NA 1T8NA 3D62A 1O30A 2CF8H 2ZC9H 4RSPA 3SJ9A 3EGKH 4D7GA 3O8CA 1QA7A 1O2YA 1ZPZA 3MQKC 1MZDA 3CNRA 2J98A 4Y0YE 1P11E 8LPRA 2G5NA 1A3BH 1BBRK 2AERH 2ZGHA 3UR6A 1SQTA 1EFRD 1TA6A 1O38A 4XRNA 1ZSJA 4MNVA 1OP2A 1HAHH 1C2MA 2A4RA 1Q2WA 4ZHMU 1G32B 5AFZH 1BTZA 1S5SA 2JH6D 5B6LA 1TGCA 1S84A 3GDVA 1RIWB 1TMTH 5EIYA 4FETA 1O3FA 3SV2H 2PLXA 2ZU3A 1J17T 1FUJA 2FESH 4JZIA 2XBWA 5A09A 3RXOA 1L1JA 3MOCA 3LGTA 1BMMH 2RG3A 2VINA 1GBMA 3GS9A 1NPMA 3BN9A 3FFGA 1P2IA 1SI5H 2AYWA 1ESAA 2GV6A 2LPRA 3F2HA 1P02A 4OS6A 1GBBA 1F5KU 1C5SA 3GCHC 2FX6A 1RFNA 2Y5FA 3TJNA 2C90B 3RLYH 4I31A 1W14U 3U9AH 1GBEA 8ESTE 3BTGE 2UUKB 1ZTJA 1TMBH 1D6RA 1P2QA 3ZVDA 1PPCE 3T27A 1O2HA 5A8YA 1SFQB 3LIWA 3PO1C 1H1BA 3E0NB 1JOUB 3TIUA 3ITIA 7LPRA 4M7GA 1ARCA 4LOYH 2FLRH 2ZHWH 4A6LA 1SGPE 5F6MA 4WWYA 1UTLM 1Y8TA 4XOJA 5EJLA 3S9CA 3FP6E 1D3QB 1N6XA 5F53A 2WV9A 1V6DA 1CA0B 4NIVA 5BPEA 3U8TH 1OYTH 2WUCA 4I7YH 2WV4A 1GMCG 1XX9A 5FBIA 1LQDB 4RKJB 1TABE 4I33A 2GKVE 4IMZA 1BTPA 2XCFA 1YCPH 2ZQ2A 1AO5A 1NY22 2RDEA 2BMGB 1GJ4H 1D3PB 4OS2A 4DGJA 1ELTA 1QJ6B 2BTCE 3QWCH 1AVXA 4IN1A 3SGBE 3SV8A 2VVUA 1YPMH 5JBBS 3CP7A 3EE0B 2P16A 3VB5A 2G5VA 3D49H 1KY9A 1P57B 3BTEE 3ZVEA 4FUBA 4WVPE 3OEHD 1AN1E 2FXRA 1O2QA 1HIAA 4IBLH 1GDNA 1GDUA 3M7TA 4F48B 1WXRA 2FI5E 1UVPA 4NFEA 3RXMA 5C0UA 1LHGH 1NRPH 3LH3A 4DIIH 3BTKE 3F68H 4CRBA 3E3TA 1RRKA 3AW0A 1C2GA 2G55A 4A7IB 5CE1A 4Q2KA 1OYQA 1WSSH 2ZDAH 2AMPA 1K21H 1EOJA 3M5NA 3RXFA 2YOLA 1XUKA 1QZ8A 4MNXA 2VB0A 2BM2A 1GGDB 1IAUA 2Z3EA 6CHAC 4I8GA 1THPB 2OD3B 2J34A 3ATKA 3KYGA 4X6NA 1KXFA 4H6SB 2J94A 1O3GA 1QIXB 1XM1A 4OS4A 5DP6A 5DO4H 1G3CA 4DVAU 1O3OA 3KNXA 1O0DH 2BB4A 2D26C 1KXBA 1ELDE 5DP3A 1B0FA 4FUIA 5AHGH 2BZ6H 1OX1A 3STJA 2ALPA 2JIZD 2ZECA 2XC5A 2Q6FA 1S6FA 2SGFE 1MTNB 1NM6A 3GCTF 3M5OA 4GVUA 2QA9E 3RXJA 1V2UT 1DUAA 1N8OB 5C20A 1HCGA 1MU6B 3RXVA 1A3EH 3F9HA 1ZTKA 1ETRH 1SQRA 4OS5A 2BXTH 4NG9H 4Y76A 4BAKB 2XRCA 4Q7XA 3Q77A 2OC1A 4WH6A 1IQLA 1CT4E 2BLQA 2JH0D 1XXFA 5C1YA 4B71A 2ZQ1A 2YMSD 1SLWB 1FY5A 1P9UA 2NU2E 1DXWA 1GVLA 1Z8RA 1C2KA 2BD8A 2AMDA 2ESTE 2PFEA 3BTQE 2F9NA 4HZHA 4Y79A 4IN2A 2P8OB 1GI9B 1H8IH 1HFDA 1TNGA 3TVJB 1E38B 2W6JD 4YOGA 4LZ1H 2A31A 4ASUD 1C5YB 1H9IE 1YY3A 5T1VA 4AG2A 2F4LA 2C8ZB 1AFEH 2ZKSA 1AVGH 3HKJB 1GJCB 1DLKB 2RA3A 3UQVA 4Y6DA 4BAHB 3H7TA 3V7TA 1OWEA 3M3TA 4ABIA 3F0OA 4B74A 1AUJA 1EJMA 3ODFA 3L3TA 4WXIA 