2QF5A

High resolution structure of the major periplasmic domain from the cell shape-determining filament mrec (monoclinic form)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
158
Chain Sequence
ATKTLAADVIMRSPVSWKQELTLDAGRSKGASENMLAIANGGLIGSVSKVEENSTIVNLLTNTENADKISVKIQHGSTTIYGIIIGYDKENDVLKISQLNSNSDISAGDKVTTGGLGNFNVADIPVGEVVATTHSREVTVKLSADTHNVDVIELVGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell shape determining protein MreC
publication title High-resolution Structure of the Major Periplasmic Domain from the Cell Shape-determining Filament MreC.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural protein
total genus 31
structure length 158
sequence length 163
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qf5A01
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qf5A02
2J5UA 2QF5A 2QF4A
chains in the Genus database with same CATH superfamily
3VGCB 1NRRH 2WV9A 3O8CA 2C90B 2M5TA 2AFQB 3BTME 1Y5BT 2W6ID 6CHAB 3BG4B 3RMNH 5EU8A 2BY5X 1IHTH 1DT2A 1FDPA 3GY7A 2A7HA 1PPGE 3JZ2B 4HTCH 1AD8H 2ZHFH 2FTMA 3GCOA 3MNBA 4O3UA 2VGCB 3H5CB 3SQHE 3PM3A 1F92A 2C8YB 4CRFA 1J9CH 1JWTA 3KL6A 2V0BA 3LGTA 3QZRA 2RFKC 4H4FA 1ZRBA 5PTPA 1BT7A 1ZYOA 2YMSD 4JYTA 1DVAH 1OWJA 1DUAA 3A86A 4Y8ZA 1AO5A 3LGWA 3ZV8A 2FTLE 5LPEA 1DICA 4J1YA 1PPZA 1BTYA 1MD8A 4MG3A 1HIAB 2ZPRA 4Q4LA 1OKXA 2WSSD 2G8TA 4Z1MD 1ABJH 2UUJB 1AU8A 2PHBA 2Y81A 2W7UA 4HG6A 1E1QD 1C1SA 2M2AA 1YCPK 1RTLA 1GBEA 4GPGA 4AN7A 2TIOA 2STAE 2GCHF 4B6EA 5HMAA 3SJKA 3LH1A 1HAHH 1W7XH 1UK2A 1TE0A 3LIWA 3UOPA 1HAPH 2ZGXH 2G55A 1Z1JA 1BRUP 2BY8X 3DA9B 1H8ED 3PROA 5DSFA 1ZTKA 1GBIA 1UTPA 2Y5FA 4KTSA 5CHAB 1F0UA 2RG3A 3Q3KA 2QF3A 2ZDVH 1C2LA 1EZUC 3S9CA 1PPCE 5J4QA 1FY5A 4NWKA 1UTNA 2ZDKA 1DANH 1B0FA 1UVSH 4ASUD 3SHCH 2H5CA 3FKSD 3QTVH 1YCPH 2TGDA 1HLTH 1PQ8A 1O2LA 9LPRA 2FIRH 1EAIA 3FFGA 1DWDH 1O2JA 1YLCA 2DE9A 2AYWA 2AMPA 1Y3WA 2BDIA 2F43B 4K69A 4XDEA 1C1UH 1RD3B 1CBWC 4U01A 1VCPA 2GMTB 1GBLA 1THRH 1O3EA 2BXTH 2ZQ1A 4LXBH 4Q7YA 3SJIA 3RXLA 3UIRA 1FONA 3UR6A 4AG1A 2A5AA 3KQDA 3UR9A 3QLPH 4TYDA 3I77A 3A82A 3ATLA 2A2QH 3UWIA 2FESH 3TJUA 1XUFA 1YYY1 2GCHG 1AE8H 1IQGA 1GBJA 2BVRH 3U9AH 5LPFA 5AHGH 1GBAA 3PMJA 1O2VA 4TWWA 3A8DA 1LKAA 2W26A 2GV7A 3CS7A 5LPRA 1HAZB 1FY4A 1LO6A 3HKJB 3VB3A 1GJ4H 1MZAA 2ZCHP 3E1XB 3T2NA 3MHWU 4MPUA 2WPKS 3SI3H 4R8TB 1QJ6B 1ESTA 2Z9KA 4LK4A 1N8OC 3V7TA 1U6QA 2F83A 3KYFA 1PPEE 2FZZA 1AHTH 1LHFH 1HRTH 1SQAA 3FAOA 3MH6A 4FUDA 3U8OH 1GJ9B 1C1NA 1ZJDA 1ZPCA 4O97A 1D6WA 3LGUA 4I8HA 3LOXA 1O2RA 2PKSB 4E05H 1KLIH 2ANYA 1C4V2 1SC8U 3RXFA 2W3IA 1GG6B 1Z8IB 4NIXA 4Q2KA 5EIYA 1V2VT 3DCLA 1ID5H 5C0TA 1K1LA 2AERH 4AFUA 2HPPH 2YNBA 2OC0A 2A1DB 4JYUH 1ACBE 2ANKH 1W0YH 2SNVA 3SU2A 4B1TA 1OP0A 4ISIH 5DP3A 2PWXA 2AGIX 2K1QA 2Z9GA 1OSSA 2BXUH 3OE7D 1T8OA 1LVMA 1AFEH 1K1JA 2XCNA 5T3HA 3SGBE 4B2AA 2XBWA 2JH0D 2I6SA 1LVBA 4A7IB 3M61U 1GDQA 2CGAA 3R3GB 3TNTA 3N7OA 4DIIH 1DM4B 1XUIA 1BZXE 4XD7D 1PQ7A 3ENSB 3DUXH 1A7SA 2PW8H 3B9FH 1Y3UA 1P9SA 3RXBA 2PR3A 4X6NA 1P8VC 2GDDA 1ARCA 1CU1A 3GDVA 4X2YA 5DP6A 3TK6A 1LQEA 3P8NA 5C1XA 2ESTE 4H42U 2JETC 5GPIB 5F03A 1SGCA 4JYVH 4K8BA 1W7GH 5FCKA 4IN2A 1GJBB 4B2CA 3TJOA 2HOBA 3C27B 5JBCS 2WINI 2H2ZA 1UVTH 1HAOH 1W3CA 2BQ7B 5FL7D 2ZEBA 1Y8TA 1XX9A 3IWMA 4DIHH 4OS4A 1G30B 2OC8A 2P8OC 1C5MD 1MMJN 1GI8B 3ESTA 1GDNA 4NZLA 1UTKA 5DP9A 2L6OA 3KEEA 1NU7B 1YKTA 4JK6A 5A2MH 1S0QA 2ZWLH 1C5PA 2WV5A 2IJOB 1CA0C 1O3KA 3FZDA 3D49H 1UHBA 1A4WH 1F5RA 1WTHD 1GI0A 4AX9H 4BTIB 3I78A 4UFDH 1ELEE 1V2ST 1YPLH 2ZG0H 3I29A 3FANA 1WTGH 3F2GA 4WJG2 3MH7A 1ABIH 3T62A 3BV9B 1C1VH 4BAQB 3EGKH 3QZQA 2Q6GA 1XUHA 4YTAA 2Y7ZA 5JPMH 4MNXA 2GKVE 9ESTA 1C5XB 2QF4A 4ZHLU 2VIWA 1SQTA 4HI3A 1DXPA 4INLA 3OTPA 1C5TA 1P2QA 3SO3A 1NPMA 2LNCA 3SV6A 1G3CA 3A88A 1SR5C 3VB4A 2XWBI 1EXFA 2IPHA 1WU1A 3KQBA 2O8UA 1MKWK 5A8YA 1O2ZA 5HYOA 2BY6X 3SNBA 4ISOA 2A32A 3NRLA 4D7FA 1YF4A 1P01A 3ZYEA 4X6PA 5GCHG 1KLTA 3D62A 1DPOA 2AEIH 2G5VA 4I8LA 4CHAB 1T4UH 2EI8A 1SLXB 1W10U 2BX4A 4IBLH 1FLEE 5EJLA 1GBFA 1O2XA 2Z94A 1LHCH 2CF8H 2ZHWH 5HKKD 4RKJB 3HATH 2BM2A 2A5KA 3IG6B 4PROA 1AZ8A 1AZZA 2OINA 3WWBA 3WWFA 4YT6H 2IN2A 1W8BH 5GJ4B 4YXWD 3GYMA 4BANB 4ZHAA 1M9UA 3K9XB 2FOMB 1ELTA 4NIYA 5KEDA 1ZTLA 3MWIU 2QYIA 3LDXH 1MH0A 5F53A 1GJAB 5JBAS 2WPDD 1HBTH 1GBDA 2XRCA 2R2WU 4F55A 1SGYE 2CF9H 1JMOH 1MKXK 1IQNA 1WV7H 3GY4A 2Z7FE 4NCYA 1O3DA 4I86A 4MPWA 1PQAA 3SZEA 1O35A 1P3CA 3EYDA 2Z9LA 3A8CA 1UTLM 3SGAE 5CMXH 1GJ7B 1K9OE 5I25A 1O3NA 3JZ1B 1GJDB 2KX4A 1RFNA 1E34B 1HJAB 3BTFE 1P09A 1NRPH 5EPYA 1MBMA 3N7EA 2CHAC 1X7AC 1L1JA 1QZ8A 2R9PA 1C1OA 1HJ9A 5SGAE 1TPOA 1TOMH 1DE7H 1PQ5A 1V2JT 2QCYA 2XNDD 1GBBA 2J92A 1C2DA 4FOUC 2PP6A 5GXPA 1BB0B 1CHGA 4GLYA 2BDBA 2Q6FA 3KQ5A 2ZKSA 2NU1E 3A7YA 5ESBA 4K1TA 1UJ1A 1HUTH 1O33A 2P59A 3M37A 1L0ZA 1TNIA 2VIPA 2XC0A 4KELA 1DITH 3T5FH 3Q77A 4A5TS 2PFEA 2VIQA 3U28C 1GHWH 5C0UA 3Q3YA 1VKYA 2Z3DA 5T6DA 3QO6A 2OP9A 2ZDNA 4GCHF 2BDYA 2BMGB 1SGRE 1NU9A 2WPHS 3PV5A 5A0CA 1BMAA 3RLYH 6CHAC 3RXPA 1C1PA 5C1UA 1NBME 3A81A 1COWD 4NIWA 1SL3A 2VH0A 4JMYA 4GUXA 3URDA 5HM9A 3S7HB 1LHDH 1YLNA 1P06A 2KCPA 3MH4A 2VGCC 5DP8A 1ELDE 3E6PH 3BTTE 4XBBA 1TABE 4BTUB 2VH6A 1BRCE 3P17H 1DSTA 4IC5A 5EXMA 1UHBB 4FUHA 3ODDA 1OS8A 1GJ6A 5HIZA 2FP7B 4ACBA 2FM2A 2TBSA 1C5WB 1DUEA 1TQ0B 3BEUA 4X6MA 4E06H 1NM6A 2RA0A 1FXYA 4X8TH 1BTWA 1IQIA 3BG8A 4OM9A 1DY9A 3EA9A 2OUAA 2ZA5A 1GGDB 1O5BB 1AN1E 1O39A 1TGBA 5EQSA 5EXLA 4JCNA 1GHAF 2TGPZ 1HXFH 4BXSA 4ABJA 1D3TB 5AFYH 2AHME 1EJNA 2C8ZB 4UONA 1YPHC 3DSPA 1EZQA 1HDTH 1ZMLA 1TPSA 4GCHG 1TRNA 1ETTH 1AE5A 4ZMAH 2G52A 1O2OA 2R0LA 4A92A 5EGMA 3MU4A 1KTSB 1O3PB 5BRRE 4UDWH 4X1QU 2F4LA 2ZFFH 1GVZA 5FX6A 5I46H 1EB1H 1SVPA 4AYVB 1SLVB 3ATIA 5DPAA 1P11E 4I8JA 3TU7H 1E0FD 3GY3A 4DVAU 4JZFH 4TWYA 1JOUB 1BITA 2LP6A 3MI4A 1SI5H 5T6GA 5FXLA 1A2CH 1WAYB 1TNJA 4DOQA 5JB9S 5GDSH 4X1RU 2K8IA 1PYTD 