2QF5A

High resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (monoclinic form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
158
Chain Sequence
ATKTLAADVIMRSPVSWKQELTLDAGRSKGASENMLAIANGGLIGSVSKVEENSTIVNLLTNTENADKISVKIQHGSTTIYGIIIGYDKENDVLKISQLNSNSDISAGDKVTTGGLGNFNVADIPVGEVVATTHSREVTVKLSADTHNVDVIELVGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution Structure of the Major Periplasmic Domain from the Cell Shape-determining Filament MreC.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural protein
molecule keywords Cell shape determining protein MreC
total genus 31
structure length 158
sequence length 163
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qf5A01
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qf5A02
2QF5A 2J5UA 2QF4A
chains in the Genus database with same CATH superfamily
4JZDH 1GVZA 1TOCB 5CHBA 3ZZCA 1B5GH 1UK4A 2W6ID 5AF9H 2STBE 1O32A 1V2RT 3O8CA 3VB3A 1BMFD 5CHAB 1ZRBA 3WW7A 3V3MA 5A09A 2K8IA 3SU5A 3U8RH 1S6LA 2CN0H 3K65B 3SHCH 1RTKA 4JK5A 1SMFE 1DE7H 3UY9A 2YMSD 3QN7A 4YM9A 3A8BA 3BEFB 1YPLH 1W0YH 5HXFA 1HDTH 1QFKH 2ZDAH 4HGCA 1ELVA 4BAHB 1A3BH 1MU6B 2BLQA 1GJ8B 2GVFA 3RXFA 4CRDA 1YPMH 1FPCH 3HGNA 2KCYA 1O3KA 1GI8B 3FZZA 3KYGA 3ZZ6A 3U69H 2G55A 2C8ZB 3FP8E 2Q1JA 1C5PA 1GHAG 1EAIA 4GCHG 1GCTC 2XCNA 1N6YA 2VWOA 1A61H 2AGEX 4AG1A 5PTPA 2A2XH 2GCTB 3TGJE 1ELDE 1VCQA 4DOQA 7ESTE 3F9HA 1A5GH 3SQHE 1EAXA 4DVAU 2ULLA 1C5MD 4O03A 1DWCH 1TA6A 1GHWH 1ESBA 1QJ6B 3PLPA 3KF2A 2Q6DA 2EI7A 3RXPA 1O2LA 1V2OT 1BDAA 4CRGA 1CA0B 1XXFA 1GL0E 1TRYA 2C90B 2Z9KA 1QBOA 4JCNA 2CF8H 3VXFH 7GCHG 5JB8S 3S9BA 1AWHB 4Z0KA 4YTAA 2QIQA 4ZKNU 3AW0A 1PYTC 1GDQA 1WDIA 4F49A 1C1QA 4E7RG 4AFUA 4BAQB 2WPDD 2Z94A 2O8TA 5CDFE 3UWIA 2OC0A 3SUDA 5GIBA 4OM9A 1GHAF 4GCHF 2AGIX 3T62A 2B5TB 4I7YH 1W12U 2HNTC 1LO6A 1ZMNA 5EXLA 1GG6B 1K22H 1YCPK 2GV7A 3TH4H 2BMGB 2VVVA 4FVDA 1GJ9B 3NXPA 2QXGA 3F2GA 1GI1A 1EB1H 1OYQA 1HFDA 1HXFH 5DN6D 1ZMLA 1LVOA 4LOYH 2ZU1A 3FN8A 4IC6A 4D9RA 1JBUH 1C2FA 4NFEA 2FI5E 1CHGA 3Q00A 2AIPA 1DUEA 3QGNB 4MDSA 1O2HA 2ZECA 1UCYH 2A4GA 4U2WA 2Q6GA 2BY6X 1J16A 1PFXC 2WYGA 1KMHB 1P2JA 4A1XA 4ABHA 4DT4A 1SGDE 2ZHWH 2FZZA 1O35A 4DGJA 1YPHE 1EOLA 1NS3A 3HATH 3DFLA 1EUFA 2VWNA 1C4V2 1BTWA 4AFQA 3A89A 3DFJA 1V2KT 1TMTH 3GCTG 3AASA 3IWMA 5K7RA 1MUEB 1ZGIA 1YPHC 1FMGA 2ZHDA 1AIXH 1L0ZA 2R2MB 2G5VA 3F9GA 3URDA 2XCFA 1ZYOA 4FXGH 3PWBA 1Y3WA 3BN9A 4K8BA 2G4UA 1FAKH 5GCHF 2G4TA 1TMUH 5TJXA 1TNGA 4CH8B 3STIA 1OWDA 3L6PA 1YWUA 1MQ6A 3SGBE 3U1JB 1RIWB 2FYQA 1TQ7B 3LGTA 1TB6H 2ANYA 3NCLA 1S6HA 5E0JA 5EJ1A 3ZIAD 1SR5C 2ZO3H 2ZGBH 1MABB 3A7TA 3ZZ5A 2B0FA 1Y59T 4ESTE 2XWBI 4YESB 4BXWA 3QUMP 1H4WA 1OX1A 4OS7A 2ZIQH 2BVRH 4WF8A 5A2MH 2P94A 2RA0A 2HNTE 2AMPA 4JZ1A 2GJGA 3PYHA 1C2KA 3QZQA 5EPYA 3URCA 1UVUH 1DWEH 2BDHA 4FETA 2P95A 3F6UH 1K1IA 1W11U 2PSYA 3A83A 5GNDA 2GCHG 1GI2A 4JZEH 1NPMA 1YPEH 1EAUA 1DOJA 1TPAE 1BZXE 4E05H 1E1QD 1VITH 3MWIU 2KCAA 2M5TA 1GBAA 4O9VA 2O8UA 3RXHA 2ZG0H 2QN5T 3EQ0H 2VWLA 5C1UA 1K28D 2EQNA 2SNWA 1EPTA 1ZGVA 1MKXH 3P8GA 1IQLA 3G01A 3W1EA 5C0TA 5FL7D 1F0UA 4OS2A 3V13A 1AE5A 1ZSKA 5HGGA 1OSSA 5ESTE 4I8HA 4AYYB 1OYTH 1XUJA 2PKSB 1LHFH 1A2CH 1NFWA 5JB9S 3K6YA 1INCA 1HRTH 2GP9B 1G30B 2FOGA 3RXSA 2AMQA 4X0WU 1O3BA 2NU0E 1CE5A 1FN8A 1TGTA 1QURH 3BG4C 4SGAE 2VIWA 1SOTA 3ZZ3A 1GCTB 1FY5A 3LPRA 1N6XA 5FAHA 1IQEA 1GMDG 2K0QA 2QAAA 3FAOA 1MAYA 3A86A 4BTTB 3PLKA 3LH3A 5E2OA 4O3TA 1BTZA 4GPGA 3A88A 3BTTE 4KELA 2CGAA 1HJ9A 6LPRA 4TSFD 4D9QA 4DW2U 2BVSH 4TYDA 3ENSB 1Y3UA 2QC2A 4ZHAA 2G5NA 4IBLH 3RM2H 3AW1A 2PHBA 5CHAC 2O8LA 2WUBA 3P70B 2DE8A 5EODA 3NZIA 1G3DA 2BDYA 2FDAA 3EE7A 3ZZ9A 2ZGXH 2I6SA 1TBQH 2YOLA 3TNTA 1H1BA 1VGCC 3MYWA 1AUJA 3PMBB 1QB6A 4BAOB 2FX6A 4NZQA 1GMHG 4AORA 2QA9E 2BB4A 4P02A 2BX4A 1CT4E 1S82A 3TJOA 1D3PB 3ESTA 4BAMB 3CNRA 2VNTA 2CHAC 1AFQC 1SLVB 2QF5A 3FANA 5KECA 2BOHB 1P12E 4ASHA 1GMHF 5JDUB 5DPAA 4YLUA 1PPZA 1IQHA 2ZFQH 5I46H 3LKWA 2J4IA 1HAVA 1ETTH 1DITH 4ISLA 4Y0ZE 1O2XA 2O8MA 2AIQA 1KSNA 3EA7A 1XUGA 1UTLM 4XBDA 1GBFA 1IQNA 1AI8H 1WXRA 3DCLA 3T28A 5FBIA 1GBLA 3N99A 5C67A 3VB4A 2HPQH 2F9BH 4X6MA 2F3CE 2FM2A 1FY1A 1O2JA 1AGJA 1IQJA 2KAIB 3M5LA 3AVZA 3M3SA 3KQDA 2FOAA 4LK4A 1O3CA 1YY3A 2WV9A 3BTHE 4P00A 1OOKB 1ELTA 2B9LA 2GCHF 3SU6A 4AG2A 5JBAS 3LGWA 1C2EA 1O5AB 2A31A 3T25A 2HPPH 1DXPA 1O38A 1FZZA 4U32A 1V2UT 1DWDH 2GDEH 1N8OB 3SV8A 3KEEA 1P10A 3P8NA 3E8LA 1DWBH 5AHGH 5DG6A 1T31A 2H5CA 3LIWA 3BIUH 3GOVB 3RC6A 3S0NA 2ZCHP 2GZ8A 1HV7A 1LMWB 3LGVA 2P93A 1H8HD 5EPNA 2BD4A 3NPSA 1GJ5H 5GJ4B 1LCYA 3KHVA 1IHSH 4INHA 8GCHF 4LZ4B 1F0SA 1NRSH 3TLOA 1PQ7A 4ASUD 3PB1E 2NU2E 2FP7B 1UHBA 6GCHG 2F9NA 2FPZA 1OP0A 2ZU3A 2GZ7A 3GCNA 4ABBA 1O33A 2WPJS 3ODDA 4BNRA 4ZCNA 4RKOB 1UVSH 2ZQ2A 1O2UA 2P3FH 4A92A 4Y7BA 1HNEE 3SV9A 3HK3B 1O3PB 3M37A 1QL7A 2QCYA 3ZVEA 3TGKE 4X1NU 2BTCE 1T8OA 1T4UH 4AGKA 5E0HA 1C5OH 1DVAH 2TRMA 3QDZB 5C2ZA 1HGTH 3RXUA 1P57B 2F91A 3MU4A 4XE4A 1O3EA 4E06H 1Z8IB 1PPHE 2GTBA 3A7YA 1P06A 1GDUA 4NCYA 2WYJA 1O2NA 1QJ1B 4MNVA 4MPWA 4Y8YA 3NWUA 4CRBA 1ANBA 3UPEA 1JXPA 2OC8A 1FPHH 1T4VH 2F83A 4IW4E 1H9IE 1YKTA 1C2GA 4CBNA 4X8VH 1DLKB 1O3HA 3F2FA 1WBGB 3BTFE 3LGIA 3S9CA 3ZZ4A 4I31A 4FUJA 5KGOA 1SGPE 1UJ1A 3GCTF 2HVXA 8KME2 3SU1A 1CQQA 3M7UA 1C5UA 1HAIH 1O5CB 5FBEA 1S0RA 2VIDA 3SHAH 5E2PA 1TPPA 3RLYH 3MU5A 1FN6A 1UTNA 1TA2A 1OWJA 4AX9H 2JDID 3CENA 1W0ZU 4ACBA 1RD3B 3MTYA 1WQVH 4B2CA 4X2YA 1TX8A 4M9FA 1AMHA 2BD8A 3MOCA 1SPJA 4WH8A 3P92A 4A5TS 2IPQX 2UUYA 1WOFA 2WSSD 4JMYA 4ACAA 5EOKA 4UONA 5AFYH 4IN1A 3ZVCA 1F5RA 2I6QA 4YOJA 2R2WU 1VCWA 2SNVA 2VGCB 1S84A 1KLJH 2FO9A 2PGBB 2TIOA 4Y0YE 1RTFB 1F5LA 2A45B 4ZXYH 1V2VT 2CF9H 1UCYK 1L2EA 3BTME 2G52A 4FU9A 5EJZA 1C1WH 1BMMH 2R0LA 4K8YA 1ELCA 1XUFA 1YPJH 2VB0A 1ELEE 2CK3D 2AMDA 2LNCA 4Q4LA 1CA0C 1SGRE 2XNIA 3JZ2B 3S7HB 3SU2A 3SQEE 1HAHH 2Y7ZA 1FAXA 4ZAEA 1CO7E 1LTOA 