2QF8A

Crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Secretory Glycoprotein with Tetrasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2qf8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qf8A01
2A3EA 3SCSA 4JKKA 1EDTA 2HISA 4Z2LA 2WM0A 4YHEA 2A3AA 4AISA 2DSZA 4HA4A 1PX4A 3N17A 3VGDA 2VRJA 2D3NA 3WD1A 2WMKA 4XUYA 1V0LA 2YLAA 2W62A 3WQ4A 3IK2A 3AIWA 1E56A 2OSWA 2G3JA 4XX6A 2ZXDA 4D71A 1FH9A 1J01A 3I3EA 2WB5A 3MV01 3WNLA 2Z1SA 1V3JA 6TAAA 3VNYA 1TE1A 1V6YA 4UFJA 4FK9A 1CWYA 1W9XA 2CPUA 2FH6A 4J28A 1HKIA 1WKYA 4V28A 1GCYA 3OA5A 3NCOA 3PZOA 4WLCA 3WFLA 5ABFB 1NM9A 4MNMA 1ITXA 2WZIA 2ZUVA 1UWUA 1XRVA 4E8DA 5EMYA 3B8SA 1EA9C 1E43A 3WQ8A 4CCCA 3QR3A 4KGLA 3W82A 1UD6A 1E9LA 1TG7A 3I3DA 4HP5A 5CLWA 4CGTA 4JHZA 1BAGA 1R87A 4UTFA 4UQEA 3QHMA 2ZX6A 1CGYA 2ZICA 5A8OA 4UQDA 4QDMA 1WDPA 1MFUA 1G01A 1KBBA 1VFOA 3PZGA 1D3CA 5BROA 2QPUA 1P6WA 3CUHA 1W3JA 3PBGA 4HMCA 2VJXA 5LA1A 2EBNA 1MW0A 3DECA 3VO0A 3CHEA 3WD4A 3HJEA 3WL1A 2Z1KA 2VX4A 1MXGA 1NWSA 4E4PA 4AWEA 2ZXQA 1CBGA 1UUQA 2XWDA 4L4PA 1WP6A 2PBGA 3ZMRA 2XIIA 3GBDA 4J3UA 5I0DA 3OLDA 1VEPA 2JEPA 3MO4A 1J0KA 4W7UA 1HL9A 1BYDA 4ATLA 1KXTA 3CTTA 3W26A 1QI2A 1X6NA 4EK7A 2XSBA 4U2YA 1RPKA 1AQHA 1E1EA 4W87A 4X9YA 1KQYA 2WC7A 3RPMA 3AXHA 4D1IA 5I24A 3ZO9A 1HJSA 4ZEPA 1BQCA 2CKSA 5HXMA 4W89A 1JZ3A 4UFLA 3W28A 4J3XA 2A3HA 2ZX9A 4UOJA 4W8LA 3FY1A 1GQKA 3EMZA 1ODUA 1EIBA 3GBEA 3UEQA 1JD9A 1BG4A 4IISA 1V3KA 3WH5A 4CU8A 5I77A 1HT6A 1C8XA 1JF5A 3WNPA 4ACZB 1TA3A 3B9AA 1PBGA 3ZJ6A 3TTSA 3TP4A 4EAMA 3VGGA 2BVTA 4NF7A 1HKKA 3KL0A 3MUIA 4KRUA 3VM7A 4ZFMA 4QCFA 2EPOA 3BAXA 1JYXA 3PN8A 4OZOA 5A6SA 3CUFA 4UFHA 2WHLA 3DYMA 4AC1X 2WMHA 2PWDA 2WW5A 5E9AA 3L4VA 3VVGA 4JFSA 4UOQA 1FH8A 4S3KA 3MKKA 2Y2WA 3ZQ9A 5HDRA 1HXJA 5A6AA 3ARVA 1WO2A 1MW3A 2FGZA 2JEQA 4JFVA 3WD3A 2CEQA 2CNCA 3W53A 3WNMA 1XCXA 1LJYA 4DUVA 4GI8A 1DTUA 4P7LA 1DWGM 2PWGA 3K8LA 1UKSA 5CZKA 2J7BA 1UWQA 4DWSD 1H0GA 4JCLA 4DWSB 3VOCA 1JG9A 4DM1A 1XH0A 4N0RA 4FLOA 1SFSA 4JIEA 1YQ2A 4E2OA 1BYBA 3IAQA 2BNJA 2G8ZA 3WQ6A 1LWJA 1M7XA 3KEHA 3O2LA 1H2JA 2QHAA 2BY3A 3M6DA 1A3HA 3FAWA 1L0PA 1EHAA 5A6BA 3U57A 1C7SA 1KCKA 3WEOA 5IFPA 1OINA 1ISYA 7CGTA 2VCCA 5JH8A 4OBRA 4CN1A 4PMYA 1QNPA 2GK1A 2O92A 3SEPA 2DSUA 5A8NA 4BA0A 3A47A 3ZR6A 1E72M 4NI3A 3NDZA 1Q6EA 1BPLB 2JE8A 1B9ZA 4OJYA 3CHFA 2FHCA 2XGIA 2BXYA 1C8YA 3WUGA 1W1VA 3AS0A 3K46A 3WN6A 1E6QM 1UKOA 1OIFA 2X2YA 1AQMA 1E40A 4HPHA 2ZX7A 3WEMA 4A4AA 3TA9A 2ZUNA 5FCZA 1E70M 1A47A 2J7HA 1E3ZA 2WMIB 2QV4A 5CG0A 1KR1A 4LXFA 1IZJA 2VI0A 4LYRA 5I2UA 2YJQA 2OYLA 3SURA 3EBVA 1ZJAA 1GOMA 1VF8A 2OLHA 1QI0A 2F8QA 3DYOA 5IXEA 2BXZA 2DSKA 3BAJA 1J0YA 4JZ5A 4KH2A 4DWSC 3AS2A 3AIRA 3WUBA 3ARPA 1V3IA 3VU2A 4OIFA 5D8ZA 1C8QA 2DH2A 1K9DA 2D0GA 3G6MA 1JI2A 2QF8A 2UY3A 2D22A 1LL6A 3GH7A 4B3KA 3WFZA 4CD4A 1E0VA 3ARYA 2YLLA 1B3WA 2YL8A 5A2AA 3M07A 1I1WA 1JNDA 1F4AA 3VIJA 1O6IA 3B9DA 2IXUA 1UQYA 5FL1A 4MTVA 3L4YA 4LYPA 4MADA 2XM1A 3K8MA 1CXIA 3VD3A 1KGUA 4CD6A 1QW8A 3WY1A 2J7CA 5E09A 1DEDA 1KQZA 2XHYA 4K68A 2OWXA 3VMNA 4B3LA 3WL0A 2YDRA 5CGMA 4ML4A 5LA0A 3AMGA 4GZJA 4U2ZA 5E0CA 4CCDA 4AEFA 2ZWYA 4W8BA 3AOFA 1C91A 5A95A 2CXGA 3QOMA 3SCTA 2J78A 4Z2KA 2EQDA 1TVNA 4L4OA 1AVAA 3AMKA 2IUZA 1OIMA 3VTRA 4ACYA 4Z2HA 3VGHA 1HJXA 3CZGA 5E0FA 1YHTA 3KL5A 5CPTA 1C92A 2YKKA 3OZOA 3F4VA 3GYCA 2VR5A 5M3WA 2VC9A 1GVIA 3I3BA 2X05A 3WF1A 4JFUA 2YOCA 4MNKA 2E8YA 3T2QA 1V6UA 4OOZA 3J7HA 1CDGA 1J11A 1H1NA 4AD2A 4W7WA 1GVYA 1NP0A 3BAYA 3BSHA 1JAKA 1UR0A 2Y4SA 2VT0A 2VL4A 4TVDA 3WENA 2WHKA 1ISZA 1TA3B 1E6RA 5DT7A 3MSDA 1UR1A 2CCRA 1JGIA 3SCQA 1K9TA 1HJQA 5FKYA 3WNOA 4URIA 2J75A 1G5AA 1QHPA 3OGRA 3UR8A 4OBSA 4XB3A 1PPIA 4PEEA 4U33A 3BMVA 3OB8A 1KXHA 1XC6A 3WNNA 5AY7A 3BCDA 2EPLX 1HJUA 3T09A 1W9BM 3CUJA 4HTYA 1UR4A 2A3BA 3CLWA 1GQLA 1CGXA 3AIBA 4W7VA 3WH7A 4HMEA 1UD4A 2VZVA 3SUTA 1GOQA 2YDQA 4JL2A 3O6AA 1XGZA 3AHYA 3AHTA 1BG9A 3VDAA 2WHMA 4QLLA 2VNCA 2WMFA 3AZSA 5DF0A 5DO8A 4W86A 2VRKA 1UG6A 2A3CA 3TOPA 3BAKA 1ITCA 3QOKA 4HOXA 3CZKA 1B1YA 1GOWA 1V0MA 3ALGA 3LPFA 1F4HA 2X09A 4J27A 3ZJ8A 2C0HA 5DT5A 3VIIA 5TD4A 3DHUA 1R7AA 1EQCA 4GO8A 1E0XA 7TAAA 4M56A 2OYMA 4AZCB 1VEMA 1UD8A 3MMDA 1TR1A 3CGTA 2WVVB 1FFRA 1W3KA 3WBEA 3KL3A 1PX8A 4JHOA 4M1RA 4QP0A 1NP2A 3BGAA 3WIJA 1QBAA 3OGSA 1EOMA 1LQ0A 3ARRA 4RE4A 4CD8A 3FHQA 1KGXA 2GK1B 4X0NA 3W6LA 1V6VA 1WZAA 2J62A 2D20A 4UQAA 2YBTA 4GIAA 2O9RA 4QAWA 4BQ3A 4Z2IA 3AFBA 4WKFA 3GNPA 3UG5A 1EGZA 2VCAA 1WNOA 4P7QA 1XH2A 1EOKA 2GDUA 1U33A 1C90A 1H5VA 5GNXA 2TAAA 1MYRA 1CLXA 4QLJA 3GXFA 1EHNA 2V3FA 9CGTA 2VZSA 2BY0A 2DGAA 2GJXB 4PTMA 2Y24A 3VDBA 1C93A 3W27A 2XG9A 3OG2A 1M03A 3UETA 1PZ2A 5CJ5A 2XM2A 4MB4A 3S2CA 4BZYA 4P8WA 4GO9A 2WVSA 1E1FA 2VVNA 1Q4NX 2CESA 4AXNA 1V6WA 2VX5A 1BTCA 1UR8A 1KFWA 2BY1A 1GOKA 1QHZA 2FHFA 2G3NA 3RILA 1MXDA 1VFFA 2VURA 2E4TA 3IAPA 1HVXA 2PB1A 3K1DA 5D8WA 2EO7A 4MJ2A 4ZXLA 1UWTA 2E9LA 1X1NA 2XGBA 4X0VA 4YPJA 1J12A 1V3LA 2WSPA 3PZUA 3QHOA 4TXEA 2NSXA 4W5UA 3W29A 1ZBWA 4AZ6A 3BAWA 3MANA 4D6DA 3DC0A 4JAWA 4UFMA 2Y8VA 1JFXA 1G9HA 2RGMA 1E0WA 1UWIA 4FLRA 4OKDA 