1BBRE 2GVFA 4D8NA 2BDAA 2QCYA 1MTWA 3UB0A 4Z6AH 4WMFA 4NGAH 1Y3VA 2BHGA 4TWYA 1TX6A 1T4UH 1BDAA 2ODPA 3BTFE 3LDXH 1C1WH 1F0UA 2KFWA 1CBWB 2BD3A 1G2LA 3F2FA 3VB6A 1DM4B 3HKIB 2HNTF 2OK5A 3RXSA 1CA0C 2VWMA 3D23A 2WYJA 1GI1A 1EAIA 4X8SH 2VVCA 3B9FH 3BEFB 3A7ZA 1P01A 1V2ST 1O3CA 2JJ2D 2J95A 1XXDA 2OTVA 1CHOF 2A4OA 1TGTA 2ZIQH 1BOQA 4ISLA 1EX3A 1IOEA 1K1OA 2G4UA 1NZQH 4JZDH 4ASHA 5A0BA 1A5GH 2NU3E 1JIRA 1FMGA 3M7UA 3FVFB 5C1XA 4Q80A 2YMSB 3SZNA 1F2SE 4Q63A 2HLCA 3PB1E 5GJ4B 4X8TH 2R0LA 1ZTLA 3QK1A 2IN2A 4CBOA 1DFPA 4J1YA 1O31A 3U8OH 3ZVGA 1UTKA 1UVUH 2WINI 1EKBB 1TNHA 4E05H 3GDSA 1UTOA 4ISNA 3TK6A 1AGJA 1GHAF 1YPHC 1Z8IB 5C3NA 1GJ9B 2Y5HA 3RC6A 3RXIA 3W1EA 4FUCA 3UWJH 2A5KA 3NK8A 3SBKA 1YPKH 1QGFA 1XUGA 4I8HA 1K9OE 3SNCA 1NBME 1VITH 3L6PA 2Z7FE 1BHXB 4B1TA 3TPIZ 4FU8A 2XTTB 2ZP0H 1PQ7A 3ZIAD 1W2KH 4JCNA 2FWWA 4SGAE 3FKSD 2HWLB 2SGPE 1GBKA 1SC8U 3PV2A 4UDWH 4KKDA 1O2NA 2DUCA 3KYFA 1A46H 1DPOA 1QJ1B 1P03A 4RKOB 2P93A 4XFQA 2GCHF 3O8BA 2Y6TA 3K9XB 1O3PB 1GVKB 3BTWE 1HB0B 3RXLA 1ELAA 3M36A 2FM2A 3QO6A 4H4FA 4AN7A 2ZFSA 1G2MA 5BRRE 1ANDA 1C9PA 3A8BA 2EA3A 2VBCA 1P9SA 3WW7A 5FX5A 5EOKA 1NO9H 1N8OC 2XC4A 5IDKA 1SOZA 5EPNA 2TGDA 3OX7U 5AVDA 1HLTH 2C93B 1CA8B 3FO8D 4A1VA 4KELA 1BMNH 6LPRA 3LGWA 2ANWA 1A5IA 1DS2E 2C8YB 5HIZA 2HRVA 4X1PU 3PLKA 2FS8A 1DY9A 3GCTG 1SGEE 3PMHB 2V35A 5C1UA 1TNLA 2D1JA 2FOGA 5CHBA 4K1TA 4FOUC 1DICA 3P92A 1O5DH 1EB2A 3M7QA 1BRCE 2EC9H 3V3MA 1C5NH 4K8YA 4R8TB 4YO9A 1XMNB 2PWXA 4YM9A 1DY8A 2BY7X 2CF9H 2OC7A 4XBCA 2ZHEH 2PUXB 4YXWD 1GG6B 4I8JA 3SV7A 3A7TA 3KQDA 2Z9GA 1TRMA 8GCHG 3MU5A 4WMEA 2SGAA 3P17H 1CGJE 1F7ZA 2ZDVH 1FY4A 1MCTA 4I32A 1C1UH 1PYTC 4O97A 2BOHB 2ZFPH 2A1DB 4Q4LA 1SPJA 3F9FA 2HVXA 3LC3A 1DWCH 1P0SH 5DP9A 1YPGH 3RC4A 3RXRA 1P3CA 2W7SA 4F55A 2GMTC 2J97A 1YC0A 1K1PA 1ZGVA 3VXFH 1FY1A 4B75A 2FODA 2IPQX 2TPIZ 1S85A 2H6MA 1DT2A 4Q7YA 1O2TA 1EQ9A 3RXDA 3F2GA 4FUHA 3CENA 2CJIA 4ABAA 1TMUH 1OWIA 4ABEA 2WPDD 3KIDU 1SLVB 1G36A 3H09A 3DA9B 2F9OA 1INCA 2VIQA 1AIXH 1ELEE 1WYKA 2ZGXH 3DD2H 4YT6H 5LH8A 1NRRH 1O3EA 4JMYA 4AYYB 1FV9A 4FU7A 3UTUH 3GY7A 2Y80A 5EW1H 1MBQA 2CGAA 1MCVA 2WPIS 1MQ5A 3MWIU 1UTQA 5JDUB 5DJ7A 3SJOA 2XWBI 2HOBA 4WJG2 3OEED 3T28A 1HJAB 1LHDH 1NRSH 4O3TA 1EAUA 4ZAEA 4GCHF 1N1LA 1TAWA 1FZZA 5HMAA 2G4TA 3A80A 3FAOA 1UO6A 1BUIA 4BOHA 1H8ED 3GY5A 1J8AA 1O3JA 1GJBB 3MU8A 2ANMH 4K3JA 2UUJB 