3TVJB 1G37A 2QXHA 1C5VA 1TGCA 2ANMH 4Y8XA 2PKSC 2J9NA 5EJLA 4MG3A 1THSH 1N1LA 1W13U 5C1XA 1XVMA 1NRQH 2ASUB 1T32A 2F9VA 1ABIH 3A7VA 3KGPA 4DIIH 4IC5A 3N7EA 3ZVAA 1WV7H 3MU8A 3RXOA 1TPSA 2ZDKA 1Y5UT 2PW8H 5HMAA 3GYLB 5T1VA 3EA8A 1KXEA 3A7ZA 1UMAH 1UTOA 2ZZUH 1PPFE 3FZDA 1EZUC 1V2JT 1F7ZA 3SNDA 7LPRA 1P9SA 1PQ5A 2ZU5A 2ODQA 3FFGA 1GBTA 3UIRA 2VJ1A 1J8AA 2IPHA 2A7HA 1FY3A 1FX0B 1DM4B 3KQBA 1W10U 4B1TA 4ZKOU 2JETB 3STJA 3F1SB 5DP4A 3SJIA 1AVWA 3OAAD 4GVUA 2TGTA 4K2YA 2FYRA 2J97A 1AZ8A 1B0FA 5E8EH 1EJAA 2A5AA 2J2UA 1P04A 4MNXA 2ZHEH 4RI0A 2JH6D 3LH1A 4D7FA 4B6EA 1C5SA 1O3GA 1AVGH 5SGAE 1O0DH 2ZDNA 1TNKA 1SC8U 3E91A 3SJOA 1PYTD 1YLCA 3RDZA 1AUTC 1MTVA 4J1YA 5FX5A 4ISIH 1OWIA 1P3CA 1G3BA 1UTJA 1QHRB 3PV4A 3UNRA 4NIYA 1P09A 2GD4B 3PO1C 2RG3A 3E0NB 1SGFA 4XSKU 5BPEA 2XBXA 2ZHQH 1HAXB 3SUGA 1FONA 4ABFA 1DICA 2EY4C 4Q80A 3GY7A 1EJNA 2EC9H 1E0FD 2UWLA 3OTJE 2G81E 1O3FA 3D23A 1C5YB 1G9IE 4X1RU 4PROA 4TWWA 2ZPRA 1AO5A 4JYVH 5BRRE 1SLXB 1E35B 3C1KA 1GI6A 4ISNA 1ZSJA 1SQOA 2LPRA 1P2OA 3RXBA 1NROH 2GV6A 1GBBA 1ELBA 1AE8H 1CBWC 3TJUA 3A8CA 1YM0A 2GT7A 2IJOB 3QK1A 1AFEH 3H09A 2HALA 2NU3E 4WWYA 4CR5A 1LPKB 2OCVB 4Y8ZA 1ZHRA 1UHBB 3CS0A 3OX7U 4LZ1H 4YO9A 1RIWC 2HWLB 1RFNA 3PM3A 1O3OA 3VEQB 2HVYB 3SUEA 1O2TA 2FI4E 5L6NH 1AVXA 2PKAB 4K1TA 4ZROA 2BVXH 1O2QA 4AFSA 5EIYA 3K9XB 1AHTH 4OGYA 1SGYE 3EYDA 1EPTC 1E38B 1L4ZA 2Z9IA 1JMOH 2WHXA 4TPYA 1BOQA 2ZEBA 3AAUA 2AGGX 1GPZA 2LP6A 1VCPA 1HBTH 4ZHMU 3SBKA 1HB0B 1OKXA 3RU4T 4WH6A 4X1SU 1C1VH 1YBWA 1G32B 1O2GH 3I29A 3MFJA 5FPTA 1MCTA 1P2MA 2XC4A 1J17T 3H7TA 1L4DA 2XXLA 1QRWA 2ZU4A 4NGAH 3QZRA 1W0JD 2RDEA 2OBOA 2KX4A 1ZHPA 2RDLA 1O5BB 3OSYA 2UUFB 5DP7A 3SNBA 3SU3A 4WXIA 1SL3A 2ZDLA 2BQWB 3SYJA 1GBHA 1NRRH 3RMOH 1ZTJA 2EA3A 2OC1A 4AYVB 3NKKA 5C17A 3ODFA 1LVBA 1PJPA 2GGVB 1E36B 2GKVE 4ZKRU 1P01A 1TQ0B 1HYLA 1W2KH 3GY3A 3MNSA 3UWJH 2BD7A 2K1QA 1NC6A 5G4BA 1O2IA 1CVWH 1FXYA 1A5HA 2VH6A 3V0XA 1BTPA 1IHTH 1TOMH 1BRBE 1HAVB 4HTCH 5A8YA 1W8BH 4YZUA 2H5DA 2V3OH 3VB7A 3MH6A 1DSUA 1VZQH 4CHAC 4X6PA 2AH4X 1THRH 3RXTA 4BTIB 3KYFA 1O3MA 1SGEE 1IQFA 1MZAA 1D6RA 4DURA 4MVNA 1GJ6A 2OTVA 1HIAB 1NRNH 3LJOA 1Q31A 2FOFA 2M2AA 3GDSA 4RT1A 4BXSA 4GSOA 2UWPA 1TAWA 4NWKA 3MH7A 3TJNA 3O8DA 3ZZBA 2FOBA 1GL1A 1DS2E 2WUCA 1ZJDA 1A0HB 1XKAC 2IOTA 1K1OA 5JBCS 1J9CH 2JH5D 2BD3A 2V6NA 3T5FH 4JK6A 1F5KU 3RXDA 2AFQB 4AOQA 2PP6A 3A84A 3DD2H 1ZOMA 1V2MT 2P8OB 4CBOA 3FVFB 1YLNA 4JZIA 1PPEE 1ZPBA 2BDIA 3E90B 3M7TA 4CHAB 3GYMA 3SGAE 2JJ1D 2ZFFH 2ALVA 2Z6BD 1OXGA 4Q7ZA 2ALPA 1O2RA 2F9OA 1LVYA 5F03A 1D3TB 3BTWE 4ABIA 1GJBB 5E0GA 4B73A 1T8NA 1TGSZ 4AC9A 2RFKC 1V6DA 2BZAA 4WMEA 3WY8A 3UAIC 1BTUA 1ELGA 2ZU2A 3LONA 4FUGA 1OWEA 1TABE 4X8SH 3SW2B 4K5ZA 2BY9X 4YOGA 3SNEA 3LDXH 4WXVA 5B6LA 1AD8H 3RXQA 5DK1A 1QA0A 3F3BA 2ESTE 1TNHA 1QA7A 2XBVA 1CSOE 1QQ4A 1D6WA 1JWTA 1TIOA 4NA7A 3UFAA 1AU8A 3DUXH 3DA9B 3B8JA 2KM0A 1EOJA 4H4FA 1BBRH 2UUJB 2BM2A 2ZDMA 4OS4A 2L6OA 1P3EA 2OLGA 1D4PB 2GZ9A 1WQSA 2ZCKP 3PO1B 4H42U 1DDJA 1GBDA 4Z6AH 2FS8A 3E6PH 4MQAA 2Y7XA 2R3UA 2A0QB 1S6FA 4GHQA 4NIVA 2PUXB 1C9TA 1GI7B 1MZDA 3TU7H 1V2LT 3ZZAA 1K1PA 4LXBH 3A8DA 1LDTT 3ZVGA 1QGFA 1L1NA 4Y76A 1UVPA 1J14A 1GJ4H 5EU8A 2C93B 1SLWB 1SG8B 1QNJA 3RMMH 1SHHB 3BG8A 1AB9B 1NM6A 4Q63A 1FNIA 1ELAA 2VH0A 2WV5A 3TH3H 1AB9C 3VGCC 1SGTA 4DY7B 3MMGA 2ZTYA 1QB9A 1EASA 3S69A 1YF4A 1Q2WA 1OWKA 1B0EA 2ZNKH 5CE1A 1IQGA 2QE7D 2FX4A 1G3CA 1QIXB 2FLRH 1O37A 2NU1E 1K1JA 3TJVA 4ABJA 1SFIA 4BANB 2BD9A 1PPGE 5HM2A 3UR6A 2A4QA 4CRCA 1OS8A 3OEHD 3SNCA 2GCTC 3Q77A 3RXRA 1MMJN 4Z1MD 1GBKA 1X7AC 4ISHH 2YMSC 1FJSA 1P11E 1NU7B 1EP5A 1JRTA 3M5NA 2ZQ1A 4DJZB 3NUMA 3RP2A 1TNIA 3W95A 7GCHF 1EX3A 3MH5A 3RC5A 3CP7A 3F9FA 1BB0B 4Y11E 3BTQE 3TIUA 2FESH 4I8JA 4GHTA 3LU9B 5ETXA 6ESTA 1NRPH 5FPSA 2FOMB 1BTXA 5EQRA 2O9QA 1DY9A 4FUIA 5C5OA 1O39A 4AFZA 1WCZA 5JYIA 3BTGE 1ARCA 2J38A 9ESTA 2FOHA 3TITA 1LKBA 2B8OH 5KEDA 1MKWH 2VWMA 2TBSA 1WTHD 1MBQA 3SO3A 4KGAA 1BUIA 1Z8JB 3OY6U 4DIHH 3RXKA 5LPRA 1Y8TA 1YCPH 3UNQA 1BA8B 4F55A 1S83A 3OYPA 1UTMA 2QF4A 1CGIE 1QQUA 5DP6A 1C5QA 1G36A 3UTUH 2HLDD 3GICB 3E16B 4FUDA 1UW7A 3FP6E 3GCHB 2OP9A 3M3VA 2Q6FA 1TGBA 1W14U 3KIDU 2FTLE 2FODA 1MTWA 3TH2H 3MHWU 1GMCF 3QTVH 2PSXA 5C0UA 2ZHFH 1K21H 2OD3B 2EI6A 4BOHA 2BY8X 1GI0A 5A8XA 1P2IA 4AN7A 3D49H 1C1PA 1AFQB 1SFQB 1V2WT 3OEED 2G51A 1K9OE 1Y5BT 3V7TA 5FCRA 1C5RA 1Q3XA 1IAUA 1IQIA 3L3TA 5EXNA 2QXIA 4H6SB 3ZV9A 2OK5A 1EAWA 3RXIA 3WWFA 3RXLA 1GI4A 1GBEA 5T3HA 1TLDA 5EQQA 1BBRE 3N7DA 1XXDA 1C9PA 2WZQA 1ARBA 5DGJA 1DSTA 1FI8A 3ATKA 4B2AA 3A7WA 1KDQA 4RN6A 3UOPA 1BHXB 1ZZZA 3P95A 3KN2A 4WJG2 5EW1H 4Y79A 2WV4A 2Y82A 1NFYA 1T8LA 3A8AA 4FU8A 3RU4D 1NTPA 5C94A 2YNBA 3S7KB 1ANEA 1SB1H 1DT2A 1GDNA 2XRCA 1THPB 1DANH 4UFGH 3Q3YA 2YNAA 2JKHA 3MO9A 2GT8A 4D76A 1E34B 4UFDH 3KCGH 4K1SA 1A3EH 1XUIA 2J98A 3PROA 5FX6A 4CREA 3K2UA 3A82A 3OY5U 2SGEE 3C27B 2KFWA 2VIVA 1E37B 1RXPA 4OS6A 4X6OA 4YLQH 4UEHH 1E79D 1TX6A 1PPCE 5A0BA 1GHBF 2Z9LA 3A7XA 3ZYDA 2KZ4A 5HKKD 1CHOG 1EKBB 3LT3A 3MI4A 5K0HA 1U6QA 1ESAA 1A0JA 2P3TB 2QXJA 1DUAA 2V7QD 1Y3YA 2V0BA 3HGPA 2CJIA 2ZTZA 1ANDA 1JRSA 1QJ7B 1T8MA 3LC3A 1G2MA 2V3MA 3KQCA 1C5TA 1PQAA 4A1TA 3RXGA 1KYNA 1QY6A 1H9HE 4MPVA 3GY2A 1SHYA 3EE0B 1ZLRA 3RC4A 1TBRH 4KTUA 3ZZ8A 2ZGJA 1SSXA 5AFZH 3GDVA 3PTBA 1EJMA 5F8TA 4KTSA 4X1PU 2Y5HA 2ZCLP 3SI3H 1GHZA 1BCUH 3QGJA 1GGDC 3SUFA 1H8DH 4YOIA 3FKSD 3BIVH 3F68H 1HAGE 1SKYE 1PQ8A 1GI9B 2AHME 2FS9A 4X6NA 2XOKD 1Z71A 3NK8A 1HAOH 3OFND 3VFEA 4XDEA 2A7CA 1NBMD 1BIOA 2A1DB 3KQ5A 4ZUHA 1F0RA 1XVOA 1QBNA 3IG6B 4JYTA 1TX7A 4HG6A 3QLPH 4H6TA 1P9UA 5HYOA 1HAPH 3EA9A 1TFXA 5DO4H 2Y5GA 5DJ7A 4GLYA 4NA9H 5HIYA 2WINI 4X8TH 1O2KA 4X8UH 3FP7E 2BY7X 2J5UA 1KIGH 4O3UA 1S81A 3GY6A 1AN1E 1IOEA 1C2HA 2ZFSA 1K1LA 4IMZA 1Y3XA 2ODPA 2AEIH 1V2PT 1TYNA 4F4OC 2FOEA 3I77A 5EQSA 2A2QH 3TK6A 2VIOA 2BQ6B 1KLTA 2QV1A 4Y10E 2ZTXA 5GDSH 1SGFG 