4TUFA 4GPNA 4MDOA 2EPMX 1WPCA 5BXTA 1NOUA 3GXIA 1NOWA 1CECA 4YHGA 4FF5A 1RP9A 1KWGA 2CERA 2JF6A 8A3HA 3N13A 3FAXA 2DT3A 3M46A 4N42A 1ISVA 3WUEA 4PBGA 3POCA 3VD9A 4CN6A 4LPCA 1AQ0A 4PMOA 3LMYA 2XUCA 3UCQA 1GJUA 4MNJA 2FHBA 3LPPA 3E1F1 5I5RA 2D3LA 3OLGA 1PEZA 2G4FA 3N18A 1V02A 3MMWA 2CITA 1LL4A 3VIKA 3K4AA 2WZEA 1E4MM 1E5NA 4AZGA 1V3MA 5JBDA 1LWHA 3VIFA 2WNWA 4P7NA 3WSUA 4D72A 1HIZA 2JFEX 1OBAA 2W92A 3WF2A 2FGLA 5C71A 2XSAA 4F79A 1V08A 2BHUA 1W9PA 5KEZA 1VEOA 2YIHA 4BS0A 1AMYA 3AHZA 1TZ7A 2NT0A 2CHNA 5I78A 1JYVA 2J79A 4WKAA 3ZJKA 3BCFA 2DIJA 1BVNP 3IJ8A 4PMDA 5CSYA 3MUZ1 3T0AA 2DPEA 4NRSA 4CD7A 4M24A 3A6OA 3CIVA 2OWWA 3VNZA 1GZJA 4CU6A 6CGTA 3TTOA 3N9KA 1H0IA 4ATWA 2UY2A 3U7BA 1E4NA 3VD5A 1RP8A 3ALFA 2J25A 1EO5A 1HKJA 8CGTA 3W4RA 4F8XA 2BVYA 1KXQA 3AIUA 3WEZA 2DT2A 1UKQA 3SCVA 1FH7A 4UZSA 1JZ7A 2QMKA 1R7OA 3VIGA 2QPSA 3PZQA 3BLKA 1W1PA 1WAWA 4WSKA 2F2HA 1E6PA 5I23A 3FW6A 2DSWA 2QMJA 1NWUA 1PJ9A 5JIWA 3HN3A 3AISA 1XCWA 1CXHA 2YA2A 4W93A 1HVQA 5E6YA 4UFKA 3G6LA 1FHDA 1H41A 4J3SA 2ZX5A 3U7VA 2D0FA 2AMGA 2GVYA 4FLSA 2VUYA 1US3A 3KZSA 4H41A 1GPFA 5EFFA 1QW9A 3OLIA 2GUYA 5A6MA 3ZSTA 1O7AA 3VIHA 2WCAA 4LGXA 3A4XA 3PTQA 4U3AA 2DT1A 4AIOA 1OD0A 4CN4A 3WELA 1BGAA 3N12A 5KZ6A 4HA3A 2YDSA 2WMGA 1XD0A 2MANA 4Z2GA 4AZBA 3CHDA 3AMDA 2WXDM 1W2PA 2X1IA 3FN9A 1BHGA 1JDCA 1S46A 1W91A 2BFGA 5DFAA 3A4AA 3ARWA 4AIEA 3D5HA 1BFNA 1UH2A 4B9YA 1H09A 2XVLA 5D4YA 3M7SA 3AICA 1ECEA 2DEPA 2VMFA 2J74A 1CGVA 2V3GA 3GXMA 4TX8A 5BYWA 1HX0A 2W67A 4PMNA 3VILA 4UCFA 4PN2A 1GNXA 4PMUA 4TTGA 1G1YA 3PZIA 1CEOA 1UQZA 1GHRA 3PZMA 1CGUA 5EB8A 3VDHA 2WWCA 1U30A 3VGEA 5ABFA 2WANA 3AZTA 4F66A 3NSMA 3EDKA 2YA0A 3APGA 2YBUA 3GDBA 1Z32X 1DWAM 2PBOA 2WAGA 5HPOA 5CPSA 3SUVA 1FHLA 3UESA 2WC3A 2J7EA 2J8FA 1I75A 4WKHA 4OUEA 4WJXA 4BCEA 2Y8KA 1CPUA 4PTWA 3VD7A 4H2CA 4LQ1A 3T2OA 2WLYA 5AYBA 2XWEA 2PF0A 5A6LA 1BSIA 1JZ4A 4HMDA 1E6XM 2D23A 2BS9A 3EDDA 2WCGA 3MUY1 1ZL1A 1W1YA 2J7FA 3SUUA 4P8VA 6A3HA 4HPGA 2ZE0A 4BF7A 1WZKA 2J4GA 1EQPA 1ZS2A 4Q7NA 1EO7A 3FNDA 2X8RA 4CVWA 2IXVA 3CBWA 3EDFA 3PTKA 1ZBCA 3O9NA 4P7OA 2G3IA 5E6ZA 5AYIA 3U5UA 3ARZA 1Q6CA 4EKJA 2EXOA 2ZUUA 3NDYA 2XVKA 3AI0A 1WDRA 1QI3A 3T08A 1KBKA 1GOIA 3UG4A 4D6FA 3WKZA 2J8GA 5BRQA 4DUXA 1W3LA 1KCLA 4ZE5A 1W32A 1CLVA 4V2XA 2JF7A 2D2OA 1UH4A 5CQ1A 3TTYA 2XFFA 3AZRA 3ARSA 3CH9A 1UWRA 2VZOA 2XIBA 1Q6GA 1QNQA 2ZWZA 1E4LA 3LPGA 1EDGA 2W61A 1W9UA 2WBGA 5D9NA 1QBBA 5AC5A 5HOSA 2V3EA 4J3TA 2VQUA 1FP8A 1XSKA 2D1ZA 1VENA 1CXKA 5FOOA 3UR7A 3WDRA 5HBFA 3SCUA 1G94A 1E15A 1TFVA 3NJ3A 2VTFA 3OBAA 1JF6A 1QNOA 1NWRA 2YL5A 1W1TA 4FMVA 4ZXOA 1B3YA 3THCA 1JYWA 3ZIZA 3SUWA 3AROA 3IJ9A 5C8BB 1H11A 1VIWA 1XD1A 2BHYA 3AJ7A 1UD5A 3VIOA 3GH5A 1WCGA 3ZR5A 1QOXA 4PSPA 3ZM8A 1J0ZA 5A2CA 4A3YA 3GTNA 4E8CA 2W91A 1IZKA 1DWJM 1MFVA 3OGVA 4H8UA 3VX1A 1UA3A 3WF4A 2XFRA 4MJ4A 4GI9A 3RM9A 2DSVA 2VX7A 4C7GA 4B9ZA 3POHA 2W63A 3HMCA 5F7UA 1WE5A 2YL9A 4D6CA 3TTQA 1JZ8A 3WD2A 4HU0A 1QPKA 4Q22A 2F61A 2VR4A 1CZ1A 2NT1A 4R27A 5IHSA 2HVMA 1BVZA 2WCSA 3AMCA 3MV11 2E9BA 1QNSA 1V6XA 1E6NA 1UKTA 4B15A 1EDQA 2PC8A 4W84A 2J7DA 1JD7A 1FFQA 1HKMA 5A6BD 3BLPX 3EDEA 4JFTA 2VRQA 3CHCA 2BV9A 3BSGA 3F5KA 4TVUA 2XFYA 1GONA 4GXPA 1XHGA 1C7TA 2CBVA 1XYFA 3CMGA 3RM8A 2ESCA 1SR0A 1GOOA 3VMOA 2WVTA 4WK9A 1IT0A 1VAHA 1LF1A 2VVSA 4TOQA 2B31A 2WBKA 4AW7A 3L4WA 1ZJBA 1QHOA 2XYLA 4NZCA 2QLYA 3VGBA 4J7RA 2WMIA 4TVCA 2E40A 1JFHA 5C70A 3RIKA 1DHKA 1GQJA 2GJRA 5ABEA 1VFMA 4JKMA 4W8AA 2DH3A 1HL8A 2EPNA 5CXPA 4D6IA 1K9FA 1CXLA 2UY5A 3ARQA 3WDPP 1E71M 3QGVA 1JZ6A 5IDIA 4BQ2A 4WIWA 4AD1A 3WMCA 3ARUA 1B90A 3NUKA 3VMPA 1UWSA 3CO4A 4GQQA 3CZ8A 4R5EA 3AS3A 1ISXA 1QNRA 2V3DA 4PCTA 4AMCA 1UYQA 4MDPA 3IANA 3GNOA 2OWCA 5BXPA 3L4XA 1NWTA 1B30A 1DP0A 1K9EA 3NSXA 2C8NA 2VQTA 2BY2A 3AIEA 1VFUA 4AZ5A 3MU7A 1OD8A 4KMQA 2WVUA 3PZNA 2CBUA 5JUVA 4RE3A 4M80A 2XVGA 1V02E 4H7VA 5DEZA 4UQCA 5LA2A 4AZHA 4MAZA 4IM4A 5IFTA 3RJYA 5EBAA 4UZUA 1W9VA 4H04A 1UZ1A 4JCMA 2ZXBA 2JIWA 5A94A 2ZUWA 3NSNA 2YL6A 4TX6A 3WH6A 4GI6A 5A69A 2CBIA 3CPUA 1BYCA 3F5LA 5D9OA 2JIEA 3AYRA 1MW1A 4HU8A 2GSJA 2FH8A 3SCNA 4AYSA 4YN5A 2VCBA 1SYTA 1XYZA 1QI4A 2VZTA 2WKGA 5E70A 3MS8A 3WF3A 3WQ5A 1PAMA 3WD0A 5IHRA 5M03A 3T0BA 2WYSA 1OGGA 1R86A 4IPNB 3AHXA 3II1A 5CSUA 1JZ5A 1WZLA 1TMQA 3F5JA 1RH9A 4GZIA 1QI5A 2J47A 2W4XA 4D1JA 4EANA 1LG2A 3W0KA 4OOUA 3L2LA 3A4WA 3WDJA 4U31A 1PX3A 2D0HA 4P7RA 2ZIDA 2XVNA 3ZT5A 1HJWA 1E73M 1KR0A 1R85A 1Q6FA 1E4IA 1UHVA 4KGJA 3T0DA 3ARTA 1I1XA 2OSYA 4J3VA 5A6JA 1UH3A 1X6LA 3GXDA 5M17A 4MPKA 1TCMA 3AIQA 2NW0A 2V38A 5M5DA 2WC4A 1KB3A 4W85A 3DYPA 1KXVA 1QVBA 3BMWA 1E6ZA 5DMYA 4U5IA 2WMJA 1LG1A 1OGBA 4M82A 4QFUA 4P8UA 1GUVA 1JAEA 1CIUA 4NRRA 1ZBVA 3EMQA 3AQUA 1XSJA 2ZUSA 3RO8A 4F9DA 1XH1A 4S3JA 2WLZA 1LL7A 1J9YA 1TVPA 4ZE4A 1CNVA 1OCQA 4Z2JA 3WDQA 1CYGA 2VO5A 1HNYA 2AAAA 1E6SM 3EYPA 3FHAA 4AD4A 1E5JA 1JXKA 1VBRA 4BQ4A 3VDCA 2GDVA 3WUFA 1DWHM 4PSRA 3PZTA 4A3HA 3ZOAA 2W66A 1UOKA 2ZUMA 4B16A 3SCOA 3VINA 5JBEA 4MAVA 3NYDA 3PZVA 3VIPA 4LX4A 2E3ZA 2CETA 3WNKA 1H4PA 3BC9A 3RJXA 2PWEA 1M04A 2Q8XA 4D6EA 2V5CA 