4NA8A 4NIWA 1GVZA 2ZDMA 2O8UA 1O5EH 4TY7A 1L4DA 1BTUA 3MNXA 1BITA 4NZQA 1O5BB 1NRNH 1O5CB 4RN6A 3PTBA 3KQEA 3LT3A 3MH6A 2UWPA 3V0XA 5T6GA 5DG6A 5E2OA 4O9VA 4CBNA 5A0AE 1T32A 2I6SA 4Y8YA 1BMAA 3BTDE 3SNAA 2ZGCA 1ELVA 2O8LA 1W11U 5ABWA 3DFLA 3A7YA 1TRNA 1A0HB 1G3DA 1YLNA 3FZDA 1HAVB 4XDEA 1QTFA 1ORFA 2ZI2H 4X6OA 5G4BA 4TPIZ 2D2DA 3SHAH 5FBEA 4ZXYH 1RTKA 1RD3B 3AASA 3RXQA 5E0GA 3JZ1B 2ZFQH 1GI4A 2Z9JA 5HIYA 1O33A 4U01A 2AHME 5HM9A 2BLWA 1Q31A 3SHCH 1W13U 1ETTH 1GJ8B 2KR7A 4HI3A 2BDYA 2PR3A 3K2UA 5LPFA 1OSSA 2BX4A 2VGCC 2GT8A 2QF3A 4JYUH 2BD7A 3KN2A 5EJZA 5LPRA 2OCVB 1TQ0B 2GCHG 3RMLH 5T3HA 2GCTB 3NZIA 3K6ZA 3SNDA 1UVSH 2BDIA 5AFYH 2PHBA 5DN6D 5GWZA 1MQ6A 2FIRH 2OC8A 4K69A 1ZJKA 1WQSA 1XUFA 3TITA 3SGAE 2GZ8A 3TJUA 3SW2B 3P8FA 3BEIB 4INKA 1ZPCA 4AG1A 3RDZA 3JZ2B 3SU3A 2ULLA 1DDJA 9LPRA 3KF2A 1SFIA 1EAXA 5EXMA 4FUDA 1EXFA 3LPRA 2Z3DA 1SQAA 2QYIA 4TY6A 5A2MH 1AQ7A 1GCTB 1GHYH 2BX3A 3N99A 4ESTE 1LHEH 1CGIE 1O2ZA 1SGDE 1V2LT 3A8CA 3L33A 3QUMP 4X1SU 4MDSA 1UVTH 1H9HE 4GHQA 1ZMLA 5JB8S 1V2OT 2PV9B 5FPSA 1KXEA 2EY4C 3M5LA 2QY0B 1P06A 1P2OA 5SGAE 3TNSA 1E79D 2O8WA 1P8VC 2ZU5A 1G37A 5I25A 1VJAU 1SHYA 1GL1A 2PTCE 2OUAA 4GLYA 2QXJA 2ZF0H 4NIXA 1LO6A 1FY8E 1C5LH 3MNSA 3E6PH 1YKTA 1O2VA 3TGJE 4NZLA 2BY5X 2H2ZA 3OY6U 3BTHE 3DSGA 3ATMA 1BBRH 1GHBG 2EEKA 2UUFB 4WXVA 2BQWB 1LPKB 3PMAB 1A1RA 2GJGA 4X2VA 1DITH 3H5CB 5TJXA 1THRH 4ABGA 4BXSA 1MD8A 2PKAB 1HJ8A 3A83A 5DPAA 1S0QA 5EW2H 2A5IA 2LP6A 1XKAC 2HVYB 3HATH 2BLVA 1YYY1 2PW8H 2P59A 2BOKA 3A86A 5FXLA 2SGQE 1AFQB 4WH8A 1WQVH 1O5GH 3LJJA 2BVXH 1O2XA 4X8VH 1HJAC 3TU7H 4JZFH 1BIOA 4LXBH 2AH4X 2J9NA 3TH3H 1S81A 1V2TT 1O3MA 1G9IE 1B0EA 3D65E 1Y3XA 1IQFA 3C27B 1SQOA 2VIOA 1IQMA 1O2MA 1KLIH 1SGFG 1WDIA 4JK5A 2NWNA 2ODQA 1VITG 3WY8A 1ZR0A 3UIRA 4U30A 3P8OA 1T8OA 2B8OH 4TYDA 2P3FH 1YCPK 3QN7A 1MAXA 3QZRA 3KHVA 4IW4E 3SUGA 5A8XA 1D9IA 4ISHH 1SGRE 3MO3A 1Z8JB 1ZLRA 5FL7D 4ZHLU 2QF4A 2ZFFH 1GBDA 2YNBA 4FXGH 4ZHAA 4AORA 1XUJA 1QBVH 2XWAA 1A0JA 2ZNKH 5CHAB 4A5TS 2AGEX 1YPHE 1ZSKA 4HTCH 1FPCH 2BQ7B 1IQNA 4YTAA 2F9UA 3HK3B 1F0RA 3PMJA 1TB6H 2NU0E 3V13A 2GDEH 1BQYA 2NU1E 1WU1A 2GD4B 3LKWA 3QDZB 5I46H 5L2ZH 2ZTXA 4NWKA 3HGNA 2XBVA 3KGPA 1S6LA 3RXEA 1HXFH 1ZRKA 1EB1H 3GY8A 1P12E 4KP0A 1LKBA 2J98B 1GMDG 1O2UA 1SL3A 2A5AA 2V0BA 1D3TB 1F5LA 2GDDA 1TGBA 3ZZAA 3TH2H 3PM3A 1KTTB 3UQOA 1ZHRA 2NU4E 1RXPA 