2QF8A

Crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
molecule tags Signaling protein
publication title Crystal structure of the complex of Buffalo Secretory Glycoprotein with Tetrasaccharide at 2.8A resolution
rcsb
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2qf8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qf8A01
2ZIDA 3PZVA 2WHLA 4EK7A 5BXSA 2WAGA 4D6CA 2V3GA 5E0FA 3RPMA 4H41A 3KZSA 5M03A 2WC4A 2WCAA 4GZIA 1CPUA 1QPKA 2ZUWA 3AHZA 3BAIA 2UWFA 1JZ8A 4W86A 3VO0A 1HN1A 3BLPX 2WVTA 1HL9A 1UKQA 4P7QA 3VNZA 3RO8A 1FOBA 3WQVA 1U2YA 5LYRA 1UA3A 3M7SA 1JD9A 1HKIA 1AQMA 1JFHA 3W24A 2BXZA 4LYQA 3VDCA 4QLKA 2QV4A 3AMDA 2JIWA 1Q6DA 2XVLA 3K46A 5JIWA 3IAQA 3SUUA 1I1WA 4GQQA 1ITCA 1CEOA 3MMWA 2VZVA 1KR1A 3WDHA 2VR4A 4FMVA 1GW1A 1WNOA 4AEFA 5FD0A 2EPKX 1EGZA 4HU0A 1FHLA 2WLYA 1VIWA 1ISYA 5C70A 1TA3B 1E4MM 3VMNA 4AYSA 3IANA 3VDAA 1HP4A 2VVSA 3F4VA 1QI4A 5M3WA 4DM2A 4U3AA 4CCDA 3U5UA 3HJEA 1VENA 2BXYA 4GZEA 4CD4A 2CNCA 2ZXBA 1K9EA 3SUSA 1RP9A 2DSWA 2WKGA 3FN9A 2G41A 1UR2A 3SCQA 2GFTA 3VX1A 4P7RA 3B8SA 4HP5A 1HXJA 1E9LA 1KQYA 1M04A 4LYRA 1MXGA 2O9TA 2WB5A 1DWHM 1XV8A 2EQDA 4GPNA 2YJQA 1B3WA 3WN6A 3CZKA 4UFLA 2W63A 3VVGA 2ZXAA 4PRWA 3K1DA 5CSYA 1ODZA 4UR9A 3SUWA 3GYCA 4PN2A 5LA2A 2YA0A 1LWJA 3B9DA 1E1FA 2BY1A 3GDBA 1LL6A 3UEQA 1MVYA 1V6VA 2IXUA 1OD0A 2VRJA 2WMFA 4UQ9A 2C0HA 3CHCA 1CGUA 1NQ6A 5A6SA 4GO9A 4NRRA 3EMQA 3DYMA 1WDRA 1QNQA 4PEEA 3VDHA 3IJ7A 1OSEA 1GOOA 1EQCA 1EDQA 1C3FA 1MQPA 4WKAA 2D20A 2CERA 4Z2LA 4JAWA 1NOUA 2VVNA 2W4XA 2ZXDA 3W38A 1VFOA 3WH8A 1KBBA 1TVPA 2XIBA 3HMCA 2DEPA 4RL3A 1GOIA 4PTXA 2XSBA 4QP0A 1E15A 3WELA 4JHZA 3WD4A 1HKJA 4CVUA 4AD1A 1B1YA 3VGFA 1V03A 1WZKA 4RE2A 2DGAA 2V3DA 4FLSA 5D8ZA 1QI2A 1V3HA 3T2QA 3SCRA 3SCVA 1PX4A 3HU7A 3RM9A 4XV0A 3AZRA 2YL6A 4PTWA 2WBGA 1UH4A 2PBGA 2Y5EA 4PMQA 2WSKA 2D1ZA 1V02E 4AWEA 1UYQA 2CBUA 2DH3A 5CZKA 4KGLA 4D6IA 1FP9A 2UY5A 3PZTA 1GQKA 4M1RA 1W1TA 5HNNA 1E6ZA 2V3FA 3VIGA 5IHRA 5CQ1A 1W1PA 1ZL1A 3FY1A 2XM2A 3ZR6A 3GBDA 3CUJA 4FK9A 2FH8A 1GOMA 5I2UA 2CITA 2VURA 1CENA 3N17A 4QCEA 3PZUA 4QCFA 3WBAA 3NSXA 3VIFA 4HOXA 2VNCA 5E0CA 3AS1A 1FP8A 3LPOA 1ZBCA 1Q6CA 3FW6A 3UERA 1MWOA 3L4ZA 4MB1A 2CBJA 1QOXA 4RE3A 1J18A 1E40A 3N04A 3RMEA 2DT1A 1CBGA 2VCBA 2ZUUA 3AYSA 4AZHA 4V28A 2NT0A 4AMCA 4V27A 2CHOA 2ZX8A 1D2KA 1JZ7A 2J77A 5DO8A 4XZBA 3WENA 1UR0A 3ZJ7A 1H3GA 3ALGA 1XH0A 4PMNA 3W26A 2CBVA 2YL9A 1RH9A 1ISXA 3KL3A 1GJUA 2ZX6A 1MQQA 1ODUA 2EO7A 3AHTA 3KL0A 3ZQ9A 1I75A 1J0JA 4CU7A 1WAWA 3WQ5A 4NI3A 1CXLA 5LA0A 4HTYA 5C71A 5I23A 2G3NA 4X0VA 4NRSA 5A6MA 1BVZA 3ZR5A 2EPMX 3AHXA 2AAAA 1JZ4A 2CCRA 4TXEA 1V0KA 2VO5A 2OYMA 5ABEA 1C8YA 1L8NA 1KB3A 2GSJA 2GVYA 2A3EA 2TAAA 4MPKA 2J8GA 3GM8A 2VT0A 1WZLA 3OZOA 2RGLA 3QGVA 3WUGA 4H04A 3W0KA 5A6AA 1C90A 4AIOA 2A3HA 3PN8A 1OIMA 2D24A 1NWTA 1CGYA 2EEXA 1V08A 1HNYA 3K4AA 1NOWA 3AYRA 1KQZA 4JHOA 1Q6FA 1UG6A 1H2JA 2CKSA 1UH2A 3I3EA 5IFTA 1UZ1A 2GDUA 1UWUA 1BYCA 4JFUA 5HBFA 1US3A 3FAXA 3T2OA 3QHMA 5A6LA 4QLJA 1UR4A 1WZAA 3WH9A 2VQUA 1XD1A 2WMKA 4P8WA 1K9FA 1QBAA 4J3UA 4IM4A 3L4UA 4NSBA 3MUZ1 1XSIA 3VMOA 3NIYA 3VILA 1E5NA 3L2LA 3ARTA 3SIMA 4JZ5A 3WNLA 1VAHA 2ZE0A 4L4OA 1NH6A 3AMLA 1H09A 5ABGA 1VJZA 1JZ5A 2XVNA 2BY0A 1E6RA 3OGRA 4WSJA 3WQ8A 2WMJA 2WMIA 1MW2A 3VGHA 3ALFA 2OWWA 3UG4A 1LQ0A 4ML4A 1QNOA 4RE4A 1B3VA 1MW0A 4MDOA 3WUBA 3KEHA 4J3WA 4UOZA 2PI6A 2XPKA 4TUFA 1MW3A 1XH2A 5DFAA 3D5HA 1FFQA 3PZMA 1MQRA 2NW0A 2E9BA 4TVDA 3PTQA 4CD6A 1JAEA 4L4PA 1C8QA 4D6FA 2UY2A 3L2MA 2WVVB 3MSDA 5CLTA 2BNJA 3WF4A 4D6JA 1M03A 3WNKA 3NCOA 3WL1A 4UQCA 2DSKA 2J7GA 1NP0A 1EO5A 4WK9A 2ZICA 4E4PA 2WK2A 3CHEA 4MTVA 2B31A 3AIEA 3RILA 3W6MA 4J27A 3F5LA 3VGGA 4W7VA 3GH4A 5E09A 2J7EA 1RP8A 3CHFA 3ZSTA 3BCDA 5CJ5A 3W82A 1PX3A 3O6AA 2QMJA 2XGBA 4PSPA 4AIEA 3MANA 1VFFA 2DIEA 3S6TA 1NP2A 4CD8A 1W9PA 3ARYA 3AJ7A 4R27A 2XVGA 4JCMA 4CD7A 2GK1B 4PMUA 3OZPA 2CKRA 4DUXA 3LPFA 3MV01 3UCQA 5I77A 1FH9A 1MW1A 3ARXA 3AZTA 1M7XA 4U2ZA 3GTNA 5GNZA 1I1XA 1OM0A 3ECQA 3D3AA 1TA3A 3DC0A 3BSGA 4A3HA 3BSHA 2XM1A 2BV9A 3DHUA 5I78A 5I79A 3WD2A 1KWKA 1MFVA 1W3LA 1CWYA 3VPLA 2J7DA 4OOUA 2VCCA 1QI0A 1UQZA 5A6BD 2ZX5A 1J0KA 1BLIA 2CETA 1VEOA 3F5KA 4ACYA 2VQTA 2Y4SA 1JGIA 1OINA 3I3BA 5EB8A 3NYDA 3CLWA 3FAWA 1QI3A 1BHGA 3I3DA 5I3DA 1B3YA 3GXMA 3AIRA 2D3NA 3CZ8A 4IPLA 5CXPA 4CCEA 3MSGA 1ZJBA 4Z2JA 3B9EA 2CESA 5A6BA 1WPCA 3RM8A 3WH6A 1EA9C 3UG5A 4UQAA 2O92A 5A69A 2ZUVA 2FHBA 4WIWA 2BHUA 4CU6A 5M5DA 4BA0A 3CPUA 1E43A 4FLQA 4HA1A 4Q22A 4TX8A 4BQ3A 2XWEA 4PBGA 4AD4A 1BYBA 3SCPA 4H2CA 2AMGA 3ARSA 3WDRA 2E40A 3AROA 1JI1A 1EOMA 2DSUA 2EJ1A 1NARA 4M56A 2W5FA 3VGEA 1GOQA 5AY7A 4PMOA 4W88A 3WF2A 1XSJA 3MKKA 2WZHA 2E3ZA 4B15A 3KL5A 1G1YA 4AZ7A 2VI0A 4PTMA 2VUYA 4J3SA 4C7GA 3GXDA 1PJ9A 4K68A 1ESWA 4DUVA 3EDKA 3IAPA 2WSPA 2ZWZA 9CGTA 2FHCA 2EBNA 1GHSA 4W7WA 1V3IA 1QNSA 1QI5A 1ZB5A 1WDSA 4XX6A 2YKKA 5GPRA 4U5KA 5EMYA 1XCWA 5ECUA 2PBOA 2PF0A 3A47A 4UOQA 3CBWA 1R86A 4H7VA 1CTNA 5I6SA 5BRPA 2J74A 4KRTA 1W3KA 4KWUA 3OLEA 1HX0A 1W9UA 4GKLA 2Z1KA 1QNRA 3AXIA 4F79A 5FOOA 3QOKA 4PMVA 4TOQA 4NZCA 1TUXA 3CH9A 