3MMUA 3SCWA 4P8XA 1HP5A 3L4ZA 1Y7VA 4HZ7A 1NARA 2E8ZA 4XZWA 4PMVA 1BYAA 1HN1A 1MQQA 3L4UA 1CTNA 1NQ6A 3SIMA 4AY1A 1W2VA 3CZJA 4PYSA 1WZMA 2UY4A 5ECUA 4UOZA 1UR2A 3ZSSA 3OLEA 2G3MA 1JNEA 3VX0A 1UA7A 2DDXA 4WF7A 2VOTA 3B9EA 2WZHA 2RGLA 3N04A 1G0CA 4UR9A 5I79A 4NSBA 3VKKA 3W24A 4IPLA 5BRPA 2J77A 1B2YA 3W37A 5GPRA 3U5YA 4AZCA 3OIHA 3VPLA 2WVVA 2DT0A 2XPKA 3GH4A 3SCPA 1EXPA 1ZB5A 5LYRA 3WBAA 1V0KA 1US2A 4ZENA 1FA2A 3UG3A 3EMCA 3QHNA 3CMJA 2E0PA 3KWXA 4CKQA 5AC4A 1SMAA 5A3HA 5I6SA 1CXFA 5JIPA 4AZ7A 4JKLA 3AXXA 1E55A 2XJ7A 2PI6A 1ZU8A 3WQVA 1JL8A 1JIBA 1JDDA 5D9PA 3AMLA 2D24A 1JDAA 1M53A 2C7FA 1J0JA 3T2PA 3AYSA 1H49A 4HOZA 1BLIA 1XSIA 1K6AA 2GJXA 2E9MA 4AZIA 3AHVA 1UD3A 4IUGA 3AS1A 3ZT6A 5FD0A 4PRWA 1GQIA 4HZ6A 3W6MA 3GZAA 1B31A 2WHJA 3TONA 3WF0A 4D6HA 5A2BA 4AD0A 5GQBA 4RE2A 5ABHA 3VD4A 2X0HA 1WB0A 4UQ9A 4W88A 1BGGA 2XVPA 5HNNA 2ZOXA 3OZPA 4ATDA 1UZ4A 3HU7A 3WH9A 5BCAA 3N1AA 1ISWA 1V3HA 3THDA 1OGSA 4LYQA 4MB5A 4AEEA 2CKRA 1W3HA 5CPQA 4PUDA 1CENA 2EPKX 1Q6DA 2O9OA 4W5ZA 1NH6A 1VJZA 3A3HA 1U2YA 3AIVA 1CXEA 2EJ1A 1JZ2A 4H8HA 3L2MA 2XTKA 2GJPA 1HP4A 3RMEA 2ZXAA 5BXSA 3S6TA 1J0IA 4UNIA 5CGTA 1J18A 1R8LA 1MQRA 1MWOA 5GNZA 1J0HA 5D9MA 1N82A 7A3HA 1HF6A 5FL0A 3BXWA 2WSKA 3SUSA 1E3XA 3IJ7A 1PIGA 3W81A 4PMZA 1V0NA 1ODZA 1GORA 4CD5A 3CUGA 4AD5A 1ZBKA 1OWQA 5HPCA 2O9PA 4UFIA 3RM4A 1JI1A 5ABGA 4HZ8A 3MUAA 1OT1A 3AXIA 2WPGA 4C7FA 1M01A 1B3VA 1LLOA 3EDJA 1UD2A 2ZUTA 1XV8A 2CIPA 1SMDA 2VZUA 2GFTA 4BQ5A 1WDQA 3LPOA 2OSXA 4HA1A 4PUEA 2CYGA 3BH4A 2WKLA 2EEXA 3W25A 4TTUA 3WH8A 2W5FA 3RCNA 1B3XA 4DM2A 4ACZA 3FXYA 3K4DA 1GHSA 1HJVA 3N15A 3NIYA 4V27A 3WDHA 1GW1A 4PMXA 1EH9A 4AD3A 1OB0A 2BHZA 4C7DA 3D3AA 3ARXA 2OYKA 1JXJA 3VM5A 3WMSA 3SCRA 2PWHA 4FLQA 1ESWA 4XV0A 4F9JA 4CU7A 4PMRA 4CUCA 4JL1A 2FDMA 2VX6A 1C3FA 5A6KA 1MW2A 1MVYA 1VBUA 1PIFA 3JUGA 2DQXA 4M81A 2PWFA 1OSEA 1MQPA 5A1AA 1UKPA 1CGWA 4WSJA 1KGWA 4GINA 1L8NA 1FOBA 4U5KA 4CVUA 5A8MA 1V03A 3CZLA 4H8VA 2DIEA 4MB1A 3VIMA 5EFDA 1D7FA 1KWKA 2ZX8A 5BWFA 3UERA 5BXRA 3PZ9A 5I3DA 4QLKA 2JALA 1OM0A 2Y5EA 3GM8A 5CLTA 1BF2A 1DWIM 4DWSA 2CBJA 4M8UA 3PTMA 1CGTA 2O9TA 2X0YA 4GQRA 2YA1A 3DHPA 4GKLA 1D2KA 1OT2A 4AIUA 3WQWA 4CCEA 3CZEA 1GJWA 3VGFA 3ZT7A 4PTXA 3L4TA 3VUPA 4HOWA 3MSGA 2G41A 3ZJ7A 2BVDA 4Y7EA 4PMQA 4JFWA 2AOSA 3GNRA 1VJSA 3BAIA 1W9DM 5A8PA 1VRXA 4EE9A 1WDSA 1J10A 2WK2A 1JYNA 3ECQA 1IV8A 1B0IA 2UWFA 1TUXA 4QCEA 5JBFA 4J3WA 5FIPA 2CHOA 3WMBA 3W38A 1FP9A 4D6JA 5A8QA 4RL3A 1DWFM 3WDIA 1VB9A 2V5DA 4PTVA 1NOFA 1PZ3A 3K8KA 3KE0A 5GNYA 3N11A 3RDKA 2WWDA 4UQBA 4MNLA 4DUWA 3CUIA 4KRTA 1H3GA 4KWUA 4PCSA 1UR9A 4XZBA 4GZEA 2J7GA 4M29A 4U3CA 3PHAA 1RD6A 4D6GA 4MB3A 1B3ZA
chains in the Genus database with same CATH superfamily
1X1ZA 2A3EA 2HISA 4YTRA 4IXXA 4Q4QA 4IOTA 3VNMA 2DSZA 3T55A 2D3NA 2XGZA 4XUYA 4IL0A 3SO7A 3TZFA 3R10A 3WQ4A 2NQ5A 1E56A 2G3JA 4FALA 4DY1A 3CASA 4D71A 1FH9A 2WB5A 3GG8A 2CZ5A 2KAUC 4INFA 4GVGA 3SGUA 2OQHA 5BOOA 5DMMA 3LG3A 1DQXA 1AD1A 1W9XA 4ZTXA 3HPSA 4V28A 4WLCA 3WQGA 4QR6A 5E93A 1NM9A 4MNMA 1TJRA 3A12A 4C1LA 2V5JA 1PTAA 1XRVA 3UZJA 4E8DA 1YDYA 1V7YA 5CKSA 4CCZA 3WK0A 4CCCA 3VK5A 4KGLA 1UD6A 1YNQA 2H8XA 3QHMA 4CLMA 3EOSA 1U1HA 2QJIA 3IJIA 2ZICA 4EXAA 4A3RA 4HNCA 3MB9A 3TTEA 4LY8A 3MYPA 1W3JA 3PBGA 4QROA 5LA1A 1MW0A 4V1XA 3HJEA 4WJEA 9XIMA 3PFMA 3QW4B 2HE5A 3WL1A 1SFTA 2DUXA 1HUVA 2VX4A 3DFHA 4AWEA 2OEMA 2V0TA 1CBGA 1UUQA 2XWDA 3SDOA 2E67A 4ZSTA 2XIIA 3AALA 4IQ2A 3GBDA 3A13A 2WJEA 4ECLA 2JEPA 2AQOA 4FA3A 5DIUA 1FCUA 3M0IA 2HBVA 3M43A 4LCSA 2O55A 4ATLA 2HK1A 1KXTA 2ZQSA 1X6NA 1FCQA 4GJJA 3QF0A 3R89A 1RPKA 2BVWA 1FVPA 5DBTA 3QR0A 4QJ5B 4W87A 2G4JA 1QCWA 3EXSA 2F6XA 3U9IA 1O5KA 1NF0A 5DCDA 1NIUA 3ES7A 3HQPA 2CKSA 3ZWTA 1KTNA 2A3HA 3F4NA 1ODUA 4ODNA 4IIEA 2TSYA 1BG4A 1JF5A 4JIIX 3GK0A 3R2GA 1TA3A 3UWWA 1REQB 4MFDA 3ZJ6A 3CL8A 3CEUA 4I90A 4YNGA 3TN4A 2ZZ6A 4HYVA 5FEWA 3QC3A 5A6SA 4UFHA 5AVNA 5D38A 4Q6JA 3RNDA 3JU2A 3SN1A 1EFZA 3APYA 4K38A 3N6HA 1WX0A 4JFSA 4S3KA 1ADOA 3MKKA 2Y2WA 2VGFA 1XUUA 1D6OA 3G22A 4JN6A 1WO2A 4CEXC 3OQ8A 2JEQA 3BO9A 4YVPA 1W1A1 3WLKX 2REQA 2CEQA 1R2TA 1A3WA 1IGWA 1DTUA 3M0KA 4L1XA 5CC6A 1KM4A 3CNYA 5CZKA 3LZ3A 2QJNA 2YSWA 4I8DA 4DWSD 3NVDA 1JG9A 4IJCA 4CNPA 1FWGC 1XBVA 3QZ6A 3FDKA 1GKPA 1JPMA 3B0VC 3Q65A 1EP1A 3WQ6A 4GABA 1YRRA 2UBPC 4BF9A 2PDYA 3APTA 3M6DA 1A3HA 3FAWA 2QNEA 1EHAA 5A6BA 1KCKA 3OHIA 2A3LA 1ISYA 4LAZA 5JH8A 4PMYA 5HUAA 1QNPA 3HIJA 3SEPA 5A8NA 4JTTA 4DBSA 4LAUA 4BA0A 4MYAA 5K4ZA 3ZR6A 3TYDA 3NDZA 1SW0A 1BPLB 4OJYA 2FHCA 4LB4A 1IZCA 2G50A 4I5UA 3WN6A 2RDUA 3I65A 1OIFA 1AQMA 3S5ZA 2ZX7A 1HKWA 4AWUA 3PTDA 4C60A 5FCZA 1R6WA 4N19A 2FJUB 4LNYA 3PRDA 2J7HA 2Z25A 3LU2A 2QV4A 5CG0A 1XXXA 2P10A 1GG1A 3FA5A 2YJQA 3QRHA 5J6EA 1KM1A 3E9AA 2X7VA 3EBVA 1TX0A 3RGCA 4HKPA 3BMXA 1XINA 1SUXA 2QUUA 3DYOA 4JNZA 4A8IA 2CU0A 2DSKA 3BAJA 4JZ5A 4LVGA 7TIMA 1JGMA 3NFUA 3WUBA 1L1PA 1V3IA 3VU2A 1XRFA 2D0GA 4YL2A 3AUOA 1Z89A 3GC5A 1LL6A 3BZJA 2YLLA 1B3WA 2YL8A 1I1WA 1H62A 1FWEC 1O6IA 3URNA 1UQYA 2NVAA 4A8RA 2PAJA 4GH3A 4WXZA 4S3FA 5TIMA 5FF7A 1DOSA 1TPFA 