4NFFA 1LPZB 1UCYE 2WPIS 3HKIB 5JPMH 2HGTH 1KXCA 3HKJB 2OQ5A 1WAYB 4XRNA 1BMNH 3OTPA 2D26C 1RGQA 4MLFB 4DCDA 3SNAA 1LQDB 5DSFA 4Y7AA 2RA3A 1UO6A 2P59A 3PTNA 5B6OA 1EATA 1O2ZA 2H9HA 4VGCB 3SJ8A 1YLDA 2A5IA 3VXEH 5J4QA 2H9TH 4TY7A 4WMFA 4XOJA 1ZRKA 1QL9A 2KCOA 2V35A 2W3IA 3VGCB 3VPKA 1GHBG 3GISB 3MQKC 1MU8B 2BX3A 3IITA 1TNLA 2Z3DA 1BJVA 1TWXB 1ZHMA 1EP6A 4JYUH 3P8OA 2BLWA 4QT8C 4B2BA 3SU4A 2BXUH 4WY3A 4HI3A 3EAJA 3T29A 3QX5H 2ZI2H 1KXAA 4TY6A 1D9IA 2C8YB 1UTQA 3A81A 1C5ZB 4DT7B 5F8ZA 2THFB 4B6FA 1EZSC 3MO3A 2Y6TA 2PFEA 1BJUA 4MNWA 3Q3XA 3DSOA 1SLUB 8GCHG 4ABEA 2HNTF 3BTKE 3M7QA 2Z3EA 2YMSB 2L74A 2XYAA 5GCHG 1G2LA 5I25A 2W26A 1QZ8A 1V2ST 2OBQA 3SGQE 3PMJA 3SZNA 1ORFA 3E0PB 1FDPA 1H9LB 3QWCH 3R3GB 1OP8A 1MTSA 3K6ZA 2VIQA 3M5MA 1OP2A 4F48B 1O5GH 1UK3A 2BHGA 1GBMA 2SGQE 7KMEH 2VINA 1O2OA 3MU1A 2ZPQA 2F9UA 1TNJA 4E7NA 3ZV8A 3RXJA 1BT7A 1NU9A 3U98H 3U28C 4X1QU 1V2TT 3BTEE 3U8TH 2XBYA 1S5SA 2CMYA 1A1RA 1C1MA 1BRCE 1L1JA 2A7JA 2W5EA 2R3YA 2OINA 1V2NT 1DX5M 4NSYA 4CR9A 2KAIA 1YPKH 2J92A 3GCOA 1XUHA 3LGYA 1MAXA 3U1IB 1IQKA 2GX4A 2AS9A 4I86A 5J4SA 2ZDVH 3QO6A 4XFQA 2TPIZ 1BBRK 5ABWA 3Q76A 1JOUB 1NZQH 2SGDE 4ZXXH 1TRMA 1O5DH 3T27A 2BDCA 2VVUA 1C1NA 1FV9A 1HLTH 2AERH 1YPGH 2BXTH 1S0QA 4GAWA 1O2SA 1G3EA 1KTTB 4OS1A 4ZH8A 1WUNH 3U9AH 4A1VA 2PR3A 4WMDA 1P2KA 4Q2KA 3BG4B 1DY8A 1COWD 1J15A 2D2DA 1KLIH 2CV3A 2WPKS 1ACBE 2BYAX 1O3NA 4K69A 3TNSA 3M61U 1T7CA 3T2NA 2W7SA 3LC5A 2HRVA 4RT0A 3H7OA 1GI3A 1EFRD 3E3TA 4NIWA 1YCPM 4MPUA 4U30A 1ZTLA 2XC5A 4A7IB 3B23B 1WTGH 3DHKH 4OGXA 4R8TB 4K3JA 2ZWLH 3M36A 1RS0A 3NRLA 3ELAH 1SGNE 4YT6H 4AGJA 1XX9A 2G8TA 2OC7A 5L30H 4GUXA 3UQOA 1P2QA 3ZZ7A 1M9UA 2TGAA 1SGQE 1FY4A 2ZFRH 5JBBS 1K0HA 1QTFA 2RCEA 1NFXA 2ANKH 2PWXA 5EW2H 2GDDA 1WYKA 4I33A 3PWCA 8LPRA 3KQEA 3RU4E 1AKSA 4NIXA 3FOAA 1ABJH 2ZFTA 1TPOA 1XM1A 2D8WA 4B76A 4OS5A 3RXMA 6CHAB 4YXWD 1LQEA 1FLEE 1UK2A 1BHXF 1FUJA 3O8BA 1BTYA 1O3DA 1P0SH 3AAVA 5GXPA 1VITG 2XW9A 2ZGCA 1GHVH 1KXFA 2BQ7B 4Y71A 5HIZA 3EDXB 5DP8A 3BV9B 2HLCA 2F9PA 2A5KA 1DLEA 1MKXK 1VKYA 3SZEA 3DSGA 1P05A 2GMTB 5L2YH 1UVOA 1SQAA 3N7OA 4B71A 1TMBH 2J94A 2PLXA 1K1NA 1CGJE 5JBTA 4MNYA 4NA8A 1VJAU 1EB2A 2F4LA 2FI3E 2JETC 9LPRA 5ESBA 4BTUB 1F2SE 2W7UA 4INKA 4Q7XA 1A5IA 1SGIB 3VB6A 3GY4A 4DG4A 2FMJA 1HAZB 1TGNA 4WVPE 1MTNB 4TT3D 4UFFH 3D65E 2JH0D 3DT0H 4UD9H 5F53A 1O3JA 1GJAB 2R9PA 2Z9JA 1GJCB 2DUCA 2VGCC 1MBMA 2PTCE 3HPTB 3PV2A 3MNBA 5H4IB 1O3IA 3HK6B 3GCHC 2AYWA 2TGDA 1EXFA 2XBWA 4FUHA 4ABAA 3LJJA 3SU0A 1GBJA 1CGHA 2Y80A 1E1RD 1ZTKA 2R0KA 3CS7A 1DXWA 1C5WB 2FEQH 3Q3KA 1C2DA 1O31A 4FUEA 1C1UH 3RLWH 4D8NA 3SOSA 2G00A 3A85A 3KL6A 2BZ6H 2ZGHA 2WPHS 1HJAB 2FXRA 1C4U2 2EEKA 3SN8A 5GPIB 4UFEH 2A32A 3TK9A 1ZPZA 2FOCA 5C20A 1KDQB 2XNDD 4HZHA 1Z8GA 2A4RA 1VITF 1H8IH 4Q7YA 2BDBA 1C4Y2 1O3LA 1XUKA 1HJAC 3H5CB 4UE7H 1VR1H 1O3AA 1JIRA 3A87A 3PRDA 4AB8A 2OXSA 1BITA 4ISOA 4X2XA 4AZ2B 1MQ5A 1ZJKA 3L33A 3SV2H 1XMNB 1CBWB 4MTBA 1MCVA 2W6JD 1ETRH 1SBWA 2ZP0H 4XD7D 4B74A 3BEIB 3RMLH 1ZPCA 4X2VA 2P8OC 1BMLA 1A46H 1C2IA 1MKWK 2CXVA 3F9EA 4U01A 3TPIZ 1C1TA 2SGAA 4ABDA 2F43B 3ZVDA 2C3SA 4FOUC 4UDWH 1ZR0A 2OUAA 4XBBA 1O2MA 1Z6JH 1GGDB 2W3KA 4R0IA 2BDGA 3JZ1B 3W94A 1ETSH 1TONA 1BRUP 8ESTE 1A7SA 2WPLS 3SJKA 1O5EH 1Y3VA 2Y81A 3SV6A 6CHAC 1HUTH 4HFPB 3M5OA 1S85A 1TRNA 2C4FH 1GJ7B 1NN6A 2HOBA 3P8FA 2FWWA 5A0CA 1LKAA 1Z8RA 4YT7H 4FUBA 3GY5A 3RXCA 4FU7A 1LHCH 4FUFA 5T6GA 4IGDA 3GY8A 3VB5A 3AK5A 1D3DB 4JZFH 2ZA5A 1C1RA 1P03A 4A6LA 5GWZA 1W0KD 1N8OC 3UNSA 2IJD1 2Y5FA 5LPFA 1W7GH 1W7XH 2JIZD 2BLOA 1H8ED 3QTOH 2B7DH 1NFUA 2BD2A 3F0OA 3SJ9A 4IN2A 5DKMA 5T6DA 1GMDF 1C5LH 3RMNH 1CHOF 2O8WA 5IYTA 3F0PA 3F2HA 1PPBH 2H9EH 4NSVA 1OHHD 2NU4E 2UUKB 2QF0A 3KNXA 1GI5A 1BTHH 1NBME 1QRXA 1BQYA 1KTSB 3DSPA 5DP3A 1FQ3A 3RXEA 4AB9A 3O8RA 1O2WA 1CA8B 3BTDE 3T26A 1MD7A 4K60A 5F8XA 2C8XB 2VU8E 5TCAA 3LOXA 2DE9A 3SI4H 2ZF0H 2GMTC 5C1YA 6GCHF 2Z3CA 1KXBA 2OQUA 1KXDA 1C1OA 3ATIA 1V2QT 2VVCA 4NZLA 2VBCA 1EZQA 3RXVA 2ZPSA 5LH8A 4RKJB 2XC0A 4NG9H 2ZFPH 2JJ2D 1SQTA 1HXEH 3TGIE 4ZMAH 3ZVFA 1OPHB 4NWLA 4THNH 1AZZA 2ODYB 1K1MA 2H6MA 1O30A 5C5NA 1LHDH 2PKAA 1MTNC 1LHEH 1HIAA 5EXMA 2P16A 1QRZA 3VG8A 1A0LA 1C5NH 1RJXB 4M7GA 5FXLA 1GBCA 5LGOA 2SGFE 1QBVH 1HCGA 1HPGA 4ZKSU 1C2JA 4I8LA 2EI8A 3TK5A 4D7GA 1ZMJA 1GG6C 3MNCA 4KTCA 1EZXC 1UTPA 3GDUA 2Z9GA 5A0AE 2D1JA 4B75A 2J34A 2WPMS 1ZSLA 4IMQA 1IQMA 1GVKB 1O2YA 1MH0A 1LPGB 1VGCB 4MPXA 4ABGA 1AQ7A 5L2ZH 1AKSB 1C5XB 1GCDA 1OWHA 3FO8D 2KCPA 1P02A 1FY8E 5FCKA 1O2VA 1Z1JA 5LPEA 1SOZA 3WWBA 5F6MA 4IS5A 1XKBC 1Z1IA 3RXAA 1NT1A 4KKDA 1P2NA 3ATMA 2XTTB 2QYIA 3ATWA 2FLBH 5DP9A 1YYY1 1AY6H 1Z6EA 1TALA 4I32A 3ATLA 3MU0A 1Y5AT 3GS9A 3ITIA 3I78A 2H1UA 2LELA 3ZYEA 1A4WH 1LVMA 3ZVBA 1CT0E 1UTKA 1GJDB 2PV9B 5IDKA 5EG4A 1CT2E 1W3CA 3MH4A 3UR9A 1F92A 2FIRH 1TBZH 3UOUA 1QCPA 2IN2A 1EQ9A 1C1SA 1D3QB 1SQRA 1L1GA 1ID5H 3S9AA 1V3XA 1YP9A 1O36A 3M3TA 3UREA 1DFPA 1MTUA 3PMAB 3UB0A 4J2YB 3PRBA 5TCCA 2CHAB 3SV7A 1NO9H 1ESTA 1HJ8A 5CMXH 3P17H 1RRKA 2H2ZA 3EGKH 1Z7KA 3MNXA 1DPOA 3MO6A 4Y6DA 1NY22 4I8KA 4FVBA 1ELFA 4XBCA 1GHYH 2QGRA 4I8GA 3R0FA 3RUOA 2TGPZ 2J95A 2V3HH 1C2LA 4CH2B 4CRAA 4KP0A 5C3NA 1UVTH 2SGPE 3A80A 5HM9A 1HAYB 2C8WB 1O5FH 2PTNA 1TE0A 1EPTB 2NWNA 2VIPA 1SVPA 3UQVA 3UUZA 3LGUA 5FHTA 4CRFA 2A4OA 3ZZDA 5DP5A 2BDAA 3SORA 1BMAA 2J98B 3OU0A 3P6ZB 4RSPA 1K2I1 3BSQA 2ANWA 3PV5A 2BLVA 3V12A 1ANCA 2Z7FE 3D62A 1GMCG 1O34A 4INLA 2QY0B 1WU1A 3M35A 1YC0A 2BY5X 1QR3E 1YGCH 1KY9A 5IK2D 1B7XB 1GHXH 2KR7A 1SI5H 4X2WA 3BF6H 1O2PA 1RTLA 4TPIZ 1FIZA 2ZKSA 2QF3A 3BEUA 2PGQB 1QL8A 4FUCA 2BOKA 3OE7D 3U8OH 4ZHLU 3E1XB 5T6FA 1GBIA 1JIMA 1SGCA 2PUQH 3PLBA 1LHGH 4TWYA 2P3UB 1P8VC 5AVDA 2FTMA 2ZC9H 3PMHB 5EGMA 1VJ9U 1NESE 4K1EA 4O97A 2BD5A 2ILNA 1WSSH 3B9FH 3RM0H 1QB1A 1GWAA 5FPYA 2STAE 4SGBE 1AWFH 1MD8A 1CU1A 1BRAA 1GVLA 2SFAA 1FIWA 4VGCC 5A8ZA 2UWOA 2XWAA 1F0TA 4BAKB 1C2MA
