2QF8A

Crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of Buffalo Secretory Glycoprotein with Tetrasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2qf8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qf8A01
3WMCA 2XGBA 2D1ZA 3NDYA 1R7OA 3SUUA 1V08A 3II1A 2GDVA 3DYMA 4UCFA 5HPOA 1KBBA 3B8SA 2BS9A 4J27A 2DT0A 2ZUNA 1RD6A 3BLKA 4UZSA 1B3VA 3WDRA 4DM2A 3RM4A 1UR0A 3BAXA 3VGBA 2BFGA 2X09A 1QNPA 1VFFA 3CPUA 3T08A 2DPEA 3WIJA 1FH8A 4AEEA 1ZBCA 1GORA 3SCNA 2OYMA 3HMCA 3WD4A 1JYVA 3IJ9A 2BHYA 1CXKA 5A69A 3FAWA 2MANA 4CVWA 3B9AA 1NARA 3PTQA 1VEPA 1G1YA 4TX6A 3WUEA 4ATDA 2PWHA 1XHGA 4JFUA 1LQ0A 3I3BA 4GKLA 4XZWA 3T0BA 1QNRA 4F79A 2VCAA 3B9EA 3CHFA 4RE2A 3MMDA 3T0DA 1Q6DA 1X1NA 2BVDA 3CGTA 3ZR6A 2JFEX 1U33A 2DT2A 2OSYA 2CBUA 1WCGA 2WW5A 1E5JA 2XIIA 3BAKA 1E4LA 2J4GA 4DUXA 4H7VA 1BPLB 4CU6A 2FGLA 3DYPA 2BY1A 3IJ7A 2GDUA 1UWRA 1DWIM 4OJYA 1HJSA 1W3JA 1JAKA 3RO8A 1J12A 3T2QA 1OGSA 1XRVA 1I1XA 1IT0A 2Y8KA 1NOUA 3ZMRA 1CXFA 2F61A 2VOTA 2J8FA 3GXMA 4B15A 5GQBA 2ZUWA 3CHEA 3LPPA 1U30A 4PMYA 1E0XA 3TTYA 3CZGA 1TA3A 1HJXA 3WL1A 3OBAA 2WVTA 5A8OA 2Y5EA 1DP0A 2ZXBA 3PZVA 2J47A 2OYKA 4PMQA 1CPUA 3UG4A 4P8UA 1Q4NX 3GXDA 3CIVA 3RPMA 4A4AA 2VI0A 2VCBA 2ZWYA 1B3XA 1F4HA 3W27A 3I3EA 3FAXA 1BLIA 5E9AA 4CD4A 3EMZA 4Z2IA 3AIQA 3N12A 1OD8A 1JZ7A 4F9JA 3A4AA 5TD4A 3NDZA 3CHDA 1VAHA 3N11A 1N82A 1XYFA 3WFZA 5AYBA 8CGTA 2ZIDA 2VX6A 3VUPA 4OOZA 8A3HA 1E56A 1H1NA 1Y7VA 3PZTA 4WLCA 3FXYA 1E4MM 3GXIA 3NIYA 1XH1A 1GUVA 4IPNB 3SCVA 2O9OA 3WNMA 3K8KA 2JALA 1UA3A 2WCAA 3AZRA 2WMHA 5CGTA 2VURA 3QHNA 1KBKA 4DUVA 2X2YA 1PX4A 3ZIZA 4N0RA 2PWGA 1V3HA 5CGMA 1UD6A 1TG7A 1GJWA 1MW2A 4LQ1A 3SIMA 2DT3A 1JGIA 2D0FA 3ZT7A 2WC4A 1EHNA 4GO8A 3PZMA 3A4XA 2CETA 3SUWA 1B31A 5KEZA 4GO9A 5AC4A 1W32A 2YDRA 4Z2HA 2AMGA 4DWSD 3AHZA 2WLYA 4MJ2A 2OLHA 3LPOA 4X0NA 5F7UA 3BC9A 3FNDA 3ARXA 1MXDA 1VFOA 2FH8A 1ZL1A 2PB1A 1E71M 1LWJA 5ABGA 1E0WA 1US3A 1W1TA 2XVNA 4UZUA 4YHGA 3CZEA 2QHAA 3W38A 3HN3A 3DHUA 2VNCA 3K46A 5EB8A 4M82A 4WKFA 5A6BA 4HOWA 4JCMA 2XFRA 1E3ZA 4DM1A 3GM8A 3NSMA 3WQVA 1QI3A 1V3KA 2G3IA 4J3UA 2GFTA 1VBRA 3WF0A 2YL5A 3WY1A 1GQLA 1BGGA 2GJRA 3WDHA 4TOQA 1MQPA 3VGEA 2FHCA 4TVUA 4EANA 3POHA 1QI5A 1FH9A 4W87A 2WNWA 5EFFA 1WNOA 1UA7A 5I79A 1CGUA 2CEQA 4QLLA 3BAYA 3WENA 1GNXA 2V3GA 3CUGA 1UG6A 3CH9A 1G94A 5A8QA 2YBUA 2VZUA 1JFXA 2ZX7A 4GZEA 3EMCA 3WNKA 3QHMA 4YN5A 5E70A 2WHJA 1CXIA 4D1JA 1ISXA 3TOPA 1EA9C 1V02A 4URIA 2Q8XA 4MDPA 3APGA 4C7GA 1JZ3A 1WDQA 1KGXA 2J74A 3LPGA 3SURA 2UWFA 1HIZA 1HT6A 3N17A 3VGHA 4TVCA 5A2CA 5ABEA 4MB4A 2VQUA 3F5LA 3W37A 1UH2A 3MKKA 1JYXA 1EDTA 1FOBA 1CECA 1SMDA 1HKIA 2WZHA 5HXMA 3W26A 1OSEA 5DEZA 1W9VA 1V6UA 1E4IA 5EFDA 2ZUUA 1WDRA 3O9NA 1KR1A 1DTUA 1KXTA 5BXTA 1E6ZA 2EPLX 2J77A 4BZYA 3DECA 4Q7NA 2J7HA 1UWQA 4AY1A 2VMFA 4HA4A 4MNLA 5IDIA 5IFPA 2O9TA 1JF5A 4MDOA 3SEPA 1GOQA 1KQZA 4OIFA 4H8HA 2D0GA 4P7QA 3WEOA 4AZHA 4PMVA 1LF1A 4L4OA 4FLSA 5A6LA 1QW8A 5FD0A 1QOXA 4V27A 2J75A 4PBGA 2J8GA 1W9PA 3N18A 4MB1A 4W89A 1QHZA 1VIWA 2ZX5A 5FOOA 1SYTA 2YA1A 2JF7A 1QW9A 1UD3A 7CGTA 2O92A 2DSZA 4AZ7A 5I3DA 3AS2A 2FHFA 2V5DA 4ZFMA 3AMKA 3TTOA 4PN2A 1B30A 2BXYA 3SCRA 4MNKA 3ZJ7A 3U7VA 3GZAA 3N04A 5HOSA 1QVBA 4OBSA 2DIJA 4U2ZA 1JXJA 4AZGA 3N1AA 4D6FA 4IM4A 2W61A 6CGTA 3FHQA 3RMEA 3VGGA 5FL1A 5I5RA 1ODZA 2BHUA 1R8LA 1MYRA 1DWGM 1QI0A 4MAZA 1JNEA 2E3ZA 4UFLA 1E55A 1OCQA 3FN9A 1WDSA 3AS3A 3VOCA 4MB3A 5I23A 1OT2A 3VIGA 5D4YA 3PZNA 5HNNA 2QPSA 2QMJA 4JFWA 3SCQA 4YPJA 1KB3A 2E4TA 2WYSA 4PUDA 4P7LA 2WWDA 3ZOAA 1E3XA 2WCSA 5JBFA 3ZO9A 1JZ8A 1LL6A 5JH8A 1E6NA 1HNYA 1W3KA 2XVGA 