2VN1A 3WLQA 4CD6A 1DHPA 4XKMA 3PBUA 4HNVA 2J9YA 4K68A 2OWXA 1RALA 2C19A 3BZGA 3WLTA 3E2QA 2Q8ZA 2QR6A 3WL0A 2YDRA 2QCGA 5LA0A 3AMGA 1TYGA 2NV1A 1PTDA 4KW2A 3O5GA 2CLFA 4DAFA 4HK5A 4TV5A 1ZJHA 3WQCA 1AVAA 3MSRA 3LX9A 2IUZA 4QG9A 3IK8A 3MC5A 2AQVA 4ACYA 4Z2HA 2ATSA 4O2TA 4GIYA 1YHTA 1O12A 2ICSA 2XH0A 2CC0A 1C92A 4HU4A 2ITKA 3ATZA 1MEWA 3VCRA 3GYCA 1TQJA 2YXOA 4CQDA 1GVIA 1NFGA 4ZOCA 2X05A 3R13A 4JFUA 2YOCA 2E8YA 3T2QA 1V6UA 4OOZA 2PN0A 3J7HA 3KOFA 1NP0A 4M19A 1W8SA 1SZGA 1R0MA 3O5IA 1TCDA 1IF2A 1Z44A 2Y4SA 2IPFA 1YXDA 2VL4A 4TVDA 2WHKA 3I6RA 3L65A 2I5IA 1UR1A 3PK7A 3OO2A 4JS3A 1K9TA 3UVAA 3SW6A 1XGEA 3WNOA 4H8NA 1S2AA 3LI0A 1BEUA 3LCWA 4HCHA 4O50A 4XB3A 1PPIA 4LY4A 4XZIA 4LAXA 4FR1A 1Q2RA 4TW7A 1XC6A 3HGSA 3W9ZA 4QIBA 3C2RA 1B4EA 3LMZA 3TQ0A 1LROA 1PL9A 3L67A 1FKGA 3EA1A 4HTYA 3L21A 3W74A 3CLWA 4W7VA 3WH7A 4HPNA 4DNMA 1GOQA 1Q63A 4UMAA 5C9RA 4GVFA 1XI3A 3CWHA 1BG9A 3KBMA 2V68A 2WHMA 1JPHA 2VNCA 1LBFA 3AZSA 2C13A 1O5QA 4W86A 3B8VA 1H1YA 2A3CA 3BAKA 1ITCA 1OC5A 1Q45A 1I8JA 5DT5A 3T7VA 5A6TC 3KBVA 3UFYA 1RXOB 1LQAA 4LRSA 1JVNA 5MKGA 1A7XA 1TR1A 1POJA 2WVVB 1FFRA 1W3KA 3KL3A 4QM1A 3N2CA 4M1RA 2AQWA 2QDEA 4DJFA 4KEVA 4ZVJA 1H51A 1EOMA 5HQMA 3FHQA 3CQKA 3GXNA 2FPVA 4X0NA 5D32A 3H7UA 4DZ2A 1V6VA 2GVLA 3UXKA 2E25A 2ZRZA 2PC4A 1UASA 3P84A 4CEUC 2YBTA 4GIAA 3KAHA 4QAWA 4PFMA 1DIKA 4FZIA 3UPWA 1JVWA 1ICPA 1KM0A 4P7QA 1EOKA 4BF5A 2QCCA 1PZ0A 1TX2A 1H5VA 2XSXA 2VDHA 1NVMA 1EHNA 2WKJA 3QQ0A 1MEIA 1JDFA 4DZ3A 9CGTA 2VZSA 3ELFA 1OQFA 2GJXB 4PTMA 2Y24A 4KWVA 2MLXA 4WGHA 4JR5A 2Z1BA 1M03A 3UETA 3UJFA 5AZ0A 3E0FA 2XM2A 2R8WA 4K36A 4JNYA 2VGBA 4ZTYA 4AXNA 2VX5A 2AL1A 4NNCA 1OABA 1QHZA 2ISWA 5CSRA 2FHFA 3RILA 2NXGA 2E4TA 3WK1A 3W7HA 2EO7A 3ZR4A 5HWBA 1UWTA 2DZWA 3H24A 3TC5A 5K9DA 1X1NA 4WOQA 2KFWA 4X0VA 3UR5A 3UWUA 3B3DA 4W5UA 1TREA 3BJFA 1VBHA 2PDQA 1ZBWA 1CB7B 4UBPC 4FXFA 2EG6A 1GK8A 4JAWA 4TW8A 2Y7FA 4UFMA 1FCVA 3ORWA 3PBYA 2YB4A 1T8QA 3YPIA 2GOUA 3RX2A 2BOEX 1VQTA 4HNUA 2YCIX 3KAGA 3URAA 5EKYA 3T40A 4NILA 1RP9A 3TJXA 1XLCA 2R1MA 5I7GA 2V67A 3N13A 3FAXA 4PUMA 3WUEA 5CPNA 3VD9A 1F6KA 5A5WA 3SN0A 3LMYA 3RK8A 3LRLA 2FHBA 3WBXA 3E1F1 4JFJA 5GVJA 5G2WA 3N18A 4AH7A 2O0TA 3MMWA 3JW7A 2CITA 1DL3A 1LL4A 5FJJA 1JPIA 4YVVA 4IZGA 2ZTJA 5JBDA 3A3XA 1RBOB 2B4GA 4YTQA 2XIOA 4Q8PA 3LYEA 3M5YA 2XSAA 3BGJA 1V08A 2BHUA 1W9PA 4QDWA 3PRBA 1R30A 2Y85A 3W7PA 1ZALA 3WLLA 4PUNA 2CHNA 2GWGA 5AB3A 2V81A 3BCFA 2E6DA 2FLIA 3IJ8A 5CCZA 4DHGA 3UQBA 3F2CA 4XZLX 2X0SA 3LOTA 4R53A 2WNZA 4Y90A 3NO5A 3IUIA 3TTOA 1VZWA 3N3TA 5CBIA 1NELA 3NL2A 3S3GA 4GISA 2NZLA 3U7BA 1E4NA 4HB7A 4H7ZA 1Z69A 1HKJA 1AZ2A 1LBMA 1W0MA 5BNKA 5BU9A 3ABSA 1WUFA 2G97A 2BX7A 1UKQA 3LZ5A 1OK6A 4M3PA 4CQ8A 1FH7A 3SBFA 2BGNE 4NG3A 3O5RA 1UP3A 3ABRA 3HGRA 3IGUA 2CHRA 4LUTA 3PUEA 1E6PA 4IMFA 1UJQA 3FW6A 3IARA 1PJ9A 2F4EA 3PUGA 5JIWA 3GQYA 1XCWA 4S2BA 1HVQA 1RJQA 3TAOA 1JUKA 1H41A 4J3SA 3TROA 4FP1A 3U7VA 2D0FA 1YW5A 2FAPA 3T42A 1US3A 1ZRQA 4X63A 4O1FA 1GPFA 4CNSA 3CL6A 4MZYA 3E0WA 4JTIA 4TMCA 2ZR4A 1R9HA 3LHZA 3SIZA 3KW3A 1AK5A 3FEQA 1Y5XA 1NDWA 2PDXA 1WYIA 3N12A 1CI1A 2YYTA 4HA3A 4I3GA 5BOFA 2YDSA 2WMGA 4UUIA 4AZBA 3T6CA 4J40A 1W2PA 3GVRA 1P48A 5HW8A 4GNJA 3UI5A 2MLYA 3D5HA 1L6YA 4UC5A 1UH2A 1KFLA 3QMSA 1H09A 7PTDA 2GUUA 1EA0A 3TNBA 2Y8UA 4EX4A 4IMEA 3AICA 2HVOA 2VMFA 3GE7A 5ECVA 1CGVA 3GXMA 3IGHX 2DU2A 4YS1A 1TV7A 1UOZA 4KWOA 3TW9A 2W67A 3OA3A 1M3UA 1G1YA 1UQZA 1GHRA 4O16A 3UU0A 2PP0A 5EB8A 4H2HA 1U30A 3NNTA 3QEZA 2WANA 2VP8A 3H53A 3LUOA 2J9ZA 4F66A 2YA0A 4GQGA 4L65A 1Z32X 3I6TA 4G5DA 3UESA 2ISVA 2E28A 4OUEA 4WJXA 3SADA 3ITTA 2Y8KA 3T05A 1CPUA 3V0SA 3ZVHB 5M2FX 5AYBA 1N8FA 1S3TC 1BSIA 4HK6A 1JZ4A 1KFBA 2NXHA 3IUDA 2X1RA 3CV6A 4HMDA 1E6XM 2D23A 2BS9A 1JCTA 2TODA 2WCGA 4WZHA 1QPLA 1ZL1A 5EBUA 4BF7A 7ODCA 5DANA 1ZS2A 3FVMA 1M7PA 2O7QA 4CVWA 3CBWA 2FIQA 1P43A 1QO5A 3ABZA 4P7OA 3CAVA 3P5ZA 3ARZA 1QAPA 2RDXA 1GJPA 3C56A 3AI0A 1KRCC 1IEQA 1XBZA 4ROPA 1W17A 1K77A 7ENLA 3UG4A 1A0DA 3RXZA 4L3NA 3WKZA 4LS0A 1OADA 2XPBA 4E4FA 1W3LA 1KCLA 3STGA 2PURA 1A5NC 3A64A 3S2JA 3MHFA 4AY7A 2XFFA 1RY8A 1XYMA 4RR4A 1TRIA 3PB2A 3CH9A 1TTIA 4X2RA 4DB7A 1Q6GA 4YTTA 4B3ZA 4D8AA 2BXVA 1QNQA 2PWUA 2ZWZA 1REQA 1IHIA 3LPGA 1EDGA 1XM3A 3DHDA 1W9UA 2FZMA 2WBGA 4LUSB 4N9EA 1L6WA 2OXNA 4LBSA 5HOSA 2V3EA 3PAJA 1FP8A 2Z2UA 1V8EA 3LS9A 4FXJA 1VENA 3Q58A 1CW2A 3QYSA 1N55A 5FOOA 3PJWA 2G95A 1MI3A 3LTSA 3WDRA 1FKFA 2O7SA 2POTA 1NMWA 3NI6A 3FVDA 3TYUA 1TFVA 2I16A 3VKCA 3TMLA 1PKLA 4YIWA 2G5WA 3GVGA 1TJ0A 3ZIZA 3CAQA 3AROA 2BHYA 2A1YA 3P6LA 3W76A 3ZM8A 1J0ZA 3P82A 4A3YA 2MNTA 4E8CA 3P61A 2GOKA 1C9WA 1DWJM 1FQ0A 3OGVA 4F40A 3KS6A 3VX1A 1IT8A 1Q2SA 3AO0A 3KP0A 1OFRA 2A6NA 4DIAA 3DFSA 3O16A 2W63A 5LNSA 3HMCA 5F7UA 3AWNA 3CHVA 5IHSA 1CZ1A 1QU4A 2A7PA 2NT1A 4E8GA 1ZENA 3QV7A 4O8RA 3AMCA 3FXGA 3V7PA 2PRMA 1Q6RA 3RPTA 2E9BA 2ZZ4A 1UKTA 1TZ9A 2C14A 5HULA 4GBUA 2PC8A 5REQB 3S5SA 3GTHA 3FSTA 3DFTA 4H9YA 1FFQA 3F03K 2VFFA 2ZRVA 3CHCA 3BSGA 4QE5A 1GONA 3LNMA 1XYCA 3EWUA 5J04A 2CBVA 3UZ5A 2ESCA 4PL1A 1GOOA 3VMOA 4TOQA 4REQA 3NQCA 