2BVTA 1LWHA 2DSVA 3VIHA 1UD2A 3G6LA 3ARVA 5HPOA 3FNDA 1JI2A 2WCGA 3UG3A 5CG0A 1V3LA 4Y7EA 1V3MA 3A4WA 1H41A 2YBTA 2PWFA 1VEMA 2XHYA 4FF5A 1KXVA 1J0IA 2PWDA 2OSXA 2A3AA 2D3LA 1KCKA 3NDYA 5TD4A 4J3XA 3MS8A 4H8HA 1XC6A 4MNJA 3VIPA 4LXFA 4F9DA 5KZ6A 3RM4A 3WMCA 4PCTA 4TVCA 2YDSA 2WZEA 5DT7A 1XRVA 1UWIA 2EPLX 3SCWA 3CUHA 1W1VA 4P8XA 1GQIA 4LX4A 3LPGA 3MUAA 3UETA 1MFUA 2ZUTA 1OGGA 1QBBA 4KH2A 4F66A 5EFFA 1BQCA 4MB5A 4JFVA 3VIJA 4D72A 4X0NA 1R87A 2J62A 3U7BA 1J01A 2JFEX 3O2LA 3ZT7A 3BLKA 3E1F1 3AICA 2OWCA 1G5AA 4ZXOA 2J7CA 4HMCA 1FH8A 3WUEA 2RGMA 5A1AA 2G3IA 2WC3A 2J78A 1KFWA 3WNNA 3WH7A 2WLZA 1W91A 4DWSB 1UKSA 1GJWA 1C91A 3L4XA 4OKDA 5BROA 1E4LA 5FIPA 2CPUA 1OIFA 4AZ5A 5EBAA 2VC9A 1CIUA 2QPSA 3OA5A 2OYKA 3CHDA 1L0PA 1JDCA 1V02A 3G6MA 1CNVA 1PZ3A 3DHPA 2WZIA 4UQEA 1KGXA 4D6HA 2IUZA 2JEPA 3WQWA 4UZUA 3VGBA 5A2AA 1CXKA 5A95A 2Z1SA 3PZOA 2OLHA 4D6DA 3UR8A 3CIVA 1TZ7A 3II1A 5A6KA 3NDZA 1HJWA 1CYGA 1OB0A 4HU8A 2YL5A 8CGTA 4QFUA 2GUYA 3ZJ8A 5DF0A 4E8CA 1VEPA 1JXKA 1XHGA 2GJXB 2WMGA 3WF0A 4WKHA 3PZGA 4UFJA 3PTKA 5E6YA 3POHA 3TOPA 2Y24A 2PWHA 3BAXA 1CXIA 2WCSA 4GI9A 1EOKA 3VU2A 1CXFA 1HJQA 5DEZA 1ZU8A 3L4VA 1JNDA 5ABHA 4N42A 3S2CA 2J79A 3W25A 5IDIA 4P8VA 1JYXA 5I24A 1DHKA 1H1NA 3EDEA 1MXDA 2D0FA 1HIZA 1WB0A 4ZFMA 1YHTA 5BXTA 3UESA 2QLYA 1PAMA 3J7HA 3CUFA 4JL1A 1ISVA 2XJ7A 5A8MA 3WBEA 4JFSA 1SYTA 2VR5A 1AVAA 4AZGA 3RCNA 1K6AA 3O9NA 3PTMA 1WO2A 3FHAA 2E8ZA 2CYGA 1LG2A 3OLDA 1M01A 1QW8A 1WKYA 2VZSA 1P6WA 4U3CA 4MAVA 4ACZA 2WVUA 2VCAA 3WD3A 3F5JA 3BC9A 4E2OA 3TTSA 1OCQA 2QMKA 1O6IA 2CXGA 4UOJA 4AZCA 1HT6A 1FH7A 2O9PA 3CZGA 2XFRA 1DWIM 3IK2A 3EBVA 3OBAA 2HISA 4QAWA 4MADA 3WQ6A 3WQ4A 5ABFB 2E9MA 1UHVA 1E4IA 1ECEA 1UKOA 1UR1A 2YDRA 1BYDA 3U5YA 1PIFA 4LPCA 3W81A 3AI0A 4M8UA 1CXHA 1ZBWA 2VX6A 2E4TA 1B2YA 5FL0A 2J4GA 2C8NA 1X6LA 1U30A 4EANA 2DT2A 3T0AA 4M29A 3A6OA 2YA1A 2BY2A 2WANA 1UOKA 4XUYA 4ATWA 1W1YA 1BVNP 1D7FA 3MUIA 2NSXA 4Z2IA 1ITXA 5HXMA 2AOSA 2BY3A 4W87A 1B3ZA 2WPGA 1OD8A 4GZJA 5A6JA 2J47A 1GNXA 4AZ6A 4PUEA 2V5CA 1HJVA 1UD3A 1ZS2A 3SUVA 4D1JA 2V5DA 2W61A 3GNRA 2BFGA 2G3MA 2W92A 4JCLA 1OT1A 2G8ZA 1E5JA 2GJXA 1BG4A 4A4AA 3SCSA 3N13A 2A3BA 1EIBA 3VD5A 5A94A 2BHZA 3SCNA 3JUGA 5AC5A 4WJXA 3ZO9A 1ZJAA 4GINA 1UWRA 4GXPA 3N18A 4PTVA 3THDA 2YIHA 4XB3A 5FCZA 1VRXA 1XH1A 2DH2A 6CGTA 4FLOA 1GZJA 3GBEA 4KMQA 3VNYA 2WW5A 1GUVA 1G9HA 2OSWA 2WVVA 1JDDA 5D9OA 5D9PA 3AQUA 1NOFA 3ARQA 4BQ4A 4P7LA 3DECA 1LJYA 1V0LA 1CLXA 1UA7A 2W67A 3W28A 2X09A 4UCFA 1V0MA 2YLAA 4PMZA 3CUGA 1CGWA 3FXYA 4GI6A 3WEOA 2WXDM 1V0NA 1V3JA 3N12A 4BQ5A 1KXHA 4QLLA 4JKMA 3AS2A 2ZOXA 5CPQA 1W3HA 2DSZA 3WEZA 3AMKA 1H0GA 2JF6A 1R8LA 4P7NA 3QHNA 4EKJA 1CDGA 3OGVA 5A8PA 3WKZA 3BAKA 3WNMA 1FFRA 1ISZA 4AC1X 4S3JA 1JYNA 2DQXA 3DYOA 1X1NA 5I0DA 2UY4A 4DUWA 1E73M 2OSYA 1UWQA 1EDTA 1CLVA 1B30A 2WKLA 1JZ2A 2OYLA 1GONA 5DMYA 3T2PA 2XVPA 2YL8A 4HZ8A 2ZUSA 3VUPA 4PMDA 3WFLA 4HZ6A 2A3CA 2BVDA 3WDPP 1QNPA 1GVIA 1E3XA 2D2OA 3WFZA 1R7OA 5D9MA 3VD7A 3A4AA 1H5VA 2D23A 2V38A 1J0HA 2XG9A 4TTGA 3VINA 1J9YA 3VIKA 3OLGA 2BVYA 3QHOA 1B90A 2WHJA 2Y8VA 2MANA 4J28A 3MMUA 2FGZA 1BSIA 4LQ1A 1IT0A 1QVBA 5FL1A 4UFHA 4HA4A 3WMSA 4W84A 3RDKA 1DP0A 4YHGA 4AZBA 5AYBA 2WMHA 2DDXA 5D4YA 2G3JA 2WHKA 4JFWA 3AHYA 5JUVA 1YQ2A 3WD1A 2X05A 4AEEA 4MB3A 3CUIA 4AD3A 3NSNA 2EPNA 3AIQA 3PZ9A 1QHZA 2VZUA 3AZSA 3PBGA 4W7UA 3CMGA 1FHDA 1AMYA 1KXTA 1CZ1A 1VFMA 1E6PA 1DWAM 4A3YA 1SFSA 1QW9A 3HN3A 3AIBA 1V6YA 3DYPA 1MYRA 1PBGA 3OLIA 5AC4A 1N82A 5CPSA 1EDGA 4OJYA 3N15A 4GIAA 1J12A 1AQ0A 1OT2A 1M53A 4DM1A 2DT0A 1XD0A 3VIOA 1NWRA 4LGXA 4B16A 4PMRA 1BPLB 2VMFA 3PZIA 1NM9A 4JKKA 4ACZB 5BYWA 3T0BA 1C7TA 1S46A 4R5EA 1XCXA 2J8FA 3WF1A 3AFBA 1VBRA 3GH5A 3LPPA 3OG2A 2CIPA 5LA1A 4JL2A 3AMCA 4KRUA 4CGTA 4UTFA 1WZMA 5BXRA 1VJSA 2VJXA 1UH3A 4Z2KA 4BF7A 3WY1A 4D6EA 4OBSA 2WBKA 3BAYA 1RD6A 1WCGA 5JIPA 3SCUA 1B3XA 2VZTA 2XGIA 3IJ8A 1E6XM 1VBUA 1DWGM 1UD4A 1WDPA 2G4FA 4PYSA 5HPCA 1W9BM 1AQHA 2WHMA 1E6SM 4S3KA 4JIEA 3OB8A 4Q7NA 1F4HA 7TAAA 1JD7A 1E55A 1CGTA 2VX4A 4U31A 3EYPA 1F4AA 2VX7A 4W93A 2O9RA 3CMJA 1NWUA 1JZ3A 4PUDA 4EE9A 1CXEA 3VIMA 2D0GA 4M81A 2X1IA 2FDMA 2EXOA 3VTRA 2NT1A 3GNPA 1U33A 1V3KA 1LF1A 1US2A 1J0YA 4H8UA 1BFNA 1IZKA 2C7FA 1KR0A 3VX0A 2WC7A 4W85A 2YLLA 1KWGA 1SMAA 3M07A 1LLOA 3OIHA 1G01A 3AS0A 5IHSA 3TTYA 2UY3A 2ZX9A 2J25A 4D71A 3MMDA 1XGZA 3CZJA 3AHVA 5KEZA 1E72M 2VX5A 6A3HA 1O7AA 1HJUA 4PSRA 3UR7A 1J11A 3K8KA 1D3CA 4OBRA 3WH5A 4IUGA 2ZXQA 1JZ6A 1UUQA 1W2VA 1K9DA 3ZMRA 3VD3A 2VTFA 3VMPA 2O9OA 3BAJA 3SUTA 3AXXA 5EFDA 5M17A 2YOCA 1H4PA 5CGTA 1CECA 1JF5A 1WE5A 4B3LA 2PB1A 1LG1A 1A3HA 2JIEA 3GZAA 4U33A 1JIBA 5C8BB 4CVWA 3ZIZA 4HZ7A 1X6NA 2EPOA 1JXJA 4DWSD 3MO4A 4CD5A 3W53A 4V2XA 2WWCA 4PMXA 4BZYA 4GQRA 5E6ZA 2VRKA 1B9ZA 1PEZA 4M80A 2F61A 5I5RA 1TCMA 1WDQA 1W9DM 5HOSA 1OBAA 3NUKA 3T0DA 7A3HA 2CEQA 1R85A 3EDDA 4W8LA 5A2BA 3M6DA 3MU7A 2XFFA 2WVSA 1WP6A 4OUEA 3K8LA 2J7BA 3AS3A 1TR1A 4N0RA 1OWQA 2XVKA 1EHNA 4JKLA 3N1AA 2E8YA 3BAWA 2XSAA 3NJ3A 1B31A 3L4TA 4UZSA 2F8QA 3GXIA 1JNEA 1UWTA 4JFTA 5E70A 2E0PA 3A3HA 3APGA 4CN1A 3AXHA 4IPNB 3FHQA 