4E8DA 1OB0A 4EE9A 4AD2A 1CGWA 5A6KA 2ZX8A 3THCA 1JNDA 3MS8A 2OSXA 2ZICA 3EDJA 1UR1A 3NSNA 4D6EA 3PZIA 3W0KA 4LYPA 3VDHA 2CYGA 2WSPA 1TVPA 1EIBA 2E8ZA 4CKQA 3DHPA 4PUEA 4KWUA 1A47A 1WAWA 1G01A 4PMZA 2VRJA 1CXLA 1UR9A 1SR0A 1WZLA 2V3FA 1C92A 4H2CA 2Y8VA 1BQCA 3JUGA 5HBFA 2YBTA 1Q6GA 1CGYA 4J28A 3VIKA 4E8CA 3OA5A 1CXHA 3EMQA 1JDAA 1O7AA 2XWDA 2AAAA 4CN6A 3WL0A 4CGTA 4BF7A 2CITA 2EQDA 4GZJA 1SMAA 1W3LA 2FGZA 4AYSA 1BGAA 3GH4A 1VENA 2PC8A 4PMDA 1XSIA 2D20A 1B0IA 1KFWA 3AJ7A 5LYRA 4Z2LA 1RH9A 4HA1A 5M5DA 4W7WA 2G3JA 1JAEA 1R7AA 3QGVA 2ESCA 3ECQA 4D6CA 2YLAA 2V38A 4OKDA 2VR4A 1EDGA 3WNNA 1EXPA 3AZTA 3WF3A 1D3CA 4NRSA 1RPKA 4HOZA 2YDSA 3OGSA 3VU2A 3LPFA 1UWIA 3FHAA 1ZBVA 1BSIA 5A94A 4M8UA 1JF6A 2WCGA 4KGLA 3T2OA 3CUIA 4J3VA 5GNXA 4CN1A 1J01A 3UETA 2E9BA 3SCUA 1E72M 2UY3A 4KGJA 3BH4A 4BQ4A 4P8WA 2VZOA 2W66A 4P8VA 4ATWA 2YL8A 2Z1SA 1W3HA 1XD1A 2QV4A 3NSXA 4W7VA 4Z2GA 1BYBA 1GQJA 3E1F1 1E6PA 4HP5A 4W84A 3VIFA 2FH6A 2XG9A 5A6AA 3WQ6A 1GOOA 2V3DA 2W62A 3VINA 5CQ1A 1Q6CA 2WBKA 3AHVA 1QNSA 2HVMA 2YA0A 1HKMA 1IV8A 4W5ZA 1PZ2A 3KWXA 4PMNA 4EKJA 3W53A 1KXQA 1FFRA 3VTRA 1KXHA 3VO0A 3B9DA 3K4DA 3I3DA 1HVQA 3WH5A 3WBEA 4UR9A 4CD6A 2WVUA 3AIVA 1FHLA 3GNRA 5CLWA 1HX0A 3EYPA 4D6DA 3MUIA 2EO7A 2NW0A 2C0HA 2AOSA 3BAIA 1OGGA 4ZXLA 4J3XA 4TVDA 4AISA 4V2XA 1HJUA 1W1PA 5DF0A 2WKGA 4RE4A 3VNZA 2XVKA 4U3AA 1QI2A 4UOQA 1C8XA 1WPCA 2D0HA 1UWSA 3GBDA 3IANA 2YJQA 7TAAA 1H5VA 4LXFA 1XYZA 3MO4A 4QLKA 1UZ4A 5C71A 1BHGA 4XUYA 4JKLA 2BVYA 4Z2KA 3PN8A 1EDQA 3WMBA 3AIBA 3F4VA 1KXVA 3N9KA 4PEEA 3WEZA 4E4PA 1M04A 4W85A 1WE5A 1V0MA 4X0VA 3VIJA 1CLVA 4CD7A 1JL8A 4GQQA 4AD3A 1OIFA 2DQXA 3CUHA 2ZE0A 2GVYA 1L8NA 1B9ZA 3IJ8A 1XD0A 3AXXA 4H8VA 1UYQA 1P6WA 1CGVA 2A3EA 1BF2A 3VMOA 2D23A 3WDJA 1W2PA 3WQ5A 4AMCA 2WLZA 4QAWA 2WWCA 2FDMA 4W93A 5A1AA 3MV11 4JKKA 1NQ6A 3KL3A 1XH0A 4U3CA 1H3GA 3VD9A 4Z2JA 4JAWA 4GXPA 1LL7A 4W86A 4RE3A 1L0PA 1B3ZA 2ZX9A 3GXFA 1Z32X 4HOXA 4LGXA 2RGLA 3MMWA 2DSWA 3UEQA 1Q6EA 3KE0A 2ZOXA 2W5FA 4KMQA 1WB0A 1DHKA 1PBGA 3AYSA 3PHAA 9CGTA 4OZOA 2PF0A 2XIBA 2CHOA 1OM0A 5CZKA 1KR0A 2XPKA 3GNPA 3ARRA 1S46A 2ZUTA 3PZGA 3AXIA 1DWHM 2DT1A 4QFUA 2WC3A 3AS0A 1ISVA 5D8ZA 2A3HA 3U7BA 1LG2A 4E2OA 1OBAA 5DMYA 4B9YA 4TUFA 4AC1X 2PI6A 3WBAA 1HL9A 1WZMA 3ZSTA 1MFUA 1US2A 4K68A 1UUQA 5BXSA 3WD3A 4AZ5A 1HL8A 1KWGA 3VD4A 3EDEA 2XVPA 2GSJA 1UR2A 1TZ7A 3OLIA 2BVTA 3VDBA 5EMYA 2EPOA 2UY4A 3GH5A 3MUAA 5ECUA 4MNMA 3ZJ8A 1NWRA 1R86A 4TTUA 1M01A 1W91A 4AZ6A 3CMJA 2Y2WA 4UOZA 4BS0A 4UFHA 5EBAA 3WQ8A 1ZBWA 1TR1A 2XTKA 1BTCA 1UD8A 3OZPA 3PBGA 1CGTA 3ZSSA 5JUVA 1WZAA 1JD7A 4AIUA 4GPNA 1VFUA 4BCEA 3QHOA 4WIWA 3VIOA 3WUFA 3AQUA 2TAAA 1JYNA 3CZKA 2JEPA 4AD0A 1UD5A 4W88A 1ZB5A 2O9RA 1JXKA 2VUYA 2J7DA 1VF8A 1CGXA 3AHXA 2VCCA 3GNOA 1E15A 4Q22A 1M03A 1GHRA 2BHZA 2DGAA 3CLWA 1W2VA 1JDDA 2CESA 2E9LA 2IXUA 3OIHA 4IPLA 3MANA 5BCAA 2W67A 3RILA 4CVUA 1J0JA 4HTYA 3ZR5A 3VM7A 4NRRA 3CBWA 5D9MA 1AQMA 2VX5A 2VZTA 3CMGA 3MU7A 3GTNA 1LJYA 5GNZA 1GOWA 1TUXA 4N42A 3VDCA 1MXGA 1PIGA 3G6LA 4ACZA 3VIMA 4PMOA 1V3MA 4FMVA 4WSJA 1TMQA 4PTVA 4OOUA 4ACZB 4NZCA 3BSHA 2XGIA 2BNJA 4UFIA 1HN1A 2VVSA 5IXEA 3OB8A 4U2YA 2QPUA 1EQCA 1HF6A 2EXOA 3L4WA 1ZJAA 1R87A 2PWDA 3VPLA 3VIPA 3W6LA 1U2YA 3THDA 4C7DA 1MQRA 2D3NA 3ALGA 4W7UA 1ZBKA 1E6SM 1XSJA 1C93A 4KH2A 3WDIA 1MFVA 4ACYA 1C3FA 3O2LA 5HDRA 4HPHA 3WFLA 5BXPA 2WXDM 1NH6A 1JD9A 3QOMA 1J0HA 3ALFA 1NOFA 3KEHA 2J7FA 4MJ4A 4F8XA 3BXWA 1GOIA 5A6BD 1EQPA 1JYWA 3M6DA 3VGDA 2W92A 1E1FA 1NWSA 3OGVA 5ABFA 2WHKA 2ZX6A 2QF8A 1BFNA 4AEFA 4CD8A 2W4XA 3AIRA 1X6NA 3U5UA 4FLOA 3WKZA 5ABFB 4UTFA 