chains in the Genus database with same CATH topology
2YMSB 2OC7A 3FKSD 3SU1A 3SU6A 3EYDA 5CHBA 3O8RA 1SKYE 2A4GA 2AHME 2OBQA 2W6ID 2WHXA 5EQQA 2XOKD 5GPIB 1DXPA 3O8CA 1BMFD 3N7DA 1KMHB 3OFND 3OAAD 3UB0A 3WW7A 4A1XA 4DT4A 2WZQA 3PRBA 2XNDD 2K0QA 2A4RA 2K8IA 1NBMD 3LOXA 3M5MA 1NS3A 3SU5A 4I33A 1S6LA 3SV7A 3SV8A 3KEEA 4WH6A 2JDID 3P8NA 3E90B 4RI0A 3KN2A 2QE7D 3PRDA 2YMSD 3FOAA 5FPTA 4B6EA 4M9FA 4WH8A 2F9UA 2JJ1D 3RC6A 2VBCA 4B76A 2WSSD 4JMYA 1BT7A 4YXWD 4TSFD 1H8HD 2J5UA 2GVFA 1W0JD 2XCFA 5EPNA 4TYDA 2OBOA 2A4QA 2JJ2D 2KCYA 2W6JD 3O8BA 3OEHD 4B73A 1A1RA 5GJ4B 4K8BA 4Z1MD 4NWLA 2YMSC 4XD7D 3SU3A 3L6PA 4B74A 2OINA 3LONA 4ASUD 2XCNA 5EQSA 3M5NA 3SYJA 2FP7B 2QV1A 3RC5A 3U1JB 3VG8A 3SUGA 3SZEA 2OC1A 2CK3D 3ZIAD 3U1IB 2KFWA 4U01A 4Q4LA 5C17A 5B6LA 2F43B 1MABB 2XNIA 4B71A 5ETXA 2YOLA 2GGVB 5FPSA 2FOMB 5EQRA 3PV5A 3SU2A 1DY9A 1E79D 4KTCA 4ZCNA 3F3BA 3OTPA 4A92A 2F4LA 3KF2A 4B75A 1RGQA 2KZ4A 4WF8A 5ESBA 5HKKD 2K1QA 3SV9A 5DSFA 3SV6A 5IK2D 2KM0A 2KR7A 3M5OA 5EPYA 2P59A 2V7QD 1N1LA 2L6OA 3FO8D 2QF5A 2KCPA 1RTLA 4F55A 2F9VA 3OYPA 4FETA 2QF4A 2KCOA 3LKWA 4TT3D 3N7EA 5GNDA 3WWBA 4A1VA 2WPDD 5CDFE 4A1TA 2OC0A 2HLDD 5F53A 3SUDA 4OM9A 1E1QD 3OE7D 3AK5A 2KCAA 2IJOB 1DY8A 1COWD 2O8MA 5T1VA 1W0KD 2IJD1 3H09A 3PV2A 3P8OA 2JIZD 3W1EA 5C0TA 1H8ED 4I32A 5H4IB 3RC4A 3F0OA 5FL7D 3SU4A 5C0UA 3GS9A 3F2GA 1JXPA 2LELA 1WXRA 2M2AA 2OC8A 3DCLA 3F0PA 3F2HA 1EFRD 5DN6D 5IDKA 3FN8A 3N99A 3SU0A 1W3CA 3SUEA 1OHHD 3OEED 1E1RD 4NWKA 5FPYA 3O8DA 2FM2A 4R8TB 4B6FA 1DXWA 3F2FA 1FX0B 3KNXA 3M5LA 3DSOA 4Q63A 1CU1A 1NBME 3NRLA 4I31A 3SUFA 2WV9A 3DSPA 2OK5A 3WWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF5 A;  2J5U A;  2QF4 A; 
#chains in the Genus database with same CATH topology
 4JZD H;  1GVZ A;  1TOC B;  5CHB A;  3ZZC A;  1B5G H;  1UK4 A;  2W6I D;  5AF9 H;  2STB E;  1O32 A;  1V2R T;  3O8C A;  3VB3 A;  1BMF D;  5CHA B;  1ZRB A;  3WW7 A;  3V3M A;  5A09 A;  2K8I A;  3SU5 A;  3U8R H;  1S6L A;  2CN0 H;  3K65 B;  3SHC H;  1RTK A;  4JK5 A;  1SMF E;  1DE7 H;  3UY9 A;  2YMS D;  3QN7 A;  4YM9 A;  3A8B A;  3BEF B;  1YPL H;  1W0Y H;  5HXF A;  1HDT H;  1QFK H;  2ZDA H;  4HGC A;  1ELV A;  4BAH B;  1A3B H;  1MU6 B;  2BLQ A;  1GJ8 B;  2GVF A;  3RXF A;  4CRD A;  1YPM H;  1FPC H;  3HGN A;  2KCY A;  1O3K A;  1GI8 B;  3FZZ A;  3KYG A;  3ZZ6 A;  3U69 H;  2G55 A;  2C8Z B;  3FP8 E;  2Q1J A;  1C5P A;  1GHA G;  1EAI A;  4GCH G;  1GCT C;  2XCN A;  1N6Y A;  2VWO A;  1A61 H;  2AGE X;  4AG1 A;  5PTP A;  2A2X H;  2GCT B;  3TGJ E;  1ELD E;  1VCQ A;  4DOQ A;  7EST E;  3F9H A;  1A5G H;  3SQH E;  1EAX A;  4DVA U;  2ULL A;  1C5M D;  4O03 A;  1DWC H;  1TA6 A;  1GHW H;  1ESB A;  1QJ6 B;  3PLP A;  3KF2 A;  2Q6D A;  2EI7 A;  3RXP A;  1O2L A;  1V2O T;  1BDA A;  4CRG A;  1CA0 B;  1XXF A;  1GL0 E;  1TRY A;  2C90 B;  2Z9K A;  1QBO A;  4JCN A;  2CF8 H;  3VXF H;  7GCH G;  5JB8 S;  3S9B A;  1AWH B;  4Z0K A;  4YTA A;  2QIQ A;  4ZKN U;  3AW0 A;  1PYT C;  1GDQ A;  1WDI A;  4F49 A;  1C1Q A;  4E7R G;  4AFU A;  4BAQ B;  2WPD D;  2Z94 A;  2O8T A;  5CDF E;  3UWI A;  2OC0 A;  3SUD A;  5GIB A;  4OM9 A;  1GHA F;  4GCH F;  2AGI X;  3T62 A;  2B5T B;  4I7Y H;  1W12 U;  2HNT C;  1LO6 A;  1ZMN A;  5EXL A;  1GG6 B;  1K22 H;  1YCP K;  2GV7 A;  3TH4 H;  2BMG B;  2VVV A;  4FVD A;  1GJ9 B;  3NXP A;  2QXG A;  3F2G A;  1GI1 A;  1EB1 H;  1OYQ A;  1HFD A;  1HXF H;  5DN6 D;  1ZML A;  1LVO A;  4LOY H;  2ZU1 A;  3FN8 A;  4IC6 A;  4D9R A;  1JBU H;  1C2F A;  4NFE A;  2FI5 E;  1CHG A;  3Q00 A;  2AIP A;  1DUE A;  3QGN B;  4MDS A;  1O2H A;  2ZEC A;  1UCY H;  2A4G A;  4U2W A;  2Q6G A;  2BY6 X;  1J16 A;  1PFX C;  2WYG A;  1KMH B;  1P2J A;  4A1X A;  4ABH A;  4DT4 A;  1SGD E;  2ZHW H;  2FZZ A;  1O35 A;  4DGJ A;  1YPH E;  1EOL A;  1NS3 A;  3HAT H;  3DFL A;  1EUF A;  2VWN A;  1C4V 2;  1BTW A;  4AFQ A;  3A89 A;  3DFJ A;  1V2K T;  1TMT H;  3GCT G;  3AAS A;  3IWM A;  5K7R A;  1MUE B;  1ZGI A;  1YPH C;  1FMG A;  2ZHD A;  1AIX H;  1L0Z A;  2R2M B;  2G5V A;  3F9G A;  3URD A;  2XCF A;  1ZYO A;  4FXG H;  3PWB A;  1Y3W A;  3BN9 A;  4K8B A;  2G4U A;  1FAK H;  5GCH F;  2G4T A;  1TMU H;  5TJX A;  1TNG A;  4CH8 B;  3STI A;  1OWD A;  3L6P A;  1YWU A;  1MQ6 A;  3SGB E;  3U1J B;  1RIW B;  2FYQ A;  1TQ7 B;  3LGT A;  1TB6 H;  2ANY A;  3NCL A;  1S6H A;  5E0J A;  5EJ1 A;  3ZIA D;  1SR5 C;  2ZO3 H;  2ZGB H;  1MAB B;  3A7T A;  3ZZ5 A;  2B0F A;  1Y59 T;  4EST E;  2XWB I;  4YES B;  4BXW A;  3QUM P;  1H4W A;  1OX1 A;  4OS7 A;  2ZIQ H;  2BVR H;  4WF8 A;  5A2M H;  2P94 A;  2RA0 A;  2HNT E;  2AMP A;  4JZ1 A;  2GJG A;  3PYH A;  1C2K A;  3QZQ A;  5EPY A;  3URC A;  1UVU H;  1DWE H;  2BDH A;  4FET A;  2P95 A;  3F6U H;  1K1I A;  1W11 U;  2PSY A;  3A83 A;  5GND A;  2GCH G;  1GI2 A;  4JZE H;  1NPM A;  1YPE H;  1EAU A;  1DOJ A;  1TPA E;  1BZX E;  4E05 H;  1E1Q D;  1VIT H;  3MWI U;  2KCA A;  2M5T A;  1GBA A;  4O9V A;  2O8U A;  3RXH A;  2ZG0 H;  2QN5 T;  3EQ0 H;  2VWL A;  5C1U A;  1K28 D;  2EQN A;  2SNW A;  1EPT A;  1ZGV A;  1MKX H;  3P8G A;  1IQL A;  3G01 A;  3W1E A;  5C0T A;  5FL7 D;  1F0U A;  4OS2 A;  3V13 A;  1AE5 A;  1ZSK A;  5HGG A;  1OSS A;  5EST E;  4I8H A;  4AYY B;  1OYT H;  1XUJ A;  2PKS B;  1LHF H;  1A2C H;  1NFW A;  5JB9 S;  3K6Y A;  1INC A;  1HRT H;  2GP9 B;  1G30 B;  2FOG A;  3RXS A;  2AMQ A;  4X0W U;  1O3B A;  2NU0 E;  1CE5 A;  1FN8 A;  1TGT A;  1QUR H;  3BG4 C;  4SGA E;  2VIW A;  1SOT A;  3ZZ3 A;  1GCT B;  1FY5 A;  3LPR A;  1N6X A;  5FAH A;  1IQE A;  1GMD G;  2K0Q A;  2QAA A;  3FAO A;  1MAY A;  3A86 A;  4BTT B;  3PLK A;  3LH3 A;  5E2O A;  4O3T A;  1BTZ A;  4GPG A;  3A88 A;  3BTT E;  4KEL A;  2CGA A;  1HJ9 A;  6LPR A;  4TSF D;  4D9Q A;  4DW2 U;  2BVS H;  4TYD A;  3ENS B;  1Y3U A;  2QC2 A;  4ZHA A;  2G5N A;  4IBL H;  3RM2 H;  3AW1 A;  2PHB A;  5CHA C;  2O8L A;  2WUB A;  