1BGAA 5E9AA 4WLCA 2PC8A 2IXVA 5JBFA 4BS0A 3ZT6A 4M24A 1RPKA 5AYIA 1TMQA 1TVNA 3OGSA 5IFPA 2Q8XA 1DWJM 3BH4A 1G94A 4NF7A 4KGJA 4EAMA 3WSUA 2PWGA 1W9VA 2J7FA 1UKPA 1PX8A 4CN4A 3W37A 3QOMA 4AXNA 3ARRA 1GCYA 4C7FA 3WEMA 1UR9A 2GK1A 2X8RA 1XYZA 4HPHA 5DT5A 3TTQA 4YHEA 4AZCB 4P7OA 2J7HA 2WMIB 1JFXA 2CBIA 4P8UA 4M82A 4ZE4A 3VGDA 4MNLA 5A8QA 3TP4A 4AW7A 3BMVA 2VOTA 2GDVA 4XZWA 3TTOA 4CU8A 4J7RA 3NSMA 1GHRA 4BQ2A 4E8DA 1JYVA 3LMYA 5A8OA 6TAAA 1BAGA 1HJSA 2X2YA 3BMWA 1A47A 8A3HA 3PZQA 3VD9A 2GJRA 4B3KA 2WWDA 3CZEA 2XUCA 3AMGA 4OIFA 1GQJA 1K9TA 4IISA 1C93A 1LL4A 1DTUA 1Q6EA 1HF6A 4FLRA 1V6XA 5HDRA 4AD5A 4X9YA 3EMCA 2YA2A 4UFKA 4DWSC 1EH9A 3SEPA 1KCLA 2XFYA 4BCEA 2Y2WA 3KWXA 4HOWA 3W29A 1GORA 3VM5A 1TE1A 3WL0A 4Z2HA 2FGLA 3AOFA 3U7VA 1NWSA 2ZWYA 4CUCA 5FKYA 4MJ2A 1VF8A 3GXFA 2D0HA 1UWSA 1KXQA 5D8WA 1PZ2A 1VFUA 5CGMA 3ZJKA 4MNKA 4TTUA 3CTTA 2XYLA 5GNYA 4UQDA 1PIGA 1EQPA 2QPUA 4ZEPA 4W8AA 1W32A 3WIJA 5IXEA 4WKFA 3W6LA 3ARWA 4PMYA 1UQYA 1FA2A 2HVMA 1BG9A 1C92A 4HOZA 1CGVA 3A4XA 3THCA 1Z32X 4U2YA 2WM0A 7CGTA 1PPIA 5D9NA 3BGAA 4W5UA 4F8XA 4AIUA 2XTKA 1HP5A 3VKKA 5A8NA 3BCFA 1UD6A 2WYSA 2JF7A 4UQBA 1XSKA 4GI8A 4ATDA 3K4DA 3POCA 1OGBA 2FHFA 2BS9A 4HMEA 3CZLA 4DWSA 1GOKA 3WDJA 3KE0A 1E56A 4F9JA 4MAZA 4W8BA 1H0IA 4AISA 1Y7VA 4UNIA 1SR0A 1IZJA 1H11A 3EDFA 1E1EA 2BHYA 5ABFA 4J3VA 3N9KA 4B9YA 1XYFA 3SCTA 1SMDA 2FH6A 1W3JA 1JL8A 2VZOA 2ZUMA 1E6NA 3AISA 3W27A 5JBEA 2PWEA 3MV11 4LYPA 3N11A 4CCCA 3VIIA 1OGSA 1E0XA 1KBKA 3WMBA 2CHNA 3K8MA 4U5IA 4GO8A 2ZX7A 4YPJA 3MUY1 1HVQA 1BTCA 2W66A 2DIJA 3ZSSA 5A3HA 2D22A 3EDJA 3ZT5A 1UZ4A 1EHAA 1DWFM 2Y8KA 2XIIA 4W89A 3WF3A 4OZOA 5CLWA 4W5ZA 4WSKA 1ZBKA 4H8VA 2DT3A 2OWXA 1H49A 3M46A 1R7AA 3ARZA 4MDPA 1W2PA 1IV8A 4AZIA 2X0HA 5BRQA 1TG7A 1E70M 2JEQA 3SURA 1J0ZA 3BXWA 1E6QM 2W91A 1GPFA 1BYAA 2QHAA 3TA9A 5BWFA 3ZJ6A 5F7UA 5A2CA 1E0WA 3VD4A 1GVYA 1W9XA 1UR8A 2YDQA 1HKKA 4WF7A 1E4NA 4URIA 3RIKA 5GNXA 3WNOA 4UFIA 3WNPA 4ZENA 4D1IA 1BGGA 3VM7A 5JH8A 2JALA 3ZM8A 3TONA 4CKQA 3ZOAA 1V6WA 3VOCA 1VB9A 1Q6GA 2VL4A 3CGTA 3AIVA 4ZXLA 3ARUA 1E3ZA 4AD2A 1QHPA 3L4WA 2E9LA 2GJPA 4HPGA 3T09A 1QHOA 4PCSA 4D6GA 1JF6A 4B9ZA 4MJ4A 3VDBA 2X0YA 1JG9A 3WUFA 3SCOA 4AD0A 3WDIA 5BCAA 1BF2A 5GQBA 3CO4A 3WD0A 2YBUA 4Z2GA 2WNWA 2W62A 2VRQA 4ZE5A 1UKTA 3AIUA 1JDAA 4HA3A 3PZNA 1UD8A 1ISWA 5BXPA 1B0IA 1HKMA 2V3EA 1GQLA 1C7SA 4TX6A 5JBDA 3W4RA 4J3TA 1HL8A 1KGWA 2JE8A 1C8XA 3AIWA 3IJ9A 4ATLA 1E71M 2F2HA 3PHAA 1UD5A 1J10A 3GNOA 1DEDA 3L4YA 5CSUA 3T08A 3GH7A 3ARPA 1ZBVA 1JYWA 4MNMA 1CGXA 1HVXA 3B9AA 1G0CA 3EMZA 1HJXA 1LL7A 3RJXA 4HMDA 1EO7A 3QR3A 1JAKA 4TVUA 4QDMA 1TFVA 1E0VA 2ESCA 3RJYA 2DPEA 1EXPA 4UFMA 1V6UA 5CPTA 4MB4A 2QF8A 2XWDA 4AY1A 1KGUA 4CN6A 4YN5A 3WDQA 4C7DA 2ZUNA 1GOWA 2J75A 4OOZA 3U57A 1Q4NX
chains in the Genus database with same CATH superfamily
2ZIDA 2WHLA 4GGHA 4D6CA 5SWUA 1SSDA 3R0DA 1IXNA 4PCNA 5CJNA 1SVDA 1IX5A 4Z1BA 1XIJA 1QPKA 3DC8A 4ODOA 1P6CA 1JZ8A 5AECA 1QPQA 2ACSA 2R91A 2WVTA 4XZHA 1K03A 1HL9A 4P7QA 5C0QA 3QFWA 5H8UA 4C02B 1FAPA 1AW2A 1UA3A 3DESA 4KERA 3O5RA 3TZFA 2WKJA 1OC7A 2KI3A 6REQA 4DX3A 2BXZA 3V5OA 5E5CA 4MGVA 3ZLGA 2JIWA 3K46A 1TKKA 4DT4A 2Y88A 1GYLA 1XW8A 1V93A 3GHTA 4V33A 2DZXA 4RZ5A 4FMVA 5K4ZA 3VKBA 4DB7A 3ANYA 2UV8G 5FD0A 1FHLA 1P43A 4I9MA 3A3WA 5C70A 3TJXA 4IQJA 4QJ3B 3H12A 5K2ZA 4EX4A 1J5SA 2VVSA 4GUFA 1P0DA 4YTSA 1XF0A 2QZRA 4WSHA 3MKCA 4CCDA 3U5UA 1VENA 1WOAA 2CNCA 4DJED 2YCIX 4Q7IA 1FWJC 2OR2A 4DJDA 2W6RA 4C6MA 1ZPTA 4JR5A 3SCQA 3RITA 3O5FA 4HP5A 1SZNA 1E9LA 1VCFA 4PRRA 4Y8EA 1M04A 7ENLA 3FGCB 4LYRA 3ANVA 3CAWA 2GL5A 3F2BA 4EPDC 1S5WA 1BWVA 4GPNA 3BUVA 3C2EA 3WN6A 4EVZA 2W63A 3HM7A 5CSYA 4IH3A 5EYWA 2PC4A 2R9RA 1S3HA 3MHGA 2PLCA 1YNYA 4PN2A 1QAPA 5CC7A 5E9XA 1Y8BA 2IXUA 5C2GA 3ME3A 2VRJA 1JRCA 2VDIA 1D8WA 4HT3A 2W27A 3MKVA 2OLSA 2H6RA 4NRRA 3DFNA 1QNQA 1RJRA 3VDHA 4NNBA 4YNGA 1EDQA 3LHZA 1C3FA 5IBXA 4DVOA 3KXQA 3VNJA 2CERA 3QV7A 2V6AA 4JAWA 5CBBA 2W4XA 2ZXDA 1A5OC 3SRKA 1X8FA 3H53A 1FXQA 2QR6A 2XSBA 1BSLA 4K8EA 2OOGA 1W1B1 1UC5A 2DVTA 2FZBA 3IS4A 5CG7A 4GIYA 4WR3A 4JTHA 3HPXA 1ICQA 3CC1A 1TJ0A 2DG3A 5M1TA 1A0CA 4DI9A 3UP8A 4J5NA 3H23A 4DRJA 1OFRA 4RE2A 2DGAA 3ZR4A 3P74A 1V3HA 3UQIA 1HO1A 3RM9A 4CNOA 4RJEA 2OTDA 4PTWA 4PMQA 1V02E 4AWEA 2CBUA 2M08A 3LG3A 3SB0A 3NL3A 4XVEA 4U10A 2B4GA 1W1TA 1PKLA 5HNNA 3S4TA 4BR1A 4ES4A 3VIGA 2OO0A 5CQ1A 2Z6JA 4CQBA 2XM2A 4L61A 3GBDA 1JPIA 2RUQA 4DZHA 3U6WA 1U5HA 4KKXA 1TMHA 4XBKA 1CENA 3YPIA 4M6QA 2YFNA 3SRDA 3GW0A 2QUMA 2X1RA 3LPOA 3UERA 4Q6JA 3L4ZA 5EMUA 4RE3A 3JYJA 3PAOA 4KFOA 3RMEA 2ZUUA 2VD9A 4AZHA 3WBXA 2HJPA 2CHOA 1D2KA 2NVAA 3O05A 2EG6A 2HV5A 4D2JA 1XH0A 4HB7A 3W26A 1RCQA 2YL9A 2ZX6A 3NNTA 1ODUA 2EO7A 1TV2A 4L9YA 1ELSA 4IQLA 1WAWA 4KWVA 3UGVA 7PTDA 4QT3A 2NX3A 3UA3A 5I23A 4L4MA 4X0VA 1RPXA 4NRSA 1FKRA 4B2DD 4F2TA 4KBXA 3RK8A 3AUOA 3BOXA 2AAAA 4TXEA 1V0KA 1NDZA 1D8CA 4Q8QA 4YLWA 1JCHB 4N7QA 4TU1A 1TSIA 2CLLA 3BMBA 2TAAA 4HVXA 5HNTA 2DZWA 3OZOA 2R1MA 4FSAA 3CHVA 3DEQA 5EMLA 1NTHA 1UUOA 3W0KA 3GFZA 1SPQA 2RUDA 4AIOA 1YPIA 2A3HA 1LRQA 3RLHA 4O0ZA 1QOQA 