1NP2A 3ZT6A 1FP9A 1E73M 3OLEA 4IISA 3CTTA 1TVNA 2WMFA 1EOKA 4HZ8A 1WP6A 3M07A 4HMCA 3WMSA 1EH9A 4BQ5A 1HVXA 3CZLA 4MTVA 1LL4A 1FA2A 5JIWA 4AZIA 1ITXA 3ARSA 3OLGA 3T0AA 2RGMA 2BXZA 4JFSA 2ZUSA 4P7NA 2WANA 2X0YA 1KWKA 2WHMA 4HMDA 1W9XA 2EEXA 3AOFA 2D2OA 1JI2A 1NWUA 3DC0A 2F8QA 4OUEA 4LPCA 4UQAA 4X9YA 2DSVA 2OWWA 2W91A 1UH3A 1FHDA 1H11A 1PX8A 1UD2A 3M46A 4UQCA 3O6AA 4D6GA 3PZOA 5M17A 2GUYA 4EAMA 3WN6A 2X8RA 2VO5A 4MPKA 4H04A 3BAJA 3QR3A 1WDPA 2J7BA 4P7OA 2A3BA 3WD0A 4B9ZA 3WH7A 2BV9A 1E9LA 4QLJA 5A2BA 7A3HA 1DWJM 5DT5A 3TA9A 5DO8A 1QNOA 1B1YA 3MMUA 1J18A 5BWFA 1E40A 5A2AA 4CCDA 3N13A 2EPNA 3A47A 4D71A 4GZIA 4UQDA 1TE1A 1XV8A 3IAPA 3DYOA 3A3HA 3KZSA 2DH2A 1C91A 3WDPP 3VD5A 3MSDA 1LLOA 1RP8A 2DH3A 3OGRA 1O6IA 1GJUA 1YHTA 2WKLA 3UCQA 1OD0A 4JHOA 1E0VA 3VIIA 3SUTA 3WELA 1AVAA 4CU7A 3L2LA 2CKRA 4JIEA 4RL3A 1X6LA 5FKYA 4IUGA 4M81A 1CWYA 3WD2A 2ZXDA 4CN4A 1KGUA 2DDXA 2F2HA 3W81A 2CERA 3MUZ1 2VT0A 4AD4A 1PZ3A 4TX8A 1UZ1A 5FCZA 5CLTA 4DWSC 2BY2A 4MADA 1PAMA 1UKQA 2PWEA 1CDGA 1V02E 4UQBA 1GZJA 1VRXA 2ZXAA 1VJSA 4FLRA 3WNLA 2XUCA 4PTMA 2J7CA 4AD1A 1CNVA 2WAGA 3W25A 1E70M 5CSUA 2J62A 4L4PA 2G4FA 1BVNP 1ISYA 3VX1A 3ARQA 2CBIA 1BYDA 1BG4A 2XYLA 4MNJA 1GVYA 3AIWA 3ARTA 3RM8A 5CPQA 4D6JA 1LWHA 2FHBA 3G6MA 5LA2A 1C8YA 1H49A 4DUWA 1G0CA 1C8QA 2VR5A 3UERA 2CPUA 1HP5A 2C8NA 2WBGA 2Z1KA 3RDKA 3WF1A 2WZIA 3FY1A 2YKKA 2NT0A 2JIWA 2CBJA 3BGAA 4AD5A 1XC6A 3VKKA 2CKSA 3SCWA 1J0ZA 1GQIA 4BQ3A 4ZENA 4R27A 1UHVA 1QI4A 4HPGA 2UY2A 2V3EA 1MW1A 1OWQA 3VD7A 4F9DA 1MW3A 1JDCA 1K6AA 3BMVA 2WMGA 5BXRA 3CHCA 4PCTA 3ZM8A 1QPKA 2BY0A 2EPMX 2EPKX 4P8XA 3TTQA 1H2JA 5ABHA 1K9FA 5I77A 3GDBA 3HU7A 4AXNA 3VNYA 3TTSA 3AI0A 3WQWA 1EOMA 4J3WA 2ZUMA 3EBVA 2X05A 4WKHA 1PEZA 1CZ1A 4H8UA 4S3KA 3VM5A 2E40A 1MQQA 2DSUA 2D22A 5A6MA 4UQ9A 3ZJKA 2O9PA 3CZ8A 2G3NA 1IZKA 1DEDA 5I24A 1UWUA 3PTMA 4KRTA 4M24A 2WC7A 3W6MA 4H41A 3TP4A 1GVIA 4QDMA 4W8LA 1FFQA 4M29A 4HZ6A 2B31A 3W29A 1V3IA 1G5AA 1BVZA 4M80A 4KRUA 1MW0A 3TONA 4LYRA 3W4RA 1J0IA 1UKPA 1ECEA 4HMEA 1E6XM 1QNQA 4AWEA 4D6IA 1SFSA 3K8MA 3UR7A 3NYDA 1HJWA 2HISA 1KGWA 1NM9A 3VX0A 3WEMA 2VRQA 1FP8A 3SCTA 1W1VA 1K9TA 2CBVA 4MAVA 1V6XA 3RJYA 3AMLA 1GQKA 1TCMA 2VQTA 5I0DA 4CD5A 3U5YA 1UKOA 1TFVA 1J0KA 5E09A 4QCFA 1Q6FA 5A8PA 2EBNA 5JIPA 3ARWA 3WH6A 3AMGA 1V03A 2XM2A 4BQ2A 3PZ9A 2WB5A 3AHYA 3EDFA 4UQEA 5D9OA 1KCLA 2WPGA 4DWSA 4GI8A 5A8NA 5BRQA 4WF7A 1CBGA 2XJ7A 4ZXOA 1NWTA 4DWSB 1TA3B 1V6YA 2E8YA 4TTGA 3GYCA 3U57A 2OYLA 3A4WA 4UFJA 4UNIA 1E43A 3EDKA 4MB5A 5E6ZA 4XZBA 2G8ZA 4J3SA 4HA3A 1ODUA 2WK2A 3GH7A 1LG1A 4LYQA 4HU0A 5BROA 4XB3A 1UKTA 5D9PA 2DIEA 1DWFM 2A3CA 5C70A 2WSKA 1V0NA 1D2KA 3PZUA 4W8BA 4HU8A 1MVYA 3ZJ6A 4M1RA 4GI6A 2UY5A 1VB9A 3AIUA 5AC5A 1EGZA 1I75A 4B3KA 1UWTA 5A6SA 5IHRA 1H41A 3RIKA 1J11A 1BAGA 5JBDA 3WF4A 4W5UA 1BYAA 1F4AA 4JFVA 3W82A 5CG0A 4CU8A 1W9DM 5E6YA 1AMYA 2WMJA 1C7SA 2E0PA 3BAWA 2OSWA 1EO5A 3WUGA 1QBAA 2GK1A 5AY7A 3SUSA 2GK1B 3BCFA 1H4PA 2XFYA 2VX7A 1XCWA 1HXJA 1V0KA 3K4AA 1UR4A 1W9UA 1FH7A 4WJXA 4U33A 2D3LA 1QBBA 5GNYA 3SCOA 2NSXA 4AZCA 4CCCA 1C7TA 3L4ZA 3GBEA 2Y4SA 4ZE5A 4PSPA 3RCNA 5KZ6A 3MV01 1GW1A 2EJ1A 2IXVA 2IUZA 4A3HA 4AZCB 2J7EA 2VL4A 3ARZA 2WMKA 2C7FA 2JF6A 1UOKA 1V6WA 4JKMA 4UOJA 4TXEA 1H0GA 1UR8A 1CTNA 1MWOA 1AQ0A 3F5KA 1H0IA 2WHLA 4PMXA 4CUCA 2A3AA 2VTFA 2G41A 2J7GA 5A3HA 3ARPA 1GOKA 2G3MA 3HJEA 2JIEA 4HZ7A 2XSBA 1WZKA 3VVGA 1OT1A 3IAQA 4W8AA 1J0YA 4UFMA 1VBUA 1A3HA 3L4YA 2J25A 5LA1A 4GQRA 3SCPA 1CLXA 4UFKA 2VJXA 3T09A 3UG5A 1ITCA 3UR8A 2WVSA 3ZQ9A 2CNCA 1HJVA 4Y7EA 3L4TA 1V0LA 1ZU8A 3BCDA 3M7SA 1G9HA 1E4NA 