4RZBA 4EXBA 1FDYA 4AW7A 3L4WA 4GBDA 1U1UA 4W9QA 2YB1A 5CZTA 4F0SA 3VFLA 1TIMA 1EWEA 4NZCA 2H90A 4J7RA 4DH0A 2W6RA 2GJRA 5ABEA 3ID7A 1VFMA 3V18A 1TJ1A 3NM3A 3H2NA 4IL2A 2Y61A 4D6IA 1LT7A 1KM2A 3WDPP 1K7FA 2NX3A 3VOJA 1JZ6A 5IDIA 4BQ2A 3WJSA 1A4LA 4AD1A 4JYFA 1UP2A 4OWGA 4UMCA 3LCGA 1UWSA 3CZ8A 1F7BA 1VFLA 4A2SA 1ISXA 4MIMA 3TUUA 1S2UA 3QTPA 4MDPA 4QJ4B 3TW6A 2QCLA 2DG4A 4KQZA 3NSXA 3UI4A 2JQXA 1VFUA 4HBOA 2NQHA 3KOYA 4AC7C 4NNBA 4B5VA 3R94A 3L66A 3IKGA 4GRSA 5JUVA 4Q4PA 3TN5A 1FWSA 4IP4A 4M80A 4YYCA 4IJRA 5LA2A 4MAZA 2A7RA 3KBJA 2I5GA 4JCMA 1WOAA 2YYUA 2YL6A 4IHCA 4TX6A 4GI6A 1GGOA 1P0DA 3N25A 4HU8A 2GSJA 4X9SA 1AH3A 1R3RA 1ZP3A 4ZQCA 1CT5A 3LSCA 2WKGA 2VZTA 1FWHC 4DRIA 3WF3A 4PTNA 1A3XA 4DZHA 5IHRA 3B04A 1WBHA 4BEQA 1SQ7A 3AHXA 4BWLC 3USBA 1WZLA 1TMQA 4N4QA 4L56A 4HK7A 4WDTA 4UCGA 1D7KA 2Z7KA 3PWGA 1TV3A 1UZDA 2Z0IA 1KM5A 3NQMA 3NDOA 2VD9A 3KTXA 4RXGA 3VYLA 4J9JA 3KUMA 3THUA 1UHVA 3E0VA 3DI1A 4KCTA 2OSYA 4QIUA 4GC3A 5HJLA 3GXDA 1R46A 4MPKA 1TCMA 2NW0A 5M5DA 2WC4A 3EXTA 1KB3A 2G37A 3GR8A 1KXVA 5BW6A 1CB2A 3BMWA 2ZZ2A 1EYMA 3W1LA 1IR1A 3E0LA 3S6DA 4RX0A 3TSDA 3BLIA 1V79A 2VXNA 4RZ5A 4M82A 2PTZA 4QFUA 4O0QA 1GUVA 1RVGA 1Q1CA 4QBXA 3RO8A 4F9DA 3KHDA 1BXBA 4CNUA 3KABA 3BURA 1A53A 1CNVA 3RLUA 4Z08A 4L6DA 3EPMA 2AAAA 1XDMA 4WXYA 3W84A 1E5JA 1W1ZA 4BQ4A 4W9PA 3EY6A 2GDVA 3WUFA 3MQTA 2Z6IA 2Q71A 2SFPA 5EYWA 4UDMA 1DJXA 4MAVA 2PA6A 2G3FA 2OR2A 3DN5A 2AAMA 2CETA 3BC9A 1FKRA 5CC5A 2PWEA 2DZSA 1M04A 1E0TA 3RR4A 3KWSA 1EQ3A 3GUWA 3SCWA 3BPWA 5ABTA 1L8PA 4P8XA 1HP5A 3QN3A 1I45A 1OFOA 1YPFA 4RK8A 1TJPA 4DUOA 1CTNA 3CZJA 1W2VA 4PYSA 1WZMA 3MHGA 3EWYA 4FNPA 4UOZA 1VPXA 3OLEA 1JNEA 3EGJA 4O19A 3H70A 2R1PA 1V7AA 1H61A 2XP4A 3CTLA 4NSBA 1MUWA 3FJLA 3LN3A 3VKKA 5DY2A 3LCFA 1N8WA 4R7WA 1B2YA 3K4WA 3L5AA 3M1ZA 3HPAA 1T40A 4UXDA 4JQ1A 3OIHA 2WVVA 4H9MA 2PDMA 4IPPA 4Z1DA 3U48A 3SJ3A 4O10A 1J93A 1A5OC 3SRDA 1JNTA 4GFSA 4G7EB 4O0ZA 2J24A 2G96A 2RJHA 4ZENA 3UG3A 4XBSA 4DZ5A 3W86A 1XLKA 4WOZA 3KCLA 1SMAA 5A3HA 4DRHA 4O52A 3UQIA 1CXFA 5JIPA 4MLRA 3XINA 3IVTA 4QQUA 3HQNA 3M7WA 4HHMA 1DE5A 1Q6QA 3S1XA 4KERA 2JBMA 1KV8A 1A5KC 5D9PA 4DJDC 3HMJG 4DBWA 3L0KA 3FYPA 1OCBA 3E2SA 3THQA 4DYKA 3NQVA 4HOZA 1BLIA 1O1ZA 4WY0B 3FAPA 2GJXA 3LGDA 4AZIA 4C5ZA 4ZO7A 1MDLA 1UBSA 2A6LA 1FRBA 5CBJA 3TONA 2PDCA 3A9IA 2XH2A 2X0HA 1UUMA 4UQ9A 4QSFA 3S1UA 1BGGA 4ZQOA 4DJEC 3HU7A 3WH9A 5BCAA 3N1AA 2IF4A 1RA5A 4IX2A 1V77A 3THDA 4IFRA 1OGSA 4MB5A 1MNSA 4NJGA 2HNHA 1CENA 1F8MA 4C6LA 2EPKX 2FVLA 4K6AA 2GZXA 4W5ZA 4MJMA 3PUDA 5IOBA 1VJZA 1XLFA 2X7WA 2PDLA 3KM8A 3AIVA 3DENA 4KETA 2D2HA 1X98A 2P0OA 1A5LC 1Q4WA 2GJPA 4AUBA 2IKJA 1W8GA 1XL9A 1GVRA 3C61A 4UNIA 1FKHA 5FSEC 4YTSA 2P0IA 1DQWA 1XR2A 2Z1XA 5C9WA 5D9MA 3HFYA 5HAOA 5C0QA 5FL0A 4HHPA 4EVZA 3SUSA 3GD6A 2VD8A 1E3XA 4IXHA 2F21A 1LP6A 3RLVA 3UF9A 1OZQA 1OWQA 3Q2DA 3SSZA 5HPCA 4UFIA 3RM4A 5ABGA 3AXIA 4C7FA 1PWMA 1B3VA 1LLOA 5HUOA 3W87A 5CPLA 3H22A 2ABAA 3B8TA 1WDQA 1TWZA 3PBMA 4HA1A 3G0UA 2WKLA 4HNTA 2EEXA 3FS2A 4L9YA 1FKWA 1B3XA 1JQVA 3K4DA 1HJVA 2TYSA 1P0KA 3NZPA 1QPFA 3WDHA 1HL2A 2PCQA 4PMXA 2QPXA 1EH9A 2BHZA 1QPQA 3TNOA 1JXJA 4RJEA 3VM5A 3WMSA 4P61A 4JTHA 4F9JA 4PMRA 4CUCA 2BBFA 5HQEA 5AHFA 4QG6A 3MWCA 5I3HA 2QUVA 4I7WA 2A4AA 2RUCA 5T9BG 3I6CA 4H00A 1BL4A 2WM1A 3R0KA 3CAKA 4O18A 1FOBA 2QYGA 3CZLA 4H8VA 3GHUA 4B91A 5EFDA 4GI4A 2OZ8A 2JALA 1JUEA 4BI7A 1OM0A 1SFJA 3BVJA 3MCOA 4KIRA 4M8UA 1EF3A 3H6OA 1W54A 1CGTA 4GQRA 1D2KA 3E12A 3WQWA 4GE8A 4MHBA 3CZEA 3F7JA 5I3JA 2V9DA 1Q65A 1AH4A 1Z42A 4B4HA 3OTRA 3VNKA 1QT1A 4DYJA 4Y7EA 3OG3A 3GNRA 4FNTA 3BAIA 1VRXA 4EE9A 2I17A 1J10A 4QT3A 1AW2A 2WK2A 2HBXA 1W5NA 3AC0A 1F74A 1BKSA 5AN7A 3FYOA 3KHJA 5AC6A 1B0IA 4JTUA 1TUXA 4QCEA 3KDNA 3WMBA 1OFDA 3W38A 5A8QA 1DWFM 3QMTA 1W31A 4IT1A 1F73A 4K3ZA 1DPMA 5HWMA 3OU8A 3JS3A 4Q32A 4UQBA 3LV6A 3S5OA 1Z6KA 2WJFA 4UTHA 4KWUA 4NNRA 2J7GA 4M29A 2PDBA 3P3BA 3PHAA 2V2DA 4S3DA 5G5IA 1RD6A 3ZZ1A 1B6CA 3OHMB 3A5VA 4D6GA 4MB3A 3H54A 1B3ZA 1LM1A 4JKKA 1EDTA 1OFEA 3W70A 4MZ8A 3CGMA 2WM0A 3NAVA 1HGWA 4XAYA 3SM0A 4AISA 1B4KA 3H4WA 4HA4A 3VGDA 3WD1A 5DRCA 2PLJA 2WMKA 3ZFHA 4Z1YA 1RJRA 1T0OA 1OX6A 5EMLA 3LHTA 3PS7A 4XAZA 3BSMA 1W1IE 2OSWA 3CC1A 3VC5A 3WNLA 2Z1SA 6TAAA 1FWBC 5DMNA 1KC7A 2OVLA 3CO8A 4KFOA 1O66A 4R33A 3UA4A 3LQGA 1WKYA 3EEZA 4U86A 1EWDA 4JN7A 1PSCA 2ZUVA 4I9TA 2R1KA 5EMYA 3ZVHA 3WQ8A 5HK4A 3QR3A 4ODLA 5TAOA 2C3ZA 3N34A 2PTXA 1TG7A 3DI0A 1SZNA 3L9CA 3PWAA 4DXVA 1BAGA 4UTFA 4UQEA 2C1HA 5B80A 3WK3A 2PS2A 4UQDA 3C2VA 2C18A 1LTDA 1RHCA 3B8DA 1WXZA 4I5RA 1D3CA 3V5FA 1W6TA 3I7RA 1F6YA 2VJXA 2OU4A 4Q8TA 3IJQA 3WD4A 1AG1O 1FWRA 1X1OA 1MXGA 4JX5A 2ZXQA 2QAPA 3CLMA 4NYUA 1WP6A 3QFEA 4DRSA 5CZJA 5I0DA 4TV6A 2QT3A 2IPWA 3W22A 3UCDA 5HA7A 3W26A 3I10A 4CQBA 2OEJA 4EK7A 2XSBA 2MNRA 4QTGA 1YDNA 3O0KA 3RPMA 3FGCA 4D1IA 5I24A 4LF1A 1B54A 1HJSA 1BQCA 1J6PA 4GYPC 3W28A 4J3XA 3W3OA 2ZX9A 3EWCA 4H4IA 4W8LA 3FY1A 2QCEA 3BICA 3EMZA 4KBXA 4LUSA 1C9DA 1EIBA 3VKJA 3GBEA 1JD9A 2QJHA 2ASHA 4NZ1A 4RDVA 3BARA 3WNPA 4HT3A 3B9AA 1H7PA 1PBGA 1XBXA 3VM7A 1XQKA 3GFYA 