1CGYA 2EEXA 1HNYA 3GAYA 3R8RA 2ATMA 3DHDA 3S1WA 1I6NA 4DRSA 1S5NA 4OT7A 4F4RA 4JFUA 1Z6KA 4JQ4A 1XLEA 5A6LA 1UR4A 3B05A 1FKTA 4GYPC 1WZAA 3AWNA 4A22A 2WMKA 3M0MA 1QBAA 4J3UA 1LM1A 4IM4A 1ZAHA 3VMOA 4F0HA 4AB4A 1ME9A 5CH9A 2CZVA 3F4NA 3PFRA 4WD0A 4JTTA 3WNLA 2H90A 1VAHA 2ZE0A 5XIAA 4TW8A 1H09A 1IXQA 1JZ5A 2GWGA 3WQ8A 3DIPA 1KLZA 4AWSA 1MW2A 1LCOA 3ALFA 1R3RA 4GBDA 4O16A 3H22A 3O6CA 4RE4A 4DF1A 3GDLA 4MDOA 3NQBA 1KCZA 4YS1A 3CWOX 2XPKA 3XISA 3TCZA 1XH2A 3R94A 4JFKA 2VP8A 5LNVA 1YDOA 2GGHA 4IL0A 1J5TA 2NW0A 3V0SA 3W1MA 3PTQA 3QW3A 5F1VA 1VBGA 2B7NA 1JAEA 4L4PA 2UY2A 3L2MA 3H2EA 3URQA 2XN0A 1FVPA 1M03A 1U83A 1K8CA 3WL1A 4IQDA 3MUXA 3SN0A 3UZWA 2J7GA 1NP0A 3SSZA 1EO5A 4WK9A 4E4PA 2WK2A 4TX9A 4M6VA 3AIEA 3QY8A 3W6MA 4EWND 5MHBA 1M41A 1SZFA 4W7VA 3GH4A 1FJDA 1TJ1A 3B0VC 3BCDA 1FKFA 1PX3A 5FI8A 3CAVA 2QMJA 1YW1A 3O5KA 4PSPA 4NQ1A 1J4EA 1KA9F 1VFFA 2DIEA 3HG3A 1DJYA 4W4QA 2PGFA 4PBFA 1A4MA 1QDSA 2CKRA 3T4CA 1FDJA 3PVFA 5FF3A 5BNKA 3VZZA 3S46A 4LVDA 1M7XA 3GTNA 3D3AA 3DC0A 3W01A 4UMAA 4A3HA 3MVTA 4OGZA 5LGXA 3VPLA 1XLBA 1A7XA 2VCCA 1FWSA 2XINA 3MPGA 3EWBX 5JXQA 3O5EA 1VEOA 4ACYA 2Y4SA 7XIMA 1JGIA 3WH0A 2HQAA 3M6YA 2RQSA 2DORA 4GUGA 4DRMA 3HPSA 3LXBA 1XGDA 3VE7A 1ZCOA 2PTWA 3AIRA 2D3NA 3CZ8A 1XUZA 4ZQMA 3FKKA 1RBOB 4Z2JA 3B9EA 1WPCA 1IWBA 2NSOA 4WIWA 3QBUA 4E4FA 2BHUA 2Y7EA 3MDYB 3BQ5A 4J40A 4FLQA 3GWQA 3BE7A 4ZQNA 4TX8A 4I6VA 4JYSA 1L6SA 2YBVA 1ONEA 2BGSA 4DIAA 4F3HA 4H2CA 4GK8A 3NVTA 4PE8A 3KCOA 2AMGA 4W9QA 4DZ3A 3SY1A 3VZXA 4V15A 2E40A 4N9EA 4OE7A 1JI1A 4DBUA 1RCXB 4QG9A 3VNLA 1V77A 3E3HA 3VGEA 1OG0A 4OHQA 5FEZA 4C6PA 3WF2A 4NJGA 1EJRC 4YTRA 4LAWA 4XAZA 3KL5A 5CC6A 3W7CA 3OODA 1MUMA 4B4HA 5CSSA 4K68A 1ESWA 9CGTA 2HE8A 4E38A 1BXCA 3LHUA 2FHCA 2GWNA 3PSWA 2PV3A 2ACUA 1YTKA 1WXZA 3DH7A 1WDSA 2YKKA 3A23A 3LI1A 1T8QA 1GKPA 5EMYA 1TB3A 2PBOA 3A47A 2X30A 4IJRA 4DJFC 2FVMA 1M5YA 3G0UA 3WQGA 2J74A 1W3KA 1H7XA 2GVLA 1W9UA 4QHRA 1QNRA 1VHCA 4G1KA 4PMVA 4UTKA 2VHLA 3TC5A 3AJXA 1LWHA 3MSYA 5TQLA 3FNDA 2WCGA 1WBHA 3VK5A 3AU2A 1XLCA 2JGYA 2HNEA 2PWFA 3LCXA 4ZPWR 1MRQA 1J0IA 2Y0FA 2YCKX 4H9TA 3M5XA 3EB2A 2PP1A 3W73A 6TIMA 3KHDA 3NDYA 5TD4A 1A5MC 3LCWA 1XLJA 3T9PA 1ENUA 1SZEA 3EB4A 4KETA 4FXRA 2PTXA 4E8GA 1Q13A 5DQPA 5KZ6A 3E38A 4L64A 4TVCA 2PF8A 3QSTA 3TAKA 2ACRA 3DFHA 4HU4A 3TKFA 1AK5A 4HYVA 3SQMA 2V30A 4P8XA 1GQIA 2VKZG 3LZ3A 4HYWA 4LX4A 5HQLA 3LPGA 3UXDA 2OG9A 1EC9A 2ZUTA 4F40A 1OGGA 3STCA 4KH2A 4F66A 4IHCA 2Y62A 4DPQA 2E6YA 4EWJA 3EKLA 4DELA 2P3ZA 2ZRVA 3TJLA 1RHCA 2D2HA 2JFEX 3BLKA 3S47A 3WJSA 1SW3A 3L23A 3NM1A 1I2OA 4ZXOA 4GVFA 3O0FA 3VC5A 4RE0A 2G3IA 1MEIA 4O1BA 3R11A 2WLZA 2QEZA 4QJ4B 3L4XA 1X1OA 4NJIA 5FAGA 2I1OA 3HOJA 2FKPA 2VC9A 5EA9A 1KKOA 1PHQA 3G6MA 1FKWA 1KGXA 2C1IA 4D6HA 3TTEA 3E9AA 1K8XA 1XGEA 3PZOA 3UR8A 3CIVA 4X9SA 2WNQA 4RK8A 2OZ0A 5BOOA 3SJ3A 1FRBA 3W6YA 5C5YA 4A8NA 3A5FA 1AH0A 3MTWA 3ZJ8A 4E8CA 1VEPA 1JXKA 1XHGA 2WMGA 1VJIA 2GSEA 3VFCA 4WKHA 3PZGA 3PA7A 4AQLA 3OBKA 1QJWA 2WM1A 5E6YA 3TOPA 2QUVA 3LQLA 4V1XA 4AY8A 5DEZA 1RJPA 5LNRA 4KF1A 1XINA 3GNXA 5HMDA 2Y78A 2VYOA 3B0PA 4C1KA 3IK4A 3CMFA 3TDFA 5K9DA 4L5ZA 2PMQA 3LMZA 4LEFA 3EDEA 1MXDA 1KRCC 2D0FA 1HIZA 3ABSA 1WB0A 4ZFMA 3I6CA 1YHTA 5BXTA 4JPGA 4A3RA 3RU8X 1ISVA 1BKHA 2P76A 3WBEA 2IKHA 3O5OA 3MCNA 1AVAA 3O7UA 3NFUA 2OKOA 3PULA 3RR1A 1LG2A 1AA1B 1JCLA 2VZSA 2A7PA 5E0KA 2WVUA 2XN1A 2QJNA 4JX5A 3UI5A 2J9YA 1O6IA 4AZCA 2INZA 3TH6A 3W1UA 2XFRA 1DWIM 3EBVA 3OBAA 3M5VA 5BZAA 1RR2A 5ABFB 2J66A 1UR1A 1D7JA 4FNPA 3U5YA 3W81A 4A3UA 4A8LA 1YDVA 5FAJA 1CXHA 4DBWA 2RURA 3ATYA 2PZNA 3KBSA 4GHRA 1ZBWA 1XLAA 2HROA 2O4MA 2ZZ6A 3S6OA 1QOPA 5FL0A 4E3VA 4EANA 3W7MA 4RDVA 1PYMA 1XI3A 3WQFA 4ATWA 3EGJA 1D7FA 1KC7A 3MUIA 2NSXA 3I10A 2J13A 4Z2IA 3GAKA 1XYLA 1MZRA 5HXMA 4NAFB 3UA4A 2DZVA 1XIHA 3KAFA 1OD8A 4S3GA 2V5CA 1R9ZA 3ZFHA 1RUSA 4TW7A 1OX6A 3TLLA 2G3MA 1KW1A 4I9AA 3L0GA 3AAMA 1OT1A 5D32A 2QJMA 4HJWA 1E5JA 2GJXA 3M43A 3N13A 1M7JA 5A94A 3ZVIA 3QGAC 2ZZ2A 1R9YA 1EC7A 3T40A 3GYEA 1YEYA 1ZJAA 1GTEA 4GINA 1UWRA 3REQB 1G6CA 4JFMA 4PTVA 4ZFCA 1XH1A 3V0TA 3TC7A 1PUDA 2R14A 3GBEA 1PTDA 1DJZA 1JJKA 3VNYA 3CO8A 3S83A 3AQUA 2R1LA 2ZQVA 4C6OA 4LALA 3DECA 1LJYA 3MP5A 1V0LA 1CLXA 4TW6A 4OFCA 1MZHA 1PTGA 2NLYA 2QJGA 3A22A 1TE6A 3TYBA 3RLGA 1V0MA 1EF3A 2YLAA 3CUGA 3B8UA 3WEOA 1NFPA 1M7OA 2PTYA 4Q8NA 2FPYA 3N12A 1TRDA 4BQ5A 4JKMA 4QEEA 3JR2A 2PE4A 4J4KA 4INFA 2PDCA 1JNSA 3BG5A 3DX5A 1LORA 3LX9A 1EKOA 4Y9NA 1CDGA 1J4IA 1JQVA 1HKVA 3JZEA 3MYOA 3OGVA 4HSOA 3W7RA 2H8ZA 1FWNA 3P62A 4WY0B 1JYNA 2DQXA 4AY7A 3QTGA 1BF6A 3DHFA 1Q45A 1ONXA 1V8EA 1W31A 3LCIA 3P93A 4GX8A 3DI0A 4JTEA 4AMAA 2OT0A 2YL8A 2ZUSA 1W5OA 3LSCA 2I9UA 4GQ0A 1A5AA 5D04C 3TX9A 4FXFA 1E3XA 1TJ2A 1REQB 4UTTC 1JEZA 1L2UA 2ONEA 1F5ZA 1K7EA 3VINA 1IE7C 4K6AA 2BVYA 3QHOA 4IJBA 2CLEA 3TJ4A 3V7PA 4LQ1A 3M16A 3RG6A 1W26A 3DFYA 4HPNA 1DP0A 1A80A 4LUYA 5FJJA 4UBPC 2LGOA 4JTIA 3LY0A 3T07A 5D4YA 4IIHA 4NNRA 1PKNA 5BWAA 1H51A 4K2SA 3NA8A 1B6CA 1KLYA 2X05A 4L7ZA 3EA2A 1PWMA 1TV8A 3NSNA 3PZ9A 4MFDA 3AXMA 3PBGA 4W7UA 2XIMA 1F61A 4BFAA 4O2TA 4JXCA 4YCOA 1DWAM 