1R85A 2GJXA 1B90A 4JCLA 1M53A 3A6OA 4U5IA 3W28A 3UG3A 2JEQA 4WSKA 1UKSA 2OWCA 2XHYA 3J7HA 3KL5A 1E1EA 4WK9A 2GJXB 3AHTA 3NCOA 4PMUA 3AMCA 1XH2A 4NF7A 1VEMA 1E5NA 2OWXA 3WDQA 3OZOA 2CIPA 5A6JA 3EDDA 4ZE4A 4OBRA 1XCXA 1GCYA 2XFFA 1ESWA 1XGZA 1QHOA 1W9BM 5AYIA 4ATLA 4QP0A 5A8MA 2CHNA 3QOKA 3AISA 3WUBA 2WM0A 1K9DA 2VZVA 1DWAM 4NSBA 2YL6A 2WVVA 3AYRA 4U5KA 2VZSA 1K9EA 3VGFA 2XWEA 5I78A 1GONA 5M03A 4S3JA 1UQZA 4PSRA 2ZUVA 1PX3A 2WVVB 1HKJA 1ISZA 3L4XA 1VJZA 3VMPA 3ARUA 6TAAA 2VX4A 3VD3A 1JI1A 2YOCA 5FIPA 3WQ4A 1JZ2A 3K8LA 4C7FA 1JZ5A 5M3WA 1HJQA 2W63A 3VILA 5I6SA 1W1YA 1JIBA 5CSYA 2PBGA 3BMWA 1PIFA 3AMDA 4FK9A 4PRWA 6A3HA 1JZ4A 5IFTA 1GPFA 4R5EA 4V28A 5E0CA 3AFBA 3AICA 4YHEA 2Y24A 3ARVA 1RP9A 3WF2A 4D6HA 4GINA 4PTWA 3S6TA 2CXGA 2VC9A 4PTXA 2NT1A 2YL9A 3OLDA 1D7FA 4JFTA 2XVLA 4BA0A 1CIUA 1JG9A 3WNPA 5E0FA 4XV0A 3FW6A 2WZEA 4AW7A 1VEOA 3CZJA 4D1IA 1IZJA 1ZJBA 1M7XA 1AQHA 3VIHA 4JHZA 2YIHA 1JZ6A 3WH8A 2D24A 4J7RA 5BYWA 1B3WA 4PCSA 3RM9A 3VDAA 3SCSA 3LMYA 1J10A 2PWFA 5FL0A 2VVNA 3AS1A 4U31A 5CPSA 3NUKA 4JL1A 1V3LA 3L4VA 1BYCA 1QHPA 3WSUA 2YDQA 2X0HA 3AXHA 3D3AA 1KCKA 4GIAA 1GHSA 1CYGA 5JBEA 5D9NA 2DSKA 4B3LA 3AIEA 5CJ5A 5A95A 3T2PA 1V3JA 1HKKA 1WO2A 2VRKA 2QMKA 1WKYA 1E6QM 1UQYA 1OGBA 3NJ3A 3L2MA 1E6RA 4F66A 3BLPX 3OG2A 2XSAA 1EO7A 3N15A 2J78A 1J9YA 4A3YA 4J3TA 1KQYA 4JZ5A 1UH4A 1B3YA 2V5CA 2WMIA 1JFHA 3KL0A 1ISWA 1CENA 3WNOA 4EK7A 4B16A 3L4UA 4NI3A 3MUY1 5CXPA 4WKAA 1BG9A 2PBOA 2E9MA 3ARYA 2WMIB 1YQ2A 2YA2A 2X1IA 1NOWA 3ZT5A 4D72A 1GOMA 1NP0A 1PJ9A 5LA0A 4FLQA 4PMRA 4M56A 5DT7A 2JE8A 1C90A 2DEPA 4GI9A 1VFMA 1OIMA 4ML4A 1CEOA 1EHAA 3AROA 3BSGA 2GJPA 5IHSA 3VMNA 5GPRA 3MSGA 4FF5A 2BY3A 3CUFA 5BRPA 3AZSA 4AIOA 1UD4A 4QCEA 3POCA 2CCRA 1OINA 4AZBA 4XX6A 1B2YA 3F5JA 3PTKA 1I1WA 3RJXA 5DFAA 3WH9A 3IK2A 4JL2A 2QLYA 3PZQA 1V6VA 2ZWZA 4PYSA 3K1DA 5HPCA 2J79A 1CXEA 5I2UA 1XSKA 4AIEA 2ZXQA 4LX4A 3W24A 1PPIA 2YLLA 3CUJA 1H09A 5D8WA 3S2CA 3D5HA 3UESA 4P7RA 2XM1A 3WD1A 1ZS2A 3CO4A 3SUVA 4CCEA 5C8BB 4ZEPA 1HP4A 5CPTA
chains in the Genus database with same CATH superfamily
2YZ5A 2D1ZA 3LGGA 1V08A 2GYIA 3GZ3A 5HPOA 3AYVA 1G7UA 2ZUNA 1B3VA 4LUJA 1JQXA 1C8VA 2OQYA 3VGBA 3VNDA 2BFGA 2CFFA 1FVPA 1QNPA 4ZSTA 3CHVA 2DPEA 4R7OA 3TLQA 4E6MA 1Q4WA 3I65A 4JQAA 3W7MA 1A5NC 4GJJA 1DXFA 1P7TA 4MPQA 3S8HA 1G1YA 2Y61A 1A49A 3WUEA 3GK0A 1MNSA 2V82A 1Q6OA 4GKLA 4O10A 2Z1BA 3KABA 1QNRA 3HZ3A 4WY0A 4PC8A 1TMLA 1YYAA 4RE2A 4L3NA 2PDLA 1DV7A 4LAYA 2NXGA 1C9DA 1K6WA 1Q6DA 1VIZA 5DX7A 5I03A 3PF3A 2X30A 1EUAA 1Z89A 1WCGA 3F2DA 1NF7A 3RGCA 1E4LA 3TFCA 4H7VA 3O8AA 5CBIA 2YBVA 3GHUA 2M08A 3E0FA 1UWRA 2BGNE 4LY4A 4HIBA 4GMEA 2YW3A 5F2IA 4UDMA 4XZMX 3RO8A 4HN8A 4IWWA 3T2QA 1RJRA 1XRVA 1SUXA 4RW5A 1DKWA 1SO4A 3U2OA 1DJWA 1I1XA 1IF2A 1CXFA 2ZQTA 4NI8A 4MFDA 3B03A 2O55A 3BDKA 4M6UA 2RUQA 3KDNA 2E1DA 4PMYA 2OGJA 2G95A 1H63A 3ABSA 3DBNA 4FALA 3SBFA 3D0CA 5HT1A 2WVTA 3QGKC 5BW6A 3THQA 2ZXBA 4FO4A 4PMQA 5E0KA 4R9OA 1CPUA 2ASHA 3VUSA 3PC0A 1P4CA 5G1MA 1Q4NX 3CIVA 4DLFA 4DO5A 2CLEA 2X16A 4DRHA 1B3XA 3CT7A 3A4JA 1EP1A 1ZJIA 1F4HA 3WQDA 4H1ZA 2XISA 2Z25A 3EMZA 4Z2IA 1OD8A 1LWIA 2ZTKA 3PWIA 3NDZA 3A64A 1Q66A 8CGTA 1OK6A 1TPFA 3ZVHB 4WLCA 3BICA 4HYWA 3GXIA 1JEZA 1Y0EA 4B4HA 3TU9A 3MHUA 1IYXA 2WMHA 4XAYA 2VURA 4BY3A 1KBKA 2X2YA 3ZIZA 1D9EA 1FDZA 5FF4A 1NFGA 2HQAA 2CU0A 3S1UA 2ZE3A 3HFYA 2VWTA 1VJIA 1H1YA 5EA9A 3SIMA 1EB3A 4M0XA 3T42A 4JTAA 3WLHA 1ROTA 3ZT7A 4DYEA 1XLIA 1O4UA 3A4XA 1T40A 2PGEA 3DUGA 3SUWA 4CQDA 1B31A 1OX4A 3AYTA 2AMGA 4ZB5A 2Z7GA 5F7UA 4RZ6A 4US6A 4R53A 2BDQA 3ARXA 3C2YA 1MXDA 