2H1UA 1SGIB 2HVXA 1H9HE 2HLDD 2FOFA 2C8XB 2PKAA 4X2VA 3VPKA 5DJ7A 4FETA 1EKBB 1GJ5H 1LHGH 1BBRK 3F68H 1Q2WA 1A5IA 2FWWA 5L30H 4O03A 1V6DA 1W12U 3RMMH 2A4GA 1SGQE 5E0JA 3ZVDA 2ZDAH 3ZZ8A 2J94A 3AW1A 3CNRA 1C1TA 2FXRA 1GHAG 2A4QA 2GVFA 2ZGJA 4B73A 4IS5A 1UVOA 4CRBA 3RXMA 2B0FA 1EP5A 4B6FA 1HAGE 2FODA 2STBE 2ANMH 3MU1A 2Y82A 2A4RA 4UD9H 1ANEA 1Z8GA 1QL8A 1SOTA 4X1PU 4X8VH 1O3LA 2AH4X 2BTCE 1GL1A 3TPIZ 3NZIA 3BTKE 3UFAA 1NY22 2Y7XA 1F2SE 1VGCC 5L2ZH 3GOVB 3BEFB 3PO1B 3ZZ3A 3STJA 1RS0A 3ZVAA 3TK9A 2F9BH 2NU4E 1TPPA 2BYAX 4NA7A 1GBMA 3MQKC 4RT0A 2WPJS 4YOJA 2EY4C 2XNIA 3QTOH 3T26A 2BQ6B 2V3MA 3LJJA 2ODYB 4MQAA 4MNWA 1YPKH 1GVKB 2PKSC 3HPTB 1GCDA 1WQSA 2XYAA 5C5OA 1KY9A 1YWUA 3RXJA 1UVUH 2VVCA 1QJ7B 2VU8E 3MO3A 4K2YA 3H09A 1O5AB 2A31A 3MH5A 3QGNB 1Y3VA 2TGTA 2P95A 3NPSA 1UW7A 4TT3D 3RU4D 4FUFA 3PLKA 1V2PT 1TRMA 1FUJA 4Y8YA 5E0HA 1S82A 3AAUA 3SV9A 1W0ZU 3RM2H 1TA6A 1DY8A 4NGAH 1BOQA 3PV4A 1Q3XA 1H9LB 2VIOA 1EAUA 4K60A 3K6YA 2DE8A 5FAHA 2Q1JA 1OYQA 4RN6A 3PB1E 4BAOB 3M35A 1TBZH 2FYQA 2R0KA 2W7SA 2GJGA 1W13U 2JH5D 5FX5A 3S69A 1EZSC 3MNXA 3GCHC 1KXCA 1IQHA 1CA8B 4O3TA 3LC5A 4XBCA 5FHTA 1LHEH 1KSNA 2AIQA 1MTNB 2GZ8A 1BTUA 3SNCA 1C5LH 4MLFB 1XVMA 1T4VH 3RMLH 3VFEA 1O2YA 4AC9A 1MABB 1O36A 3ZVEA 2Q6DA 4NSYA 1SHHB 2BOKA 3RU4T 1YY3A 1CGHA 1W14U 3EA7A 3F6UH 3VXEH 4DCDA 3T25A 2W5EA 1O5EH 1GDUA 1CSOE 3V13A 1BTPA 2ZHQH 3QUMP 3AK5A 1ZPZA 3DSOA 2WZQA 4UE7H 2RCEA 1QCPA 1JRSA 2BD2A 1HJ8A 1MQ5A 1DFPA 2BZAA 2O9QA 1P2MA 3MU0A 2VB0A 5IYTA 1QRZA 1S5SA 1J14A 1XMNB 2CN0H 2OC1A 3P70B 3SV2H 1O3MA 2B9LA 1ANBA 1UTQA 1VCQA 4CBOA 1JXPA 3HK6B 1V2QT 5E8EH 1O3BA 2Y6TA 2BVSH 1QQUA 1ZSJA 1GI9B 4B76A 2VWLA 2HPQH 1H8IH 2PKAB 5C3NA 1NFUA 1MTVA 3EQ0H 2FOEA 5AFZH 1L4DA 3M5LA 1KIGH 1C5UA 1EOJA 1YGCH 5AF9H 1EP6A 3RXDA 1O2PA 4O9VA 2G00A 3OY5U 5EXNA 4I31A 4AYYB 2AGGX 1NBMD 1K1MA 2PUXB 5LGOA 3H7OA 1MTSA 4NZQA 1SOZA 3R0FA 1Y5AT 2P3FH 1Z7KA 2IOTA 5A0BA 1V2RT 1YPHE 2HLCA 4WMEA 1PPBH 3GY8A 4WH8A 2J4IA 1G32B 1ETRH 1TX7A 1AQ7A 2ZO3H 2OQ5A 3GDSA 4FUGA 4KGAA 2QIQA 4CH2B 1C2HA 2BLOA 1THPB 4TSFD 3M36A 1LDTT 2RA3A 1QB9A 4I32A 1FIWA 3V12A 3DFJA 3U1IB 1O38A 1YPMH 4Y10E 1AFQC 1OOKB 1DX5M 1HCGA 1SSXA 3ZZDA 1QB6A 3OY6U 1TLDA 1S6HA 1C5SA 4HFPB 1NFWA 4DY7B 1KLJH 2G4TA 1GI4A 1PPHE 1FMGA 4UEHH 1GVLA 1SGDE 3P92A 2PSYA 2V7QD 1TMTH 1XKBC 1L4ZA 2KM0A 4MDSA 3BN9A 1P10A 1SGTA 2KAIA 4FUIA 4VGCC 3ZZ6A 3KIDU 1TONA 1FQ3A 1O31A 5DK1A 1DLEA 1INCA 2BD4A 2A45B 2ZFPH 1HJAC 1P2KA 1V2OT 2Z3EA 2ZHEH 1QFKH 4QT8C 1P2NA 2FI4E 3ZIAD 4DGJA 5C5NA 1EASA 1HYLA 1C2JA 1P2JA 2G5NA 2P94A 3ZZCA 3PLBA 2Z6BD 1XVOA 1TNHA 5DO4H 4ABGA 1GPZA 2FOAA 4ZAEA 1UVPA 2ZFQH 4DT7B 1OPHB 1AUJA 2YMSB 4AGJA 4X0WU 1DXWA 1EQ9A 2EQNA 3NKKA 1S6LA 3FO8D 2LPRA 1S6FA 5JDUB 1BHXF 4RKOB 1H9IE 4UFGH 1ZGVA 3PMAB 5CDFE 2O8TA 4D9QA 1D3DB 3A84A 4JK5A 3AVZA 5EG4A 8GCHF 2JDID 1O2HA 2V3OH 2FO9A 5FBEA 1TAWA 1QBOA 1A0HB 1QQ4A 1BMMH 1QRWA 2KR7A 3LC3A 4I7YH 4P02A 3VXFH 1C5QA 2FYRA 3EA8A 2O8MA 3M3VA 1YCPM 3GCTF 1FI8A 4A1VA 1KXBA 1NTPA 4CR5A 2R3UA 4U30A 1D4PB 3BIUH 3B8JA 2L74A 2VIDA 3B23B 1O30A 2BDAA 2OBQA 1C4U2 2ZCLP 1NFYA 2UUFB 4BAKB 2PTNA 3F9EA 5CHBA 4B71A 2JJ1D 3ATMA 4CR9A 1PJPA 5C67A 1OYTH 3UQVA 4A6LA 4FU7A 1IQLA 3SU6A 7ESTE 2BOHB 4WVPE 4KTCA 3PWBA 4TY7A 2F3CE 2QY0B 1MTWA 2XW9A 2FI5E 2B5TB 2F9VA 1AIXH 2GV6A 2K0QA 2WUBA 1RIWB 2KCAA 3WY8A 1NRSH 1V2LT 1CT2E 1HFDA 3LH3A 1IQJA 2BY9X 4Y0ZE 1IOEA 2H9HA 3RU4E 1XUJA 3HKIB 1B5GH 4JZIA 1GGDC 1AMHA 1KYNA 1SFIA 1TALA 2XBXA 2Z9IA 1SGPE 3E8LA 3S7KB 1O37A 2PGQB 3WW7A 1GMDF 1S81A 1F0SA 3CS0A 1JRTA 1QA7A 3BTQE 4I8KA 2BD3A 5C94A 1EJAA 1ESBA 3KCGH 8GCHG 1TGCA 2BY7X 1EX3A 2JJ2D 1MTUA 1N6YA 3GCTG 1LPKB 3RC4A 1ELFA 2ZU1A 4YO9A 2BLVA 2A4OA 1EAXA 1RJXB 1HNEE 1MKWH 1GBCA 2VBCA 3SUFA 4B2BA 2QN5T 5K7RA 1CGIE 5FPSA 4IW4E 2Y80A 1O5CB 1GI7B 2ZFRH 3Q76A 3U98H 1H1BA 1C2KA 1S85A 1MQ6A 1W0KD 3ZZ7A 1G9IE 1MU6B 7LPRA 2V3HH 4OGXA 4IN1A 3NXPA 3ZYDA 2ZI2H 1TYNA 2A7JA 1AB9C 1KXDA 2IJD1 3SW2B 5FBIA 1DWCH 3PWCA 2C93B 1IQMA 4FU8A 5J4SA 3LU9B 1W0JD 2GZ7A 1CT0E 2OQUA 2HNTC 3TGIE 1EPTC 2UWOA 2ZC9H 3D23A 3UNQA 1C9TA 2ODQA 4B75A 1GHBF 5E0GA 1TBQH 5GNDA 2NU2E 5EJ1A 1TX6A 1UTOA 1GMCF 4M9FA 1MUEB 2NU0E 5KECA 3MYWA 1T8MA 3SZNA 4ACAA 3RUOA 4OS2A 3V3MA 4DJZB 3M7QA 3DFLA 1O3HA 4FVDA 1V2UT 3QN7A 3P8GA 1FPHH 2FI3E 4AGKA 4H6SB 3FN8A 5JB8S 1MKXH 3SNDA 1YPEH 1AGJA 1QIXB 2KAIB 1Y59T 2GCTB 2BLWA 4MPVA 3KN2A 1O32A 1A0JA 2R3YA 4MVNA 3GY6A 3EE0B 2JETB 1UCYK 2KCYA 1HAVA 4F48B 1BBRE 1HXEH 3PO1C 1GJ8B 2F9NA 3SUEA 1E1RD 5DP7A 3E3TA 5EQQA 2EI7A 3SV7A 1DLKB 2XTTB 2OC7A 2P3TB 3FZZA 3VGCC 2SNWA 5B6LA 4Y6DA 1BTHH 1T31A 2P8OB 3IITA 4WMDA 2AMDA 3KQCA 3SUGA 3BG4C 2HWLB 2VVUA 2VVVA 4BOHA 2SGQE 3SNAA 2D1JA 3NK8A 5HGGA 1V3XA 5F8TA 2QF0A 4Z6AH 4Y7BA 1OXGA 3LPRA 1L1GA 4NFFA 2OD3B 3BEIB 4ISNA 1BRAA 1YLDA 5EOKA 1F0TA 1BDAA 2F9PA 1J16A 2ZFSA 3OAAD 1GHBG 3BTDE 2OXSA 1DS2E 4JZEH 3AASA 1GMCG 2RDLA 1WQVH 1XM1A 1Z1IA 1WSSH 1S0RA 2BX3A 3OFND 3RXSA 4OS6A 3PV2A 4AFSA 2A0QB 3O8DA 4J2YB 3PMHB 2FDAA 4BNRA 1V2MT 3F3BA 1A3EH 1QB1A 1D9IA 2BHGA 2ASUB 3QGJA 1DOJA 2B8OH 5DG6A 3CP7A 3TH3H 3C1KA 1D6RA 3ITIA 1Y5UT 1FPCH 4OGYA 3TLOA 4GHTA 2BDHA 3ZVFA 3SQEE 2F91A 3F9HA 3A7ZA 2FS9A 6GCHF 1ELCA 2WHXA 3RXEA 1FY3A 4NFEA 1QHRB 2G4UA 1TBRH 3RP2A 4OS7A 3ZVBA 1MTNC 1HAXB 1GI3A 2OBOA 5CHAC 3MTYA 3L33A 4F49A 3S9BA 3RC5A 2XWAA 1GJCB 2H9TH 3CENA 3RMOH 3SU0A 4THNH 4YT7H 1O3IA 3TJVA 2GGVB 1O2MA 1J17T 1XXFA 1LCYA 4YOGA 1BRBE 4Y11E 4WMFA 4AG2A 4CRCA 1QGFA 1SMFE 4Y7AA 4XFQA 1CHOF 3RLWH 1UTMA 4NA9H 2ZNKH 1TFXA 2PV9B 3A7TA 1K21H 2WYGA 4CBNA 4U2WA 1BIOA 3FP6E 4GSOA 4TPYA 4K3JA 1WOFA 5BPEA 2ZU2A 4I8GA 5EODA 5EPNA 3TH4H 1RGQA 2UWPA 1ELAA 1CGJE 1F5KU 2AMQA 2I6QA 4GHQA 4AOQA 2GMTC 3AW0A 1C2GA 4Y0YE 1C9PA 1AKSA 2FMJA 5FPTA 3STIA 4LOYH 5H4IB 1FX0B 1NN6A 2ZIQH 1LVYA 2UUYA 1TWXB 2ZF0H 3MFJA 4FU9A 1JBUH 1ZMJA 1A3BH 2OK5A 1SLWB 2Y5GA 4ASHA 4ISHH 3ZZ9A 6GCHG 2BDGA 