1AJ2A 1QW9A 2FTPA 2WQPA 3LS9A 3AIBA 5CBJA 4S3DA 5REQA 3OLIA 5JVLA 3KZPA 4GIAA 3C61A 2OEKA 1AQ0A 1NF7A 3O8AA 5AB3A 4DM1A 5HWNA 2DT0A 1XD0A 3UY8A 4LGXA 2ZCGA 1P0EA 2EHHA 4CNNA 4JKKA 4ACZB 2PGRA 1C7TA 4R5EA 3U8GA 3FYPA 5TF0A 3BLFA 3RX4A 1XCXA 3GH5A 1VBRA 5LA1A 1LZOA 1XYMA 3AMCA 1YBQA 2HMCA 4UTFA 5BXRA 3EZ4A 2ZYFA 2QCGA 4BF7A 1Q7QA 4H6KA 4O4WA 2WBKA 2VGFA 1RD6A 5JIPA 3SCUA 2VZTA 1J2BA 3BLLA 2XGIA 1VBUA 5ENLA 1UD4A 2WHMA 2DY3A 3LCHA 1DJWA 4Q7NA 1Q6OA 1CGTA 2XH7A 4DYJA 4GVIA 3VNMA 1S2WA 4ZOEA 2VX7A 4W93A 5HNRA 2O9RA 3CMJA 4XD4A 4PUDA 3CGMA 3E0FA 2X1IA 2A85A 3V36A 3VCCA 3WBYA 1W8SA 3BO9A 1V3KA 4O12A 3W7PA 1CX9A 3VNKA 2CLPA 3QKEA 4DY1A 1J0YA 1KR0A 3EOOA 1DJGA 5LIKX 3DENA 3BDKA 4NXKA 1VH7A 5IOBA 3CZJA 3AHVA 4DLMA 1E72M 2VX5A 6A3HA 5HUAA 4EAYA 1DBTA 3UR7A 3K8KA 1D3CA 4IQCA 1FKSA 1UUQA 2DJXA 1WUEA 4RXGA 1K9DA 3HG2A 4XVDA 3PANA 3FVMA 3EKGA 3VMPA 3MBFA 5GJNA 3BAJA 3SUTA 2QGYA 1KRBC 1H4PA 4X2PA 1C8VA 1JF5A 4MJMA 1LG1A 2HRWA 4I90A 3H6OA 1EJWC 5T9CE 1X6NA 3S5YA 1QK2A 1JXJA 3T1GA 3W53A 4V2XA 1GEHA 4L1XA 3A64A 5E6ZA 2VRKA 2EKGA 4E4UA 2F61A 1VS1A 5JH1A 4IT1A 3SY5A 4HNCA 3ITLA 2V8ZA 4MIMA 4K7VA 3NUKA 4QJ1A 1OYCA 3E2VA 4YWSA 3ZZ1A 1PDZA 2PU1A 3IVSA 3UF9A 3CXOA 5CPMA 2ZRUA 1FX6A 3K8LA 3SW6A 4LAOA 4MWAD 4N0RA 1I0DA 1F05A 3GUWA 2PD5A 4LCRA 1GPWA 1SJDA 3BAWA 3B40A 4GXMA 4QE1A 3PPCA 2VWSA 3NJ3A 3M44A 1S1RA 4U85A 1S38A 4XZ9A 5KITA 3GXIA 5FJOA 2E0PA 3TN3A 3AXHA 3W72A 1U1UA 2ALRA 2FVLA 3W87A 1R3WA 1AFSA 4GY0A 4Q8WA 4ZSUA 4WLCA 1ITUA 3BVJA 4BS0A 4EACA 3GIYA 3GNDA 1YADA 1QPNA 4KGJA 2PWGA 1UKPA 4K1WA 3IIXA 4HNVA 2QCNA 2Y70A 3W7LA 3WQOA 3NQGA 3TTQA 1RV8A 5GPGA 1UR3M 4P8UA 4ZE4A 1TQXA 2BXVA 1K1DA 4MNLA 3PPGA 2BODX 3TP4A 4AW7A 2CLHA 3VOJA 3TTOA 3O5QA 4CU8A 4J7RA 1F6PA 1GHRA 4JHMA 1GWJA 2A7NA 3HJZA 6TAAA 4JTDA 3FSUA 5I09A 8A3HA 4JX6A 2NVDA 2QV5A 2Y7GA 3AMGA 3MB9A 1GQJA 4IISA 3D6NA 1C93A 2AQVA 3WLPA 1LL4A 5C7VA 1DTUA 5D05A 2HVNA 3E6EA 1BXNA 2W79A 4XQ6A 2EKCA 1EH9A 1W6TA 4IGNA 4BCEA 1THFD 3MJMA 3QSRA 5K9CA 5KZDA 3CASA 1GORA 3WL0A 4Z2HA 1LBLA 3U7VA 3JZUA 4H19A 4CUCA 3VKJA 4FNTA 2D0HA 1UWSA 1FKXA 3KP1A 1VFUA 2XP4A 1MI3A 3H2CA 1E1CA 3IUDA 3MWCA 2XYLA 4UQDA 1RY8A 3H54A 2F7FA 3BLDA 1XYCA 4IUOA 1Z8AA 1J6OA 2GPTA 4C6EA 3IV8A 4ZEPA 4C6BA 1W32A 2VEPA 2IKGA 3ARWA 3M0JA 2P88A 1CGVA 3THCA 4WRHA 1Z32X 5KMYA 7CGTA 2C1HA 5GJPA 5A8NA 3KHJA 3BCFA 1OVDA 2WYSA 4GUIA 4UQBA 4US5D 3KFTA 4I7UA 4C1NB 4EPKA 3POCA 2BS9A 1BRLA 8XIAA 3CZLA 4FI4A 1E56A 1G67A 3KVKA 1TV5A 4UNKA 1H0IA 1IGSA 4UNIA 2C79A 4J3VA 2ABBA 3FYOA 4MYXA 3UQNA 2ZUMA 1E6NA 3W27A 2NX1A 2PWEA 3MV11 4LYPA 2LJ4A 3UQAA 2PD9A 3GE7A 3WLKX 1OGSA 1E0XA 2P8BA 3WMBA 3NR0A 2CHNA 3GKFA 4ZGYA 4RZ6A 4YPJA 2NXGA 3BZGA 2A0NA 4FX8A 2DIJA 3PY2A 2D22A 3ZT5A 4DXVA 1UZ4A 3E0VA 3W7OA 1OC5A 3TR9A 4EPEC 4Q8VA 4IPJA 1OY0A 3SN1A 2XIIA 3WF3A 3VKDA 2RDWA 4OZOA 4WQ6A 5CLWA 4YVPA 1ZY9A 1JVNA 1ONRA 4W5ZA 4WSKA 4JYEA 4US6A 3M46A 3OYXA 3THAA 2NQ9A 3UGRA 4MDPA 2EG8A 1IV8A 2PWUA 2PN0A 5BU6A 2FPTA 2QJHA 3KS6A 3BXWA 2W91A 3LLXA 1GPFA 5BWFA 2QHAA 3FKRA 3H70A 5A2CA 1E0WA 3VD4A 2XDFA 4RXFA 1HKKA 4C6FA 3F4WA 2QAPA 4LJ3A 4URIA 3WNOA 4FX7A 4D1IA 3LV6A 3S5OA 4UTTA 3BICA 4B92A 1V6WA 3PBMA 3VOCA 1PVNA 4JYFA 2ZBTA 5HULA 2ISSA 2VL4A 4DUOA 6REQB 3I6TA 4O18A 1SO4A 4ODMA 3NG3A 1E3ZA 4AD2A 2I17A 1QHPA 3BCJA 2P1FA 2TODA 3KLKA 4PTDA 2OFJA 3OA3A 1YDNA 1QHOA 4PCSA 4DIPA 4D6GA 4B9ZA 5K9XA 3GG0A 1XX1A 1XQKA 4TR9A 5HW8A 3CO4A 1C9HA 2P0OA 2YBUA 3W7IA 4Z2GA 2W62A 3AIUA 3QQWA 1JDAA 3PZNA 4GJ1A 2EGZA 5BXPA 3HG4A 1B0IA 3L5MA 4R7WA 1C7SA 3P81A 1O68A 3OOBA 1BL4A 3UZYA 2FGBA 4J3TA 3TQPA 3WJWA 4FPSA 1KGWA 5FSEC 2JE8A 3W1XA 5D75A 4MWAC 1UD5A 1J10A 1F07A 1KO0A 3CIWA 4C6KA 1T6MA 1DXEA 4QIUA 4WDUA 2BZNA 3NO5A 3WG6A 1HVXA 3EMZA 2L5HA 4J4NA 3EA1A 1ML1A 1F76A 3T8QA 4G6CA 4TVUA 4FAPA 4EXQA 3PP7A 2PCEA 2DPEA 1F3TA 4UFMA 5F4WA 3NDOA 1JR1A 4GQGA 4CN6A 4RUBA 4MZ8A 4D9PA 1G7UA 2J75A 3SDOA 2F6XA 3U57A 3TXZA 4LCQA 2FZ9A 4IG2B 1W1A1 4GE8A 4EK7A 2WAGA 4NILA 5E0FA 3RPMA 3KZSA 1PXGA 2WC4A 2WCAA 2FMOA 5AHLA 4IMAA 2Q6ZA 4JFJA 1GOXA 2I5IA 3DG3A 3BAIA 2UWFA 1DJXA 1ZFJA 1MUCA 3UWUA 4H3DA 4JTKA 2DP3A 4PC8A 1DL3A 2BSLA 1ADSA 3UD6A 3LA4A 1GVOA 3WQVA 5LYRA 1HG3A 2CLMA 3OPSA 3KACA 1Y5VA 3BARA 3PJTA 4UNLA 3M7SA 2JGQA 1TV4A 4PA8A 3RF9A 5A8GA 3ITCA 4ZBCA 3VDCA 5KINA 2VEGA 4MY8A 1LYXA 4JQ1A 5JIWA 3BJSA 1KRAC 3UJEA 5I03A 2X1SA 4N02A 3SUUA 2ZFAA 1YYAA 1IXOA 1I1WA 4GC4A 4LY8A 1ZAJA 4B91A 4GQQA 4K8GA 1KTBA 3QZEA 4AWUA 3T05A 3WDHA 2VR4A 5CZJA 1N2VA 9XIMA 2TSYA 3ABRA 1OYBA 4AEFA 3GIPA 1DJIA 3NL5A 4QDPA 1ISYA 3C2YA 1OFBA 3TSDA 3VDAA 1GVSA 1HP4A 4XAPA 4NI8A 4HNUA 1Q1CA 1S3TC 2MF9A 1OFAA 1QI4A 1F8IA 5M3WA 3B97A 4DM2A 4U3AA 1WQ5A 2BXYA 4GZEA 4CD4A 4E2VA 4S23A 1K9EA 3SUSA 2I16A 2WKGA 2PTZA 1UR2A 4XAYA 4P7RA 3B8SA 3CGNA 1Q8JA 4IIDA 3TA6A 2REQB 2E7FA 4MF4A 4S2CA 1KQYA 4G5DA 3KADA 4KEUA 1MXGA 2WB5A 1H61A 1RXOB 4OECA 1B5TA 2YJQA 3ABXA 1UP3A 3STGA 1KT1A 3CZKA 4UFLA 4PRWA 3K1DA 1XRFA 3UJFA 1ODZA 2GUUA 4UR9A 1M65A 5I3KA 3GYCA 2XPAA 3WLLA 3CYJA 4PUMA 1E1FA 4AH7A 2E5CA 1LT8A 3UEQA 1MVYA 4DJEC 5DRCA 1I2RA 3VA8A 2IQTA 1UPPA 