5GJMA 1VFOA 3ABXA 4WJEA 3NQVA 3AAMA 4LYKA 3E3HA 2QCDA 5ABGA 3NPVA 4Y9OA 1W1TA 4UZUA 1PHQA 3TTEA 4RNFA 5K3VA 4L80A 3DHUA 3TROA 1VBJA 3KFTA 2D69A 1G4PA 1X8CA 3GVGA 2XFRA 3GM8A 3QMTA 1AJZA 3NSMA 4M6QA 1QI3A 1V3KA 1VBRA 3WY1A 1BGGA 4I7WA 2VFDA 1EJWC 1W3NA 4TIMA 3M0HA 4UTWA 3M0YA 1ZLPA 3H9RB 3URAA 3POHA 4C6OA 1FH9A 4Q4KA 2BZNA 4NYYA 2GVLA 3NQ2A 5A8QA 1HFBA 2RJHA 4C6KA 2D73A 4Z0SA 4IOTA 3HMJG 3KCLA 4L9YA 3IWPA 5C0QA 4GZEA 3WNKA 1QW7A 3WJXA 3G0XA 4KRZA 1K7EA 3EWBX 5E70A 1BRLB 5AKQA 4W9QA 1A5KC 2AKZA 3LHZA 3W83A 4URIA 2O7SA 3RX2A 3APGA 3LD5A 3EWXA 4K36A 4I9TA 4MHBA 4C7GA 1NFPA 3CAQA 2ZZ3A 1XYMA 1HIZA 1HT6A 4MYXA 3VGHA 5A2CA 5CZ0A 3W37A 1NDVA 1U1UA 4NZ1A 4FIRA 3NR0A 4XUGA 3OQEA 4O8RA 3O9NA 5K2ZA 3UG8A 3C2RA 1EC8A 1WA3A 1PDZA 2PSNA 2OQLA 4JY8A 5EMLA 3SN4A 2PP1A 5DMLA 1FWBC 3DGBA 3Q37A 4QDWA 4E3VA 1OFBA 2I5GA 1JF5A 3SEPA 4YVPA 1PIIA 3QPYA 3TNOA 2D0GA 4V15A 3MCMA 4AZHA 1MUCA 1VYSX 3B4YA 5G1YA 4FLSA 4GIRA 4F2UA 4MZ1A 2J13A 2TRSA 3G0UA 2J75A 5AC7A 2BP1A 5D2YA 3N18A 3FYPA 3NPXA 2ZX5A 4NVTA 3ZVIA 2JF7A 7CGTA 1NDZA 5BOFA 4AZ7A 5I3DA 2WSYA 4G56A 2V5DA 3GB6A 4E4UA 2HPIA 2OZ0A 4PN2A 1J5SA 1VFLA 2OXNA 3ZJ7A 3U7VA 1DVJA 3N34A 3QV7A 3TLLA 4JX6A 1JXJA 4AVNA 5REQB 1PWLA 4IM4A 4MYAA 2W61A 2YXOA 3FHQA 4YWIA 2BHUA 3TW7A 3TCSA 3C6CA 4XIMA 1JNEA 4UFLA 1M5YA 1CT5A 3NZ1A 3UQBA 4KCVA 2OT1A 3FN9A 3OHMB 3AS3A 3S9IA 3HG5A 3QY6A 2R82A 5D4YA 1SVDA 5HNNA 1VYRA 2PTZA 3UZYA 4YPJA 3WBWA 3W70A 5FF7A 5AOUA 3IIZA 1XC4A 4BR1A 3MSRA 2VELA 2QCEA 3ZR4A 3P67A 1AW2A 3ZO9A 3EEGA 1QK0A 2NV1A 4FIQA 1YNPA 1E6NA 3F2CA 3IK4A 4E8DA 5A6KA 2ZX8A 5KZMA 3LQGA 4JIPA 3MS8A 1UR1A 2YCIX 5A5WA 2Y5SA 2CYGA 2ZZ2A 4CKQA 3UJ2A 1JNTA 5AB3A 5LXXA 3DHPA 4PUEA 3M6YA 1W3IA 4ODNA 3MJYA 3NNTA 4RNHA 3NQ6A 3ONCA 1WZLA 4FN2A 1PKMA 4EP8C 1BQCA 2YBTA 4J28A 4PL2A 1ZAHA 4E8CA 3EMQA 2KGJA 4RLIA 3NRKA 3WL0A 2CITA 3LCGA 5AHEA 1SMAA 2OT0A 4ZL1A 1VPQA 4AYSA 2GVGA 5HMDA 1VENA 3REQA 4PMDA 1XLJA 1B0IA 1YTDA 5LYRA 1RH9A 5HNRA 1WBJA 1PHWA 5M5DA 1BVWA 1SFJA 1R7AA 1E51A 1YXDA 3SECA 1EDGA 3WNNA 1VLIA 1EXPA 3VZZA 4HOZA 2VXNA 5AYYA 1P0DA 3CL8A 1Z48A 2WCGA 4KGLA 3O15A 2E28A 1PYFA 1XLGA 2J88A 5GNXA 3UETA 1E72M 4KGJA 3BH4A 3UCCA 4R85A 2YL8A 2HNHA 3OOQA 1W3HA 3PFMA 3IGSA 3GRIA 1AODA 2FKEA 4OU1A 4W7VA 4Z2GA 1BYBA 4HP5A 4W84A 1Q1CA 2FH6A 3O5QA 4UR8A 4UTTA 1BTMA 1GOOA 4X2PA 2V3DA 2W62A 2PDWA 3GC2A 3AHVA 3TJIA 4XVEA 2YA0A 1IV8A 4FNQA 2UV8G 3RCMA 4Y9NA 1AJ2A 1KRBC 1KXHA 2PV1A 1LRNA 3RLGA 3I3DA 3WH5A 2BOFX 1LDCA 2PRLA 2K8IA 1T5AA 3BOLA 3BG5A 1R2TA 4PCFA 5CLWA 1HX0A 2PAJA 1YE6A 3TW9A 1P6BA 4AG0A 2EO7A 2NW0A 1RBOB 2ICSA 1MUWA 5CGQA 7REQA 2KE0A 1QO5A 2XP3A 3P3BA 1UJPA 4J3XA 3N6HA 2VOMA 4ZS6A 2GJNA 3TJLA 4MLJA 2A0NA 3AO0A 4RE4A 2XVKA 3O5KA 1QI2A 1M6JA 1R38A 4GC4A 7TAAA 1H5VA 4QLKA 3TC5A 4YTUA 1T8QA 4EXQA 3KAGA 1RHCA 2XSXA 1WYIA 3WK1A 1XF0A 3S1GA 3MW7A 2FZ9A 1C29A 4Q8VA 1M04A 3QF0A 2DG4A 3PA7A 2PDKA 5FA5A 3M64A 3BO9A 1R5YA 3MZ2A 1F74A 4FXJA 2HJPA 3A24A 1L8NA 3IJ8A 3GUWA 3AXXA 2Y88A 5AHIA 3C2EA 1RLDA 4L9XA 3WLOA 4TMCA 3MKVA 1XXXA 1ONEA 3MV11 1XH0A 3AWNA 4U3CA 3VD9A 3G0SA 1B3ZA 2RGLA 2DSWA 3UEQA 1GJPA 4F0RA 4QRNA 2I9UA 3EB4A 3PHAA 9CGTA 3S2NA 2XIBA 3W1XA 1OM0A 4JIRA 1KR0A 4HNLA 4HVXA 2XPKA 3GNPA 5E5CA 1ZALA 4PEKA 4D8LA 3AXIA 4NY2A 3HB9A 1EWDA 2WC3A 1KFLA 3AS0A 3N29A 4K8EA 3U7BA 4ZMGA 3GU2A 4O1DA 4DI8A 4E2OA 3PPFA 3GSMA 6REQB 2QJJA 4AC1X 1P5BA 4DEFA 1XL9A 1TR9A 2I1OA 2XH7A 1US2A 2Z1WA 4X2RA 4IZGA 2FVLA 2XVPA 2I16A 3CO8A 3OLIA 3Q45A 2PGWA 3Q67A 5EMYA 3E49A 3PAOA 3LY0A 2WJEA 5C5YA 3CIXA 4AZ6A 1JGMA 2Z6IA 3CMJA 3T6CA 4UOZA 3G1HA 1OABA 5EBAA 1ZBWA 