3BIVH 4B74A 2J34A 4ESTE 3NWUA 1ZR0A 1O2WA 4ZXYH 1MBQA 4Q63A 3A87A 4SGAE 1BBRH 2HRVA 1O3FA 1ANDA 3SU1A 3NCLA 4DW2U 2GZ9A 1C5ZB 5T6FA 3UNRA 3SNEA 3BTEE 1MD7A 3TVJB 1SBWA 1ZOMA 2CHAB 2WYJA 1GCTB 2OTVA 3P8OA 2HVYB 1OP8A 1EOLA 3ATWA 4NWLA 3MNSA 5EQRA 1HGTH 4ABDA 4AFZA 1GHZA 1KMHB 4A1TA 1AUTC 1BUIA 1ZSLA 4Y76A 4AZ2B 5L6NH 4YLQH 3M7UA 1JIMA 2CV3A 2UWLA 1VITH 4Q80A 2GT7A 3RXAA 2PUQH 1FIZA 1ETSH 4K1EA 1GG6C 5T1VA 1A61H 1D3PB 5JBBS 2ZDMA 5HM2A 2SFAA 3RXGA 3RXCA 4ABIA 3A8AA 1HAVB 1LPGB 1O3OA 1C5NH 2CK3D 5A09A 2ZGCA 4GAWA 4CREA 3GY2A 2NU3E 1MAXA 1OWDA 1C5OH 1QBVH 3U8RH 2BD9A 5IK2D 1C1QA 2XXLA 1P12E 4OS5A 2QXIA 5DKMA 1A5HA 2CXVA 4INHA 4ZH8A 1FY1A 1MZDA 1K2I1 1NESE 1GBKA 4MNVA 2XOKD 4IC6A 3BTHE 3TITA 2THFB 2ZZUH 3P6ZB 3PLPA 1Z8JB 4CH8B 1ZHMA 2SGFE 3A83A 4ZKNU 4DURA 1ELGA 1WXRA 2KCOA 2HNTE 4K8YA 3KQEA 4LZ4B 2ZU5A 1TA2A 3UNSA 5FPYA 1TX8A 2QXHA 3SI4H 1O0DH 4YOIA 5TJXA 1GBHA 4WXIA 3PTNA 1A46H 1P2IA 1TGSZ 4XBDA 1AWHB 4FVBA 2FOBA 4Z0KA 1KXEA 5A0AE 1HPGA 1LKBA 3A7WA 1LTOA 2SGPE 3LGIA 3TGKE 2VNTA 3GDUA 5EJZA 2RDEA 2O8WA 2GD4B 1K1PA 1K1IA 2J97A 4KKDA 4ZKSU 2YMSC 1XKAC 1TQ7B 1SQRA 5EW2H 4E7NA 2TGAA 2QV1A 1AVXA 2PGBB 4X2WA 2EA3A 4CRGA 1K22H 3LT3A 1OWIA 1ESAA 3A7VA 4ZKOU 2W6JD 3KYGA 2Z9JA 1ZSKA 1WCZA 3Q00A 4XOJA 5F6MA 1FNIA 1QJ1B 3OSYA 4ABAA 8ESTE 4CRAA 3E16B 5F8ZA 4ABBA 1FV9A 2FX4A 5HIYA 1Z6JH 3QK1A 3PRBA 1KTTB 1SLUB 3LGVA 4D8NA 4X2XA 1FAKH 5ETXA 3SOSA 3DSGA 2QA9E 1QA0A 3GISB 3FP7E 5CE1A 3ZVGA 1O2UA 1E38B 1AY6H 1H8HD 1BQYA 1DWBH 2FOHA 1EB2A 4KP0A 1N6XA 4RT1A 1EJMA 2QF5A 4X1SU 1HB0B 1WUNH 1SGEE 1HV7A 3MOCA 1RIWC 3FP8E 3GY5A 1AKSB 1P9UA 3OEED 5GWZA 1Z6EA 3K65B 2R2MB 4K5ZA 1C2FA 2ZPQA 3N99A 1UK3A 2F9UA 3N7DA 3OYPA 4IGDA 4AB8A 3U69H 1EZXC 1ZPBA 2VWOA 1NROH 1A1RA 4R0IA 5TCAA 3UY9A 1PPFE 4H6TA 3KNXA 1K1OA 1O2IA 4CHAC 4LZ1H 1LMWB 4ZHMU 1VGCB 2JH6D 4XE4A 4UFEH 2C3SA 5LH8A 3A8BA 1C2MA 2ILNA 2KZ4A 2D8WA 1C5RA 4ZKRU 3F0OA 2G51A 7GCHF 1VZQH 4WWYA 2XC4A 3KF2A 2FEQH 1ELBA 1GI6A 1TGNA 2NWNA 3F2FA 4JZ1A 2XBYA 3UOUA 1PFXC 1W2KH 1GHVH 1OWKA 4FUEA 2QXGA 1O3GA 3MNCA 1CQQA 4CRDA 2ZHDA 1E79D 1AVGH 2BDCA 1EATA 3RXHA 2ZU4A 1O34A 4D76A 2FPZA 3UB0A 3L3TA 4HZHA 1T8LA 4WH6A 1VITF 1V2TT 3E91A 1TNKA 1TRYA 2BLQA 2XBVA 2FOCA 3ATKA 5FCRA 3W1EA 1ZRKA 3A80A 4MPXA 3RXVA 2DUCA 3BF6H 4ZCNA 4D7GA 2G81E 1V2WT 4DT4A 3U8TH 4Y71A 3SJOA 1LPZB 2FX6A 1TMUH 1VCWA 4FUJA 2XC5A 3M3SA 2J5UA 4ZROA 1JIRA 1V2KT 3SU3A 3S0NA 1D3QB 3GS9A 1VJAU 2ANWA 5G4BA 4ZUHA 1P57B 1NRNH 2GCTC 2JIZD 7GCHG 1BTZA 1VR1H 1YP9A 3ELAH 3KHVA 3GCHB 4TPIZ 3E0PB 2KFWA 4XSKU 3BTWE 1QY6A 8LPRA 3SU4A 3QDZB 4HGCA 1YC0A 3GICB 1W11U 1BA8B 5C20A 1SB1H 3M7TA 1MAYA 3LONA 3P8FA 1BMFD 1KXAA 1YPGH 3E0NB 3F0PA 1OWHA 1SKYE 1T8NA 2VJ1A 2VINA 1O3AA 1NT1A 4JZDH 2EC9H 2J9NA 3RXQA 1NS3A 3K2UA 2GTBA 1DWEH 1VITG 2ZECA 1C5YB 4FUCA 3MMGA 1C2EA 3L6PA 2V35A 2VWNA 3A7XA 5GIBA 5GCHF 1DDJA 2VWMA 2A5IA 1G3EA 2J98A 1F0RA 2FLBH 3D65E 4ABEA 1KXFA 4F4OC 3RXIA 2BD5A 1RRKA 4D9RA 1O2KA 1TOCB 2ZQ2A 1C2IA 2QGRA 1UCYE 1CBWB 4ISLA 1WBGB 3F9GA 3T29A 4ZXXH 2H6MA 5C2ZA 1P2OA 1RTKA 2HALA 3TIUA 4BAMB 2ZU3A 4GVUA 1E36B 1ZJKA 4YZUA 1O3JA 3MO6A 2BD8A 3UAIC 1VJ9U 1QR3E 1P04A 1GL0E 1TIOA 3ZZ4A 1KDQA 1LQDB 3UTUH 1O5FH 1EUFA 4WY3A 2ZGHA 4ABFA 2QAAA 1P0SH 4X8UH 4U32A 2FS8A 1ZHPA 3GCNA 4KTUA 2A2XH 2OCVB 3OEHD 2SGDE 4XRNA 2YNAA 1THSH 1SPJA 4BTTB 1L1NA 4OS1A 2FOGA 2UUKB 1UO6A 1QURH 1TGTA 2ZCKP 1N8OB 2H9EH 2ZFTA 3UQOA 1Z71A 2C8WB 1ZZZA 1GI1A 4IMQA 1CVWH 2SGAA 6ESTA 3KGPA 3F9FA 1HAIH 1NO9H 2QXJA 2GT8A 3SORA 4BAHB 5A8XA 1ZTJA 2EI6A 3SBKA 3PMBB 4Q7XA 3T28A 1G37A 3VB5A 3VB6A 3K6ZA 3RXTA 1IQKA 3H7TA 3OTJE 1O2GH 2FLRH 4FUBA 1Q31A 1A5GH 1K28D 1T7CA 5E2OA 3EDXB 3SU5A 1FJSA 3SGQE 1SGFA 2P16A 1EPTA 3FVFB 1J15A 7KMEH 4NIVA 1AFQB 3DHKH 1G36A 2W3KA 1O2TA 1UMAH 1BCUH 4P00A 3S9AA 1MU8B 3PRDA 1IAUA 2BVXH 1ORFA 3M3TA 1NZQH 2IPQX 1P3EA 1GMDG 1G2MA 1FAXA 2BD7A 3QX5H 1N1LA 1QNJA 2C4FH 4VGCB 5L2YH 3AAVA 3SYJA 1BTXA 5HXFA 3TK5A 2CMYA 1AI8H 1QL7A 4YM9A 1BHXB 5ESTE 1AWFH 5C1YA 3UWJH 1B0EA 2HNTF 3PYHA 4K1SA 3VEQB 1FN8A 1Z8RA 3HK3B 1XUGA 1S83A 4YESB 1TNLA 1O5DH 1GCTC 1GMHF 5TCCA 3PTBA 1NRQH 3W95A 1GBTA 2WPLS 2P3UB 1TMBH 1H8DH 1S84A 1SGNE 2J2UA 3LGYA 1BMNH 4RI0A 5AVDA 3O8RA 3Q3XA 2ALPA 1DSUA 4ABHA 2WUCA 1C5VA 2PSXA 4AFQA 3F1SB 3HGNA 1GWAA 4X8SH 3A89A 2H5DA 3V0XA 1L2EA 1O2NA 3M5MA 4WF8A 1EAWA 1CA0B 1BJUA 1O2SA 1UCYH 5E2PA 3NUMA 1BMLA 4FXGH 1ZGIA 3RXOA 1B7XB 3TJNA 1BJVA 2ALVA 5JBTA 1E35B 1T32A 1GHYH 1H4WA 1ZMNA 2JKHA 1F7ZA 3LJOA 2BQWB 3LKWA 1G2LA 1YM0A 1HIAA 1EFRD 5F8XA 3M5NA 3RDZA 1UTJA 3RXUA 2Y5HA 5DGJA 3ZV9A 1IQEA 3OU0A 4I33A 1K0HA 1SGFG 2ZTXA 3TGJE 4Q7ZA 4M7GA 1HAYB 3UUZA 2J98B 1CT4E 1TPAE 1GMHG 3ZZBA 5A8ZA 4DG4A 1C1WH 2A7CA 1G3BA 1MCTA 1C1RA 1FN6A 4SGBE 2WV4A 2ODPA 2PTCE 5IDKA 3BSQA 3HGPA 5DP4A 1QL9A 4IMZA 4MNYA 3SN8A 1Y3XA 4AB9A 4NSVA 1F5LA 3URCA 4NG9H 3TH2H 2TRMA 2AIPA 4AORA 2ZPSA 3P95A 1ELVA 1E37B 1FY8E 1J8AA 5DN6D 1C1MA 1K1NA 5ABWA 1KDQB 1WYKA 1GHXH 1O2QA 4TY6A 3UPEA 1P02A 3MU8A 3UREA 2J95A 2QE7D 3ZVCA 1O5GH 2D26C 3RC6A 1RTFB 4WXVA 3RXKA 2Z3CA 4X1NU 3ZZAA 2GP9B 3TNSA 4UFFH 1C4Y2 3T27A 2B7DH 8KME2 2SGEE 2PLXA 1MCVA 3QWCH 2AS9A 3GYLB 4Y79A 1TNGA 2XCFA 2ZDLA 5JYIA 4Y8XA 3ODFA 3DT0H 5DP5A 1ANCA 2F9OA 2LELA 2TPIZ 2ZGBH 2D2DA 3FOAA 3W94A 3EE7A 1O3CA 3OX7U 3SJ9A 1OP2A 1QTFA 3SUDA 2ZP0H 3BTGE 3EAJA 2OLGA 3A85A 2HGTH 2V6NA 1A0LA 2AGEX 1SG8B 3RM0H 1GI2A 2ZTYA 1AB9B 2ZTZA 3SHAH 2O8LA 5B6OA 1TB6H 5K0HA 3VG8A 1P03A 1ZLRA 2GX4A 1CO7E 1EPTB 1NC6A 1FZZA 1WDIA 3M5OA 2ULLA 1PYTC 4A1XA 3ZZ5A 4BXWA 1CE5A 4YLUA 1SFQB 1QBNA 2YOLA 5EW1H 4E7RG 4RSPA 1AVWA 1IHSH 3SJ8A 3DD2H 1YBWA 5KGOA 3SV8A 2BZ6H 1Y3YA 2WPMS 1YPJH 2WPIS 1G3DA 1ARBA 1P05A 1GI5A 3U1JB 1CHOG 1OX1A 4X6OA 1SHYA 1QRXA 1ZHRA 5C17A 1XXDA 2GDEH 1RXPA 3F2HA 1XUKA 2VIVA 2J38A 1IQFA 3MO9A 1OHHD 2QC2A 2EEKA 1OWEA 1V2NT 4INKA 4MTBA 3VB7A 3MU5A 4NA8A 1LVOA 2CJIA 1SQOA 2P93A 2BB4A 3RXRA 1NFXA 1UK4A 3E90B 6LPRA 3G01A 3O8BA