3M64A 4UQ9A 5D37A 3CHCA 2BWGA 3EMQA 2H9AA 1WDRA 2P0IA 3W1LA 2Z7KA 3ITOA 4DBSA 5H2ZA 1MQPA 3TAOA 1GZ1A 3BL3A 4GUJA 5AOUA 1H63A 2XIQA 2VVNA 1VFOA 3WH8A 1TVPA 3EOEA 3S2MA 2XH0A 3AALA 3R89A 5HMFA 4CVUA 5EMJA 3CL8A 5DIUA 3V18A 3EX2A 2P8CA 4FOKA 1WZKA 3NPVA 3MUCA 1Q5MA 2VN1A 3FV9A 4FLSA 3OW1A 3STFA 2QW5A 3HU7A 1GTHA 3NQFA 3M0YA 3VFLA 3G1DA 4POCA 3M0KA 2YL6A 4LANA 3KCEA 2FVKA 3NPXA 2PBGA 3L9CA 2NWSA 4DO7A 3CH0A 4NJKA 2HZGA 3WLMA 4QRNA 3CQJA 1AODA 4M1RA 4ZB5A 1ZL1A 3FY1A 3QC0A 2HPIA 3ZR6A 4BEQA 5HQEA 4FK9A 1GOMA 5I2UA 2VFDA 4G50A 4QCEA 3WBAA 4NP7A 1N8WA 3QV8A 1EWDA 4HOXA 4IPXA 5E0CA 3NZ1A 4EOUA 1Q6CA 3HV8A 1MWOA 5DELA 9RUBA 3RXZA 3QW4B 3PR2A 1TMLA 3A9BA 3DDMA 1QOXA 3GC2A 2KO7A 2Z2AA 1E40A 2YXXA 4HK7A 3UI4A 4GFSA 3AYSA 4C6LA 1KD0A 1PZ0A 5HUOA 5HANA 1LTDA 3UXLA 1XLDA 2ZX8A 1E51A 2KE0A 3WENA 4MG4A 3H55A 3SFWA 1H3GA 3ALGA 4Q3MA 4CQCA 2E09A 2CBVA 4NKCA 1GJUA 1MQQA 3AHTA 3VE9A 1OC6A 1I75A 4H7ZA 4CU7A 1GW9A 3WQ5A 2PPOA 3V5FA 5FJUA 3TOYA 5C71A 2G3NA 5EL1A 3TROA 3EWDA 4JIIX 2I14A 2VO5A 1OX4A 2D9FA 1W1IE 1F3WA 1KM3A 3KBVA 3RPTA 4Y9AA 4AX7A 2GVYA 4ZZ9A 1EC8A 3ZWTA 5FF4A 1LROA 1WZLA 2CLIA 3P82A 3V35A 3MA8A 4HKPA 1XBVA 1QPOA 3WUGA 2ZA2A 3QYSA 4O8AA 5B8IC 1J6YA 3FYYA 1DIDA 1UZHA 2PODA 1F3XA 3KVLA 1NWTA 3IGSA 4F0SA 3UWZA 3K4AA 3WLNA 2ZR4A 1LRNA 4A05A 2XZ9A 2BASA 1UG6A 1KQZA 3AYRA 4XKYB 5K7JA 1OK6A 3I3EA 1UZ1A 3WLTA 2GDUA 5HT1A 4S1FA 3TJIA 3B9OA 3GPKA 3T2OA 3QHMA 3MSRA 4B5SA 3NWRA 3VNIA 3WH9A 2QIWA 4Q33A 4P8WA 3GC5A 4L6OA 2LLEA 2VEIA 4RZBA 3L4UA 4NSBA 4NAEA 2ZR5A 1XSIA 1E5NA 1J79A 1IEVA 3TC3A 4L4OA 1NAL1 3SO7A 3C0SA 3VZYA 3AMLA 2NV2A 4DH0A 1MSSA 2BY0A 1NMWA 1JCJA 1KFJA 3BW4A 4WSJA 2WMJA 4ZQPA 3VGHA 5CPOA 4DRPA 2EAWA 3UG4A 1QNOA 4G8TA 4MWAE 1W56A 4E3TA 5FA5A 1A3WA 4KPLA 5T26A 2HK1A 1SU5A 4J3WA 3N4EA 5D2TA 5IBXC 3GKAA 4QG6A 1EGMA 1C29A 1BTMA 3D5HA 2A2IA 3HGSA 2ZDRA 1NJJA 5FJTA 5F4SA 3ITTA 2VENA 2WVVB 2OELA 3OZMA 2BNJA 3WF4A 2PURA 3WNKA 3NCOA 2DW6A 4UQCA 3V16A 4HBKA 4KCTA 2DSKA 5FSDC 1FDYA 3P61A 2ZTJA 2FPVA 3BOLA 3T44A 1XKJA 4UIOA 2HK0A 3F5LA 3NQVA 5E09A 1RP8A 4ZOBA 3O6AA 3CPGA 4DN1A 2XGBA 2CHRA 2QF7A 2H9AB 4JX4A 4JTJA 1Q6IA 3MANA 4CD8A 1W9PA 3AJ7A 4R27A 3O5DA 2ZQSA 1DV7A 1ZUAX 1F6YA 4IXXA 3QPZA 4CD7A 1A5KC 1OF8A 3DCPA 4F0RA 4JTCA 4DUXA 3UCQA 8TIMA 5I77A 3FJLA 1FH9A 1K6WA 3LUTA 3ARXA 3AZTA 3HPZA 3UVIA 1OM0A 3UWVA 3HA1A 2NUWA 3WLQA 3BSHA 2DQWA 2XM1A 2BV9A 3WMLA 3V1PA 5I78A 1ROTA 1KWKA 4IJCA 5E93A 3QVQA 2O56A 2J7DA 4OOUA 5A6BD 2BX7A 2PDMA 4IX2A 4UMCA 2VQTA 3MDWA 4QDWA 3I3BA 5EB8A 4H6RA 5TIMA 3HO8A 3IJQA 4Q4MA 1XDMA 5I3DA 3PPFA 4KEZA 3GXMA 3SJNA 3QY6A 4IPLA 4CCEA 1RBLA 3LTYA 1ZZMA 2CESA 3WH6A 1EA9C 3UCDA 3O16A 3UG5A 5A69A 2F2DA 2Z1VA 3H2OA 1Y0OA 5M5DA 4BA0A 1UJQA 2AL2A 2ZTKA 3QMSA 4Q22A 1MMFA 3C4UA 1XISA 1XDLA 1XL9A 3HTWA 2O7QA 4BQ3A 1TPH1 4AD4A 3A12A 1FD9A 3QPYA 3I6RA 4ZTXA 3TMQA 4LUSA 3WDRA 5H6HA 1XFCA 1TWIA 2UZ9A 2Z2UA 4XSLA 1IGWA 2PRLA 3QJAA 4JN7A 1A4LA 4FS9A 4HYRA 4QG8A 1W0MA 3SGGA 4M56A 4K1GA 2W5FA 2ZZ4A 4HARA 5AY7A 5IM51 2DZPA 1XSJA 3FCPA 4WOQA 3MKKA 4IZGA 1G1YA 2VI0A 3BK0A 3ZLFA 4C7GA 3MDUA 3B8TA 2G97A 3UZXA 3S9IA 1PJ9A 1TELA 4GISA 3MT1A 4DUVA 3EDKA 1MO0A 2VUNA 4MVAA 2WSPA 4U86A 1F9CA 3U4AA 4F2BA 2DZTA 5LKYA 1Q6RA 1V3IA 5H8MA 4XX6A 3CL6A 1XCWA 3GDTA 3B8DA 1OJXA 3CBWA 3DBPA 1CTNA 1G4EA 1N55A 3G1SA 5G1YA 4KWUA 1HX0A 3W70A 3T6CA 4LC6A 4LUTA 3AXKA 1S5VA 4DBEA 3QOKA 1PE1A 3M0LA 1FWRA 4NZCA 1TUXA 1EYWA 4JTFA 2DSVA 3VIHA 3G6LA 2R8WA 3FOKA 3LNMA 3UG3A 4J2MA 1JULA 2Y63A 5D33A 4DJEA 4FZIA 3A4WA 2YBTA 3FSTA 3UZZA 2H8XA 2ACQA 1FQ0A 1FUYA 2B0MA 2A3AA 1O1ZA 4Y9PA 3PB0A 3RN6A 5J04A 4J3XA 3MS8A 2YYTA 4H8HA 3EWYA 2VOMA 1VLWA 4LS0A 4DLFA 3NYZA 1AMKA 4F9DA 3RM4A 3WMCA 2YZRA 4GIRA 1TO3A 4H6QA 1QUMA 4DF2A 5DT7A 1VRDA 1UWIA 2EPLX 3SCWA 1J4RA 2QIIA 1MFUA 4OUIA 1YXCA 3LEPA 3GW3A 1PV8A 3K30A 1ZJIA 5EFFA 2DZAA 3OG3A 4MB5A 1T99A 4R9XA 1EJSC 3R8GA 2G0WA 4X0NA 5LSMA 2DUAA 1PHWA 3U7BA 4GUHA 1J01A 5JMUA 4H4IA 1M3UA 1QMLA 1PSCA 1T8XA 2QVNA 2B81A 3UWEA 1FH8A 2C14A 3WUEA 3RU6A 3EPNA 1OFPA 3MO7A 1PCWA 1O95A 3O5MA 1FKKA 4L80A 3WH7A 3PBVA 1L6GA 4DWSB 1UKSA 4M51A 5HMSA 4HA0A 5G4EA 3KM8A 2WZTA 1OIFA 2Y5JA 5EBAA 2V68A 4XISA 1XPGA 2QPSA 4EP8C 4ORIA 3CHDA 1KFBA 3A9IA 3HG5A 3ES8A 1CNVA 2WSYA 2WNNA 3QH2A 5LHFA 1VR6A 3CIXA 4AVOA 3ORWA 2JEPA 1UROA 3WQWA 4GH3A 4UZUA 3WLHA 5A95A 2Z1SA 4M1BA 1XIIA 2OLHA 4D6DA 5T9BG 2P50A 4OU1A 4B5WA 1HJWA 2LPVA 1OB0A 4HU8A 2YL5A 4LAUA 8CGTA 1L1PA 4QFUA 3G8EA 5EGRA 4PGLA 4TX0A 2PTDA 3NQDA 4O0QA 1FHVA 3H2FA 1ADDA 4UFJA 5DRIA 3POHA 2Y24A 4R7OA 4UC5A 5BU9A 1TPUA 4CNSA 2WCSA 3BG3A 4KR0B 1H50A 1EOKA 1HJQA 3LLFA 3L4VA 2VWTA 5ABHA 2NV1A 4N42A 1QWGA 3S2CA 1TVLA 4Q4QA 3UU0A 4P8VA 2BTMA 1JYXA 1KV8A 3ZLHA 1I45A 1LWIA 4QM1A 2OEJA 2Z27A 2Q8LA 2EF9A 1PAMA 3J7HA 3KRSA 4JL1A 3IRSA 2FAPA 2XJ7A 3ELFA 5A8MA 3UPWA 4O54A 3EKZA 2EG7A 1EJ7L 3RCNA 3GO2A 3LBMA 2V2DA 3MP4A 3FHAA 3NL6A 3TMLA 4MZYA 4GCAA 1Q66A 1QW8A 1KM5A 1WKYA 4M7TA 4MAVA 5AYYA 1IEWA 3UJ2A 3H24A 3WD3A 4E2OA 2ANUA 1IIHA 2QMKA 4MKNA 1A5LC 1R3SA 2WJDA 4HHMA 4UOJA 4GOAA 1FH7A 1PCKA 3CZGA 1ADOA 1WA3A 2XN2A 