4AYVB 1EPTA 2ZPSA 1HAZB 2GCTC 4B6EA 2R2MB 1AY6H 4ZKRU 1F5RA 1BTXA 3EA8A 1GHXH 1SOTA 1AKSA 2ZPQA 3ODDA 1NT1A 5AF9H 3EYDA 4THNH 1TPPA 1ABJH 3ZZBA 2ZU2A 2B7DH 1YCPM 3MNCA 1LKAA 2ZDLA 3F1SB 3MU0A 1UMAH 3PWBA 4A1XA 1W7XH 2R9PA 4YT7H 3T2NA 1GI5A 2BVSH 2Y82A 4UE7H 2A2QH 2ZPRA 1C5TA 2O9QA 5L6NH 1LMWB 1FY3A 4K1SA 1K2I1 4BXWA 4MPUA 1ABIH 1L0ZA 1BMLA 1EOLA 4FUFA 3A89A 2PTNA 3FOAA 3PV5A 1AMHA 1GCTC 1X7AC 1UHBA 2AS9A 5E8EH 2THFB 3Q3KA 4Q7ZA 2GZ9A 2W6ID 1S6HA 2A32A 1DWEH 2FOBA 3U1IB 4O03A 3SYJA 3KEEA 3RUOA 3OAAD 1ZOMA 1JRTA 3MNBA 2W3IA 4UONA 1BJUA 1EP5A 3C1KA 3RXCA 1HJ9A 1OP0A 3QZQA 5B6OA 1K22H 1RIWC 1OXGA 2XYAA 1C1MA 1PPHE 3SORA 4ACBA 2G52A 2GTBA 2FTLE 1TIOA 1QB1A 1C9TA 1MBMA 3N7DA 1O2IA 1C5XB 4ZKSU 1SGYE 5L30H 4OM9A 3DSOA 3Q76A 1TONA 5T6DA 1UK4A 3PWCA 3ZZDA 5EU8A 2P94A 2XNDD 5LGOA 1QRXA 1ELFA 4X1RU 1E37B 1GHVH 1EAWA 4DT4A 1C2LA 3OTPA 1HAXB 3RXTA 3A88A 4MPWA 2I6QA 3MI4A 3GY3A 1UTNA 1FJSA 6GCHF 1O3IA 4GAWA 4TT3D 4ZROA 1AWFH 1OKXA 1LTOA 3EAJA 2FOAA 3FP7E 2PGQB 1HGTH 4NSYA 1A2CH 1FN6A 1CVWH 2VH0A 4JK6A 1O2RA 4PROA 1HIAB 4ZKNU 2QGRA 1GBIA 3PRBA 2D8WA 5EQRA 1NRQH 1TOMH 3E91A 4X1NU 3VB4A 2P3TB 1C4V2 3ZZ3A 1AD8H 5KGOA 5EXLA 2PUQH 1O2SA 1LQEA 1UCYH 5EQSA 2ZEBA 5DK1A 2ZZUH 1SLXB 2Z9IA 1V2VT 3UOPA 4Y7BA 4GSOA 4DURA 5JBTA 2FO9A 2QIQA 2K8IA 1TA2A 2VWLA 2BDGA 3TNTA 4X1QU 1WTGH 3RXUA 1K1MA 2FLBH 1NBMD 1SR5C 4KTUA 3I78A 3SOSA 2UUYA 3P95A 4D9QA 1NFYA 3TJOA 1KLJH 1RTFB 2XXLA 4ABFA 3FANA 2PP6A 3ZVBA 1CHGA 5TCCA 5CHAC 3BTTE 2FOFA 1DWBH 2EI8A 2J5UA 2O8TA 2R0KA 4B2BA 2V3MA 1ELCA 1GI6A 1KXDA 1QBNA 1UTJA 3ZV8A 3I29A 3F6UH 3P70B 5JBCS 1V2RT 2TGPZ 4IGDA 2BXUH 4QT8C 4AFSA 1W12U 3OFND 1JRSA 2F9VA 1QL9A 2OBQA 3QTOH 1QFKH 1SSXA 2A7CA 1GJDB 3P6ZB 3DFJA 2A4GA 1ELGA 3ZZCA 1NESE 1NFXA 1QR3E 1SG8B 5CDFE 1TOCB 1QURH 3OSYA 1GGDC 1LDTT 7GCHF 2DE9A 3TK9A 4AZ2B 1K1IA 1G3EA 2JETB 1Y3YA 1EASA 3RXPA 1WUNH 2HGTH 2F3CE 3VGCB 3AW1A 4MQAA 1L1GA 1BMFD 1MKXH 3EE7A 1UTMA 5JYIA 4WY3A 1OOKB 3S9AA 1C2JA 3DSPA 1JXPA 2RA0A 1JWTA 1QA0A 1ZSLA 2STBE 2BY8X 2FOHA 3U69H 4AOQA 4R0IA 1H4WA 1U6QA 2AFQB 1MTNC 3GY6A 1GJ7B 4NCYA 1O3LA 1KSNA 5HYOA 2ANKH 2GX4A 2LNCA 1W0YH 4CRCA 2ZCKP 3ZVCA 2QF0A 2ZGBH 4Y11E 3SI4H 2L6OA 3LGYA 2GP9B 3BV9B 3RMNH 3ZZ5A 3NXPA 4TSFD 2RFKC 1F92A 3SNBA 5FAHA 2WV5A 1Z6EA 1MKWH 2RDLA 4DIHH 3KQCA 3U28C 4IMQA 2ZTYA 1UVOA 1PJPA 1PQ8A 2OBOA 1CO7E 2VNTA 3AAUA 3TK5A 3SU0A 