2NUWA 3BPWA 1XYAA 3OZPA 4HZMA 3GO2A 3UFYA 4LNYA 4DAFA 1CGTA 5JUVA 1DQUA 4AIUA 3MA8A 4JTTA 3VIOA 3O6YX 3AQUA 2TAAA 3W1TA 1XBZA 4PTNA 4B2DA 1DJNA 4DZAA 2VCDA 3GU1A 5KINA 3R89A 1VF8A 1Z44A 2GGIA 1EEXA 3LN3A 4Q22A 3T40A 1M03A 2BHZA 4FNTA 3RXZA 2E9LA 2IXUA 3OIHA 2Q3OA 5BCAA 3IIXA 3ZR5A 4HHMA 4GXWA 2OTDA 1FKSA 4LEFA 4O4WA 3S1VA 4TNSA 4IXHA 2VX5A 3UPWA 3O5GA 3DFSA 2QNEA 3M5XA 3W86A 4X3ZA 1TUXA 1Q5MA 2PU0A 1AW1A 3V0SA 3LCWA 3C2OA 3VIMA 1V3MA 3F4NA 3S5OA 4WSJA 5I3GA 1OC6A 4AHPA 4OOUA 5L6UA 3DH7A 1DQXA 2IQDA 2BNJA 2AQWA 3LRMA 1A5MC 1ML1A 5G4HC 1EQCA 3GQYA 2EXOA 3W7GA 3O6CA 1MO0A 2X41A 2BSLA 2GUBA 1F6PA 2PWDA 3W2MA 3VIPA 5GPGA 2J24A 4HKPA 3THDA 1F73A 4C7DA 2D3NA 1E6SM 1XSJA 2DW7A 1JCMP 3WDIA 3AXKA 3WJWA 3IIVA 2Z2BA 4PCNA 3WFLA 4ODKA 1EC9A 3R94A 2W6RA 3B4UA 3NTPA 4IIEA 1FKGA 3H2AA 4QM1A 4XWUA 3ALFA 3MVTA 3KEHA 2J7FA 3LERA 4MJ4A 4F8XA 3QW3A 4ZBCA 3B7XA 1TRIA 1S38A 3CS2A 3OGVA 3IJQA 2WHKA 4AEFA 3FKRA 2F38A 2W4XA 2W0UA 1X6NA 4JIQA 2VDIA 4GRSA 4GXMA 5C9WA 5DXXA 4I6KA 5G4EA 4NAEB 4IISA 1TVNA 1ZAJA 4LS0A 5I3HA 2MPHA 1A5OC 1XM3A 3CZLA 1Q6UA 1X1OA 1F5ZA 4AZIA 2B7OA 3ARSA 5CPLA 2P88A 1FWSA 3T0AA 5CH9A 3DG3A 4I90A 4MLRA 3ABQA 1D7IA 4P7NA 3KS6A 2WHMA 4HMDA 1DIKA 3AOFA 1JI2A 5HK4A 4Q6XA 1HO4A 4IMDA 1WXJA 2F8QA 4OUEA 4JFIA 5F4XA 3R1ZA 5EMUA 4UQAA 4X9YA 2HWGA 2OWWA 3W88A 3QGAC 1YTKA 5F4SA 1PX8A 1UD2A 3F4DA 1H60A 3UGRA 3O6AA 1XLKA 5M17A 1KTNA 1GTEA 4FXSA 1WXYA 1B5TA 1XBVA 5LIWX 1X8FA 4MPKA 5C9UA 1FKLA 1M7PA 3F2BA 2Z6JA 2PDUA 3H55A 4QLJA 4IFOA 4DRQA 3TA9A 2VFGA 1JPHA 3B06A 3MHGA 4DJFD 2YCEA 3HURA 2H90A 4FHAA 1ADDA 3NQBA 3A47A 3UXIA 5LIKX 1XV8A 3BG9A 2G50A 3EX4A 3KZSA 2MLZA 3GDKA 2CHRA 3TN6A 4Z1AA 3RU8X 1C91A 4C6EA 1YPFA 1O6IA 1DPMA 1Z3NA 3QSRA 2FJUB 4TMBA 3N6JA 4Y8EA 3UCQA 2HMCA 1J5TA 4G1KA 4Z0JA 1JJKA 4Q4QA 1AVAA 5J04A 1KBLA 3T44A 4JIEA 4TV6A 1X6LA 2PPOA 3LXAA 4M81A 1KGUA 1NTHA 3MUXA 1W5PA 2F2HA 3W81A 1TCDA 1EJTC 1PZ3A 4TX8A 2ANUA 2H3BA 5CLTA 2AL2B 2BY2A 3EX6A 4Y90A 3GXPA 1OCJA 3AWOA 5CBJA 2PWEA 1PSCA 4LT9A 4C91A 5EMJA 2GZXA 4DNHA 2VGFA 4DAIA 2V5KA 1VJSA 4H9UA 4FLRA 3WNLA 2XUCA 5AFDA 2WAGA 5FJPA 1UWAA 3N2XA 4XTDA 5KTLA 2XPAA 2G4FA 1BVNP 2PV2A 4Z42C 3AALA 3IJIA 3UI5A 3C86A 2Q09A 3QC0A 5AHFA 2IMRA 2CXEA 3ARTA 3UA4A 1PZ1A 2A2IA 3RM8A 1LWHA 2P3EA 1R3SA 2OG9A 1GOXA 2X7WA 4DUWA 2PTYA 4XD3A 3IHZA 2CPUA 4RR4A 2LKNA 1MDRA 2C8NA 3KZPA 5I98A 1BXCA 2YKKA 3EOLA 3H7UA 2JIWA 1XC6A 2OJPA 3W6YA 3O5IA 1GQIA 4IPJA 4NAFA 1NDWA 2WQDA 4QQ3A 4JTLA 4I5UA 3L23A 1US0A 4GY7A 2OZTA 3GUGA 1OWQA 1FRBA 4ZZ9A 1KM5A 1W8SA 2WMGA 4UMAA 2FB2A 4F3HA 2HNEA 4PCTA 4AQLA 5D2VA 1QPKA 3PNZA 3UCDA 1K9FA 3V16A 4NIRA 1XUUA 4TW7A 1TUFA 3R11A 4ES4A 2VEIA 1PWMA 3TTSA 3WQWA 1Q2RA 1QWKA 4WKHA 3MYOA 1ZUAX 1PEZA 4H8UA 4ZTXA 4WDXA 1IR2A 1X98A 3V75A 2O9PA 3ZJKA 3CZ8A 2G3NA 1L2QA 1IEVA 8TIMA 1J6PA 4FR1A 1SJBA 1TMHA 1AK5A 3NGJA 3ATYA 4D8ZA 2G97A 3KTCA 4ROPA 5TAOA 3MVIA 3GIQA 3ZXWA 5D2XA 4HZ6A 2BG5A 1EZWA 4N7QA 1IX5A 1FKRA 3O3RA 1UKPA 2GWNA 4EOUA 2QYGA 4RZBA 2FYMA 1ECEA 4HMEA 4L9ZA 1E6XM 4AWEA 1HJWA 4MWAC 1WX0A 4FNRA 3INPA 1M3UA 4F48A 1KGWA 4JDYA 4LANA 3QSTA 1J93A 1QUMA 4XQ6A 4I9JA 5EMKA 3QH2A 1VQTA 3TN3A 1QR7A 1ICPA 1QXLA 5D2WA 1TFVA 4PBEA 1I0DA 1Q6FA 1Z6KA 3VXGA 5A8PA 2Z26A 5J6EA 2TSYA 4JXCA 4ONVA 1V03A 4N4PA 3SAZA 3M0ZA 2XINA 3EDFA 4UQEA 4NHVA 4BWLA 5A8NA 3B8VA 1CBGA 2PD9A 2Y89A 4S2CA 5BU6A 1TPC1 5F1VA 3ABZA 3P8IA 5FJJA 2JKAA 4DY1A 4XK2A 1RV8A 3W7PA 1MZRA 3U57A 3TYUA 2GQ3A 4UFJA 3UWZA 2ACUA 1E43A 5HTGA 5E6ZA 1H50A 2G8ZA 2BOGX 4AVOA 2SFPA 1ICSA 2CLHA 5BROA 5HINA 1UKTA 4B5VA 5D9PA 1XFCA 4HU4A 3KTSA 3NQEA 1EJUC 