3P70 B;  2DE8 A;  5EOD A;  3NZI A;  1G3D A;  2BDY A;  2FDA A;  3EE7 A;  3ZZ9 A;  2ZGX H;  2I6S A;  1TBQ H;  2YOL A;  3TNT A;  1H1B A;  1VGC C;  3MYW A;  1AUJ A;  3PMB B;  1QB6 A;  4BAO B;  2FX6 A;  4NZQ A;  1GMH G;  4AOR A;  2QA9 E;  2BB4 A;  4P02 A;  2BX4 A;  1CT4 E;  1S82 A;  3TJO A;  1D3P B;  3EST A;  4BAM B;  3CNR A;  2VNT A;  2CHA C;  1AFQ C;  1SLV B;  2QF5 A;  3FAN A;  5KEC A;  2BOH B;  1P12 E;  4ASH A;  1GMH F;  5JDU B;  5DPA A;  4YLU A;  1PPZ A;  1IQH A;  2ZFQ H;  5I46 H;  3LKW A;  2J4I A;  1HAV A;  1ETT H;  1DIT H;  4ISL A;  4Y0Z E;  1O2X A;  2O8M A;  2AIQ A;  1KSN A;  3EA7 A;  1XUG A;  1UTL M;  4XBD A;  1GBF A;  1IQN A;  1AI8 H;  1WXR A;  3DCL A;  3T28 A;  5FBI A;  1GBL A;  3N99 A;  5C67 A;  3VB4 A;  2HPQ H;  2F9B H;  4X6M A;  2F3C E;  2FM2 A;  1FY1 A;  1O2J A;  1AGJ A;  1IQJ A;  2KAI B;  3M5L A;  3AVZ A;  3M3S A;  3KQD A;  2FOA A;  4LK4 A;  1O3C A;  1YY3 A;  2WV9 A;  3BTH E;  4P00 A;  1OOK B;  1ELT A;  2B9L A;  2GCH F;  3SU6 A;  4AG2 A;  5JBA S;  3LGW A;  1C2E A;  1O5A B;  2A31 A;  3T25 A;  2HPP H;  1DXP A;  1O38 A;  1FZZ A;  4U32 A;  1V2U T;  1DWD H;  2GDE H;  1N8O B;  3SV8 A;  3KEE A;  1P10 A;  3P8N A;  3E8L A;  1DWB H;  5AHG H;  5DG6 A;  1T31 A;  2H5C A;  3LIW A;  3BIU H;  3GOV B;  3RC6 A;  3S0N A;  2ZCH P;  2GZ8 A;  1HV7 A;  1LMW B;  3LGV A;  2P93 A;  1H8H D;  5EPN A;  2BD4 A;  3NPS A;  1GJ5 H;  5GJ4 B;  1LCY A;  3KHV A;  1IHS H;  4INH A;  8GCH F;  4LZ4 B;  1F0S A;  1NRS H;  3TLO A;  1PQ7 A;  4ASU D;  3PB1 E;  2NU2 E;  2FP7 B;  1UHB A;  6GCH G;  2F9N A;  2FPZ A;  1OP0 A;  2ZU3 A;  2GZ7 A;  3GCN A;  4ABB A;  1O33 A;  2WPJ S;  3ODD A;  4BNR A;  4ZCN A;  4RKO B;  1UVS H;  2ZQ2 A;  1O2U A;  2P3F H;  4A92 A;  4Y7B A;  1HNE E;  3SV9 A;  3HK3 B;  1O3P B;  3M37 A;  1QL7 A;  2QCY A;  3ZVE A;  3TGK E;  4X1N U;  2BTC E;  1T8O A;  1T4U H;  4AGK A;  5E0H A;  1C5O H;  1DVA H;  2TRM A;  3QDZ B;  5C2Z A;  1HGT H;  3RXU A;  1P57 B;  2F91 A;  3MU4 A;  4XE4 A;  1O3E A;  4E06 H;  1Z8I B;  1PPH E;  2GTB A;  3A7Y A;  1P06 A;  1GDU A;  4NCY A;  2WYJ A;  1O2N A;  1QJ1 B;  4MNV A;  4MPW A;  4Y8Y A;  3NWU A;  4CRB A;  1ANB A;  3UPE A;  1JXP A;  2OC8 A;  1FPH H;  1T4V H;  2F83 A;  4IW4 E;  1H9I E;  1YKT A;  1C2G A;  4CBN A;  4X8V H;  1DLK B;  1O3H A;  3F2F A;  1WBG B;  3BTF E;  3LGI A;  3S9C A;  3ZZ4 A;  4I31 A;  4FUJ A;  5KGO A;  1SGP E;  1UJ1 A;  3GCT F;  2HVX A;  8KME 2;  3SU1 A;  1CQQ A;  3M7U A;  1C5U A;  1HAI H;  1O5C B;  5FBE A;  1S0R A;  2VID A;  3SHA H;  5E2P A;  1TPP A;  3RLY H;  3MU5 A;  1FN6 A;  1UTN A;  1TA2 A;  1OWJ A;  4AX9 H;  2JDI D;  3CEN A;  1W0Z U;  4ACB A;  1RD3 B;  3MTY A;  1WQV H;  4B2C A;  4X2Y A;  1TX8 A;  4M9F A;  1AMH A;  2BD8 A;  3MOC A;  1SPJ A;  4WH8 A;  3P92 A;  4A5T S;  2IPQ X;  2UUY A;  1WOF A;  2WSS D;  4JMY A;  4ACA A;  5EOK A;  4UON A;  5AFY H;  4IN1 A;  3ZVC A;  1F5R A;  2I6Q A;  4YOJ A;  2R2W U;  1VCW A;  2SNV A;  2VGC B;  1S84 A;  1KLJ H;  2FO9 A;  2PGB B;  2TIO A;  4Y0Y E;  1RTF B;  1F5L A;  2A45 B;  4ZXY H;  1V2V T;  2CF9 H;  1UCY K;  1L2E A;  3BTM E;  2G52 A;  4FU9 A;  5EJZ A;  1C1W H;  1BMM H;  2R0L A;  4K8Y A;  1ELC A;  1XUF A;  1YPJ H;  2VB0 A;  1ELE E;  2CK3 D;  2AMD A;  2LNC A;  4Q4L A;  1CA0 C;  1SGR E;  2XNI A;  3JZ2 B;  3S7H B;  3SU2 A;  3SQE E;  1HAH H;  2Y7Z A;  1FAX A;  4ZAE A;  1CO7 E;  1LTO A;  3TVJ B;  1G37 A;  2QXH A;  1C5V A;  1TGC A;  2ANM H;  4Y8X A;  2PKS C;  2J9N A;  5EJL A;  4MG3 A;  1THS H;  1N1L A;  1W13 U;  5C1X A;  1XVM A;  1NRQ H;  2ASU B;  1T32 A;  2F9V A;  1ABI H;  3A7V A;  3KGP A;  4DII H;  4IC5 A;  3N7E A;  3ZVA A;  1WV7 H;  3MU8 A;  3RXO A;  1TPS A;  2ZDK A;  1Y5U T;  2PW8 H;  5HMA A;  3GYL B;  5T1V A;  3EA8 A;  1KXE A;  3A7Z A;  1UMA H;  1UTO A;  2ZZU H;  1PPF E;  3FZD A;  1EZU C;  1V2J T;  1F7Z A;  3SND A;  7LPR A;  1P9S A;  1PQ5 A;  2ZU5 A;  2ODQ A;  3FFG A;  1GBT A;  3UIR A;  2VJ1 A;  1J8A A;  2IPH A;  2A7H A;  1FY3 A;  1FX0 B;  1DM4 B;  3KQB A;  1W10 U;  4B1T A;  4ZKO U;  2JET B;  3STJ A;  3F1S B;  5DP4 A;  3SJI A;  1AVW A;  3OAA D;  4GVU A;  2TGT A;  4K2Y A;  2FYR A;  2J97 A;  1AZ8 A;  1B0F A;  5E8E H;  1EJA A;  2A5A A;  2J2U A;  1P04 A;  4MNX A;  2ZHE H;  4RI0 A;  2JH6 D;  3LH1 A;  4D7F A;  4B6E A;  1C5S A;  1O3G A;  1AVG H;  5SGA E;  1O0D H;  2ZDN A;  1TNK A;  1SC8 U;  3E91 A;  3SJO A;  1PYT D;  1YLC A;  3RDZ A;  1AUT C;  1MTV A;  4J1Y A;  5FX5 A;  4ISI H;  1OWI A;  1P3C A;  1G3B A;  1UTJ A;  1QHR B;  3PV4 A;  3UNR A;  4NIY A;  1P09 A;  2GD4 B;  3PO1 C;  2RG3 A;  3E0N B;  1SGF A;  4XSK U;  5BPE A;  2XBX A;  2ZHQ H;  1HAX B;  3SUG A;  1FON A;  4ABF A;  1DIC A;  2EY4 C;  4Q80 A;  3GY7 A;  1EJN A;  2EC9 H;  1E0F D;  2UWL A;  3OTJ E;  2G81 E;  1O3F A;  3D23 A;  1C5Y B;  1G9I E;  4X1R U;  4PRO A;  4TWW A;  2ZPR A;  1AO5 A;  4JYV H;  5BRR E;  1SLX B;  1E35 B;  3C1K A;  1GI6 A;  4ISN A;  1ZSJ A;  1SQO A;  2LPR A;  1P2O A;  3RXB A;  1NRO H;  2GV6 A;  1GBB A;  1ELB A;  1AE8 H;  1CBW C;  3TJU A;  3A8C A;  1YM0 A;  2GT7 A;  2IJO B;  3QK1 A;  1AFE H;  3H09 A;  2HAL A;  2NU3 E;  4WWY A;  4CR5 A;  1LPK B;  2OCV B;  4Y8Z A;  1ZHR A;  1UHB B;  3CS0 A;  3OX7 U;  4LZ1 H;  4YO9 A;  1RIW C;  2HWL B;  1RFN A;  3PM3 A;  1O3O A;  3VEQ B;  2HVY B;  3SUE A;  1O2T A;  2FI4 E;  5L6N H;  1AVX A;  2PKA B;  4K1T A;  4ZRO A;  2BVX H;  1O2Q A;  4AFS A;  5EIY A;  3K9X B;  1AHT H;  4OGY A;  1SGY E;  3EYD A;  1EPT C;  1E38 B;  1L4Z A;  2Z9I A;  1JMO H;  2WHX A;  4TPY A;  1BOQ A;  2ZEB A;  3AAU A;  2AGG X;  1GPZ A;  2LP6 A;  1VCP A;  1HBT H;  4ZHM U;  3SBK A;  1HB0 B;  1OKX A;  3RU4 T;  4WH6 A;  4X1S U;  1C1V H;  1YBW A;  1G32 B;  1O2G H;  3I29 A;  3MFJ A;  5FPT A;  1MCT A;  1P2M A;  2XC4 A;  1J17 T;  3H7T A;  1L4D A;  2XXL A;  1QRW A;  2ZU4 A;  4NGA H;  3QZR A;  1W0J D;  2RDE A;  2OBO A;  2KX4 A;  