2OX4A 4QAWA 2QS8A 4A21A 3B4YA 4NZ1A 4OTKA 3WQ4A 2E9MA 3O5IA 1BYDA 4HCDA 1YLVA 1PIFA 2GUBA 4C5YA 4N6EA 4R85A 3LV5A 4M8UA 3R79A 1D7HA 3N2CA 5BXJA 1UPMB 4R33A 2Q3RA 2M2AA 3W7GA 1B2YA 2V67A 2J4GA 5KTLA 4IX0A 3LRMA 1X6LA 3R4IA 3NQMA 1TWZA 3GFYA 4IICA 3T0AA 2YA1A 4KWWA 4CNUA 1Q6UA 2OO6A 2WANA 4XUYA 2HTMA 1W1YA 3UBPC 3RGCA 3BSMA 1BEUA 1ITXA 3CV7A 3PUOA 1U1JA 2BY3A 1H7NA 1X7IA 4GZJA 2FJKA 4PUEA 5D2YA 1R9HA 3R43A 1DXFA 1KM6A 2NQ5A 3E5PA 2PEVA 4LNCA 2V5BA 2G8ZA 2AQWA 2P4VA 3NOYA 4A4AA 3SCSA 1DJHA 3VD5A 3SCNA 2QCFA 3JUGA 4WDTA 4UTWC 3S8HA 5AC5A 2PRHA 4YCPA 5HATA 3ZO9A 4ERGA 3THDA 4XB3A 3GDMA 5JU6A 4GZ7A 1VRXA 2QCCA 4MKVA 3VABA 2PDGA 4FLOA 2VC5A 2DZBA 1GZJA 5AYZA 2ABAA 2WVVA 3OVGA 1FWIC 1JDDA 1UA7A 3TN5A 2ZADA 1POKA 3LENA 1Q7ZA 3QEZA 3W28A 5F2GA 1JPMA 2NXIA 4RPQA 3PK7A 3MHFA 2BB0A 1CGWA 2OJPA 3QPEA 2WXDM 1KFCA 1V3JA 4NYYA 3M5YA 4QLLA 4FNSA 2DSZA 1EUNA 2ZZ5A 3AMKA 3W2JA 4J35A 3QHNA 4B4FA 3BAKA 4QS5A 4LY4A 4ILSA 2Q5AA 1FFRA 1ISZA 3ITYA 2OGYA 5I0DA 1EYEA 4IIEA 2PLJA 1EDTA 1TWDA 4Q4SA 3T2PA 3BLEA 2XVPA 4NAFA 4HZ8A 1JCXA 3ZWSA 3GSMA 3TEVA 4GYKA 2WV8A 3URBA 4HZ6A 4L9ZA 2BVDA 1S5TA 3S42A 3VYLA 2BLEA 3WFZA 1JPKA 1ME8A 1CB2A 1J0HA 4TTGA 4UR7A 3S1VA 4O57A 4GGQA 1Z7AA 2WHJA 4GQBA 2Y8VA 1B54A 4UXDA 2D73A 4J28A 1D9EA 2Y7DA 4K39A 5FL1A 3ICJA 4HA4A 5C9RA 4UTHA 3BPWA 4AZBA 4XZLX 3ENLA 1EEXA 3G1XA 2P53A 5HWJA 1AD4A 2WHKA 4JFWA 5DCEA 3AHYA 3QLLA 3NQ2A 4ICCX 3BLOA 4S3CA 2Z00A 2ZZ1A 1W3TA 4IP5A 1PDYA 4IMCA 1EBGA 5BRBA 1WKFA 5CPLA 3CMGA 5CAKA 2NXHA 3THQA 4ZOAA 1QZ2A 3EA3A 4ZODA 1CZ1A 1EJTC 4QSFA 3PWIA 4XAGA 1R0MA 4LW7A 2WO5A 1T0OA 1T41A 2PRMA 3ONBA 4OJYA 2BBFA 3TW7A 2PWVA 4H9XA 1J8VA 5M2FX 3EX6A 3W07A 1DQWA 2YDAA 1NWRA 3L67A 4UTJA 1BPLB 3EEGA 2VMFA 5LNWA 1NM9A 1S46A 4FIRA 3NURA 1WDDA 3QR0A 5LXXA 4BF9A 5HW7A 3AFBA 2CIPA 4QT2A 4KRUA 2SFPA 4EF9A 2VJXA 4ZS6A 5U4NA 1R2TA 1QR7A 1XP3A 3SI9A 5AHIA 4WDWA 5AZ0A 1E6XM 3U4FA 3FJNA 4Q4KA 4J4OA 4PYSA 3GZ3A 1W9BM 1AQHA 1HGWA 2DG4A 4JIEA 7TAAA 1F4HA 4CEUC 2VDGA 1X7FA 5LIXX 1VPXA 1TWWA 3N34A 2QKFA 2QUUA 1I2QA 3CS2A 1CXEA 3IKDA 4M81A 1US0A 2FDMA 2DUZA 2NT1A 3UPBA 3TSBA 1D6OA 4GJJA 2CWNA 1TPC1 3ABZA 4GA8A 1ZCCA 3ONCA 1IZKA 3TCSA 3VX0A 2WC7A 4W85A 2NZLA 1XBYA 1LLOA 1EP3A 2J24A 2PDUA 2PP3A 1EPVA 3AS0A 2UY3A 1XGZA 4DAIA 2YCLA 1TX0A 2CLFA 5KEZA 1DJQA 2Y1HA 1Q85A 5C9ZA 1BQGA 4F2UA 2VFGA 3C52A 2OVLA 2WSQA 3MCOA 2CZ5A 4IUGA 3W00A 1XIBA 2QUTA 1ICPA 3RFWA 1QASA 1AD1A 2CLKA 2VTFA 3B9NA 4JTSA 4QE5A 1ROUA 5EFDA 4ZPTR 5LIUX 4AHPA 4XO7A 1CECA 3GZAA 5C8BB 5J8LA 3P5ZA 2E6AA 3ZIZA 2DVUA 2EPOA 4DWSD 1TV3A 3C86A 5TNVA 4PMXA 2RUSA 2WJEA 3A13A 3FJ6A 2VFIA 2CZEA 4TYOA 1PEZA 3SADA 3R6IA 4BWLA 1AJZA 1TCMA 3Q45A 5E1QA 1W9DM 1TPB1 5HOSA 3DXIA 4GACA 5EU9A 4L1WA 3HFTA 3STPA 1RD5A 1TTPA 3W1TA 3M6DA 2GSHA 3LM7A 3TQKA 1WP6A 3E0IA 4MWAB 3PBWA 1CT5A 3W23A 2O4QA 4IG2A 3PFMA 3TFCA 1EHNA 4LFYA 2E8YA 5GVJA 5C9WA 1JGMA 4UZSA 4REQA 1W1ZA 1H1ZA 3EX3A 4X2RA 2QUNA 4FR6A 1OFQA 5E70A 1VQTA 3RMJA 4LOCA 3FHQA 2V9DA 1SGJA 5E9AA 1RAKA 1R2RA 1RPKA 5AYIA 1OCNA 3OGSA 1I4NA 1U22A 1G94A 1XFBA 1RVGA 2PPNA 3R0KA 3WSUA 1W9VA 2J7FA 4FALA 3S3GA 3ARRA 4IIFA 1UR9A 2ISWA 1AG1O 1GVEA 1JFXA 3M41A 5DBUA 2NQZA 3KOWA 1LQ2A 4IP4A 4BQ2A 4E8DA 3BZJA 3LMYA 3QMRA 5I7GA 3UR2A 2A4AA 3MY9A 1AW5A 2IPGA 4KWOA 3V75A 3BMWA 1A47A 3L0KA 4C1LA 5XINA 2XUCA 4OIFA 5KZEA 1YXYA 1HF6A 1IEXA 1M9HA 2Z1XA 3IVUA 3EMCA 2YA2A 4DWSC 3HBLA 2XFYA 2JZVA 2FTYA 3LDVA 4HOWA 4UUIA 3GU0A 4CEXC 2GQ3A 1RZMA 3VM5A 1ZTVA 2FGLA 6PTDA 1MXSA 2V5LA 5FKYA 1VF8A 4MUZA 4KT2A 2HDJA 3NI6A 1PZ2A 1DIOA 1HO4A 3HF3A 4TTUA 3CTTA 4N4QA 5GNYA 3CNYA 4EPBC 3KVJA 1EQPA 3GDRA 4H1ZA 3TR2A 4W8AA 3WIJA 3W6LA 1O94A 1UQYA 3EIPA 1EX1A 1FA2A 2XISA 1C92A 4HOZA 3A4XA 2BGQA 4H83A 3MVIA 1PPIA 5D9NA 3BGAA 3STEA 4AIUA 1SQ7A 1HP5A 4N9CA 1CCWB 2DVXA 4IT6A 3GR7A 2NQLA 2IPWA 1FKLA 2JF7A 4UTWA 5I02A 1REQA 4ATDA 1LT7A 4W9PA 5PTDA 3SFKA 4IQ2A 2R24A 2G37A 1GOKA 3KE0A 2Q02A 4MAZA 3NQ7A 3P60A 4GY7A 4AF0B 1E1EA 2BVWA 2E1WA 2PP0A 1XYFA 1W17A 3SCTA 1SMDA 1W3JA 3W2LA 2DU2A 3TU9A 1V4YA 3KLLA 3N73A 3VIIA 2PLKA 3GTXA 1KBKA 2PDXA 3IGHX 4ICNA 4JTAA 4Y96A 1YPXA 4NNCA 2ZX7A 3A3XA 5C9XA 3MUY1 3S2JA 1Q6QA 2W66A 5A3HA 4JIRA 4WDXA 3EDJA 2RUCA 3EXSA 4C6DA 4DYKA 5FJIA 2L2SA 2R94A 1JDFA 3VAVA 2YR1A 4R53A 1DWFM 3URNA 3W1AA 4W89A 1ECQA 1OABA 3T7VA 3L7RA 4ODNA 5LIWX 2PDIA 1RK5A 2J9XA 3N2MA 3JYMA 2C13A 1YE4A 1W2PA 4AZIA 3VUSA 2X0HA 5BRQA 5J5RA 4DZIA 3OU8A 1YTEA 4AIBA 1UR8A 1AZ1A 3N4FA 2E28A 2VXNA 2YDQA 3UNDA 3HGRA 3RIKA 2KGJA 5J6EA 3BGJA 3REQA 4ZENA 4CQ8A 4YIWA 5DMMA 3C0LA 1P7TB 1XRTA 1KTCA 4O14A 1Q6GA 2INEA 1GJPA 4H9MA 2DW7A 4US5A 2JKEA 3VC6A 1SJAA 4XD3A 2DZUA 2C19A 3LHTA 1R3QA 3GQYA 1LRTA 4GWEA 2FQIA 3SZ8A 4HPGA 3GG1A 3GXNA 1UMLA 2PDFA 3G1AA 3DOPA 1WYIA 3WFAA 1JF6A 1JG9A 3KOXA 4RW3A 3E12A 3TLQA 3RGTA 2YZ5A 3IUHA 1OHLA 2XFWA 1BF2A 3KBNA 1VZWA 1XG3A 3WD0A 2V5JA 4S3BA 1TZZA 2WNWA 1X8CA 4BK9A 4Z08A 4HA3A 1U5JA 5EBUA 3MP3A 3WLIA 1GQLA 1UJPA 4K7YA 1TTIA 3BMXA 1HL8A 1P0KA 2UZ5A 3OZYA 4HMNA 2HS6A 1HKWA 3JS3A 2X16A 3C5QA 1E71M 2F2HA 3PHAA 3TNBA 3GNOA 5CSUA 3L4YA 3RRXA 3CQKA 5FEXA 1ZBVA 