1AG1O 2Y7DA 1D2KA 4U10A 1XBYA 3PZUA 4HU8A 2DJXA 3EX1A 2UY5A 1F07A 1A0EA 1I75A 1ZHAA 3ANUA 3KRSA 1LP6A 1Z41A 1N7KA 2FVMA 4KS0A 2J9YA 4DI9A 1M7OA 1WUFA 4CU8A 4JTDA 4ZQRA 1J79A 1C7SA 4ZPTR 1TREA 1GVSA 2F7FA 1S3TC 5F1UA 4JNZA 1YEYA 3LSCA 4IICA 1H4PA 3VOFA 1Q6HA 1XCWA 4QROA 2FPVA 4WJXA 4LVFA 1OYBA 2D3LA 1QBBA 1QO2A 4U33A 1A3XA 1IIGA 3UNDA 4L61A 3SCOA 4AZCA 2ALDA 2QULA 3GBEA 3VZYA 4PSPA 3RG6A 1SQ7A 1ZP4A 4AY8A 3MDUA 4RDZA 2REQB 1JCTA 3TYZA 2VL4A 3CK5A 4Q3MA 3G1DA 4TXEA 1M9HA 3K30A 3UWYA 1OC5A 3EOSA 3P5ZA 2ETNA 1MWOA 1H0IA 2Z1VA 4CUCA 2G41A 2OU4A 4DX3A 3ARPA 1GOKA 2JIEA 5I3JA 3R6IA 4HZ7A 1FQ0A 1WZKA 4KWVA 4RJEA 3P81A 2OB3A 1AZ2A 1J0YA 4MKSA 4UFMA 5KMYA 1A3HA 2J25A 4WX2A 1LOQA 3SCPA 4WR3A 1CLXA 2Q8ZA 4UTKA 4ZB2A 4IMGA 3UY7A 4DRMA 5FJRA 2CNCA 1NMWA 1V0LA 1ZU8A 3M7SA 1G9HA 4DJEA 4H6RA 1E4NA 2DZWA 3KLLA 1QAPA 2GJXA 1I45A 5HMEA 3KCJA 4PULA 4IF2A 5JU6A 2OWCA 2XHYA 4C5ZA 1AW5A 1VHNA 2QUMA 4POCA 2E7FA 1T6MA 4S39A 5CPMA 3LMZA 3WDQA 2J66A 4Y9PA 4IG2B 4PUNA 5A6JA 3SQMA 3LTYA 1VBGA 3CWNA 4KBXA 3SGGA 4JOMA 2FFIA 1LOSA 1FCUA 3QMRA 1SSDA 2XFFA 2DZPA 3MUCA 4YCPA 3QOKA 1GYNA 2BB0A 3WUBA 2WM0A 3B3DA 2VZVA 1DWAM 2GSHA 3AYRA 1TCOC 4B2DD 3VGFA 1GONA 3NA8A 2ZRUA 1JPKA 1H5YA 1DIEA 3B04A 1HL2A 1SR9A 3LLDA 3ITXA 1OFDA 3KCEA 4JY9A 2AGTA 3ITLA 3VD3A 2V69A 4B5TA 4LAMA 1PCWA 2YOCA 2Z2AA 3K8LA 4C7FA 1NMVA 3KUMA 1W1YA 2MLYA 2CLKA 4AWUA 1JIBA 4MMWA 5CSYA 3BQ6A 3WCZA 4G9PA 5EPDA 3LSBA 2PLMA 2NVCA 4ZR8A 4CQAA 2PDYA 1I8JA 2VC5A 5E0CA 1ADOA 1RP9A 2RAGA 4D6HA 4DBWA 1I60A 1OZMA 1QPQA 3T9PA 2NT1A 4F0HA 3E5PA 1JG9A 3UP8A 5EY5A 2WZEA 3R79A 3FA3A 3LA4A 4DROA 3CZJA 4Y9MA 1ZJBA 3KVMA 1M7XA 2GGGA 2Y8UA 3H7RA 2AQOA 1HW6A 2E5BA 4IFKB 2QXWA 2QCLA 3WH8A 2OVLA 2XIMA 3CAVA 2D24A 4J7RA 1B3WA 5F2LA 3TC6A 4DH0A 3SCSA 1S2UA 3LM3A 1AH0A 3LMYA 2CZ5A 2PWFA 4LVGA 4JIIX 1MXSA 3TH6A 1V3LA 3LZ5A 3L4VA 3RCYA 4GYPC 1KNWA 3WSUA 4J35A 5FEWA 1I2PA 3TUUA 3BANA 3WLJA 5D9NA 2KO7A 2DSKA 4B3LA 5A95A 4AAJA 1EEPA 3AXMA 3RNDA 3QLDA 1WO2A 2VRKA 1IXQA 3CPGA 3G24A 1OGBA 2VD8A 4JDBA 4NKCA 3N15A 3PSWA 2TYSA 1KQYA 1UH4A 3QXBA 4G50A 4MUZA 1DJQA 2WMIA 3KL0A 3PBVA 4LAVA 3WNOA 3USBA 3ZFHA 1F05A 1F3TA 3L4UA 4NI3A 3SADA 4ALDA 3PUOA 1BG9A 2PBOA 4B5UA 3RO6A 1YQ2A 2X1UA 2YA2A 4FNPA 4ICMA 3UWQA 1GOMA 1I2NA 4PMRA 5DT7A 3O5MA 2JE8A 4PUMA 4GI9A 4ZB0A 5MF5A 1XQLA 1YDVA 1XRFA 5CC7A 5DQPA 3K5XA 4QEEA 5IHSA 5GPRA 3C2FA 4QCEA 5J5DA 1M1BA 1O94A 5DFAA 3WH9A 2A7RA 2ZR4A 4PYSA 1XKYA 4M7SA 3FOKA 1CXEA 3GLCA 2ABAA 4YLWA 3FV9A 4AIEA 2ZXQA 3PANA 1PPIA 5XIMA 3CUJA 1H09A 3BCJA 2XFWA 3W1QA 4LC8A 3TR2A 2YZRA 2QJGA 4JTFA 3CO4A 1FWRA 4CCEA 2IW0A 2QEZA 5C8BB 4MIMA 1ZK6A 4GACA 2WKJA 3H26A 3SUUA 2GDVA 1PUDA 3TDBA 2BS9A 4B90A 4J27A 2DT0A 1IHIA 6ALDA 1YATA 1U83A 2OKOA 3EB3A 2CC0A 3QYQA 4JX5A 4GGBA 1KLYA 1UR0A 3BAXA 8RUCA 1VFFA 3P74A 2M1IA 4YS1A 1Z69A 3WIJA 4RDVA 3S46A 1ZBCA 2W3ZA 1U1HA 3SCNA 2E67A 4A3RA 2INZA 3HMCA 4NP7A 2Y70A 2BHYA 4UB9A 1EYWA 1XIJA 1XCFA 1EIXA 3SSJA 3B9AA 2C19A 2RFGA 5D05A 2JGQA 1VEPA 4TX6A 1UP0A 3H22A 4H01A 1XHGA 1LQ0A 3I3BA 1P7TB 1Z9AA 3IGUA 1EFZA 1YDOA 5FJUA 2IPGA 2GVJA 2VCAA 4N9CA 1JVNA 4PH6A 3T0DA 3B0UX 1IEXA 2NV2A 3UQIA 3NWRA 1X1NA 2BVDA 4K37A 4ZA0A 3ZR6A 4WY0B 2OSYA 2CBUA 2WW5A 1E5JA 4ZQNA 1XUZA 1AQFA 2XIIA 3BAKA 5B7YA 4CU6A 3R10A 1FCBA 3I4KA 1GG0A 2R14A 2GDUA 4Q8MA 2HK1A 4XSMA 1HJSA 1ZCNA 1W3JA 1JAKA 1W5NA 3W87A 1LT7A 3IKDA 3LHYA 1IT0A 5C55A 4GIYA 3S2JA 4A8RA 4C1KA 3S3GA 2J8FA 1QU4A 3SO7A 3GXMA 5T9CE 3CHEA 3LPPA 1U30A 5KZEA 1TV5A 3UU0A 2VDGA 3VOJA 3SRFA 4N6EA 3OBAA 3TYAA 4P2VA 3CIWA 2ZQSA 2B7QA 1DP0A 1O66A 2XH2A 3BWWA 1AL7A 