chains in the Genus database with same CATH topology
4U01A 2WV9A 3KNXA 3SUEA 2F9VA 1E1RD 2K0QA 3O8CA 5EQQA 3L6PA 1MABB 5EPNA 3SV7A 2A4RA 1RGQA 2KCAA 2KCPA 5GPIB 5HKKD 2OC7A 5FPYA 5DN6D 2OINA 2W6ID 4K8BA 3WWBA 3WWFA 1N1LA 2V7QD 4TYDA 2KZ4A 5B6LA 5GJ4B 3SYJA 4YXWD 5FPTA 2QE7D 3F0OA 3RC6A 2FOMB 1FX0B 1W3CA 2KM0A 5H4IB 5FL7D 3SUGA 2FP7B 3KF2A 2FM2A 3AK5A 3WW7A 3F2FA 5F53A 3DSOA 2OC8A 2WZQA 2OK5A 2WPDD 2XNIA 4OM9A 1DY9A 2L6OA 2YMSC 3KEEA 4B74A 4F55A 1BT7A 1E79D 2OC1A 2XCFA 3OAAD 2JJ2D 4Q63A 2YMSD 5EQSA 3ZIAD 3RC4A 2IJOB 4R8TB 3SZEA 2LELA 1JXPA 2QV1A 3EYDA 2AHME 3FOAA 3SU1A 4RI0A 3DSPA 3O8RA 3UB0A 3OFND 4B76A 3SUFA 2VBCA 3PV2A 4WH6A 3SUDA 4Q4LA 3O8DA 5FPSA 4A92A 2WSSD 3H09A 3OEHD 3P8OA 3F2GA 2YMSB 3W1EA 2W6JD 4Z1MD 1DXWA 4NWLA 3F3BA 5EQRA 1S6LA 3FO8D 5EPYA 4ZCNA 3N7EA 1E1QD 2F4LA 3M5MA 1W0KD 3LOXA 4WF8A 3M5LA 1KMHB 2M2AA 4TT3D 4A1TA 4DT4A 1RTLA 3VG8A 4B6EA 3DCLA 2IJD1 5CDFE 5C0TA 2XNDD 2QF4A 4I31A 3M5OA 3PRBA 1NBMD 2J5UA 4A1XA 5T1VA 2OC0A 3SV9A 1W0JD 2JDID 1H8ED 2YOLA 3LKWA 5DSFA 5ETXA 3SU3A 2K8IA 1DY8A 3SU2A 1DXPA 3GS9A 5ESBA 2HLDD 2WHXA 2KR7A 3OTPA 1EFRD 2CK3D 2K1QA 2P59A 3M5NA 2O8MA 3SV8A 4FETA 2JIZD 4B75A 3SV6A 3OE7D 1H8HD 5GNDA 4A1VA 2XCNA 2OBOA 2KFWA 4M9FA 4WH8A 4NWKA 5IK2D 5C0UA 3RC5A 4I33A 3U1JB 2QF5A 3SU4A 5C17A 3SU0A 2A4GA 3SU5A 3F2HA 2OBQA 4ASUD 3OEED 1OHHD 2GGVB 3FKSD 3NRLA 4XD7D 5CHBA 3FN8A 3LONA 3PV5A 4B71A 2JJ1D 4TSFD 2XOKD 1BMFD 3N99A 1NBME 1COWD 2A4QA 2F9UA 2GVFA 3KN2A 3N7DA 4B73A 3F0PA 4I32A 3OYPA 5IDKA 1CU1A 3SU6A 1SKYE 2KCYA 3U1IB 2F43B 3E90B 3PRDA 4KTCA 4JMYA 3O8BA 3P8NA 1A1RA 1WXRA 4B6FA 1NS3A 2KCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5U A;  2QF5 A;  2QF4 A; 
#chains in the Genus database with same CATH topology
 3VGC B;  1NRR H;  2WV9 A;  3O8C A;  2C90 B;  2M5T A;  2AFQ B;  3BTM E;  1Y5B T;  2W6I D;  6CHA B;  3BG4 B;  3RMN H;  5EU8 A;  2BY5 X;  1IHT H;  1DT2 A;  1FDP A;  3GY7 A;  2A7H A;  1PPG E;  3JZ2 B;  4HTC H;  1AD8 H;  2ZHF H;  2FTM A;  3GCO A;  3MNB A;  4O3U A;  2VGC B;  3H5C B;  3SQH E;  3PM3 A;  1F92 A;  2C8Y B;  4CRF A;  1J9C H;  1JWT A;  3KL6 A;  2V0B A;  3LGT A;  3QZR A;  2RFK C;  4H4F A;  1ZRB A;  5PTP A;  1BT7 A;  1ZYO A;  2YMS D;  4JYT A;  1DVA H;  1OWJ A;  1DUA A;  3A86 A;  4Y8Z A;  1AO5 A;  3LGW A;  3ZV8 A;  2FTL E;  5LPE A;  1DIC A;  4J1Y A;  1PPZ A;  1BTY A;  1MD8 A;  4MG3 A;  1HIA B;  2ZPR A;  4Q4L A;  1OKX A;  2WSS D;  2G8T A;  4Z1M D;  1ABJ H;  2UUJ B;  1AU8 A;  2PHB A;  2Y81 A;  2W7U A;  4HG6 A;  1E1Q D;  1C1S A;  2M2A A;  1YCP K;  1RTL A;  1GBE A;  4GPG A;  4AN7 A;  2TIO A;  2STA E;  2GCH F;  4B6E A;  5HMA A;  3SJK A;  3LH1 A;  1HAH H;  1W7X H;  1UK2 A;  1TE0 A;  3LIW A;  3UOP A;  1HAP H;  2ZGX H;  2G55 A;  1Z1J A;  1BRU P;  2BY8 X;  3DA9 B;  1H8E D;  3PRO A;  5DSF A;  1ZTK A;  1GBI A;  1UTP A;  2Y5F A;  4KTS A;  5CHA B;  1F0U A;  2RG3 A;  3Q3K A;  2QF3 A;  2ZDV H;  1C2L A;  1EZU C;  3S9C A;  1PPC E;  5J4Q A;  1FY5 A;  4NWK A;  1UTN A;  2ZDK A;  1DAN H;  1B0F A;  1UVS H;  4ASU D;  3SHC H;  2H5C A;  3FKS D;  3QTV H;  1YCP H;  2TGD A;  1HLT H;  1PQ8 A;  1O2L A;  9LPR A;  2FIR H;  1EAI A;  3FFG A;  1DWD H;  1O2J A;  1YLC A;  2DE9 A;  2AYW A;  2AMP A;  1Y3W A;  2BDI A;  2F43 B;  4K69 A;  4XDE A;  1C1U H;  1RD3 B;  1CBW C;  4U01 A;  1VCP A;  2GMT B;  1GBL A;  1THR H;  1O3E A;  2BXT H;  2ZQ1 A;  4LXB H;  4Q7Y A;  3SJI A;  3RXL A;  3UIR A;  1FON A;  3UR6 A;  4AG1 A;  2A5A A;  3KQD A;  3UR9 A;  3QLP H;  4TYD A;  3I77 A;  3A82 A;  3ATL A;  2A2Q H;  3UWI A;  2FES H;  3TJU A;  1XUF A;  1YYY 1;  2GCH G;  1AE8 H;  1IQG A;  1GBJ A;  2BVR H;  3U9A H;  5LPF A;  5AHG H;  1GBA A;  3PMJ A;  1O2V A;  4TWW A;  3A8D A;  1LKA A;  2W26 A;  2GV7 A;  3CS7 A;  5LPR A;  1HAZ B;  1FY4 A;  1LO6 A;  3HKJ B;  3VB3 A;  1GJ4 H;  1MZA A;  2ZCH P;  3E1X B;  3T2N A;  3MHW U;  4MPU A;  2WPK S;  3SI3 H;  4R8T B;  1QJ6 B;  1EST A;  2Z9K A;  4LK4 A;  1N8O C;  3V7T A;  1U6Q A;  2F83 A;  3KYF A;  1PPE E;  2FZZ A;  1AHT H;  1LHF H;  1HRT H;  1SQA A;  3FAO A;  3MH6 A;  4FUD A;  3U8O H;  1GJ9 B;  1C1N A;  1ZJD A;  1ZPC A;  4O97 A;  1D6W A;  3LGU A;  4I8H A;  3LOX A;  1O2R A;  2PKS B;  4E05 H;  1KLI H;  2ANY A;  1C4V 2;  1SC8 U;  3RXF A;  2W3I A;  1GG6 B;  1Z8I B;  4NIX A;  4Q2K A;  5EIY A;  1V2V T;  3DCL A;  1ID5 H;  5C0T A;  1K1L A;  2AER H;  4AFU A;  2HPP H;  2YNB A;  2OC0 A;  2A1D B;  4JYU H;  1ACB E;  2ANK H;  1W0Y H;  2SNV A;  3SU2 A;  4B1T A;  1OP0 A;  4ISI H;  5DP3 A;  2PWX A;  2AGI X;  2K1Q A;  2Z9G A;  1OSS A;  2BXU H;  3OE7 D;  1T8O A;  1LVM A;  1AFE H;  1K1J A;  2XCN A;  5T3H A;  3SGB E;  4B2A A;  2XBW A;  2JH0 D;  2I6S A;  1LVB A;  4A7I B;  3M61 U;  1GDQ A;  2CGA A;  3R3G B;  3TNT A;  3N7O A;  4DII H;  1DM4 B;  1XUI A;  1BZX E;  4XD7 D;  1PQ7 A;  3ENS B;  3DUX H;  1A7S A;  2PW8 H;  3B9F H;  1Y3U A;  1P9S A;  3RXB A;  2PR3 A;  4X6N A;  1P8V C;  2GDD A;  1ARC A;  1CU1 A;  3GDV A;  4X2Y A;  5DP6 A;  3TK6 A;  1LQE A;  3P8N A;  5C1X A;  2EST E;  4H42 U;  2JET C;  5GPI B;  5F03 A;  1SGC A;  4JYV H;  4K8B A;  1W7G H;  5FCK A;  4IN2 A;  1GJB B;  4B2C A;  3TJO A;  2HOB A;  3C27 B;  5JBC S;  2WIN I;  2H2Z A;  1UVT H;  1HAO H;  1W3C A;  2BQ7 B;  5FL7 D;  2ZEB A;  1Y8T A;  1XX9 A;  3IWM A;  4DIH H;  4OS4 A;  1G30 B;  2OC8 A;  2P8O C;  1C5M D;  1MMJ N;  1GI8 B;  3EST A;  1GDN A;  4NZL A;  1UTK A;  5DP9 A;  2L6O A;  3KEE A;  1NU7 B;  1YKT A;  4JK6 A;  5A2M H;  1S0Q A;  2ZWL H;  1C5P A;  2WV5 A;  2IJO B;  1CA0 C;  1O3K A;  3FZD A;  3D49 H;  1UHB A;  1A4W H;  1F5R A;  1WTH D;  1GI0 A;  4AX9 H;  4BTI B;  3I78 A;  4UFD H;  1ELE E;  1V2S T;  1YPL H;  2ZG0 H;  3I29 A;  3FAN A;  1WTG H;  3F2G A;  4WJG 2;  3MH7 A;  1ABI H;  3T62 A;  3BV9 B;  1C1V H;  4BAQ B;  3EGK H;  3QZQ A;  2Q6G A;  1XUH A;  4YTA A;  