1WAUA 4MNMA 1CGXA 3B9AA 3LBOA 6ENLA 3TYUA 1Z9AA 4HMDA 3F2DA 1P0NA 9XIAA 4AAJA 4RV8A 4R0XA 4QDMA 3QR1A 1E0VA 2ESCA 3O63A 4UTMA 3P80A 5CPTA 3N9RA 3PNUA 3P3BA 3K5XA 4ZB2A 2GQ8A 4L1GA 3QKZA 4OOZA 3W3OA 2ZC8A 1Q4NX 5BXSA 1YRRA 2X42A 5I06A 3D46A 4O52A 4GZIA 4FAMA 1CPUA 2ZUWA 3M0ZA 3LQGA 4W86A 1HN1A 3BLPX 4QEHA 1IXPA 4V1YA 3S9YA 4DHGA 4QE4A 3VNZA 3M0IA 1FOBA 1Q65A 1W5MA 1U2YA 4HGXA 4G56A 1S2TA 1QT1A 4WGXA 1JD9A 3A21A 3MW7A 5H91A 1HKIA 3SRFA 1VPYA 3USBA 1AQMA 1JFHA 1L8PA 1QPRA 2CZFA 4MLRA 1K7FA 1R2SA 4EXAA 1Q6DA 2XVLA 1KCXA 1ZLPA 1CB7B 3V5CA 1ITCA 1CEOA 2VZVA 1N8FA 2QYGA 1FWWA 1K4GA 4WY0F 1KR1A 4Q6XA 2E6FA 4Y9OA 1GW1A 3LUOA 1WNOA 4GC3A 4HU0A 2WLYA 2IKJA 1SW7A 1VIWA 4ITZA 1TA3B 1E4MM 3VMNA 4AYSA 3IANA 1MNSA 2A3LA 1E0UA 2RFGA 1WXJA 1OADA 4I3GA 1G4PA 3W1PA 2ZXBA 2Y5SA 1MEWA 3QM3A 1RP9A 2DSWA 4WHBA 3EOLA 5AC6A 3FN9A 3S1GA 3FA5A 1DE6A 2GYIA 3WLSA 3NOEA 3K13A 4HCHA 1VCGA 1HXJA 4ASTA 4NZJA 2HSAA 1H7RA 3C3NA 3T42A 1Z42A 1DWHM 1GG1A 2EQDA 1OQFA 4L9XA 1IZCA 3MI3A 1I60A 3VVGA 1GVFA 3EB3A 4O1CA 1VCVA 4HNLA 1FWHC 4K36A 3I7SA 1A49A 1LWJA 1R38A 3B9DA 3GDBA 3GS6A 1V6VA 2QT3A 3CJPA 2GJLA 3PRBA 2XP8A 1OD0A 4WVXA 2WMFA 2TMDA 2C0HA 3KBMA 4DZ2A 2Q09A 3DYMA 3PR9A 4I7WA 5DN1A 3ODKA 1GOOA 5LHEA 5FF0A 3BV7A 3L68A 4WKAA 3UI6A 2IF4A 2D20A 1IEQA 1NFGA 2QCLA 2B7PA 3KBJA 2GDQA 4Z2LA 2DV0A 4YYFA 2ZZ7A 1NOUA 3BQ6A 3W38A 5CKSA 4YTQA 1KBBA 3HMCA 2DEPA 6XIMA 1LDCA 4GJIA 4YMZA 1E15A 3OJGA 3NAVA 3WELA 4JHZA 3LCGA 3WD4A 1HKJA 3EWXA 3Q67A 3WO8A 3OQ8A 5DBTA 4AD1A 1FCVA 1B1YA 4YJ5A 2AQOA 1RSCA 1F40A 1UIOA 2V3DA 3W7QA 4B5TA 2PDJA 3H9RB 3IV3A 3UFYA 3T2QA 3SCRA 1PX4A 2BDQA 3Q37A 3AZRA 1KBIA 2WBGA 2PS2A 4NZ5A 1HGYA 2Y5EA 4O0KA 2WSKA 3EX1A 4UTUA 2DH3A 5CZKA 3RR4A 4KGLA 4OVXA 3KAOA 5MKGA 1GQKA 2FZNA 2Y89A 1G7VA 1E6ZA 2XH4A 4YWIA 3W1QA 5IHRA 1GZGA 3KRBA 4O1EA 2A6NA 5D02A 2V0TA 3G1RA 2FH8A 3P84A 2C6QA 2VURA 3N17A 3GHSA 4IWWA 4GNVA 5CC5A 3C0JA 3PZUA 4QCFA 3NSXA 3VIFA 5DCBA 2E68A 2VNCA 1FP8A 4Q8MA 1ZBCA 2OZ3A 3TCEA 4S3AA 1NEYA 2O0TA 1RQEA 4MB1A 4F0MA 4L6DA 4C65A 1J18A 4HBOA 3N04A 2DT1A 1CBGA 3BTNA 2VCBA 1S2UA 4V28A 2NT0A 4ROQA 1PYFA 4A8RA 1Z48A 4K8HA 1TR9A 4NX5A 3M5ZA 1TCDA 4QS6A 5JQ9A 1LBFA 1L2QA 4XZBA 3OVQA 3KAGA 3ZJ7A 2OQYA 3GXTA 2J27A 4DRKA 1ISXA 3KL3A 3GU9A 3KVMA 4H6EA 4AYGA 3KCJA 1YKWA 1CXLA 4MFEA 4MUPA 5BMXA 1S2VA 4ZQCA 1FWFC 1W5NA 5A6MA 4QAIA 1JZ4A 4E5TA 2XP3A 2Q71A 3LYEA 2OYMA 5ABEA 3FJ4A 3PWAA 3RCYA 3FA4A 1C8YA 1KB3A 5HMEA 2GSJA 4M0XA 2A3EA 1TIMA 4MPKA 2J8GA 3GM8A 3CT7A 2RGLA 3P8JA 3QGVA 3QV9A 5I3IA 2XH2A 3TK7A 4H04A 5A6AA 1NMVA 6XIAA 5FACA 5H8PA 3QF0A 3PN8A 1GYMA 1V7YA 4IMEA 3W2NA 1NOWA 4JHOA 1H2JA 2CKSA 5DCDA 3FA3A 1T96A 1SW0A 1ZRQA 1IR2A 3RLVA 2DG9A 1UWUA 3WK1A 1BYCA 1JUBA 4IGSA 1US3A 2ODOA 3FAXA 3NTYA 1QPFA 4QLJA 4RDZA 3CB3A 2VQUA 1XD1A 1K9FA 4RNJA 5BW6A 1VFSA 3LXAA 4G2DA 1XDJA 3KTSA 3W7JA 2Z1BA 3PUGA 1NIUA 3ARTA 1K77A 1ZNNA 1NU5A 3D0CA 3Q4DA 3UXKA 3C8NA 4CNTA 1P1XA 1E44A 1NH6A 5ABGA 2XVNA 3VOGA 3FAPA 4Z1AA 1E6RA 2POTA 4DO4A 3UPMA 2X7WA 4PMJA 5AHEA 2OWWA 2D2JA 1LQ0A 3UYCA 4LF2A 3IPWA 3V4BA 4FX6M 2GOKA 3WUBA 4IFKB 3KEHA 2PI6A 4DEFA 1FKGA 1MW3A 3TYCA 5XIMA 1FFQA 3BOFA 4TVDA 4CD6A 3G22A 3TWAA 4D6FA 2AWGA 4I5RA 2VGGA 3W02A 4D6JA 5G2HA 3TXVA 2CC0A 1WUFA 2IPFA 3NQ6A 3CHEA 4MTVA 2VGBA 3GVWA 3RILA 1FCBA 4NXSA 3G3MA 4DRNA 2OB3A 1WKDA 1SFLA 4OWGA 1B57A 3M7WA 2FFIA 2J7EA 3CHFA 3ZSTA 5CJ5A 3W82A 1PB0A 2C3ZA 4A35A 1GK8A 4GG9A 1DE5A 2F2KA 2AGTA 3CAQA 4AIEA 3SM0A 1NP2A 4R3UA 3PTDA 5AC8A 5AHNA 5C2XA 3B7XA 4F48A 3R1ZA 1FKHA 1O66A 3MWAA 4JCMA 2GK1B 4PMUA 4P61A 1TPVA 3JVAA 2OOFA 3LPFA 3MV01 4DZ5A 1TPFA 3UZ5A 4NJJA 4U2ZA 1I1XA 3ECQA 3IHZA 5I98A 1YXDA 4NL1A 3W88A 4FIQA 3DGRA 2Y6ZA 4XAFA 1W3LA 1S39A 1CWYA 2FB3A 3IARA 2FMNA 4Q8OA 1QI0A 1UQZA 3A4JA 2CETA 4HPJA 2UBPC 3F5KA 4C6JA 4NX0A 3CLWA 3W71A 4FP1A 4AG0A 1P0BA 1BHGA 1B3YA 3S9ZA 4C60A 4IMDA 5CXPA 3BJTA 3W84A 2AKMA 3MSGA 1ZJBA 4S2BA 1EP1A 3VXGA 2A21A 3RM8A 4J1OA 2KAUC 1XBXA 4UQAA 2BOEX 2GVGA 4O11A 3OOQA 2Z1WA 4JDYA 7REQA 4XKYA 3QXBA 3CPUA 1FKIA 3M1ZA 3R58A 5HKGA 2VELA 1N8IA 1E43A 3EOUA 4HA1A 3AUJA 3M0HA 1YE6A 1H62A 3S1XA 3C8FA 3DKLA 4HU3A 3PUEA 1XUUA 4GLEA 3G5EA 3AROA 2REQA 1WKEA 3I4KA 4PB3A 2E5BA 1Q8AA 3HIJA 3N25A 2RDUA 4KEMA 1EOMA 1NARA 5FF7A 1GOQA 4G9PA 3HQ1A 4JOMA 4B15A 5AZ1A 2NQHA 4BKNA 3P6LA 4PTMA 1WX0A 3SQSA 4J3SA 3OP2A 3F4DA 3GXDA 3L5LA 1J2WA 4WZHA 3CQIA 1MDRA 4N2YA 3UWWA 1GHSA 4I9JA 4W7WA 1KRMA 1QNSA 3WLOA 1QI5A 1ZB5A 5I3JA 4AU0A 5GPRA 1EEPA 4U5KA 4JGDA 1XLHA 2PF0A 4UOQA 1R86A 4H7VA 4IF2A 4IFOA 4JY9A 5BRPA 4KRTA 3OLEA 4GKLA 5F1UA 3AXIA 5FOOA 1TX2A 4TOQA 2F4EA 4BHYA 1JUEA 2BVTA 4ORMA 3USZA 3ARVA 4AVFA 1NDYA 1O12A 1V3LA 4NZFA 4Y7EA 3DFTA 1V3MA 1ZP3A 4G7EA 4ERAA 4KCUA 1D3HA 3CAKA 3RAOA 2PWDA 4B5VA 1O1HA 4C91A 2TRSA 3KWSA 1KCKA 3GXPA 1D7IA 4BI6A 4MNJA 2P5NA 4LXFA 4PCTA 2QPXA 3L66A 2YDSA 2WZEA 1PINA 3N2BA 1XRVA 3TDBA 5F4XA 2PPPA 1VFLA 3UETA 3XINA 4JQ2A 1VYPX 1XYAA 1LOLA 3RO6A 2W9MA 3ERPA 3VIJA 1FXPA 3OBEA 3Q65A 4D72A 5I07A 2J62A 4LVGA 3CWNA 2X41A 2G96A 3O2LA 3ZT7A 3E1F1 3AICA 3GDKA 4ZQOA 4Y8FA 2OWCA 3GIQA 5LXEA 5LNUA