2EQNA 1NN6A 2P8OC 3MO9A 4IS5A 4NA9H 1QNJA 1D4PB 1C2FA 3BG4B 3M5MA 5C0TA 1BRUP 4XD7D 2ZU1A 1CT2E 3EQ0H 3GISB 4HFPB 2IOTA 1ZPBA 4P00A 2FZZA 3ZZ6A 5F8ZA 1HRTH 2VWNA 1BRBE 1MTSA 3RU4E 4FU9A 3LU9B 4XE4A 3ZVFA 1L1NA 3CS0A 1ANBA 1C5QA 3ZZ8A 5DP8A 1GPZA 5FPYA 2M2AA 2OC0A 5J4SA 1B7XB 2CXVA 1SGTA 2F91A 2BYAX 3MH5A 2AGIX 2G51A 3N7OA 1JIMA 5JBAS 2H1UA 5CMXH 3TGKE 1CBWC 1GI0A 1HYLA 2G81E 1WAYB 1NTPA 1YGCH 1ZJDA 4SGBE 3UR9A 1JBUH 6GCHG 4CRFA 4X8UH 4MLFB 3A7WA 4NFFA 1YP9A 4FVDA 4OGXA 4UFFH 3GY4A 1OPHB 1ESTA 1C5UA 1ZYOA 3SU6A 2BLOA 2HLDD 3OE7D 1QCPA 2FTMA 1COWD 3GCNA 2G00A 3P8NA 2YMSC 3RMOH 1BJVA 1GI2A 2O8MA 3U98H 3GCHB 4I8LA 1L2EA 1YWUA 3A7VA 2Q1JA 4MVNA 3A8DA 2AEIH 3I77A 3AK5A 4FUEA 4K2YA 4O3UA 1GBCA 1CHOG 4CRAA 2RCEA 1GMCF 4BTTB 1AWHB 1EP6A 1MU8B 1O3DA 4GUXA 3SGQE 1V2JT 4DCDA 1QHRB 1HAGE 3A8AA 3UNRA 3UNSA 1O3HA 2WPMS 2WPJS 4INLA 1O5FH 5GXPA 1RTLA 2BDBA 3MFJA 5GPIB 4MPVA 1O2KA 2A7JA 2F83A 3DT0H 3RXAA 4D7FA 2CV3A 1TWXB 4E06H 2JETC 4KGAA 1THSH 1ZHMA 5HGGA 2FOEA 1GHAG 2ZO3H 3T25A 3EDXB 3F0PA 5FPTA 1GBLA 3VGCC 3O8DA 2ANYA 4UFEH 2P95A 1DE7H 3BIUH 1TNIA 1IHSH 1FXYA 1A5HA 1GI7B 3RC5A 4Z1MD 3GY2A 1TALA 1PQ5A 1TX7A 1YBWA 1L4ZA 2VIWA 5EJ1A 1TNKA 1Q3XA 4HG6A 4ACAA 4B6FA 2OP9A 4BTIB 1QJ7B 2V6NA 1PFXC 2WPLS 3FZZA 4B2CA 1DLEA 2K0QA 5DKMA 2TGAA 2Y81A 5E2PA 1ZHPA 2HNTC 3KQ5A 3W95A 4FVBA 5C17A 2QN5T 1O35A 3VG8A 4CH2B 1W0KD 1C2EA 2C8XB 5KECA 5FCKA 3DHKH 1SB1H 1TPAE 7KMEH 1W8BH 1LVMA 1HUTH 3SUEA 5GIBA 2SGDE 3KCGH 2L74A 2WSSD 4JYTA 2R2WU 2ZFTA 4WF8A 2A2XH 1HAYB 3ZZ7A 3PYHA
chains in the Genus database with same CATH topology
3A82A 1LVOA 1HAOH 2PKSB 1Z1IA 2FYRA 2OXSA 1K1NA 1YF4A 6CHAB 3VB7A 3QTVH 2A7HA 2VH6A 3BG4C 1H9LB 4OS7A 1YLCA 1J14A 1GG6C 3ZZ4A 4NWLA 5K0HA 1BTWA 5DP5A 4BAOB 1C1PA 3B8JA 1GJ6A 3KL6A 5HXFA 1HAIH 2FEQH 4K60A 3OYPA 1XKBC 1B5GH 1C5ZB 3URDA 1O3NA 1OWKA 1GHWH 3MU1A 2XW9A 1FDPA 1C5WB 5DP4A 3V12A 4XSKU 1Z1JA 4BNRA 1O2OA 3OY5U 2B0FA 2YNAA 4B76A 1ZRBA 3A81A 1O3KA 4CHAB 1SGQE 1GBTA 3CS7A 5F8TA 2OINA 4Z0KA 1AB9B 3LC5A 5GDSH 1BT7A 1AE8H 1C2HA 1O36A 1XVMA 3B23B 4Y8ZA 1CT0E 3ATLA 3NKKA 1H8DH 3RM0H 4X2WA 1MD7A 1D6WA 1OWDA 1SGNE 1V2KT 1ZGIA 2VWOA 3RM2H 1TGSZ 2C4FH 2CN0H 3GOVB 5DP7A 5HM2A 4XBBA 1QL7A 4UFGH 1LHFH 2BVRH 1FAKH 1J15A 1VCWA 1TYNA 3STIA 3K6YA 2H9TH 3VFEA 3T26A 2HPPH 4AB9A 1AE5A 3QGJA 4J2YB 1RGQA 5EG4A 3S7KB 5E0JA 1FAXA 3ELAH 1YPEH 