2Y7Z A;  5JPM H;  4MNX A;  2GKV E;  9EST A;  1C5X B;  2QF4 A;  4ZHL U;  2VIW A;  1SQT A;  4HI3 A;  1DXP A;  4INL A;  3OTP A;  1C5T A;  1P2Q A;  3SO3 A;  1NPM A;  2LNC A;  3SV6 A;  1G3C A;  3A88 A;  1SR5 C;  3VB4 A;  2XWB I;  1EXF A;  2IPH A;  1WU1 A;  3KQB A;  2O8U A;  1MKW K;  5A8Y A;  1O2Z A;  5HYO A;  2BY6 X;  3SNB A;  4ISO A;  2A32 A;  3NRL A;  4D7F A;  1YF4 A;  1P01 A;  3ZYE A;  4X6P A;  5GCH G;  1KLT A;  3D62 A;  1DPO A;  2AEI H;  2G5V A;  4I8L A;  4CHA B;  1T4U H;  2EI8 A;  1SLX B;  1W10 U;  2BX4 A;  4IBL H;  1FLE E;  5EJL A;  1GBF A;  1O2X A;  2Z94 A;  1LHC H;  2CF8 H;  2ZHW H;  5HKK D;  4RKJ B;  3HAT H;  2BM2 A;  2A5K A;  3IG6 B;  4PRO A;  1AZ8 A;  1AZZ A;  2OIN A;  3WWB A;  3WWF A;  4YT6 H;  2IN2 A;  1W8B H;  5GJ4 B;  4YXW D;  3GYM A;  4BAN B;  4ZHA A;  1M9U A;  3K9X B;  2FOM B;  1ELT A;  4NIY A;  5KED A;  1ZTL A;  3MWI U;  2QYI A;  3LDX H;  1MH0 A;  5F53 A;  1GJA B;  5JBA S;  2WPD D;  1HBT H;  1GBD A;  2XRC A;  2R2W U;  4F55 A;  1SGY E;  2CF9 H;  1JMO H;  1MKX K;  1IQN A;  1WV7 H;  3GY4 A;  2Z7F E;  4NCY A;  1O3D A;  4I86 A;  4MPW A;  1PQA A;  3SZE A;  1O35 A;  1P3C A;  3EYD A;  2Z9L A;  3A8C A;  1UTL M;  3SGA E;  5CMX H;  1GJ7 B;  1K9O E;  5I25 A;  1O3N A;  3JZ1 B;  1GJD B;  2KX4 A;  1RFN A;  1E34 B;  1HJA B;  3BTF E;  1P09 A;  1NRP H;  5EPY A;  1MBM A;  3N7E A;  2CHA C;  1X7A C;  1L1J A;  1QZ8 A;  2R9P A;  1C1O A;  1HJ9 A;  5SGA E;  1TPO A;  1TOM H;  1DE7 H;  1PQ5 A;  1V2J T;  2QCY A;  2XND D;  1GBB A;  2J92 A;  1C2D A;  4FOU C;  2PP6 A;  5GXP A;  1BB0 B;  1CHG A;  4GLY A;  2BDB A;  2Q6F A;  3KQ5 A;  2ZKS A;  2NU1 E;  3A7Y A;  5ESB A;  4K1T A;  1UJ1 A;  1HUT H;  1O33 A;  2P59 A;  3M37 A;  1L0Z A;  1TNI A;  2VIP A;  2XC0 A;  4KEL A;  1DIT H;  3T5F H;  3Q77 A;  4A5T S;  2PFE A;  2VIQ A;  3U28 C;  1GHW H;  5C0U A;  3Q3Y A;  1VKY A;  2Z3D A;  5T6D A;  3QO6 A;  2OP9 A;  2ZDN A;  4GCH F;  2BDY A;  2BMG B;  1SGR E;  1NU9 A;  2WPH S;  3PV5 A;  5A0C A;  1BMA A;  3RLY H;  6CHA C;  3RXP A;  1C1P A;  5C1U A;  1NBM E;  3A81 A;  1COW D;  4NIW A;  1SL3 A;  2VH0 A;  4JMY A;  4GUX A;  3URD A;  5HM9 A;  3S7H B;  1LHD H;  1YLN A;  1P06 A;  2KCP A;  3MH4 A;  2VGC C;  5DP8 A;  1ELD E;  3E6P H;  3BTT E;  4XBB A;  1TAB E;  4BTU B;  2VH6 A;  1BRC E;  3P17 H;  1DST A;  4IC5 A;  5EXM A;  1UHB B;  4FUH A;  3ODD A;  1OS8 A;  1GJ6 A;  5HIZ A;  2FP7 B;  4ACB A;  2FM2 A;  2TBS A;  1C5W B;  1DUE A;  1TQ0 B;  3BEU A;  4X6M A;  4E06 H;  1NM6 A;  2RA0 A;  1FXY A;  4X8T H;  1BTW A;  1IQI A;  3BG8 A;  4OM9 A;  1DY9 A;  3EA9 A;  2OUA A;  2ZA5 A;  1GGD B;  1O5B B;  1AN1 E;  1O39 A;  1TGB A;  5EQS A;  5EXL A;  4JCN A;  1GHA F;  2TGP Z;  1HXF H;  4BXS A;  4ABJ A;  1D3T B;  5AFY H;  2AHM E;  1EJN A;  2C8Z B;  4UON A;  1YPH C;  3DSP A;  1EZQ A;  1HDT H;  1ZML A;  1TPS A;  4GCH G;  1TRN A;  1ETT H;  1AE5 A;  4ZMA H;  2G52 A;  1O2O A;  2R0L A;  4A92 A;  5EGM A;  3MU4 A;  1KTS B;  1O3P B;  5BRR E;  4UDW H;  4X1Q U;  2F4L A;  2ZFF H;  1GVZ A;  5FX6 A;  5I46 H;  1EB1 H;  1SVP A;  4AYV B;  1SLV B;  3ATI A;  5DPA A;  1P11 E;  4I8J A;  3TU7 H;  1E0F D;  3GY3 A;  4DVA U;  4JZF H;  4TWY A;  1JOU B;  1BIT A;  2LP6 A;  3MI4 A;  1SI5 H;  5T6G A;  5FXL A;  1A2C H;  1WAY B;  1TNJ A;  4DOQ A;  5JB9 S;  5GDS H;  4X1R U;  2K8I A;  1PYT D;  2H1U A;  1SGI B;  2HVX A;  1H9H E;  2HLD D;  2FOF A;  2C8X B;  2PKA A;  4X2V A;  3VPK A;  5DJ7 A;  4FET A;  1EKB B;  1GJ5 H;  1LHG H;  1BBR K;  3F68 H;  1Q2W A;  1A5I A;  2FWW A;  5L30 H;  4O03 A;  1V6D A;  1W12 U;  3RMM H;  2A4G A;  1SGQ E;  5E0J A;  3ZVD A;  2ZDA H;  3ZZ8 A;  2J94 A;  3AW1 A;  3CNR A;  1C1T A;  2FXR A;  1GHA G;  2A4Q A;  2GVF A;  2ZGJ A;  4B73 A;  4IS5 A;  1UVO A;  4CRB A;  3RXM A;  2B0F A;  1EP5 A;  4B6F A;  1HAG E;  2FOD A;  2STB E;  2ANM H;  3MU1 A;  2Y82 A;  2A4R A;  4UD9 H;  1ANE A;  1Z8G A;  1QL8 A;  1SOT A;  4X1P U;  4X8V H;  1O3L A;  2AH4 X;  2BTC E;  1GL1 A;  3TPI Z;  3NZI A;  3BTK E;  3UFA A;  1NY2 2;  2Y7X A;  1F2S E;  1VGC C;  5L2Z H;  3GOV B;  3BEF B;  3PO1 B;  3ZZ3 A;  3STJ A;  1RS0 A;  3ZVA A;  3TK9 A;  2F9B H;  2NU4 E;  1TPP A;  2BYA X;  4NA7 A;  1GBM A;  3MQK C;  4RT0 A;  2WPJ S;  4YOJ A;  2EY4 C;  2XNI A;  3QTO H;  3T26 A;  2BQ6 B;  2V3M A;  3LJJ A;  2ODY B;  4MQA A;  4MNW A;  1YPK H;  1GVK B;  2PKS C;  3HPT B;  1GCD A;  1WQS A;  2XYA A;  5C5O A;  1KY9 A;  1YWU A;  3RXJ A;  1UVU H;  2VVC A;  1QJ7 B;  2VU8 E;  3MO3 A;  4K2Y A;  3H09 A;  1O5A B;  2A31 A;  3MH5 A;  3QGN B;  1Y3V A;  2TGT A;  2P95 A;  3NPS A;  1UW7 A;  4TT3 D;  3RU4 D;  4FUF A;  3PLK A;  1V2P T;  1TRM A;  1FUJ A;  4Y8Y A;  5E0H A;  1S82 A;  3AAU A;  3SV9 A;  1W0Z U;  3RM2 H;  1TA6 A;  1DY8 A;  4NGA H;  1BOQ A;  3PV4 A;  1Q3X A;  1H9L B;  2VIO A;  1EAU A;  4K60 A;  3K6Y A;  2DE8 A;  5FAH A;  2Q1J A;  1OYQ A;  4RN6 A;  3PB1 E;  4BAO B;  3M35 A;  1TBZ H;  2FYQ A;  2R0K A;  2W7S A;  2GJG A;  1W13 U;  2JH5 D;  5FX5 A;  3S69 A;  1EZS C;  3MNX A;  3GCH C;  1KXC A;  1IQH A;  1CA8 B;  4O3T A;  3LC5 A;  4XBC A;  5FHT A;  1LHE H;  1KSN A;  2AIQ A;  1MTN B;  2GZ8 A;  1BTU A;  3SNC A;  1C5L H;  4MLF B;  1XVM A;  1T4V H;  3RML H;  3VFE A;  1O2Y A;  4AC9 A;  1MAB B;  1O36 A;  3ZVE A;  2Q6D A;  4NSY A;  1SHH B;  2BOK A;  3RU4 T;  1YY3 A;  1CGH A;  1W14 U;  3EA7 A;  3F6U H;  3VXE H;  4DCD A;  3T25 A;  2W5E A;  1O5E H;  1GDU A;  1CSO E;  3V13 A;  1BTP A;  2ZHQ H;  3QUM P;  3AK5 A;  1ZPZ A;  3DSO A;  2WZQ A;  4UE7 H;  2RCE A;  1QCP A;  1JRS A;  2BD2 A;  1HJ8 A;  1MQ5 A;  1DFP A;  2BZA A;  2O9Q A;  1P2M A;  3MU0 A;  2VB0 A;  5IYT A;  1QRZ A;  1S5S A;  1J14 A;  1XMN B;  2CN0 H;  2OC1 A;  3P70 B;  3SV2 H;  1O3M A;  2B9L A;  1ANB A;  1UTQ A;  1VCQ A;  4CBO A;  1JXP A;  3HK6 B;  1V2Q T;  5E8E H;  1O3B A;  2Y6T A;  2BVS H;  1QQU A;  1ZSJ A;  1GI9 B;  4B76 A;  2VWL A;  2HPQ H;  1H8I H;  2PKA B;  5C3N A;  1NFU A;  1MTV A;  3EQ0 H;  2FOE A;  5AFZ H;  1L4D A;  3M5L A;  1KIG H;  1C5U A;  1EOJ A;  1YGC H;  5AF9 H;  1EP6 A;  3RXD A;  1O2P A;  4O9V A;  2G00 A;  3OY5 U;  5EXN A;  4I31 A;  4AYY B;  2AGG X;  1NBM D;  1K1M A;  2PUX B;  5LGO A;  3H7O A;  1MTS A;  4NZQ A;  1SOZ A;  3R0F A;  1Y5A T;  2P3F H;  1Z7K A;  2IOT A;  5A0B A;  1V2R T;  1YPH E;  2HLC A;  4WME A;  1PPB H;  3GY8 A;  4WH8 A;  2J4I A;  1G32 B;  1ETR H;  1TX7 A;  1AQ7 A;  2ZO3 H;  2OQ5 A;  3GDS A;  4FUG A;  4KGA A;  2QIQ A;  4CH2 B;  1C2H A;  2BLO A;  1THP B;  4TSF D;  3M36 A;  1LDT T;  2RA3 A;  1QB9 A;  4I32 A;  1FIW A;  3V12 A;  3DFJ A;  3U1I B;  1O38 A;  1YPM H;  4Y10 E;  1AFQ C;  1OOK B;  1DX5 M;  1HCG A;  1SSX A;  3ZZD A;  1QB6 A;  3OY6 U;  1TLD A;  1S6H A;  1C5S A;  4HFP B;  1NFW A;  4DY7 B;  1KLJ H;  2G4T A;  1GI4 A;  1PPH E;  1FMG A;  4UEH H;  1GVL A;  1SGD E;  3P92 A;  2PSY A;  2V7Q D;  1TMT H;  1XKB C;  1L4Z A;  2KM0 A;  4MDS A;  3BN9 A;  1P10 A;  1SGT A;  2KAI A;  4FUI A;  4VGC C;  3ZZ6 A;  3KID U;  1TON A;  1FQ3 A;  1O31 A;  5DK1 A;  1DLE A;  1INC A;  2BD4 A;  2A45 B;  2ZFP H;  1HJA C;  1P2K A;  1V2O T;  2Z3E A;  2ZHE H;  1QFK H;  4QT8 C;  1P2N A;  2FI4 E;  3ZIA D;  4DGJ A;  5C5N A;  1EAS A;  1HYL A;  1C2J A;  1P2J A;  2G5N A;  2P94 A;  3ZZC A;  3PLB A;  2Z6B D;  1XVO A;  1TNH A;  5DO4 H;  4ABG A;  1GPZ A;  2FOA A;  4ZAE A;  1UVP A;  2ZFQ H;  4DT7 B;  1OPH B;  1AUJ A;  2YMS B;  4AGJ A;  4X0W U;  1DXW A;  1EQ9 A;  2EQN A;  3NKK A;  1S6L A;  3FO8 D;  2LPR A;  1S6F A;  5JDU B;  1BHX F;  4RKO B;  1H9I E;  4UFG H;  1ZGV A;  3PMA B;  5CDF E;  2O8T A;  4D9Q A;  1D3D B;  3A84 A;  4JK5 A;  3AVZ A;  5EG4 A;  8GCH F;  2JDI D;  1O2H A;  2V3O H;  2FO9 A;  5FBE A;  1TAW A;  1QBO A;  1A0H B;  1QQ4 A;  1BMM H;  1QRW A;  2KR7 A;  3LC3 A;  4I7Y H;  4P02 A;  3VXF H;  1C5Q A;  2FYR A;  3EA8 A;  2O8M A;  3M3V A;  1YCP M;  3GCT F;  1FI8 A;  4A1V A;  1KXB A;  1NTP A;  4CR5 A;  2R3U A;  4U30 A;  1D4P B;  3BIU H;  3B8J A;  2L74 A;  2VID A;  3B23 B;  1O30 A;  2BDA A;  2OBQ A;  1C4U 2;  2ZCL P;  1NFY A;  2UUF B;  4BAK B;  2PTN A;  3F9E A;  5CHB A;  4B71 A;  2JJ1 D;  3ATM A;  4CR9 A;  1PJP A;  5C67 A;  1OYT H;  3UQV A;  4A6L A;  4FU7 A;  1IQL A;  3SU6 A;  7EST E;  2BOH B;  4WVP E;  4KTC A;  3PWB A;  4TY7 A;  2F3C E;  2QY0 B;  1MTW A;  2XW9 A;  2FI5 E;  2B5T B;  2F9V A;  1AIX H;  2GV6 A;  2K0Q A;  2WUB A;  1RIW B;  2KCA A;  3WY8 A;  1NRS H;  1V2L T;  1CT2 E;  1HFD A;  3LH3 A;  1IQJ A;  2BY9 X;  4Y0Z E;  1IOE A;  2H9H A;  3RU4 E;  1XUJ A;  3HKI B;  1B5G H;  4JZI A;  1GGD C;  1AMH A;  1KYN A;  1SFI A;  1TAL A;  2XBX A;  2Z9I A;  1SGP E;  3E8L A;  3S7K B;  1O37 A;  2PGQ B;  3WW7 A;  1GMD F;  1S81 A;  1F0S A;  3CS0 A;  1JRT A;  1QA7 A;  3BTQ E;  4I8K A;  2BD3 A;  5C94 A;  1EJA A;  1ESB A;  3KCG H;  8GCH G;  1TGC A;  2BY7 X;  1EX3 A;  2JJ2 D;  1MTU A;  1N6Y A;  3GCT G;  1LPK B;  3RC4 A;  1ELF A;  2ZU1 A;  4YO9 A;  2BLV A;  2A4O A;  1EAX A;  1RJX B;  1HNE E;  1MKW H;  1GBC A;  2VBC A;  3SUF A;  4B2B A;  2QN5 T;  5K7R A;  1CGI E;  5FPS A;  4IW4 E;  2Y80 A;  1O5C B;  1GI7 B;  2ZFR H;  3Q76 A;  3U98 H;  1H1B A;  1C2K A;  1S85 A;  1MQ6 A;  1W0K D;  3ZZ7 A;  1G9I E;  1MU6 B;  7LPR A;  2V3H H;  4OGX A;  4IN1 A;  3NXP A;  3ZYD A;  2ZI2 H;  1TYN A;  2A7J A;  1AB9 C;  1KXD A;  2IJD 1;  3SW2 B;  5FBI A;  1DWC H;  3PWC A;  2C93 B;  1IQM A;  4FU8 A;  5J4S A;  3LU9 B;  1W0J D;  2GZ7 A;  1CT0 E;  2OQU A;  2HNT C;  3TGI E;  1EPT C;  2UWO A;  2ZC9 H;  3D23 A;  3UNQ A;  1C9T A;  2ODQ A;  4B75 A;  1GHB F;  5E0G A;  1TBQ H;  5GND A;  2NU2 E;  5EJ1 A;  1TX6 A;  1UTO A;  1GMC F;  4M9F A;  1MUE B;  2NU0 E;  5KEC A;  3MYW A;  1T8M A;  3SZN A;  4ACA A;  3RUO A;  4OS2 A;  3V3M A;  4DJZ B;  3M7Q A;  3DFL A;  1O3H A;  4FVD A;  1V2U T;  3QN7 A;  3P8G A;  1FPH H;  2FI3 E;  4AGK A;  4H6S B;  3FN8 A;  5JB8 S;  1MKX H;  3SND A;  1YPE H;  1AGJ A;  1QIX B;  2KAI B;  1Y59 T;  2GCT B;  2BLW A;  4MPV A;  3KN2 A;  1O32 A;  1A0J A;  2R3Y A;  4MVN A;  3GY6 A;  3EE0 B;  2JET B;  1UCY K;  2KCY A;  1HAV A;  4F48 B;  1BBR E;  1HXE H;  3PO1 C;  1GJ8 B;  2F9N A;  3SUE A;  1E1R D;  5DP7 A;  3E3T A;  5EQQ A;  2EI7 A;  3SV7 A;  1DLK B;  2XTT B;  2OC7 A;  2P3T B;  3FZZ A;  3VGC C;  2SNW A;  5B6L A;  4Y6D A;  1BTH H;  1T31 A;  2P8O B;  3IIT A;  4WMD A;  2AMD A;  3KQC A;  3SUG A;  3BG4 C;  2HWL B;  2VVU A;  2VVV A;  4BOH A;  2SGQ E;  3SNA A;  2D1J A;  3NK8 A;  5HGG A;  1V3X A;  5F8T A;  2QF0 A;  4Z6A H;  4Y7B A;  1OXG A;  3LPR A;  1L1G A;  4NFF A;  2OD3 B;  3BEI B;  4ISN A;  1BRA A;  1YLD A;  5EOK A;  1F0T A;  1BDA A;  2F9P A;  1J16 A;  2ZFS A;  3OAA D;  1GHB G;  3BTD E;  2OXS A;  1DS2 E;  4JZE H;  3AAS A;  1GMC G;  2RDL A;  1WQV H;  1XM1 A;  1Z1I A;  1WSS H;  1S0R A;  2BX3 A;  3OFN D;  3RXS A;  4OS6 A;  3PV2 A;  4AFS A;  2A0Q B;  3O8D A;  4J2Y B;  3PMH B;  2FDA A;  4BNR A;  1V2M T;  3F3B A;  1A3E H;  1QB1 A;  1D9I A;  2BHG A;  2ASU B;  3QGJ A;  1DOJ A;  2B8O H;  5DG6 A;  3CP7 A;  3TH3 H;  3C1K A;  1D6R A;  3ITI A;  1Y5U T;  1FPC H;  4OGY A;  3TLO A;  4GHT A;  2BDH A;  3ZVF A;  3SQE E;  2F91 A;  3F9H A;  3A7Z A;  2FS9 A;  6GCH F;  1ELC A;  2WHX A;  3RXE A;  1FY3 A;  4NFE A;  1QHR B;  2G4U A;  1TBR H;  3RP2 A;  4OS7 A;  3ZVB A;  1MTN C;  1HAX B;  1GI3 A;  2OBO A;  5CHA C;  3MTY A;  3L33 A;  4F49 A;  3S9B A;  3RC5 A;  2XWA A;  1GJC B;  2H9T H;  3CEN A;  3RMO H;  3SU0 A;  4THN H;  4YT7 H;  1O3I A;  3TJV A;  2GGV B;  1O2M A;  1J17 T;  1XXF A;  1LCY A;  4YOG A;  1BRB E;  4Y11 E;  4WMF A;  4AG2 A;  4CRC A;  1QGF A;  1SMF E;  4Y7A A;  4XFQ A;  1CHO F;  3RLW H;  1UTM A;  4NA9 H;  2ZNK H;  1TFX A;  2PV9 B;  3A7T A;  1K21 H;  2WYG A;  4CBN A;  4U2W A;  1BIO A;  3FP6 E;  4GSO A;  4TPY A;  4K3J A;  1WOF A;  5BPE A;  2ZU2 A;  4I8G A;  5EOD