4OZOA 1A0EA 4C6QA 5DY3A 3CUFA 3OVGA 2AKMA 4ZA0A 4JYDA 1I0BA 1XIDA 2WW5A 4LJ3A 5E9AA 2YFNA 1YE6A 1PKYA 1PB0A 2BODX 2E1DA 1IQ8A 3CL7A 3ZQ9A 1TPVA 3BQ6A 4JEQA 5CC7A 1FKIA 1R5YA 3W7IA 2A85A 2VEKA 3WD3A 1OX5A 3M5VA 2CLMA 2CNCA 4J2MA 5E5CA 1LJYA 4AHQA 4GI8A 4DUVA 4P7LA 1DWGM 2PWGA 1LQ2A 3KBSA 1A5AA 3ITGA 2OQLA 4DWSB 4JCLA 4DM1A 1ZHAA 4GKTA 1XH0A 4KQNA 4FX7A 1FWAC 3PRAA 4E2OA 1J5TA 4RNIA 4DXKA 3CUZA 3QPEA 3DX5A 1IT7A 3K5XA 5FJUA 1OCNA 4IGHA 1FKBA 2MF9A 1M7XA 3KEHA 5REQA 3OZYA 4RDZA 2BY3A 4NX5A 3WEOA 2DUAA 1EPVA 1MNZA 3BW2A 1U22A 1EXBA 4PB3A 4HIBA 4PMJA 1LLZA 2GK1A 2O92A 2L2SA 2DW6A 3IWPA 3MP3A 4IGMA 4Y96A 1R47A 3DHFA 3U6WA 4G1NA 1L2QA 4PFHA 3A47A 5AKQA 1Q6EA 3V1HA 2JE8A 3CHFA 1C8VA 4XVDA 3R25A 4JX6A 1C8YA 4UNLA 3AS0A 5AHEA 1UKOA 3DGRA 4FNRA 3LV5A 2DG3A 2X2YA 1RPXA 5TNVA 4HPHA 1XIGA 3WEMA 3TA9A 4PODA 2ZUNA 2CFFA 3KACA 4R34A 4N6EA 4ODQA 1E70M 4OBTA 3L5LA 1A47A 2YCKX 2DJLA 3WJWA 1IZJA 1M68A 4ICNA 5I2UA 3ANYA 4ZPWR 3BOXA 3EX2A 2POZA 3EOOA 5FJTA 4L9XA 1D3GA 5IXEA 1AUSL 2BXZA 3WH0A 4KH2A 3O15A 4DWSC 4XSLA 3UP8A 1P5BA 3AIRA 2XH7A 3WLRA 1K7EA 1K6WA 1C8QA 4FAMA 1RLCL 1SZEA 4GACA 5FA5A 3R8GA 3WCZA 4G50A 4CD4A 4KS0A 3ARYA 4I6VA 3M07A 3LM3A 3QPZA 3R7MA 3B9DA 5FL1A 1NFPA 1YX1A 4ZQPA 1KRAC 3M0XA 4UR8A 2QQ6A 1QPRA 2G0WA 2I57A 1B5TA 1A5BA 1CXIA 2PUZA 1KGUA 3W2NA 3CM4A 2ZE3A 4HPJA 5AC8A 3M44A 3QFWA 2J7CA 3UNDA 5G1YA 5E09A 1KQZA 2XHYA 1DV7A 4N02A 3RN6A 5CGMA 3UXAA 4E2BA 4UTWC 5LHFA 4PUWA 4U2ZA 3I7QA 3C86A 3RHGA 4ZR8A 3IV3A 3M0HA 3QY7A 3VI2A 3NQDA 2GVEA 3QV6A 1Z3NA 1F8AB 3SCTA 2J78A 1J4HA 2NUYA 5G4HC 3VTRA 1VBGA 3B06A 2GJLA 3CYVA 3G18A 4PUJA 3TAKA 5C5YA 1D8WA 4XK2A 3PWIA 4LEFA 1HJXA 3CZGA 3C2FA 3SQLA 3KL5A 2YCJA 5H2ZA 4NYYA 3F4VA 2VR5A 2FVMA 3IIPA 1F40A 4KESA 4LW7A 5EMUA 2ZBTA 4ALDA 4XAFA 4RXFA 1U1JA 3NQAA 5BRBA 2YX0A 3LTYA 3HG5A 1OY0A 1VHCA 2VT0A 1ISZA 1TA3B 1E6RA 2NQJA 5DT7A 1BQGA 1UUOA 1DXIA 1JGIA 4FI4A 2QUNA 5FKYA 4URIA 1G5AA 1DJNA 3OGRA 4PRRA 5K7JA 3MWAA 3M0MA 3BMVA 4LAMA 1OYAA 3W7DA 2EPLX 5F2IA 4YJ5A 4GJIA 3LNPA 3LCHA 2R1LA 3GG7A 1GQLA 3EA2A 3AIBA 1B57A 1JRCA 3W1PA 5KSWA 4F0KA 2YDQA 1MSSA 4EPEC 5HKGA 4DJEA 1DJYA 3QC0A 1RZMA 4S3BA 4JL2A 2ON3A 1L6FA 4L1WA 4QLLA 4UR7A 2WMFA 3QXBA 3JZUA 2QAFA 2PSNA 1UG6A 2CWXA 3A4JA 1QK0A 5LNWA 1Q6OA 2WNNA 2EKCA 4S3GA 4HOXA 3ATYA 1S1PA 1V0MA 3GHSA 2VFHA 5D2YA 3VIIA 2X40A 1EQCA 3R58A 4GO8A 4DX3A 4M56A 1VEMA 3BG5A 3DFPA 4NQ1A 3DBNA 1GTEA 4JHOA 1J4EA 1PX8A 2OG9A 3HQOA 1TV5A 2NV2A 4IMDA 3BGAA 2WV8A 3TWBA 4U28A 3GG0A 1QBAA 2PDKA 3RG6A 2WQPA 1LQ0A 4CD8A 7XIMA 1KGXA 2YZRA 3IIZA 2QJGA 1AMKA 4UQAA 3VNDA 2WSYA 3GG1A 4C6MA 3AFBA 4OE7A 4WY0A 1WNOA 1U33A 4KEZA 5GNXA 2TAAA 1CLXA 2OFNA 3IJLA 3NRKA 1A5UA 3UYCA 2INFA 3CQIA 2GGEA 3W27A 2XG9A 1SZFA 5CJ5A 3P2VA 1M5WA 1UMYA 4JY8A 4IF2A 3LGGA 2VVNA 4QAIA 1Q4NX 3NXLA 3I7SA 4WJ8A 1VYRA 2HDJA 2CLPA 1S5WA 2G3NA 4Y9NA 2VURA 1A50A 2GGHA 5D8WA 4FHAA 1EF2A 3B8WA 3BCJA 4US5A 2XGBA 4JIRA 4YPJA 3PZUA 4TXEA 2CXEA 3PPHA 1XPGA 4UTIA 2EG7A 5F2MA 4CNNA 4IQEA 3BAWA 6TIMA 4ADUA 4YYFA 4NAFB 1KT1A 5I09A 2DORA 2VKZG 1JFXA 3E6EA 1K70A 2QDDA 4OKDA 4FLRA 3W1RA 3FSUA 3TFCA 1WDDA 3GXIA 3BTNA 3KRSA 4DQWA 5FJOA 3ICJA 2ZZ1A 4FOUA 4IIGA 3SN4A 2ACSA 2CERA 4OFCA 3N2MA 2DUZA 5LNRA 3KXQA 2DT3A 3M46A 1LBLA 2BASA 3BWWA 3GW3A 1MUMA 5EMKA 1DIEA 3NL6A 3ZXWA 4NP7A 1EBHA 5T8GA 4ODRA 2XUCA 3UCQA 4LH8A 3V0TA 1GJUA 4WR3A 3U8GA 1EJ7L 1XDLA 5I5RA 3USZA 3OLGA 3CIWA 1PEZA 1V02A 1DBTA 5I3IA 2E1WA 4V33A 4QGCA 4GUHA 4JNMA 4MWAD 1AD4A 1CLKA 2INZA 1E5NA 1V3MA 3M47A 3VIFA 3RR1A 4PZVA 3ZVIA 4P7NA 5G1TA 4D72A 1HIZA 4GCXA 2JFEX 1OBAA 2FGLA 2OGYA 3EX6A 3SQSA 2ISSA 1VEOA 5KZEA 4PR4A 4Z1AA 1AMYA 1XC4A 3F4CA 1S2VA 3CV1A 1UIPA 1U79A 4MUZA 5I78A 1JYVA 2J79A 4ZB2A 4ZO9A 3TCEA 4WKAA 2F6KA 4C65A 1U83A 3LY0A 2DIJA 4PRTA 4PMDA 5U7SA 1YADA 2FTPA 2BMBA 3T0AA 1G4EA 3N9SA 3QBUA 4CD7A 2GWNA 2OWWA 2FPTA 4H6KA 5CG7A 2DVUA 3KBWA 2Q3RA 3KZ7A 4C6OA 1ZNNA 3H9RB 1M65A 4HJWA 1EO5A 4S2CA 8CGTA 4F8XA 1KXQA 3ABXA 2Z29A 2DT2A 4LS2A 4UZSA 2HRWA 2QMKA 3MI2A 1TPUA 1W1PA 4ZPVR 1WAWA 2PV3A 3IKDA 3RUBL 2QCHA 2RSEA 2PPGA 2QMJA 1NWUA 4J35A 3PNZA 3GU0A 3T4CA 4DPQA 5LIXX 2UZ9A 5E6YA 4GFIA 4RLIA 4MY1A 2B7QA 2OGJA 3O63A 3LK6A 3DIPA 3GAYA 4HSHA 3KZSA 4XD6A 3SB0A 3BG3A 3C0SA 1GYLA 3OLIA 1PKNA 4YWIA 3VIHA 3UJEA 2WCAA 1XISA 1E1CB 1EJXC 1NMVA 3MO7A 1EX5A 1KW1A 8XIAA 3ITXA 1OD0A 3L23A 5D2VA 1Q7ZA 1H7WA 3I68A 2ZFAA 1SGJA 4O12A 4QG8A 4CQCA 2WXDM 4BF8A 3FN9A 1S46A 2VC6A 3W6YA 1W91A 2BFGA 3A4AA 2K8IA 3TJ4A 1W26A 4AIEA 4B5WA 2RDWA 3XISA 1UW9A 3F2DA 5L9FA 5D4YA 1TSIA 1F6PA 1GKRA 2PPOA 2PF8A 2V3GA 3AUJA 3W7KA 1TRDA 3EOEA 2Z1VA 1P0EA 1GNXA 4TTGA 3PZIA 2KO7A 1CGUA 3VGEA 5D75A 1D7IA 4AVOA 2Y62A 1GG0A 3NSMA 3APGA 4YCOA 2X1TA 2PBOA 1OG6A 2Q6ZA 5HPOA 3SUVA 1FHLA 5GJPA 5AC7A 4JIPA 2C0AA 5DX7A 5FAGA 3TYZA 3R6IA 2WLYA 3M0ZA 5A6LA 4ERGA 5JXQA 4G6CA 1JCLA 3BOLA 3DAQA 5AHIA 3R12A 4ZB0A 4ZFCA 2OZ3A 3SUUA 4P8VA 4HPGA 4PE8A 1WZKA 2J4GA 4Q7NA 2X8RA 5MHBA 2FKPA 4GXWA 2BGQA 5E6ZA 4DJFC 4EKJA 1H1ZA 2EXOA 3G1XA 4U4MA 4O1BA 5DQPA 4UTLA 1WDRA 5D30A 2WZMA 2CLHA 3TH6A 4D6FA 4MF4A 2J8GA 