3BEUA 1C5MD 1MZAA 1WCZA 5L2YH 3FP8E 3M61U 1BZXE 2ZHDA 4JZEH 2SGEE 1WOFA 1MH0A 5H4IB 2F9PA 4TPYA 1A61H 1ZMJA 1O2WA 5ESTE 5DGJA 3UREA 1WV7H 3S7HB 3PROA 3TJVA 1TQ7B 2ZHQH 4Y7AA 1SLUB 4GCHG 1Y5AT 1AZ8A 2KAIA 2VIVA 5LPEA 1O2LA 3U1JB 3P8GA 2ZCLP 4Y8XA 2ILNA 3SN8A 3GYLB 1C1RA 2FX4A 1GBFA 3SU1A 1HXEH 2W5EA 2A4QA 1E0FD 3T29A 4YOIA 1GBAA 1BCUH 3PV4A 5C67A 1GL0E 2H9EH 5C2ZA 2ASUB 2DE8A 1LPGB 2V3HH 1GHZA 3OTJE 1HPGA 1SMFE 4YOJA 4JYVH 1O5AB 1FQ3A 1A4WH 5TCAA 3SJKA 3H7OA 1TPSA 4ABDA 3KQBA 3RXBA 2PGBB 1QB6A 1QB9A 4YESB 4ZUHA 4AGKA 1W7GH 2BY9X 2EI6A 2TIOA 1HV7A 1VGCB 2ALVA 3SV6A 1KXCA 2G8TA 4E7RG 4UD9H 4ZKOU 2Y7XA 1Y59T 4IC6A 1YPLH 2A45B 2Z9KA 1TGNA 3LGVA 1UK3A 1PYTD 4VGCB 2PKSC 2OQ5A 4X0WU 2XNIA 1AHTH 4LK4A 4ISOA 3Q3YA 5F03A 1XVOA 1SGIB 4DJZB 3RU4T 3GDUA 4CH8B 2W26A 4BAMB 2SNVA 2B5TB 1QY6A 1GMHF 3A85A 3A87A 2BDHA 4FUJA 1EJAA 3M35A 1E34B 2BD4A 1NS3A 1O2GH 2FI3E 1P2MA 5A8ZA 4ABHA 5A0CA 1QL8A 1VCPA 9ESTA 3Q3XA 1OWHA 1EZUC 3K65B 1ELBA 2ZWLH 4E7NA 1PPBH 4YZUA 3RP2A 1IQEA 2BD9A 2ZA5A 1ACBE 1DOJA 4MG3A 4NA7A 4CHAC 1TBZH 2IJOB 3SV9A 1AB9C 1VJ9U 3R3GB 2B9LA 4IC5A 1BTYA 1S83A 2J92A 1W3CA 2ZCHP 1QBOA 4NIYA 8GCHF 4X6PA 1TLDA 1DX5M 4AB8A 4Y10E 2KAIB 3IG6B 5ETXA 1Z6JH 2ZG0H 5EQQA 3GCOA 2ZHFH 1E35B 1NFUA 3UPEA 1YPJH 1IHTH 3IWMA 3LH1A 1UK2A 3F9EA 1C1NA 2QXGA 1AFQC 5ESBA 1TE0A 1BHXF 1EJNA 3LGIA 1CU1A 1IQKA 5C5NA 1P2JA 3G01A 2UWOA 2UWLA 1ANEA 1UCYK 2QC2A 3MMGA 1GDQA 3ZVAA 2XC0A 3VB3A 1P04A 2VIDA 1NC6A 2HPQH 1FIZA 2J4IA 4MPXA 1NU9A 3MYWA 1CE5A 1KLTA 2GZ7A 2FP7B 1QQUA 2GMTB 2Q6GA 3UFAA 3S9BA 1S82A 1FIWA 1DWDH 1UJ1A 3SQHE 3LOXA 2BZAA 3E0PB 1J16A 1TNJA 4UEHH 2FOMB 1KXAA 4K1EA 1FPHH 1EPTB 1NU7B 1SGCA 2JKHA 4FUGA 2FPZA 2BD2A 1P10A 5E0HA 1ARBA 1AKSB 2ZDNA 1MTUA 3LGUA 4BAQB 5JPMH 3S0NA 1XUHA 3W94A 1XUIA 7ESTE 2W7UA 2WYGA 3NCLA 4F4OC 2A0QB 3SJIA 3EA7A 1OWJA 3E1XB 3NPSA 4CRDA 1LCYA 3QGNB 2HALA 1D3DB 2AMQA 2Z6BD 4XBDA 2EI7A 3M3VA 1T8LA 2Q6DA 1J9CH 1C5VA 1PQAA 2H9HA 2FS9A 2VJ1A 1O2PA 1T31A 1FI8A 1UHBB 1KTSB 4K5ZA 1P3EA 1BTHH 5K7RA 1LVYA 1O39A 1VCQA 1RS0A 1MUEB 1Z8GA 1K28D 3UUZA 1GBJA 2CMYA 4GPGA 2J2UA 1SVPA 2CHAB 1OS8A 3BTME 1VZQH 1T7CA 1MKXK 1C5PA 3QX5H 1V2WT 2ZGJA 1VGCC 2H5CA 4WMDA 1TFXA 4YLUA 1BRAA 3NWUA 5EODA 4B2AA 3O8RA 1JMOH 1O32A 3RMMH 3ZYEA 4A1TA 1EUFA 4VGCC 4Y0ZE 2HNTE 1LHCH 2Z94A 5C5OA 1Y5BT 3SU2A 4HGCA 3PTNA 4U32A 5FCRA 3UWIA 3HGPA 1EZSC 3RU4D 2BQ6B 1DVAH 1W0ZU 3RLWH 4CR9A 5EXNA 5GCHF 1K1JA 1O34A 1AUTC 3PLBA 4AFQA 1N6YA 5FX6A 4BANB 3PLPA 1AZZA 1O3AA 3MHWU 3SUFA 3U8RH 2BD5A 3GICB 1LVBA 1MKWK 4GHTA 1GJAB 1O3BA 3E90B 3BSQA 3HK6B 1ID5H 1EATA 5PTPA 2Z3CA 2R3UA 1A7SA 1Z7KA 3T5FH 2OLGA 3ESTA 4X2YA 1GMHG 2QXHA 2ODYB 2GV7A 3ENSB 2ZFRH 1PPFE 2VGCB 1C4Y2 1GJ5H 1BA8B 1F0SA 1W10U 4ISIH 1P05A 3TLOA 2FYQA 3UY9A 2FMJA 3R0FA 3UNQA 2FDAA 1G30B 2QAAA 1P09A 3LJOA 1PPZA 3MO6A 3SO3A 3IITA 1TRYA 2JH5D 3LONA 2Y7ZA 4AFUA 4AX9H 4MTBA 1IQHA 1GCDA 1OP8A 2TRMA 4AGJA 4BTUB 4LZ4B 1WTHD 1MAYA 1V3XA 1HAVA 1SHHB 1ETSH 5F8XA 2W3KA 1K1LA 4YLQH 1HBTH 1DXPA 3VEQB 1G3BA 2K1QA 1V2NT 1WBGB 1NFWA 2V3OH 1CSOE 1EZXC 1Z71A 1M9UA 4DT7B 1C5OH 1E36B 1TPOA 1QQ4A 4ABBA 3SUDA 1AVWA 3SNEA 3DUXH 3MU4A 1GWAA 3M37A 3SJ8A 1LPZB 4ZXXH 1C4U2 1KYNA 2P3UB 2QXIA 4H42U 1GHBF 3MH4A 2WUBA 1ANCA 1CGHA 4INHA 1KDQA 2BY6X 2VIPA 4UFDH 1Y3UA 4DY7B 2ZU4A 3HPTB 5J4QA 1VR1H 4ZMAH 1T4VH 2WPKS 4MNYA 3M3SA 1SGFA 2STAE 1IQJA 4DW2U 1V2MT 1C1TA 2WPHS 3T62A 8KME2 1EPTC 1GBHA 1S0RA 3TGIE 3A7XA 3SQEE 2SFAA 4NSVA 3RXGA 3TH4H 3QLPH 1QRWA 1BB0B 1QRZA 1FN8A 1YM0A 4KTSA 5IYTA 4OGYA 2AGGX 3RXKA 4AFZA 1VITF 1FONA 1UCYE 1C1OA 4DOQA 3VXEH 1ZZZA 3AAVA 2H5DA 3EA9A 3PO1B 3SU4A 3URCA 5JB9S 2Y5GA 2R3YA 3ZZ9A 1IQGA 2AIPA 1KIGH 2C8WB 1C1QA 1TBQH 2VU8E 3ATWA 3E16B 3RXHA 1NROH 1HAPH 4I8KA 3ATIA 4MNWA 3ZV9A 4ABJA 4K8BA 3SU5A 1C2IA 1HNEE 1EZQA 1TX8A 3S69A 2CHAC 2PSYA 1PPGE 3ZYDA 1V2PT 3AVZA 2FI4E 2Z9LA 2ZDKA 3VPKA 3Q00A 4CR5A 4D9RA 1P2KA 4D76A 4A92A 1F0TA 2GT7A 3E8LA 1Y5UT 4X6MA 2PKAA 3UOUA 1C2DA 2TBSA 4F49A 1A0LA 4DG4A 7GCHG 2M5TA 4CREA 2TGTA 1ESBA 1PPEE 1Y3WA 1MTVA 3SI3H 1IQIA 1GMDF 1MMJN 1GI3A 3PMBB 5EGMA 2GGVB 3BF6H 2FOCA 1V2QT 2IPHA 2VVVA 1DUEA 4CRGA 5T6FA 1DANH 6ESTA 3F9GA 4TWWA 1C1VH 1YLDA 1AU8A 1HDTH 1T8MA 2QV1A 3GYMA 1O2JA 1FLEE 3BIVH 1TBRH 1CQQA 1UTPA 4X2XA 5EPYA 2SNWA 2F9BH 1FNIA 5GCHG 4B73A 2PSXA 1C5RA 1RJXB 3MTYA 2XCNA 2BDCA 2XBYA 4H6TA 1O37A 2AIQA 4KTCA 4ZH8A 3BG8A 1KDQB 5FHTA 1AI8H 2J38A 1C1SA 1GI8B 3MH7A 1DSUA 3NUMA 1DSTA 4Y71A 4U2WA 2XBXA 2OQUA 4OS1A 1ZMNA 2C3SA 1SBWA 3A84A 2ZTZA 4JZ1A 3OU0A 1P2NA 1T8NA 3D62A 1O30A 2CF8H 2ZC9H 4RSPA 3SJ9A 3EGKH 4D7GA 3O8CA 1QA7A 1O2YA 1ZPZA 1MZDA 4Y0YE 1P11E 8LPRA 2G5NA 1A3BH 1BBRK 2AERH 2ZGHA 3UR6A 1SQTA 1TA6A 1O38A 1ZSJA 4MNVA 1OP2A 1HAHH 1C2MA 2A4RA 1Q2WA 4ZHMU 1G32B 5AFZH 1BTZA 1S5SA 2JH6D 