A;  5EPN A;  3TH4 H;  1RGQ A;  2UWP A;  1ELA A;  1CGJ E;  1F5K U;  2AMQ A;  2I6Q A;  4GHQ A;  4AOQ A;  2GMT C;  3AW0 A;  1C2G A;  4Y0Y E;  1C9P A;  1AKS A;  2FMJ A;  5FPT A;  3STI A;  4LOY H;  5H4I B;  1FX0 B;  1NN6 A;  2ZIQ H;  1LVY A;  2UUY A;  1TWX B;  2ZF0 H;  3MFJ A;  4FU9 A;  1JBU H;  1ZMJ A;  1A3B H;  2OK5 A;  1SLW B;  2Y5G A;  4ASH A;  4ISH H;  3ZZ9 A;  6GCH G;  2BDG A;  3BIV H;  4B74 A;  2J34 A;  4EST E;  3NWU A;  1ZR0 A;  1O2W A;  4ZXY H;  1MBQ A;  4Q63 A;  3A87 A;  4SGA E;  1BBR H;  2HRV A;  1O3F A;  1AND A;  3SU1 A;  3NCL A;  4DW2 U;  2GZ9 A;  1C5Z B;  5T6F A;  3UNR A;  3SNE A;  3BTE E;  1MD7 A;  3TVJ B;  1SBW A;  1ZOM A;  2CHA B;  2WYJ A;  1GCT B;  2OTV A;  3P8O A;  2HVY B;  1OP8 A;  1EOL A;  3ATW A;  4NWL A;  3MNS A;  5EQR A;  1HGT H;  4ABD A;  4AFZ A;  1GHZ A;  1KMH B;  4A1T A;  1AUT C;  1BUI A;  1ZSL A;  4Y76 A;  4AZ2 B;  5L6N H;  4YLQ H;  3M7U A;  1JIM A;  2CV3 A;  2UWL A;  1VIT H;  4Q80 A;  2GT7 A;  3RXA A;  2PUQ H;  1FIZ A;  1ETS H;  4K1E A;  1GG6 C;  5T1V A;  1A61 H;  1D3P B;  5JBB S;  2ZDM A;  5HM2 A;  2SFA A;  3RXG A;  3RXC A;  4ABI A;  3A8A A;  1HAV B;  1LPG B;  1O3O A;  1C5N H;  2CK3 D;  5A09 A;  2ZGC A;  4GAW A;  4CRE A;  3GY2 A;  2NU3 E;  1MAX A;  1OWD A;  1C5O H;  1QBV H;  3U8R H;  2BD9 A;  5IK2 D;  1C1Q A;  2XXL A;  1P12 E;  4OS5 A;  2QXI A;  5DKM A;  1A5H A;  2CXV A;  4INH A;  4ZH8 A;  1FY1 A;  1MZD A;  1K2I 1;  1NES E;  1GBK A;  4MNV A;  2XOK D;  4IC6 A;  3BTH E;  3TIT A;  2THF B;  2ZZU H;  3P6Z B;  3PLP A;  1Z8J B;  4CH8 B;  1ZHM A;  2SGF E;  3A83 A;  4ZKN U;  4DUR A;  1ELG A;  1WXR A;  2KCO A;  2HNT E;  4K8Y A;  3KQE A;  4LZ4 B;  2ZU5 A;  1TA2 A;  3UNS A;  5FPY A;  1TX8 A;  2QXH A;  3SI4 H;  1O0D H;  4YOI A;  5TJX A;  1GBH A;  4WXI A;  3PTN A;  1A46 H;  1P2I A;  1TGS Z;  4XBD A;  1AWH B;  4FVB A;  2FOB A;  4Z0K A;  1KXE A;  5A0A E;  1HPG A;  1LKB A;  3A7W A;  1LTO A;  2SGP E;  3LGI A;  3TGK E;  2VNT A;  3GDU A;  5EJZ A;  2RDE A;  2O8W A;  2GD4 B;  1K1P A;  1K1I A;  2J97 A;  4KKD A;  4ZKS U;  2YMS C;  1XKA C;  1TQ7 B;  1SQR A;  5EW2 H;  4E7N A;  2TGA A;  2QV1 A;  1AVX A;  2PGB B;  4X2W A;  2EA3 A;  4CRG A;  1K22 H;  3LT3 A;  1OWI A;  1ESA A;  3A7V A;  4ZKO U;  2W6J D;  3KYG A;  2Z9J A;  1ZSK A;  1WCZ A;  3Q00 A;  4XOJ A;  5F6M A;  1FNI A;  1QJ1 B;  3OSY A;  4ABA A;  8EST E;  4CRA A;  3E16 B;  5F8Z A;  4ABB A;  1FV9 A;  2FX4 A;  5HIY A;  1Z6J H;  3QK1 A;  3PRB A;  1KTT B;  1SLU B;  3LGV A;  4D8N A;  4X2X A;  1FAK H;  5ETX A;  3SOS A;  3DSG A;  2QA9 E;  1QA0 A;  3GIS B;  3FP7 E;  5CE1 A;  3ZVG A;  1O2U A;  1E38 B;  1AY6 H;  1H8H D;  1BQY A;  1DWB H;  2FOH A;  1EB2 A;  4KP0 A;  1N6X A;  4RT1 A;  1EJM A;  2QF5 A;  4X1S U;  1HB0 B;  1WUN H;  1SGE E;  1HV7 A;  3MOC A;  1RIW C;  3FP8 E;  3GY5 A;  1AKS B;  1P9U A;  3OEE D;  5GWZ A;  1Z6E A;  3K65 B;  2R2M B;  4K5Z A;  1C2F A;  2ZPQ A;  3N99 A;  1UK3 A;  2F9U A;  3N7D A;  3OYP A;  4IGD A;  4AB8 A;  3U69 H;  1EZX C;  1ZPB A;  2VWO A;  1NRO H;  1A1R A;  4R0I A;  5TCA A;  3UY9 A;  1PPF E;  4H6T A;  3KNX A;  1K1O A;  1O2I A;  4CHA C;  4LZ1 H;  1LMW B;  4ZHM U;  1VGC B;  2JH6 D;  4XE4 A;  4UFE H;  2C3S A;  5LH8 A;  3A8B A;  1C2M A;  2ILN A;  2KZ4 A;  2D8W A;  1C5R A;  4ZKR U;  3F0O A;  2G51 A;  7GCH F;  1VZQ H;  4WWY A;  2XC4 A;  3KF2 A;  2FEQ H;  1ELB A;  1GI6 A;  1TGN A;  2NWN A;  3F2F A;  4JZ1 A;  2XBY A;  3UOU A;  1PFX C;  1W2K H;  1GHV H;  1OWK A;  4FUE A;  2QXG A;  1O3G A;  3MNC A;  1CQQ A;  4CRD A;  2ZHD A;  1E79 D;  1AVG H;  2BDC A;  1EAT A;  3RXH A;  2ZU4 A;  1O34 A;  4D76 A;  2FPZ A;  3UB0 A;  3L3T A;  4HZH A;  1T8L A;  4WH6 A;  1VIT F;  1V2T T;  3E91 A;  1TNK A;  1TRY A;  2BLQ A;  2XBV A;  2FOC A;  3ATK A;  5FCR A;  3W1E A;  1ZRK A;  3A80 A;  4MPX A;  3RXV A;  2DUC A;  3BF6 H;  4ZCN A;  4D7G A;  2G81 E;  1V2W T;  4DT4 A;  3U8T H;  4Y71 A;  3SJO A;  1LPZ B;  2FX6 A;  1TMU H;  1VCW A;  4FUJ A;  2XC5 A;  3M3S A;  2J5U A;  4ZRO A;  1JIR A;  1V2K T;  3SU3 A;  3S0N A;  1D3Q B;  3GS9 A;  1VJA U;  2ANW A;  5G4B A;  4ZUH A;  1P57 B;  1NRN H;  2GCT C;  2JIZ D;  7GCH G;  1BTZ A;  1VR1 H;  1YP9 A;  3ELA H;  3KHV A;  3GCH B;  4TPI Z;  3E0P B;  2KFW A;  4XSK U;  3BTW E;  1QY6 A;  8LPR A;  3SU4 A;  3QDZ B;  4HGC A;  1YC0 A;  3GIC B;  1W11 U;  1BA8 B;  5C20 A;  1SB1 H;  3M7T A;  1MAY A;  3LON A;  3P8F A;  1BMF D;  1KXA A;  1YPG H;  3E0N B;  3F0P A;  1OWH A;  1SKY E;  1T8N A;  2VJ1 A;  2VIN A;  1O3A A;  1NT1 A;  4JZD H;  2EC9 H;  2J9N A;  3RXQ A;  1NS3 A;  3K2U A;  2GTB A;  1DWE H;  1VIT G;  2ZEC A;  1C5Y B;  4FUC A;  3MMG A;  1C2E A;  3L6P A;  2V35 A;  2VWN A;  3A7X A;  5GIB A;  5GCH F;  1DDJ A;  2VWM A;  2A5I A;  1G3E A;  2J98 A;  1F0R A;  2FLB H;  3D65 E;  4ABE A;  1KXF A;  4F4O C;  3RXI A;  2BD5 A;  1RRK A;  4D9R A;  1O2K A;  1TOC B;  2ZQ2 A;  1C2I A;  2QGR A;  1UCY E;  1CBW B;  4ISL A;  1WBG B;  3F9G A;  3T29 A;  4ZXX H;  2H6M A;  5C2Z A;  1P2O A;  1RTK A;  2HAL A;  3TIU A;  4BAM B;  2ZU3 A;  4GVU A;  1E36 B;  1ZJK A;  4YZU A;  1O3J A;  3MO6 A;  2BD8 A;  3UAI C;  1VJ9 U;  1QR3 E;  1P04 A;  1GL0 E;  1TIO A;  3ZZ4 A;  1KDQ A;  1LQD B;  3UTU H;  1O5F H;  1EUF A;  4WY3 A;  2ZGH A;  4ABF A;  2QAA A;  1P0S H;  4X8U H;  4U32 A;  2FS8 A;  1ZHP A;  3GCN A;  4KTU A;  2A2X H;  2OCV B;  3OEH D;  2SGD E;  4XRN A;  2YNA A;  1THS H;  1SPJ A;  4BTT B;  1L1N A;  4OS1 A;  2FOG A;  2UUK B;  1UO6 A;  1QUR H;  1TGT A;  2ZCK P;  1N8O B;  2H9E H;  2ZFT A;  3UQO A;  1Z71 A;  2C8W B;  1ZZZ A;  1GI1 A;  4IMQ A;  1CVW H;  2SGA A;  6EST A;  3KGP A;  3F9F A;  1HAI H;  1NO9 H;  2QXJ A;  2GT8 A;  3SOR A;  4BAH B;  5A8X A;  1ZTJ A;  2EI6 A;  3SBK A;  3PMB B;  4Q7X A;  3T28 A;  1G37 A;  3VB5 A;  3VB6 A;  3K6Z A;  3RXT A;  1IQK A;  3H7T A;  3OTJ E;  1O2G H;  2FLR H;  4FUB A;  1Q31 A;  1A5G H;  1K28 D;  