1ZHP A;  2RDL A;  1O5B B;  3OSY A;  2UUF B;  5DP7 A;  3SNB A;  3SU3 A;  4WXI A;  1SL3 A;  2ZDL A;  2BQW B;  3SYJ A;  1GBH A;  1NRR H;  3RMO H;  1ZTJ A;  2EA3 A;  2OC1 A;  4AYV B;  3NKK A;  5C17 A;  3ODF A;  1LVB A;  1PJP A;  2GGV B;  1E36 B;  2GKV E;  4ZKR U;  1P01 A;  1TQ0 B;  1HYL A;  1W2K H;  3GY3 A;  3MNS A;  3UWJ H;  2BD7 A;  2K1Q A;  1NC6 A;  5G4B A;  1O2I A;  1CVW H;  1FXY A;  1A5H A;  2VH6 A;  3V0X A;  1BTP A;  1IHT H;  1TOM H;  1BRB E;  1HAV B;  4HTC H;  5A8Y A;  1W8B H;  4YZU A;  2H5D A;  2V3O H;  3VB7 A;  3MH6 A;  1DSU A;  1VZQ H;  4CHA C;  4X6P A;  2AH4 X;  1THR H;  3RXT A;  4BTI B;  3KYF A;  1O3M A;  1SGE E;  1IQF A;  1MZA A;  1D6R A;  4DUR A;  4MVN A;  1GJ6 A;  2OTV A;  1HIA B;  1NRN H;  3LJO A;  1Q31 A;  2FOF A;  2M2A A;  3GDS A;  4RT1 A;  4BXS A;  4GSO A;  2UWP A;  1TAW A;  4NWK A;  3MH7 A;  3TJN A;  3O8D A;  3ZZB A;  2FOB A;  1GL1 A;  1DS2 E;  2WUC A;  1ZJD A;  1A0H B;  1XKA C;  2IOT A;  1K1O A;  5JBC S;  1J9C H;  2JH5 D;  2BD3 A;  2V6N A;  3T5F H;  4JK6 A;  1F5K U;  3RXD A;  2AFQ B;  4AOQ A;  2PP6 A;  3A84 A;  3DD2 H;  1ZOM A;  1V2M T;  2P8O B;  4CBO A;  3FVF B;  1YLN A;  4JZI A;  1PPE E;  1ZPB A;  2BDI A;  3E90 B;  3M7T A;  4CHA B;  3GYM A;  3SGA E;  2JJ1 D;  2ZFF H;  2ALV A;  2Z6B D;  1OXG A;  4Q7Z A;  2ALP A;  1O2R A;  2F9O A;  1LVY A;  5F03 A;  1D3T B;  3BTW E;  4ABI A;  1GJB B;  5E0G A;  4B73 A;  1T8N A;  1TGS Z;  4AC9 A;  2RFK C;  1V6D A;  2BZA A;  4WME A;  3WY8 A;  3UAI C;  1BTU A;  1ELG A;  2ZU2 A;  3LON A;  4FUG A;  1OWE A;  1TAB E;  4X8S H;  3SW2 B;  4K5Z A;  2BY9 X;  4YOG A;  3SNE A;  3LDX H;  4WXV A;  5B6L A;  1AD8 H;  3RXQ A;  5DK1 A;  1QA0 A;  3F3B A;  2EST E;  1TNH A;  1QA7 A;  2XBV A;  1CSO E;  1QQ4 A;  1D6W A;  1JWT A;  1TIO A;  4NA7 A;  3UFA A;  1AU8 A;  3DUX H;  3DA9 B;  3B8J A;  2KM0 A;  1EOJ A;  4H4F A;  1BBR H;  2UUJ B;  2BM2 A;  2ZDM A;  4OS4 A;  2L6O A;  1P3E A;  2OLG A;  1D4P B;  2GZ9 A;  1WQS A;  2ZCK P;  3PO1 B;  4H42 U;  1DDJ A;  1GBD A;  4Z6A H;  2FS8 A;  3E6P H;  4MQA A;  2Y7X A;  2R3U A;  2A0Q B;  1S6F A;  4GHQ A;  4NIV A;  2PUX B;  1C9T A;  1GI7 B;  1MZD A;  3TU7 H;  1V2L T;  3ZZA A;  1K1P A;  4LXB H;  3A8D A;  1LDT T;  3ZVG A;  1QGF A;  1L1N A;  4Y76 A;  1UVP A;  1J14 A;  1GJ4 H;  5EU8 A;  2C93 B;  1SLW B;  1SG8 B;  1QNJ A;  3RMM H;  1SHH B;  3BG8 A;  1AB9 B;  1NM6 A;  4Q63 A;  1FNI A;  1ELA A;  2VH0 A;  2WV5 A;  3TH3 H;  1AB9 C;  3VGC C;  1SGT A;  4DY7 B;  3MMG A;  2ZTY A;  1QB9 A;  1EAS A;  3S69 A;  1YF4 A;  1Q2W A;  1OWK A;  1B0E A;  2ZNK H;  5CE1 A;  1IQG A;  2QE7 D;  2FX4 A;  1G3C A;  1QIX B;  2FLR H;  1O37 A;  2NU1 E;  1K1J A;  3TJV A;  4ABJ A;  1SFI A;  4BAN B;  2BD9 A;  1PPG E;  5HM2 A;  3UR6 A;  2A4Q A;  4CRC A;  1OS8 A;  3OEH D;  3SNC A;  2GCT C;  3Q77 A;  3RXR A;  1MMJ N;  4Z1M D;  1GBK A;  1X7A C;  4ISH H;  2YMS C;  1FJS A;  1P11 E;  1NU7 B;  1EP5 A;  1JRT A;  3M5N A;  2ZQ1 A;  4DJZ B;  3NUM A;  3RP2 A;  1TNI A;  3W95 A;  7GCH F;  1EX3 A;  3MH5 A;  3RC5 A;  3CP7 A;  3F9F A;  1BB0 B;  4Y11 E;  3BTQ E;  3TIU A;  2FES H;  4I8J A;  4GHT A;  3LU9 B;  5ETX A;  6EST A;  1NRP H;  5FPS A;  2FOM B;  1BTX A;  5EQR A;  2O9Q A;  1DY9 A;  4FUI A;  5C5O A;  1O39 A;  4AFZ A;  1WCZ A;  5JYI A;  3BTG E;  1ARC A;  2J38 A;  9EST A;  2FOH A;  3TIT A;  1LKB A;  2B8O H;  5KED A;  1MKW H;  2VWM A;  2TBS A;  1WTH D;  1MBQ A;  3SO3 A;  4KGA A;  1BUI A;  1Z8J B;  3OY6 U;  4DIH H;  3RXK A;  5LPR A;  1Y8T A;  1YCP H;  3UNQ A;  1BA8 B;  4F55 A;  1S83 A;  3OYP A;  1UTM A;  2QF4 A;  1CGI E;  1QQU A;  5DP6 A;  1C5Q A;  1G36 A;  3UTU H;  2HLD D;  3GIC B;  3E16 B;  4FUD A;  1UW7 A;  3FP6 E;  3GCH B;  2OP9 A;  3M3V A;  2Q6F A;  1TGB A;  1W14 U;  3KID U;  2FTL E;  2FOD A;  1MTW A;  3TH2 H;  3MHW U;  1GMC F;  3QTV H;  2PSX A;  5C0U A;  2ZHF H;  1K21 H;  2OD3 B;  2EI6 A;  4BOH A;  2BY8 X;  1GI0 A;  5A8X A;  1P2I A;  4AN7 A;  3D49 H;  1C1P A;  1AFQ B;  1SFQ B;  1V2W T;  3OEE D;  2G51 A;  1K9O E;  1Y5B T;  3V7T A;  5FCR A;  1C5R A;  1Q3X A;  1IAU A;  1IQI A;  3L3T A;  5EXN A;  2QXI A;  4H6S B;  3ZV9 A;  2OK5 A;  1EAW A;  3RXI A;  3WWF A;  3RXL A;  1GI4 A;  1GBE A;  5T3H A;  1TLD A;  5EQQ A;  1BBR E;  3N7D A;  1XXD A;  1C9P A;  2WZQ A;  1ARB A;  5DGJ A;  1DST A;  1FI8 A;  3ATK A;  4B2A A;  3A7W A;  1KDQ A;  4RN6 A;  3UOP A;  1BHX B;  1ZZZ A;  3P95 A;  3KN2 A;  4WJG 2;  5EW1 H;  4Y79 A;  2WV4 A;  2Y82 A;  1NFY A;  1T8L A;  3A8A A;  4FU8 A;  3RU4 D;  1NTP A;  5C94 A;  2YNB A;  3S7K B;  1ANE A;  1SB1 H;  1DT2 A;  1GDN A;  2XRC A;  1THP B;  1DAN H;  4UFG H;  3Q3Y A;  2YNA A;  2JKH A;  3MO9 A;  2GT8 A;  4D76 A;  1E34 B;  4UFD H;  3KCG H;  4K1S A;  1A3E H;  1XUI A;  2J98 A;  3PRO A;  5FX6 A;  4CRE A;  3K2U A;  3A82 A;  3OY5 U;  2SGE E;  3C27 B;  2KFW A;  2VIV A;  1E37 B;  1RXP A;  4OS6 A;  4X6O A;  4YLQ H;  4UEH H;  1E79 D;  1TX6 A;  1PPC E;  5A0B A;  1GHB F;  2Z9L A;  3A7X A;  3ZYD A;  2KZ4 A;  5HKK D;  1CHO G;  1EKB B;  3LT3 A;  3MI4 A;  5K0H A;  1U6Q A;  1ESA A;  1A0J A;  2P3T B;  2QXJ A;  1DUA A;  2V7Q D;  1Y3Y A;  2V0B A;  3HGP A;  2CJI A;  2ZTZ A;  1AND A;  1JRS A;  1QJ7 B;  1T8M A;  3LC3 A;  1G2M A;  2V3M A;  3KQC A;  1C5T A;  1PQA A;  4A1T A;  3RXG A;  1KYN A;  1QY6 A;  1H9H E;  4MPV A;  3GY2 A;  1SHY A;  3EE0 B;  1ZLR A;  3RC4 A;  1TBR H;  4KTU A;  3ZZ8 A;  2ZGJ A;  1SSX A;  5AFZ H;  3GDV A;  3PTB A;  1EJM A;  5F8T A;  4KTS A;  4X1P U;  2Y5H A;  2ZCL P;  3SI3 H;  1GHZ A;  1BCU H;  3QGJ A;  1GGD C;  3SUF A;  1H8D H;  4YOI A;  3FKS D;  3BIV H;  3F68 H;  1HAG E;  1SKY E;  1PQ8 A;  1GI9 B;  2AHM E;  2FS9 A;  4X6N A;  2XOK D;  1Z71 A;  3NK8 A;  1HAO H;  3OFN D;  3VFE A;  4XDE A;  2A7C A;  1NBM D;  1BIO A;  2A1D B;  3KQ5 A;  4ZUH A;  1F0R A;  1XVO A;  1QBN A;  3IG6 B;  4JYT A;  1TX7 A;  4HG6 A;  3QLP H;  4H6T A;  