4D2JA 4IGNA 4ZE5A 4GY7A 4V2XA 2JF7A 2PODA 1UH4A 5CQ1A 3TTYA 1U5VA 4WEVX 4B5TA 4NUWA 3TSBA 1HW6A 4ZSUA 2VZOA 2XIBA 4W9OA 1WXJA 3Q94A 4X22A 2HCVA 3HB9A 1XLBA 1YMYA 3KAIA 4H6EA 3GWQA 1W3NA 2PEVA 2W61A 2FZNA 4EIVA 3KAFA 2VQUA 3M5ZA 3PPGA 1GVSA 4Q7IA 1XSKA 2ABBA 4RV3A 5I07A 1XIBA 1ZP4A 3FK4A 5T9CE 1RY0A 3SCUA 1Q6IA 2GQ9A 1G94A 3VOGA 4ODKA 1TELA 2GJNA 3E38A 1J2BA 3PJXA 2E5CA 2PV2A 4O13A 3L12A 3S0CA 2NQLA 3RGTA 1W1TA 3MA8A 1AW5A 3THCA 2OLSA 4QT2A 1XIJA 3WMLA 4ZL1A 3A5FA 5E9XA 1UD5A 3VIOA 4AAJA 3L7RA 2YW4A 4S1FA 3ZR5A 4PSPA 1K02A 5A2CA 3GTNA 3TV8A 3BJSA 3VDGA 4DPPA 1IZKA 3O1NA 4H8UA 1MFVA 1QNVA 5G1MA 4HN8A 4FAPA 3RM9A 3O5OA 4RW3A 3V0UA 2J6XA 2V5KA 3UW6A 5KZMA 1WE5A 1SSDA 1WBJA 1AW1A 2IPJA 1N1AA 4NXKA 4R27A 2VR4A 4DT4A 2XP5A 1POKA 4GD0A 1RUSA 3SY5A 2X41A 1BVZA 3TJLA 1EZ2A 1OC7A 1FXQA 1ZAIA 1IWAA 1QNSA 1V6XA 1L6SA 1VC4A 3OOBA 4B15A 1BWVA 4A3QA 4QZVB 1JD7A 2M2AA 4AVNA 4JFTA 4DWDA 2XFYA 4XAGA 2RH9A 2V2CA 2OTDA 3RPDA 1C7TA 1Q13A 1PIIA 2BWGA 4PUKA 2WVTA 2I14A 1VAHA 1KO0A 2J27A 2HSAA 2AGKA 2OOFA 2XYLA 2OMAA 1KFKA 2QCMA 2QLYA 2J66A 2XP6A 4LBUA 4TVCA 3M64A 2DY3A 5C70A 4UWMA 1QRQA 1SSGA 2XP9A 4S23A 2AKZA 4JKMA 1YDOA 2DH3A 1HL8A 2PZNA 1CXLA 1XLGA 9RUBA 1XS2A 1Y5WA 2N87A 3Q4DA 4DXXA 1PXGA 3CO4A 4GQQA 1P0NA 1S5VA 3TU9A 1TPEA 1ENUA 4NIRA 4XZMX 4ZZ9A 1UYQA 1OVDA 3IANA 3UZXA 3GNOA 2WJZA 3TA6A 2OWCA 1NSJA 3M41A 2H9AA 1DP0A 1K9EA 3BDKA 4GUFA 4HMNA 1O68A 1HKVA 4KT2A 4Y6GA 4AZ5A 4X2PA 4AIBA 3GTYX 4FS9A 3ZS4A 5D2XA 4KMQA 2WVUA 2Y63A 3TX9A 4BI5A 4YLWA 3PVFA 4RE3A 3TDBA 3SAZA 5LGXA 1ME9A 5DEZA 4UQCA 3GNNA 4AZHA 3NURA 4I6KA 2A21A 3TSMA 3RJYA 1KD0A 4UZUA 2YXGA 4NJIA 5A94A 4MUPA 2P8BA 3NSNA 4Q33A 2DW7A 3SRKA 2BG5A 5A69A 4DRNA 4JPGA 3WLPA 3WZ0E 3W1UA 2FZ8A 5D9OA 2JIEA 3GXPA 4C1KA 1Z9AA 3DEQA 1L2UA 4PA8A 2B5UB 1ZZMA 2XINA 2JZVA 4HYRA 4OV4A 4YN5A 2VCBA 1SYTA 1XYZA 2GGIA 3LDVA 2Y88A 4MKVA 3WQ5A 3LD5A 2B7PA 1YLVA 4DO4A 5M03A 3SY1A 3N2OA 3MI6A 4PH6A 4IPNB 3ZLGA 4JFKA 2PBCA 3TN3A 4HN4A 3II1A 1Q85A 1Q6LA 1JZ5A 3KZPA 3F5JA 1QI5A 3WFAA 4ONVA 4OOUA 3L2LA 4U31A 1M7OA 5LIWX 4P7RA 2ZIDA 2XVNA 1TZZA 1HJWA 2A7NA 3GDLA 1E73M 3MP4A 1FKKA 3DERA 2FJKA 1E4IA 5C7HA 4EF9A 2ZC8A 3T0DA 3ARTA 1I1XA 1X6LA 3EKZA 3LGEA 5IRPA 1Y65A 3AIQA 1QPOA 3EB2A 4O1CA 2ZYFA 3UJRA 4A6GA 4Y9AA 2BSLA 4NJJA 3NQEA 4GYKA 1OEPA 1SO6A 2IW0A 1V51A 2DZTA 2FYMA 5DMYA 4Z0JA 3MBDA 2WMJA 3B40A 3T07A 1OGBA 2HTMA 4P8UA 1ZBVA 3EMQA 3AQUA 5EMJA 2WLZA 4ZE4A 3H55A 3WDQA 3FHAA 3EYPA 2M08A 4HD5A 2TMDA 3NWRA 1XKYA 2ZQ0A 1DWHM 4PSRA 5GPGA 3UZWA 4H9UA 3ZOAA 1UOKA 1ZLPA 8RUCA 5JBEA 3VNLA 2JKPA 3PZVA 3VIPA 2E3ZA 3RJXA 3TCZA 2OB3A 4IQLA 4B5XA 3BW4A 1HQTA 3AXMA 1F3XA 1P4CA 3L4ZA 1NARA 2E8ZA 2VC5A 4PMVA 1HN1A 1MQQA 2HV5A 2CW6A 2RQSA 1UR3M 4GIEA 1H5YA 4KCWA 1SZRA 4GWEA 1R3WA 3PPFA 2G3MA 3VX0A 2DDXA 4WF7A 2VOTA 3B9EA 5HQLA 2XN1A 1K1DA 1IEWA 1T41A 1TV8A 1K03A 3N04A 4UR9A 1THFD 4XO7A 3UWEA 3W24A 2J77A 2GGGA 3TYBA 3U5YA 2Y1HA 5EA9A 4JTEA 2DT0A 4Q4SA 3GH4A 2V8ZA 4M51A 1AZ1A 3WBAA 4LAWA 1O95A 3IJDA 3GFXA 3WG6A 3B4UA 3O5LA 3BW3A 5J5RA 1S2WA 3W71A 4BJHA 4IFKB 1OG0A 2C91A 4F4RA 3MMTA 4Q7BA 1I6NA 2ATMA 4JHMA 3AXXA 1Y0OA 1E55A 2XJ7A 1W3IA 1ZU8A 2F7FA 3CPRA 4YCPA 4LNCA 1JCNA 4UTTC 4KEUA 1A5MC 3GC2A 2D24A 4REQB 3RFAA 2OKTA 3KVJA 1H49A 3QM3A 1GVFA 1AODA 2OEKA 2QKFA 3IVSA 4RKAA 1F5ZA 2E9MA 4HTBA 2BTMA 3O06A 4GG9A 5AOUA 4RNJA 3UI6A 1E9IA 4Y8FA 2YCLA 3W6MA 1B31A 2GYIA 4YTUA 5HINA 5FF3A 3DC8A 3G24A 3GO2A 4D6HA 1GEHA 5GQBA 4RE2A 2RFGA 5ABHA 2PP3A 1J2WA 3UBPC 1VH7A 1S2CA 2XVPA 5DELA 2QCDA 1TMHA 1ISWA 1V3HA 1Z8AA 1NFBA 4JTFA 4AEEA 4NVTA 5CPQA 1WV2A 3UY7A 4KR0B 4Q8OA 1NH6A 1IR2A 3MUXA 2FTWA 3SGGA 2Q09A 3G1SA 1CXEA 1JZ2A 1QO2A 4H8HA 2OO6A 2XTKA 4NAFA 3S6TA 4JTGA 3LCLA 1ADDA 3E5BA 5CGTA 1A80A 3UNTA 1J0HA 4P5UA 3BXWA 2PDHA 3DG6A 3VKDA 1XIHA 3PSWA 1T8XA 5B7YA 1R9YA 3S46A 1PIGA 1XIFA 2PDFA 4K8HA 1V0NA 4PMZA 1ODZA 3A23A 2PTYA 3NZQA 4O28A 3WJYA 3CGNA 2O9PA 2V82A 4JTRA 4AU0A 1OZMA 1JI1A 4QRNA 1XP3A 1RCQA 1OT1A 3IIVA 3NR0A 2ZUTA 1UD2A 2NX1A 4JQ2A 4AY8A 3UVIA 4NY2A 1W5QA 4RPPA 1D3HA 3W7EA 1JEZA 3S9IA 2J88A 1R3SA 2BDQA 4R0XA 4M1BA 3S2LA 4DM2A 4ACZA 4ZPTR 3HPXA 4JICA 3TDFA 4ENLA 4F0RA 3N15A 3CS2A 8XIMA 1GW1A 2NX9A 2R94A 4AD3A 4C7DA 3D3AA 2A5HA 2D2JA 3SCRA 4GC4A 1Q5MA 5I3KA 4FLQA 1NEYA 1VJIA 3LUTA 4ICCX 5FI8A 4Y8EA 1ZCNA 2F9RA 2ZVRA 4A21A 1MW2A 2ZR6A 3NQ2A 2QDHA 3JUGA 2PWFA 3EWZA 5DXXA 4HSOA 3O5MA 2H3BA 1IEVA 3WJXA 1CGWA 4WSJA 4GINA 1L8NA 3VIMA 1X7IA 5BWFA 1QFEA 5I3DA 3CIXA 3HJZA 2PPPA 1Q8JA 4H6RA 5HMSA 2PDGA 1F2JA 5D05A 2ZC1A 4LRTA 1I2NA 2YGYA 4AHOA 1IXPA 2CBJA 2W79A 3PTMA 3W7QA 1ZQ5A 3AJXA 3VKBA 4O1DA 1TJ2A 1A5SA 1YPIA 4DZAA 4CCEA 3ZT7A 1IWPA 3LCIA 3EKLA 4DF0A 4HOWA 1J5SA 4IP7A 3C8NA 2IKHA 2FPYA 5A8PA 3G1AA 3S42A 3ECQA 5TBOA 1TMLA 1OC6A 4J3WA 5E0KA 4TU1A 1E44A 1FP9A 1VRDA 5JH1A 1UMLA 1FWNA 5CAKA 3TQPA 3WDIA 2FB3A 5T91A 3JRKA 1E1CA 3PY2A 1ZCOA 1VB9A 2V5DA 3TZNA 7REQA 4PTVA 2OX4A 5B8IC 3K8KA 1O4UA 4AEOA 5GNYA 3RDKA 2WWDA 3OP2A 1MXSA 1SW7A 3NVTA 3QLLA 4DUWA 3CUIA 4KRTA 1UR9A 3NG3A 4QXIA 3R43A 1RR2A 3EWDA 4U3CA 2VFGA 3UWQA 2CZVA 