1T7C A;  5E2O A;  3EDX B;  3SU5 A;  1FJS A;  3SGQ E;  1SGF A;  2P16 A;  1EPT A;  3FVF B;  1J15 A;  7KME H;  4NIV A;  1AFQ B;  3DHK H;  1G36 A;  2W3K A;  1O2T A;  1UMA H;  1BCU H;  4P00 A;  3S9A A;  1MU8 B;  3PRD A;  1IAU A;  2BVX H;  1ORF A;  3M3T A;  1NZQ H;  2IPQ X;  1P3E A;  1GMD G;  1G2M A;  1FAX A;  2BD7 A;  3QX5 H;  1N1L A;  1QNJ A;  2C4F H;  4VGC B;  5L2Y H;  3AAV A;  3SYJ A;  1BTX A;  5HXF A;  3TK5 A;  2CMY A;  1AI8 H;  1QL7 A;  4YM9 A;  1BHX B;  5EST E;  1AWF H;  5C1Y A;  3UWJ H;  1B0E A;  2HNT F;  3PYH A;  4K1S A;  3VEQ B;  1FN8 A;  1Z8R A;  3HK3 B;  1XUG A;  1S83 A;  4YES B;  1TNL A;  1O5D H;  1GCT C;  1GMH F;  5TCC A;  3PTB A;  1NRQ H;  3W95 A;  1GBT A;  2WPL S;  2P3U B;  1TMB H;  1H8D H;  1S84 A;  1SGN E;  2J2U A;  3LGY A;  1BMN H;  4RI0 A;  5AVD A;  3O8R A;  3Q3X A;  2ALP A;  1DSU A;  4ABH A;  2WUC A;  1C5V A;  2PSX A;  4AFQ A;  3F1S B;  3HGN A;  1GWA A;  4X8S H;  3A89 A;  2H5D A;  3V0X A;  1L2E A;  1O2N A;  3M5M A;  4WF8 A;  1EAW A;  1CA0 B;  1BJU A;  1O2S A;  1UCY H;  5E2P A;  3NUM A;  1BML A;  4FXG H;  1ZGI A;  3RXO A;  1B7X B;  3TJN A;  1BJV A;  2ALV A;  5JBT A;  1E35 B;  1T32 A;  1GHY H;  1H4W A;  1ZMN A;  2JKH A;  1F7Z A;  3LJO A;  2BQW B;  3LKW A;  1G2L A;  1YM0 A;  1HIA A;  1EFR D;  5F8X A;  3M5N A;  3RDZ A;  1UTJ A;  3RXU A;  2Y5H A;  5DGJ A;  3ZV9 A;  1IQE A;  3OU0 A;  4I33 A;  1K0H A;  1SGF G;  2ZTX A;  3TGJ E;  4Q7Z A;  4M7G A;  1HAY B;  3UUZ A;  2J98 B;  1CT4 E;  1TPA E;  1GMH G;  3ZZB A;  5A8Z A;  4DG4 A;  1C1W H;  2A7C A;  1G3B A;  1MCT A;  1C1R A;  1FN6 A;  4SGB E;  2WV4 A;  2ODP A;  2PTC E;  5IDK A;  3BSQ A;  3HGP A;  5DP4 A;  1QL9 A;  4IMZ A;  4MNY A;  3SN8 A;  1Y3X A;  4AB9 A;  4NSV A;  1F5L A;  3URC A;  4NG9 H;  3TH2 H;  2TRM A;  2AIP A;  4AOR A;  2ZPS A;  3P95 A;  1ELV A;  1E37 B;  1FY8 E;  1J8A A;  5DN6 D;  1C1M A;  1K1N A;  5ABW A;  1KDQ B;  1WYK A;  1GHX H;  1O2Q A;  4TY6 A;  3UPE A;  1P02 A;  3MU8 A;  3URE A;  2J95 A;  2QE7 D;  3ZVC A;  1O5G H;  2D26 C;  3RC6 A;  1RTF B;  4WXV A;  3RXK A;  2Z3C A;  4X1N U;  3ZZA A;  2GP9 B;  3TNS A;  4UFF H;  1C4Y 2;  3T27 A;  2B7D H;  8KME 2;  2SGE E;  2PLX A;  1MCV A;  3QWC H;  2AS9 A;  3GYL B;  4Y79 A;  1TNG A;  2XCF A;  2ZDL A;  5JYI A;  4Y8X A;  3ODF A;  3DT0 H;  5DP5 A;  1ANC A;  2F9O A;  2LEL A;  2TPI Z;  2ZGB H;  2D2D A;  3FOA A;  3W94 A;  3EE7 A;  1O3C A;  3OX7 U;  3SJ9 A;  1OP2 A;  1QTF A;  3SUD A;  2ZP0 H;  3BTG E;  3EAJ A;  2OLG A;  3A85 A;  2HGT H;  2V6N A;  1A0L A;  2AGE X;  1SG8 B;  3RM0 H;  1GI2 A;  2ZTY A;  1AB9 B;  2ZTZ A;  3SHA H;  2O8L A;  5B6O A;  1TB6 H;  5K0H A;  3VG8 A;  1P03 A;  1ZLR A;  2GX4 A;  1CO7 E;  1EPT B;  1NC6 A;  1FZZ A;  1WDI A;  3M5O A;  2ULL A;  1PYT C;  4A1X A;  3ZZ5 A;  4BXW A;  1CE5 A;  4YLU A;  1SFQ B;  1QBN A;  2YOL A;  5EW1 H;  4E7R G;  4RSP A;  1AVW A;  1IHS H;  3SJ8 A;  3DD2 H;  1YBW A;  5KGO A;  3SV8 A;  2BZ6 H;  1Y3Y A;  2WPM S;  1YPJ H;  2WPI S;  1G3D A;  1ARB A;  1P05 A;  1GI5 A;  3U1J B;  1CHO G;  1OX1 A;  4X6O A;  1SHY A;  1QRX A;  1ZHR A;  5C17 A;  1XXD A;  2GDE H;  1RXP A;  3F2H A;  1XUK A;  2VIV A;  2J38 A;  1IQF A;  3MO9 A;  1OHH D;  2QC2 A;  2EEK A;  1OWE A;  1V2N T;  4INK A;  4MTB A;  3VB7 A;  3MU5 A;  4NA8 A;  1LVO A;  2CJI A;  1SQO A;  2P93 A;  2BB4 A;  3RXR A;  1NFX A;  1UK4 A;  3E90 B;  6LPR A;  3G01 A;  3O8B A; 
#chains in the Genus database with same CATH homology
 4U01 A;  2WV9 A;  3KNX A;  3SUE A;  2F9V A;  1E1R D;  2K0Q A;  3O8C A;  5EQQ A;  3L6P A;  1MAB B;  5EPN A;  3SV7 A;  2A4R A;  1RGQ A;  2KCA A;  2KCP A;  5GPI B;  5HKK D;  2OC7 A;  5FPY A;  5DN6 D;  2OIN A;  2W6I D;  4K8B A;  3WWB A;  3WWF A;  1N1L A;  2V7Q D;  4TYD A;  2KZ4 A;  5B6L A;  5GJ4 B;  3SYJ A;  4YXW D;  5FPT A;  2QE7 D;  3F0O A;  3RC6 A;  2FOM B;  1FX0 B;  1W3C A;  2KM0 A;  5H4I B;  5FL7 D;  3SUG A;  2FP7 B;  3KF2 A;  2FM2 A;  3AK5 A;  3WW7 A;  3F2F A;  5F53 A;  3DSO A;  2OC8 A;  2WZQ A;  2OK5 A;  2WPD D;  2XNI A;  4OM9 A;  1DY9 A;  2L6O A;  2YMS C;  3KEE A;  4B74 A;  4F55 A;  1BT7 A;  1E79 D;  2OC1 A;  2XCF A;  3OAA D;  2JJ2 D;  4Q63 A;  2YMS D;  5EQS A;  3ZIA D;  3RC4 A;  2IJO B;  4R8T B;  3SZE A;  2LEL A;  1JXP A;  2QV1 A;  3EYD A;  2AHM E;  3FOA A;  3SU1 A;  4RI0 A;  3DSP A;  3O8R A;  3UB0 A;  3OFN D;  4B76 A;  3SUF A;  2VBC A;  3PV2 A;  4WH6 A;  3SUD A;  4Q4L A;  3O8D A;  5FPS A;  4A92 A;  2WSS D;  3H09 A;  3OEH D;  3P8O A;  3F2G A;  2YMS B;  3W1E A;  2W6J D;  4Z1M D;  1DXW A;  4NWL A;  3F3B A;  5EQR A;  1S6L A;  3FO8 D;  5EPY A;  4ZCN A;  3N7E A;  1E1Q D;  2F4L A;  3M5M A;  1W0K D;  3LOX A;  4WF8 A;  3M5L A;  1KMH B;  2M2A A;  4TT3 D;  4A1T A;  4DT4 A;  1RTL A;  3VG8 A;  4B6E A;  3DCL A;  2IJD 1;  5CDF E;  5C0T A;  2XND D;  2QF4 A;  4I31 A;  3M5O A;  3PRB A;  1NBM D;  2J5U A;  4A1X A;  5T1V A;  2OC0 A;  3SV9 A;  1W0J D;  2JDI D;  1H8E D;  2YOL A;  3LKW A;  5DSF A;  5ETX A;  3SU3 A;  2K8I A;  1DY8 A;  3SU2 A;  1DXP A;  3GS9 A;  5ESB A;  2HLD D;  2WHX A;  2KR7 A;  3OTP A;  1EFR D;  2CK3 D;  2K1Q A;  2P59 A;  3M5N A;  2O8M A;  3SV8 A;  4FET A;  2JIZ D;  4B75 A;  3SV6 A;  3OE7 D;  1H8H D;  5GND A;  4A1V A;  2XCN A;  2OBO A;  2KFW A;  4M9F A;  4WH8 A;  4NWK A;  5IK2 D;  5C0U A;  3RC5 A;  4I33 A;  3U1J B;  2QF5 A;  3SU4 A;  5C17 A;  3SU0 A;  2A4G A;  3SU5 A;  3F2H A;  2OBQ A;  4ASU D;  3OEE D;  1OHH D;  2GGV B;  3FKS D;  3NRL A;  4XD7 D;  5CHB A;  3FN8 A;  3LON A;  3PV5 A;  4B71 A;  2JJ1 D;  4TSF D;  2XOK D;  1BMF D;  3N99 A;  1NBM E;  1COW D;  2A4Q A;  2F9U A;  2GVF A;  3KN2 A;  3N7D A;  4B73 A;  3F0P A;  4I32 A;  3OYP A;  5IDK A;  1CU1 A;  3SU6 A;  1SKY E;  2KCY A;  3U1I B;  2F43 B;  3E90 B;  3PRD A;  4KTC A;  4JMY A;  3O8B A;  3P8N A;  1A1R A;  1WXR A;  4B6F A;  1NS3 A;  2KCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...