1P9U A;  5HYO A;  1HAP H;  3EA9 A;  1TFX A;  5DO4 H;  2Y5G A;  5DJ7 A;  4GLY A;  4NA9 H;  5HIY A;  2WIN I;  4X8T H;  1O2K A;  4X8U H;  3FP7 E;  2BY7 X;  2J5U A;  1KIG H;  4O3U A;  1S81 A;  3GY6 A;  1AN1 E;  1IOE A;  1C2H A;  2ZFS A;  1K1L A;  4IMZ A;  1Y3X A;  2ODP A;  2AEI H;  1V2P T;  1TYN A;  4F4O C;  2FOE A;  3I77 A;  5EQS A;  2A2Q H;  3TK6 A;  2VIO A;  2BQ6 B;  1KLT A;  2QV1 A;  4Y10 E;  2ZTX A;  5GDS H;  1SGF G;  4NFF A;  1LPZ B;  1UCY E;  2WPI S;  3HKI B;  5JPM H;  2HGT H;  1KXC A;  3HKJ B;  2OQ5 A;  1WAY B;  4XRN A;  1BMN H;  3OTP A;  2D26 C;  1RGQ A;  4MLF B;  4DCD A;  3SNA A;  1LQD B;  5DSF A;  4Y7A A;  2RA3 A;  1UO6 A;  2P59 A;  3PTN A;  5B6O A;  1EAT A;  1O2Z A;  2H9H A;  4VGC B;  3SJ8 A;  1YLD A;  2A5I A;  3VXE H;  5J4Q A;  2H9T H;  4TY7 A;  4WMF A;  4XOJ A;  1ZRK A;  1QL9 A;  2KCO A;  2V35 A;  2W3I A;  3VGC B;  3VPK A;  1GHB G;  3GIS B;  3MQK C;  1MU8 B;  2BX3 A;  3IIT A;  1TNL A;  2Z3D A;  1BJV A;  1TWX B;  1ZHM A;  1EP6 A;  4JYU H;  3P8O A;  2BLW A;  4QT8 C;  4B2B A;  3SU4 A;  2BXU H;  4WY3 A;  4HI3 A;  3EAJ A;  3T29 A;  3QX5 H;  2ZI2 H;  1KXA A;  4TY6 A;  1D9I A;  2C8Y B;  1UTQ A;  3A81 A;  1C5Z B;  4DT7 B;  5F8Z A;  2THF B;  4B6F A;  1EZS C;  3MO3 A;  2Y6T A;  2PFE A;  1BJU A;  4MNW A;  3Q3X A;  3DSO A;  1SLU B;  8GCH G;  4ABE A;  2HNT F;  3BTK E;  3M7Q A;  2Z3E A;  2YMS B;  2L74 A;  2XYA A;  5GCH G;  1G2L A;  5I25 A;  2W26 A;  1QZ8 A;  1V2S T;  2OBQ A;  3SGQ E;  3PMJ A;  3SZN A;  1ORF A;  3E0P B;  1FDP A;  1H9L B;  3QWC H;  3R3G B;  1OP8 A;  1MTS A;  3K6Z A;  2VIQ A;  3M5M A;  1OP2 A;  4F48 B;  1O5G H;  1UK3 A;  2BHG A;  1GBM A;  2SGQ E;  7KME H;  2VIN A;  1O2O A;  3MU1 A;  2ZPQ A;  2F9U A;  1TNJ A;  4E7N A;  3ZV8 A;  3RXJ A;  1BT7 A;  1NU9 A;  3U98 H;  3U28 C;  4X1Q U;  1V2T T;  3BTE E;  3U8T H;  2XBY A;  1S5S A;  2CMY A;  1A1R A;  1C1M A;  1BRC E;  1L1J A;  2A7J A;  2W5E A;  2R3Y A;  2OIN A;  1V2N T;  1DX5 M;  4NSY A;  4CR9 A;  2KAI A;  1YPK H;  2J92 A;  3GCO A;  1XUH A;  3LGY A;  1MAX A;  3U1I B;  1IQK A;  2GX4 A;  2AS9 A;  4I86 A;  5J4S A;  2ZDV H;  3QO6 A;  4XFQ A;  2TPI Z;  1BBR K;  5ABW A;  3Q76 A;  1JOU B;  1NZQ H;  2SGD E;  4ZXX H;  1TRM A;  1O5D H;  3T27 A;  2BDC A;  2VVU A;  1C1N A;  1FV9 A;  1HLT H;  2AER H;  1YPG H;  2BXT H;  1S0Q A;  4GAW A;  1O2S A;  1G3E A;  1KTT B;  4OS1 A;  4ZH8 A;  1WUN H;  3U9A H;  4A1V A;  2PR3 A;  4WMD A;  1P2K A;  4Q2K A;  3BG4 B;  1DY8 A;  1COW D;  1J15 A;  2D2D A;  1KLI H;  2CV3 A;  2WPK S;  1ACB E;  2BYA X;  1O3N A;  4K69 A;  3TNS A;  3M61 U;  1T7C A;  3T2N A;  2W7S A;  3LC5 A;  2HRV A;  4RT0 A;  3H7O A;  1GI3 A;  1EFR D;  3E3T A;  4NIW A;  1YCP M;  4MPU A;  4U30 A;  1ZTL A;  2XC5 A;  4A7I B;  3B23 B;  1WTG H;  3DHK H;  4OGX A;  4R8T B;  4K3J A;  2ZWL H;  3M36 A;  1RS0 A;  3NRL A;  3ELA H;  1SGN E;  4YT6 H;  4AGJ A;  1XX9 A;  2G8T A;  2OC7 A;  5L30 H;  4GUX A;  3UQO A;  1P2Q A;  3ZZ7 A;  1M9U A;  2TGA A;  1SGQ E;  1FY4 A;  2ZFR H;  5JBB S;  1K0H A;  1QTF A;  2RCE A;  1NFX A;  2ANK H;  2PWX A;  5EW2 H;  2GDD A;  1WYK A;  4I33 A;  3PWC A;  8LPR A;  3KQE A;  3RU4 E;  1AKS A;  4NIX A;  3FOA A;  1ABJ H;  2ZFT A;  1TPO A;  1XM1 A;  2D8W A;  4B76 A;  4OS5 A;  3RXM A;  6CHA B;  4YXW D;  1LQE A;  1FLE E;  1UK2 A;  1BHX F;  1FUJ A;  3O8B A;  1BTY A;  1O3D A;  1P0S H;  3AAV A;  5GXP A;  1VIT G;  2XW9 A;  2ZGC A;  1GHV H;  1KXF A;  2BQ7 B;  4Y71 A;  5HIZ A;  3EDX B;  5DP8 A;  3BV9 B;  2HLC A;  2F9P A;  2A5K A;  1DLE A;  1MKX K;  1VKY A;  3SZE A;  3DSG A;  1P05 A;  2GMT B;  5L2Y H;  1UVO A;  1SQA A;  3N7O A;  4B71 A;  1TMB H;  2J94 A;  2PLX A;  1K1N A;  1CGJ E;  5JBT A;  4MNY A;  4NA8 A;  1VJA U;  1EB2 A;  2F4L A;  2FI3 E;  2JET C;  9LPR A;  5ESB A;  4BTU B;  1F2S E;  2W7U A;  4INK A;  4Q7X A;  1A5I A;  1SGI B;  3VB6 A;  3GY4 A;  4DG4 A;  2FMJ A;  1HAZ B;  1TGN A;  4WVP E;  1MTN B;  4TT3 D;  4UFF H;  3D65 E;  2JH0 D;  3DT0 H;  4UD9 H;  5F53 A;  1O3J A;  1GJA B;  2R9P A;  2Z9J A;  1GJC B;  2DUC A;  2VGC C;  1MBM A;  2PTC E;  3HPT B;  3PV2 A;  3MNB A;  5H4I B;  1O3I A;  3HK6 B;  3GCH C;  2AYW A;  2TGD A;  1EXF A;  2XBW A;  4FUH A;  4ABA A;  3LJJ A;  3SU0 A;  1GBJ A;  1CGH A;  2Y80 A;  1E1R D;  1ZTK A;  2R0K A;  3CS7 A;  1DXW A;  1C5W B;  2FEQ H;  3Q3K A;  1C2D A;  1O31 A;  4FUE A;  1C1U H;  3RLW H;  4D8N A;  3SOS A;  2G00 A;  3A85 A;  3KL6 A;  2BZ6 H;  2ZGH A;  2WPH S;  1HJA B;  2FXR A;  1C4U 2;  2EEK A;  3SN8 A;  5GPI B;  4UFE H;  2A32 A;  3TK9 A;  1ZPZ A;  2FOC A;  5C20 A;  1KDQ B;  2XND D;  4HZH A;  1Z8G A;  2A4R A;  1VIT F;  1H8I H;  4Q7Y A;  2BDB A;  1C4Y 2;  1O3L A;  1XUK A;  1HJA C;  3H5C B;  4UE7 H;  1VR1 H;  1O3A A;  1JIR A;  3A87 A;  3PRD A;  4AB8 A;  2OXS A;  1BIT A;  4ISO A;  4X2X A;  4AZ2 B;  1MQ5 A;  1ZJK A;  3L33 A;  3SV2 H;  1XMN B;  1CBW B;  4MTB A;  1MCV A;  2W6J D;  1ETR H;  1SBW A;  2ZP0 H;  4XD7 D;  4B74 A;  3BEI B;  3RML H;  1ZPC A;  4X2V A;  2P8O C;  1BML A;  1A46 H;  1C2I A;  1MKW K;  2CXV A;  3F9E A;  4U01 A;  3TPI Z;  1C1T A;  2SGA A;  4ABD A;  2F43 B;  3ZVD A;  2C3S A;  4FOU C;  4UDW H;  1ZR0 A;  2OUA A;  4XBB A;  1O2M A;  1Z6J H;  1GGD B;  2W3K A;  4R0I A;  2BDG A;  3JZ1 B;  3W94 A;  1ETS H;  1TON A;  1BRU P;  8EST E;  1A7S A;  2WPL S;  3SJK A;  1O5E H;  1Y3V A;  2Y81 A;  3SV6 A;  6CHA C;  1HUT H;  4HFP B;  3M5O A;  1S85 A;  1TRN A;  2C4F H;  1GJ7 B;  1NN6 A;  2HOB A;  3P8F A;  2FWW A;  5A0C A;  1LKA A;  1Z8R A;  4YT7 H;  4FUB A;  3GY5 A;  3RXC A;  4FU7 A;  1LHC H;  4FUF A;  5T6G A;  4IGD A;  3GY8 A;  3VB5 A;  3AK5 A;  1D3D B;  4JZF H;  2ZA5 A;  1C1R A;  1P03 A;  4A6L A;  5GWZ A;  1W0K D;  1N8O C;  3UNS A;  2IJD 1;  2Y5F A;  5LPF A;  1W7G H;  1W7X H;  2JIZ D;  2BLO A;  1H8E D;  3QTO H;  2B7D H;  1NFU A;  2BD2 A;  3F0O A;  3SJ9 A;  4IN2 A;  5DKM A;  5T6D