5JQ9A 3WLOA 3IJ6A 4Y9PA 4XQ6A 3SCSA 5LXEA 4DLFA 4YHEA 2ANUA 2A3AA 3T0CA 3IRDA 3H12A 4FR6A 3W7RA 1PX4A 3N17A 2VRJA 3GUGA 3EPNA 3D47A 2XZ9A 1GVEA 1V0LA 2YLAA 2W62A 5HANA 4KRZA 3AIWA 4XX6A 3W2JA 5CEWA 2BLEA 1J01A 2PD5A 1D7HA 4AQLA 3VNYA 1TE1A 4DF2A 4UFJA 4GXMA 4F3HA 3HGOA 1CWYA 3P81A 2CPUA 3TMQA 1HKIA 1GCYA 3OA5A 1ITXA 4QSHA 2XIJA 5BU6A 1XICA 1KM6A 1UWUA 4MZ1A 3E96A 2J8TA 4QEEA 3B8SA 1EA9C 4QISA 3TXZA 4Z1CA 4H7CA 4LVAA 1A49A 3P7YA 3W82A 4IQJA 1J4RA 1E9LA 4HP5A 5CLWA 4CGTA 4JHZA 1R87A 3COTA 2ZX6A 3HG2A 2I7GA 1CGYA 2W3ZA 5A8OA 1WDPA 1ICQA 1MFUA 4JDYA 4PUUA 1G01A 1KBBA 1VFOA 5CC3A 5BROA 4JEJA 1W5OA 2QPUA 3CUHA 3G1VA 4FNQA 3DUGA 4HMCA 2EBNA 3DECA 3L0NA 2Z1KA 1NWSA 4E4PA 3FCPA 3QZEA 3ZMRA 3W02A 4BEUA 2VC7A 1IIHA 3CYJA 1GKQA 1J0KA 2ISFA 5AYYA 3LLDA 1BVWA 3MYOA 5LIUX 4IT6A 1BYDA 5JU6A 2V30A 4JFMA 1JRBA 1VCFA 3TEVA 1ME8A 3DFQA 3E2VA 2V5LA 1AQHA 5D02A 4X9YA 4HGXA 2WC7A 5DIVA 3AXHA 4W89A 3LXBA 1XG4A 2AL2B 3T78A 3RAOA 4MVAA 1VYPX 4LC6A 2P76A 3H7VA 5EMMA 1GQKA 1UB3A 4IISA 3WH5A 4CU8A 3PULA 5I77A 1C8XA 4RPQA 3NPXA 3A22A 5HMDA 3OVPA 3TTSA 3TP4A 1EP2A 2BVTA 1KFEA 1YTKA 1M41A 3MUIA 5MF5A 1SPQA 4ZFMA 3GS6A 2EPOA 3F4DA 3BAXA 4UTUA 1JYXA 4LB3A 3PN8A 1LUCA 2WHLA 4LU0A 3DYMA 2XP7A 4G2PA 3EZ4A 3C4UA 3NQ7A 3V36A 3UA3A 1X38A 2PGWA 3VVGA 1FTXA 3KOZA 1FH8A 3LHUA 1Y0EA 1HXJA 1S5TA 1MW3A 4QITA 3O8AA 4JFVA 4LAVA 4HNNA 3E5PA 4FOJA 3W53A 3WNMA 1K7XA 1XCXA 4H3DA 4BKNA 3K8LA 2J7BA 4LCRA 1H0GA 3MY9A 4IX0A 4FLOA 1SFSA 3GIQA 4JIEA 2M1IA 2R9RA 4B5UA 3VKAA 1BYBA 1EBGA 2DG9A 3T8LA 5IBXA 2BNJA 4M5PA 1AL8A 4Q3MA 3O2LA 4EAYA 1FWCC 4O14A 3UGRA 3IHZA 2QHAA 3RCYA 5TF0A 5DXYA 3CAWA 1C7SA 5IFPA 2XDFA 3A21A 4Q8VA 7CGTA 1S38A 1ADSA 4CN1A 1GTHA 2DSUA 3CJPA 2V69A 3D3FA 1E72M 1KFCA 2XGIA 1P6CA 4KFNA 5C7VA 2BXYA 3EOUA 3W07A 3WUGA 4EXQA 3GU2A 3K46A 3UD6A 4Y9MA 3S5NA 4XKYA 1TV4A 3O5JA 5DRIA 2R91A 2PDWA 3S4TA 1IXOA 2VELA 4LXFA 3RU8X 1RVKA 4JDBA 5C6MA 3SURA 1ZJAA 4HCDA 5LGZA 3FLUA 4WGXA 1M7JA 3DZ1A 3HG3A 2F8QA 4B5NA 4JX4A 1DJHA 1J0YA 2Y7DA 3C0LA 3PJTA 3TC7A 1G7UA 4FXSA 4GNVA 2LLEA 1FJDA 3G6MA 3EWBX 2OLAA 2H6RA 2UY3A 1KBJA 4B3KA 3KVKA 3WFZA 1E0VA 3F4WA 5A2AA 4MY8A 4S39A 1F4AA 1KV5A 3VIJA 3R4IA 4GGBA 4BI6A 4LT9A 1BXNA 3HG4A 4O4WA 4Z17A 3PR9A 4MTVA 2W0UA 3L4YA 4LYPA 1ICSA 5BOEA 4K8EA 1F61A 3HGJA 3VD3A 1QW8A 1PYMA 2GLKA 4IFOA 5HMEA 2OOGA 2PU0A 3HM7A 6PTDA 3LCXA 4B3LA 4GQBA 3MKVA 5DITA 1PTGA 4NX0A 2WZTA 4ML4A 1J6YA 4GZJA 1D8CA 5E0CA 3SI9A 3GIPA 3S1VA 4CCDA 3P80A 4IPIA 1TPB1 4R7OA 2X2GA 3S83A 4W8BA 3IGSA 5J5DA 1C91A 5A95A 4ROQA 3QOMA 3HFTA 4ZOEA 1PV8A 4Z2KA 1R9ZA 2EQDA 1TVNA 4L4OA 2QCNA 1UPPA 2YBVA 3NA8A 4XVEA 1J4IA 1OIMA 3G77A 5T26A 3VGHA 2ADAA 5EY5A 3WYZA 1BWLA 4IIFA 2GGJA 5CPTA 3B4YA 4M6QA 3K30A 3W7NA 3XIMA 4E6MA 2ZQUA 2YKKA 4MSSA 1ZFJA 3FGCB 3PUOA 4IMCA 3S1WA 3S2MA 2VC9A 2WJDA 3WF1A 1PE1A 4MNKA 3PFRA 2OZTA 3NL3A 1CDGA 1H1NA 1S3HA 4W7WA 1AA1B 3WQDA 1GVYA 3GDTA 2NSOA 5JMUA 3BSHA 1T11A 3LB0A 1JAKA 3ABOA 1V93A 1UR0A 4XO6A 2EF9A 4UTTA 3WENA 3FA4A 3LRMA 3MSDA 2ZCGA 3C6CA 1RQEA 4N9CA 4KWSA 4L4MA 3GDMA 4Y2WA 3RLGA 3MJMA 3PAOA 4OBSA 1WKEA 4C6KA 2IMRA 1FKLA 3OB8A 3AYVA 1EUNA 5AY7A 1SO3A 3I4EA 1QWKA 1ZSXA 3BCDA 1HJUA 1W9BM 3CUJA 3OZMA 3GC4A 4DIPA 1I9CB 4J4KA 4PBFA 5D33A 1N8IA 3BV4A 3D0CA 1FAPA 3O6AA 4ZCWA 1RLDA 3LBOA 2TRSA 1XGZA 3AHYA 4ZBCA 3AYTA 5KZDA 1QOQA 4IP5A 3SFKA 5DO8A 4ZO6A 4M7TA 1G69A 1N7KA 2VRKA 4JQ4A 4HNLA 2PMQA 4H83A 2QDGA 3TOPA 2VFDA 1QPNA 2BGSA 3VC6A 3QOKA 3CZKA 1B1YA 3STPA 3H2FA 4MG4A 5CAHA 3LPFA 4ITZA 1F4HA 4J27A 4Q4KA 2C0HA 5TD4A 3DHUA 4XIMA 1E0XA 3A24A 5B7ZA 4AZCB 1UD8A 3MMDA 4IFKA 3QYQA 5I02A 1TIWA 2YZ5A 3P74A 3BLDA 1FKSA 4RE4A 2GK1B 4QEHA 3W6LA 1WZAA 3IRSA 2D20A 1ZGDA 4C6JA 3HOJA 2FFIA 4WKFA 3GNPA 1EGZA 5I3GA 2YXXA 3Q37A 1PO9A 4H01A 4OVXA 5K9XA 1C90A 1V6TA 4JOMA 3SJNA 1RSCA 4HPXA 1DORA 1MYRA 3GXFA 1XX1A 1EC9A 2BY0A 2DGAA 3CQJA 3VDBA 2NVDA 4TR9A 3DFNA 2BOFX 3REQB 1XIMA 3IUHA 5C2GA 4CNTA 4GK8A 3FJ6A 2WVSA 1PBKA 1E1FA 1V6WA 1X8FA 1FKTA 1BTCA 2BY1A 2WPBA 1VFFA 3IAPA 1QMLA 3GYEA 2C1GA 1YNYA 4C6EA 3C52A 3GW0A 3TC3A 1IEXA 2PRHA 3WQEA 1GZ1A 1J12A 1FKXA 3QHOA 4JGDA 3GRIA 1UWAA 3W29A 1RCXB 2PDUA 4AZ6A 3MANA 3OW1A 3H8AA 4RNHA 4D6DA 3G1YA 4OT7A 3JYMA 4J2PA 1G9HA 2RGMA 1E0WA 4ZMGA 1DYSA 4EWND 4B90A 4A3UA 4TUFA 3AU2A 4MDOA 3RU6A 2EPMX 1WPCA 2GVJA 3VNIA 2EG8A 2VFIA 4DO7A 5BXTA 1NOUA 3BL3A 5G2IA 1TCOC 1NOWA 2DZXA 3MDUA 3KP1A 3O5PA 3EA3A 2Y5SA 8A3HA 1ISVA 5LNUA 3U2CA 2Z4GA 4X61A 4NAEA 2NLYA 4PB4A 4B92A 1EJWC 4O57A 4L64A 2PLCA 4Q4OA 3LPPA 3LRKA 1JNSA 4LFYA 3NQGA 1BKFA 2G4FA 5CPMA 4NXSA 5F1VA 2CLKA 4NI8A 1LDCA 1MDRA 2RJGA 5DBUA 4MWAB 1QUMA 1LWHA 2WNWA 3C2OA 3A3WA 5FAJA 3NEHA 2W92A 3WF2A 1R9XA 4F79A 3E74A 3TQKA 2CLLA 1YDVA 4KPLA 1S2TA 2ETNA 1TZ7A 1F07A 2NT0A 4UTKA 4MM1A 2BOGX 5IM51 3PPCA 4EOUA 3ZJKA 3HF3A 3B05A 5CSYA 3EWXA 2DPEA 4YVXA 4C91A 1LOQA 2XZ7A 4M24A 3A6OA 3QKZA 1M5YA 1OHLA 1DJGA 3VNZA 4F2UA 4CU6A 2R14A 3N9KA 2LGOA 3R5EA 1FBAA 3DU0A 2UY2A 3QLDA 3BJTA 3VD5A 1RP8A 3ALFA 2QV5A 2HWGA 2BVYA 3WEZA 1UC4A 1XBYA 1KFJA 3VZZA 3W1MA 3SCVA 3TWAA 4IPXA 1XLEA 3VIGA 3PZQA