1TGCA 1S84A 3GDVA 1RIWB 1TMTH 1O3FA 3SV2H 2PLXA 2ZU3A 1J17T 1FUJA 2FESH 4JZIA 2XBWA 5A09A 3RXOA 1L1JA 3MOCA 3LGTA 1BMMH 2RG3A 2VINA 1GBMA 1NPMA 3BN9A 3FFGA 1P2IA 1SI5H 2AYWA 1ESAA 2GV6A 2LPRA 1P02A 4OS6A 1GBBA 1F5KU 1C5SA 3GCHC 2FX6A 1RFNA 2Y5FA 3TJNA 2C90B 3RLYH 4I31A 1W14U 3U9AH 1GBEA 8ESTE 3BTGE 2UUKB 1ZTJA 1TMBH 1D6RA 1P2QA 3ZVDA 1PPCE 3T27A 1O2HA 5A8YA 1SFQB 3LIWA 3PO1C 1H1BA 3E0NB 1JOUB 3TIUA 3ITIA 7LPRA 4M7GA 1ARCA 4LOYH 2FLRH 2ZHWH 4A6LA 1SGPE 5F6MA 4WWYA 1UTLM 1Y8TA 4XOJA 3S9CA 3FP6E 1D3QB 1N6XA 1V6DA 1CA0B 4NIVA 5BPEA 3U8TH 1OYTH 2WUCA 4I7YH 2WV4A 1GMCG 1XX9A 5FBIA 1LQDB 4RKJB 1TABE 4I33A 2GKVE 4IMZA 1BTPA 2XCFA 1YCPH 2ZQ2A 1AO5A 1NY22 2BMGB 1GJ4H 1D3PB 4OS2A 4DGJA 1ELTA 1QJ6B 2BTCE 3QWCH 1AVXA 4IN1A 3SGBE 3SV8A 2VVUA 1YPMH 5JBBS 3CP7A 3EE0B 2P16A 3VB5A 2G5VA 3D49H 1KY9A 1P57B 3BTEE 3ZVEA 4FUBA 4WVPE 1AN1E 2FXRA 1O2QA 1HIAA 4IBLH 1GDNA 1GDUA 3M7TA 2FI5E 1UVPA 4NFEA 3RXMA 1LHGH 1NRPH 3LH3A 4DIIH 3BTKE 3F68H 4CRBA 3E3TA 1RRKA 3AW0A 1C2GA 2G55A 4A7IB 5CE1A 4Q2KA 1OYQA 1WSSH 2ZDAH 2AMPA 1K21H 1EOJA 3M5NA 3RXFA 2YOLA 1XUKA 4MNXA 2VB0A 2BM2A 1GGDB 1IAUA 2Z3EA 6CHAC 4I8GA 1THPB 2OD3B 2J34A 3ATKA 4X6NA 1KXFA 4H6SB 2J94A 1O3GA 1QIXB 1XM1A 4OS4A 5DP6A 5DO4H 1G3CA 4DVAU 1O3OA 3KNXA 1O0DH 2BB4A 2D26C 1KXBA 1ELDE 5DP3A 1B0FA 4FUIA 5AHGH 2BZ6H 1OX1A 3STJA 2ALPA 2ZECA 2XC5A 2Q6FA 1S6FA 2SGFE 1MTNB 1NM6A 3GCTF 3M5OA 4GVUA 2QA9E 3RXJA 1V2UT 1DUAA 1N8OB 5C20A 1HCGA 1MU6B 3RXVA 1A3EH 3F9HA 1ZTKA 1ETRH 4OS5A 2BXTH 4NG9H 4Y76A 4BAKB 2XRCA 4Q7XA 3Q77A 2OC1A 4WH6A 1IQLA 1CT4E 2BLQA 2JH0D 1XXFA 5C1YA 4B71A 2ZQ1A 1SLWB 1FY5A 1P9UA 2NU2E 1DXWA 1GVLA 1Z8RA 1C2KA 2BD8A 2PFEA 2AMDA 2ESTE 3BTQE 2F9NA 4HZHA 4Y79A 4IN2A 2P8OB 1GI9B 1H8IH 1HFDA 1TNGA 3TVJB 1E38B 4YOGA 4LZ1H 2A31A 1C5YB 1H9IE 4AG2A 2C8ZB 1AFEH 2ZKSA 1AVGH 3HKJB 1GJCB 1DLKB 2RA3A 3UQVA 4Y6DA 4BAHB 3H7TA 3V7TA 1OWEA 3M3TA 4ABIA 4B74A 1AUJA 1EJMA 3ODFA 3L3TA 4WXIA 1BBRE 2GVFA 4D8NA 2BDAA 2QCYA 1MTWA 4Z6AH 4WMFA 4NGAH 1Y3VA 2BHGA 4TWYA 1TX6A 1T4UH 1BDAA 2ODPA 3BTFE 3LDXH 1C1WH 1F0UA 1CBWB 2BD3A 1G2LA 3VB6A 1DM4B 3HKIB 2HNTF 3RXSA 1CA0C 2VWMA 3D23A 2WYJA 1GI1A 1EAIA 4X8SH 2VVCA 3B9FH 3BEFB 3A7ZA 1P01A 1V2ST 1O3CA 2J95A 1XXDA 2OTVA 1CHOF 2A4OA 1TGTA 2ZIQH 1BOQA 4ISLA 1EX3A 1IOEA 1K1OA 2G4UA 1NZQH 4JZDH 4ASHA 5A0BA 1A5GH 2NU3E 1JIRA 1FMGA 3M7UA 3FVFB 5C1XA 4Q80A 3SZNA 1F2SE