A;  1GMD F;  1C5L H;  3RMN H;  1CHO F;  2O8W A;  5IYT A;  3F0P A;  3F2H A;  1PPB H;  2H9E H;  4NSV A;  1OHH D;  2NU4 E;  2UUK B;  2QF0 A;  3KNX A;  1GI5 A;  1BTH H;  1NBM E;  1QRX A;  1BQY A;  1KTS B;  3DSP A;  5DP3 A;  1FQ3 A;  3RXE A;  4AB9 A;  3O8R A;  1O2W A;  1CA8 B;  3BTD E;  3T26 A;  1MD7 A;  4K60 A;  5F8X A;  2C8X B;  2VU8 E;  5TCA A;  3LOX A;  2DE9 A;  3SI4 H;  2ZF0 H;  2GMT C;  5C1Y A;  6GCH F;  2Z3C A;  1KXB A;  2OQU A;  1KXD A;  1C1O A;  3ATI A;  1V2Q T;  2VVC A;  4NZL A;  2VBC A;  1EZQ A;  3RXV A;  2ZPS A;  5LH8 A;  4RKJ B;  2XC0 A;  4NG9 H;  2ZFP H;  2JJ2 D;  1SQT A;  1HXE H;  3TGI E;  4ZMA H;  3ZVF A;  1OPH B;  4NWL A;  4THN H;  1AZZ A;  2ODY B;  1K1M A;  2H6M A;  1O30 A;  5C5N A;  1LHD H;  2PKA A;  1MTN C;  1LHE H;  1HIA A;  5EXM A;  2P16 A;  1QRZ A;  3VG8 A;  1A0L A;  1C5N H;  1RJX B;  4M7G A;  5FXL A;  1GBC A;  5LGO A;  2SGF E;  1QBV H;  1HCG A;  1HPG A;  4ZKS U;  1C2J A;  4I8L A;  2EI8 A;  3TK5 A;  4D7G A;  1ZMJ A;  1GG6 C;  3MNC A;  4KTC A;  1EZX C;  1UTP A;  3GDU A;  2Z9G A;  5A0A E;  2D1J A;  4B75 A;  2J34 A;  2WPM S;  1ZSL A;  4IMQ A;  1IQM A;  1GVK B;  1O2Y A;  1MH0 A;  1LPG B;  1VGC B;  4MPX A;  4ABG A;  1AQ7 A;  5L2Z H;  1AKS B;  1C5X B;  1GCD A;  1OWH A;  3FO8 D;  2KCP A;  1P02 A;  1FY8 E;  5FCK A;  1O2V A;  1Z1J A;  5LPE A;  1SOZ A;  3WWB A;  5F6M A;  4IS5 A;  1XKB C;  1Z1I A;  3RXA A;  1NT1 A;  4KKD A;  1P2N A;  3ATM A;  2XTT B;  2QYI A;  3ATW A;  2FLB H;  5DP9 A;  1YYY 1;  1AY6 H;  1Z6E A;  1TAL A;  4I32 A;  3ATL A;  3MU0 A;  1Y5A T;  3GS9 A;  3ITI A;  3I78 A;  2H1U A;  2LEL A;  3ZYE A;  1A4W H;  1LVM A;  3ZVB A;  1CT0 E;  1UTK A;  1GJD B;  2PV9 B;  5IDK A;  5EG4 A;  1CT2 E;  1W3C A;  3MH4 A;  3UR9 A;  1F92 A;  2FIR H;  1TBZ H;  3UOU A;  1QCP A;  2IN2 A;  1EQ9 A;  1C1S A;  1D3Q B;  1SQR A;  1L1G A;  1ID5 H;  3S9A A;  1V3X A;  1YP9 A;  1O36 A;  3M3T A;  3URE A;  1DFP A;  1MTU A;  3PMA B;  3UB0 A;  4J2Y B;  3PRB A;  5TCC A;  2CHA B;  3SV7 A;  1NO9 H;  1EST A;  1HJ8 A;  5CMX H;  3P17 H;  1RRK A;  2H2Z A;  3EGK H;  1Z7K A;  3MNX A;  1DPO A;  3MO6 A;  4Y6D A;  1NY2 2;  4I8K A;  4FVB A;  1ELF A;  4XBC A;  1GHY H;  2QGR A;  4I8G A;  3R0F A;  3RUO A;  2TGP Z;  2J95 A;  2V3H H;  1C2L A;  4CH2 B;  4CRA A;  4KP0 A;  5C3N A;  1UVT H;  2SGP E;  3A80 A;  5HM9 A;  1HAY B;  2C8W B;  1O5F H;  2PTN A;  1TE0 A;  1EPT B;  2NWN A;  2VIP A;  1SVP A;  3UQV A;  3UUZ A;  3LGU A;  5FHT A;  4CRF A;  2A4O A;  3ZZD A;  5DP5 A;  2BDA A;  3SOR A;  1BMA A;  2J98 B;  3OU0 A;  3P6Z B;  4RSP A;  1K2I 1;  3BSQ A;  2ANW A;  3PV5 A;  2BLV A;  3V12 A;  1ANC A;  2Z7F E;  3D62 A;  1GMC G;  1O34 A;  4INL A;  2QY0 B;  1WU1 A;  3M35 A;  1YC0 A;  2BY5 X;  1QR3 E;  1YGC H;  1KY9 A;  5IK2 D;  1B7X B;  1GHX H;  2KR7 A;  1SI5 H;  4X2W A;  3BF6 H;  1O2P A;  1RTL A;  4TPI Z;  1FIZ A;  2ZKS A;  2QF3 A;  3BEU A;  2PGQ B;  1QL8 A;  4FUC A;  2BOK A;  3OE7 D;  3U8O H;  4ZHL U;  3E1X B;  5T6F A;  1GBI A;  1JIM A;  1SGC A;  2PUQ H;  3PLB A;  1LHG H;  4TWY A;  2P3U B;  1P8V C;  5AVD A;  2FTM A;  2ZC9 H;  3PMH B;  5EGM A;  1VJ9 U;  1NES E;  4K1E A;  4O97 A;  2BD5 A;  2ILN A;  1WSS H;  3B9F H;  3RM0 H;  1QB1 A;  1GWA A;  5FPY A;  2STA E;  4SGB E;  1AWF H;  1MD8 A;  1CU1 A;  1BRA A;  1GVL A;  2SFA A;  1FIW A;  4VGC C;  5A8Z A;  2UWO A;  2XWA A;  1F0T A;  4BAK B;  1C2M A; 
#chains in the Genus database with same CATH homology
 2YMS B;  2OC7 A;  3FKS D;  3SU1 A;  3SU6 A;  3EYD A;  5CHB A;  3O8R A;  1SKY E;  2A4G A;  2AHM E;  2OBQ A;  2W6I D;  2WHX A;  5EQQ A;  2XOK D;  5GPI B;  1DXP A;  3O8C A;  1BMF D;  3N7D A;  1KMH B;  3OFN D;  3OAA D;  3UB0 A;  3WW7 A;  4A1X A;  4DT4 A;  2WZQ A;  3PRB A;  2XND D;  2K0Q A;  2A4R A;  2K8I A;  1NBM D;  3LOX A;  3M5M A;  1NS3 A;  3SU5 A;  4I33 A;  1S6L A;  3SV7 A;  3SV8 A;  3KEE A;  4WH6 A;  2JDI D;  3P8N A;  3E90 B;  4RI0 A;  3KN2 A;  2QE7 D;  3PRD A;  2YMS D;  3FOA A;  5FPT A;  4B6E A;  4M9F A;  4WH8 A;  2F9U A;  2JJ1 D;  3RC6 A;  2VBC A;  4B76 A;  2WSS D;  4JMY A;  1BT7 A;  4YXW D;  4TSF D;  1H8H D;  2J5U A;  2GVF A;  1W0J D;  2XCF A;  5EPN A;  4TYD A;  2OBO A;  2A4Q A;  2JJ2 D;  2KCY A;  2W6J D;  3O8B A;  3OEH D;  4B73 A;  1A1R A;  5GJ4 B;  4K8B A;  4Z1M D;  4NWL A;  2YMS C;  4XD7 D;  3SU3 A;  3L6P A;  4B74 A;  2OIN A;  3LON A;  4ASU D;  2XCN A;  5EQS A;  3M5N A;  3SYJ A;  2FP7 B;  2QV1 A;  3RC5 A;  3U1J B;  3VG8 A;  3SUG A;  3SZE A;  2OC1 A;  2CK3 D;  3ZIA D;  3U1I B;  2KFW A;  4U01 A;  4Q4L A;  5C17 A;  5B6L A;  2F43 B;  1MAB B;  2XNI A;  4B71 A;  5ETX A;  2YOL A;  2GGV B;  5FPS A;  2FOM B;  5EQR A;  3PV5 A;  3SU2 A;  1DY9 A;  1E79 D;  4KTC A;  4ZCN A;  3F3B A;  3OTP A;  4A92 A;  2F4L A;  3KF2 A;  4B75 A;  1RGQ A;  2KZ4 A;  4WF8 A;  5ESB A;  5HKK D;  2K1Q A;  3SV9 A;  5DSF A;  3SV6 A;  5IK2 D;  2KM0 A;  2KR7 A;  3M5O A;  5EPY A;  2P59 A;  2V7Q D;  1N1L A;  2L6O A;  3FO8 D;  2QF5 A;  2KCP A;  1RTL A;  4F55 A;  2F9V A;  3OYP A;  4FET A;  2QF4 A;  2KCO A;  3LKW A;  4TT3 D;  3N7E A;  5GND A;  3WWB A;  4A1V A;  2WPD D;  5CDF E;  4A1T A;  2OC0 A;  2HLD D;  5F53 A;  3SUD A;  4OM9 A;  1E1Q D;  3OE7 D;  3AK5 A;  2KCA A;  2IJO B;  1DY8 A;  1COW D;  2O8M A;  5T1V A;  1W0K D;  2IJD 1;  3H09 A;  3PV2 A;  3P8O A;  2JIZ D;  3W1E A;  5C0T A;  1H8E D;  4I32 A;  5H4I B;  3RC4 A;  3F0O A;  5FL7 D;  3SU4 A;  5C0U A;  3GS9 A;  3F2G A;  1JXP A;  2LEL A;  1WXR A;  2M2A A;  2OC8 A;  3DCL A;  3F0P A;  3F2H A;  1EFR D;  5DN6 D;  5IDK A;  3FN8 A;  3N99 A;  3SU0 A;  1W3C A;  3SUE A;  1OHH D;  3OEE D;  1E1R D;  4NWK A;  5FPY A;  3O8D A;  2FM2 A;  4R8T B;  4B6F A;  1DXW A;  3F2F A;  1FX0 B;  3KNX A;  3M5L A;  3DSO A;  4Q63 A;  1CU1 A;  1NBM E;  3NRL A;  4I31 A;  3SUF A;  2WV9 A;  3DSP A;  2OK5 A;  3WWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...