4C6BA 1D3HA 3UG4A 4QX4A 4I8YA 4M6VA 3QC3A 2VCBA 2ZWYA 5BMXA 2QCFA 5TNVA 4G7FA 1OEPA 3MYPA 2O7QA 4C65A 3N12A 4F9JA 3A4AA 1TVLA 1OG0A 2NQ9A 3RK8A 3CHDA 1VAHA 3GC5A 4JTQA 3OP2A 3WFZA 1PTDA 1TJ0A 2VX6A 2IPJA 1JR1A 2KZHA 3V5OA 1EJXC 8A3HA 4JYEA 1Y7VA 1Y5VA 4KFNA 2XP8A 1E4MM 5LIUX 2FKPA 4DO4A 4DBUA 1TYGA 3P84A 5EL1A 3SW6A 3W9ZA 2P0IA 3ZLFA 1A5UA 2GGHA 2JALA 2WCAA 3AZRA 3U2EA 3NO3A 1VHCA 3WJZA 3QHNA 2NX1A 3G1SA 3ZS4A 3TMQA 1JDEA 4NZJA 1RALA 1HTIA 1NSJA 3E2SA 1OCNA 2NVDA 1V3HA 3WQGA 2IPFA 3T55A 1UD6A 1GJWA 4LQ1A 4NU7A 4LRSA 2D0FA 3EA1A 4YXGA 1TJ1A 2CETA 1K8YA 5KEZA 4GO9A 5AC4A 2YDRA 1DL3A 1N8WA 2WLYA 1S5TA 4MJ2A 3O5OA 3W7KA 1C9WA 1OX4B 1B3OA 1TSIA 2FH8A 3IUIA 5MKGA 1E71M 5CJNA 3BW2A 3PK7A 2XVNA 2QHAA 2ITKA 4IQLA 3W38A 3HN3A 4LUTB 2QCDB 3B9NA 3VYLA 1QOPA 4KEUA 3QFWA 4UTLA 3O5EA 2G3IA 3WF0A 1GQLA 2GJRA 1NIUA 4KFOA 2FIQA 1Q7MA 2XU2A 3KCOA 3G1FA 5AHNA 3DAQA 4WDUA 4M51A 3KAHA 3CXOA 5HWBA 1IWAA 3O0KA 2WNWA 5T26A 1WNOA 1UA7A 3GXTA 5FAJA 2V5LA 2V3GA 2R8WA 1UG6A 4NQ1A 3CH9A 2VFHA 2VZUA 3MI6A 3HG3A 3Q4DA 4WSHA 4J1OA 1TIWA 1YXYA 4YN5A 2YX0A 2WHJA 1CXIA 4GLEA 3CB8A 4MDPA 2DZAA 3LCXA 1BSLA 1WDQA 4GQGA 1KGXA 2HBXA 3LPGA 3SM0A 3SURA 3CM4A 5CCZA 2UWFA 3A12A 1SM9A 4NXKA 3B0PA 4V33A 4MB4A 4KQNA 5LNUA 4O16A 3MKKA 1JYXA 1EDTA 1FOBA 1DE5A 1SMDA 1HKIA 3H6OA 4QNEA 2YB4A 1OSEA 2C79A 3W26A 1W9VA 1V6UA 2XGZA 1E4IA 3B0XA 1KBJA 5EFDA 2PPGA 2ABBA 1OC7A 1WDRA 3V18A 1E6ZA 5CSSA 5BXTA 3STPA 1R3QA 1XYLA 1SFTA 4AY1A 1DXIA 2E09A 3BLLA 4HA4A 1K1DA 4K7VA 2I5QA 3HPAA 4HCDA 4H8HA 1OFAA 5EU9A 1EQ3A 2QJIA 3DI0A 3G1XA 4QNWA 4LFYA 4PRRA 5FD0A 5JVLA 1IZCA 4V27A 3O5FA 4DBDA 3TR9A 2OZ8A 2J8GA 4W89A 1XISA 1SYTA 2YA1A 1R47A 1TZ9A 3DGRA 3QVQA 4DRIA 2O92A 1GQNA 3AS2A 2FHFA 4QGCA 2Z28A 4ZFMA 4QE5A 2JQXA 1BKHA 1G4SA 1ZGDA 3O5JA 3GZAA 5J5RA 3R0UA 4WXYA 3USZA 3JZEA 4OBTA 4U2ZA 2VP8A 3N1AA 4HNOA 4D6FA 6CGTA 2J27A 5FL1A 3U2CA 4IIGA 4XO6A 2OO6A 4N02A 4MAZA 3N4AA 2E3ZA 2Q8LA 4QT3A 2PLKA 2DZUA 4F0SA 1VKFA 3VOCA 3VE9A 3HGRA 4PB4A 3VIGA 3MI3A 4JFWA 3JR2A 3LQLA 4Z1CA 5DCEA 2ZA1A 1JQVA 4PUDA 4XBSA 1RVKA 2WWDA 1BKFA 1E3XA 3G1RA 1JZ8A 1ITQA 1LL6A 2QZRA 3P5YA 1H7NA 4O0QA 3THAA 4CNPA 4FB7A 3WJSA 3OODA 4AD2A 1IQ8A 1F8IA 4YTQA 1KFKA 2OSXA 4F0MA 3PZIA 3R8GA 3A22A 4N2YA 1TVPA 2FZDA 1EIBA 4BF8A 3UVIA 5CAKA 3BJSA 3LRKA 1I4NA 1A47A 5L9FA 3KDOA 2FMNA 4PMZA 4HQVA 4O8AA 1CXLA 5DXYA 3QRHA 4ODPA 4IFRA 3PVFA 5HBFA 4H7ZA 3VIKA 1LBLA 5BNKA 1CXHA 1JDAA 4FS9A 4H9VA 4XBJA 3SR7A 3WO8A 2GL5A 1TV8A 3M0IA 1FWTA 5AHMA 2EQDA 4GZJA 3T0TA 1W3LA 1LQAA 4DPQA 3GIPA 3R13A 3GH4A 1XSIA 5DIUA 1W37A 3AJ7A 4Z2LA 4QJ3B 3LUOA 1JAEA 3QGVA 3REQB 3VKJA 3QQWA 4L64A 4KPLA 3BMXA 3AZTA 3VC6A 1RPKA 2YDSA 5H8PA 1QK2A 3OGSA 2QDEA 3PG8A 1UWIA 3FHAA 1BSIA 4HK5A 5BZAA 3A9BA 3SZ8A 4HARA 1P0NA 4CN1A 1J01A 3LHUA 3SY1A 3SJ3A 2E9BA 2VEPA 4BQ4A 2VZOA 4P8VA 2VC6A 3C8FA 3C4UA 2Z1SA 1UIOA 2QV4A 3IPWA 3TC7A 2DORA 2VC7A 4DIAA 1GQJA 3E1F1 3VIFA 3WQEA 3MWAA 1RCXB 3WQ6A 1D8WA 4GBDA 5A6AA 1XQKA 3ELFA 3KVJA 1EX1A 3HGOA 3VNJA 4YMZA 4J2MA 1QNSA 2OFNA 2HVMA 1OFOA 2H9AA 3U48A 1HKMA 4MY1A 4IMFA 4W5ZA 4X9SA 3MP3A 2OLAA 5JH1A 4QZVB 4EKJA 1A53A 3UZZA 3TSDA 1PXGA 1FFRA 4DHGA 2XIQA 3E38A 3B9DA 3VO0A 1ZNNA 1DYSA 4GGHA 1ITUA 4UR9A 1XLDA 4CD6A 1MNZA 2WVUA 1MZHA 3LUTA 3FVDA 3SFKA 4D6DA 1TPVA 3B0VC 4K8GA 3CQ0A 4CLMA 1Z8AA 1LORA 3VCRA 3BAIA 4TVDA 3M5YA 4AISA 5BWAA 4NJIA 4LBSA 4L6OA 5BMWA 4ZCWA 2GOUA 1X38A 7REQB 4IP5A 1AH3A 3TMLA 3CEPA 4IH3A 3E2VA 1V4YA 2ISDA 1UWSA 3IIPA 2IKIA 1XYZA 3H2OA 3C8NA 1UZ4A 4OUIA 2QIWA 4XUYA 3L0NA 4Z2KA 1EDQA 4O0KA 3E0IA 3WMBA 3AIBA 5A6TC 4Q8OA 1X6UA 3F4VA 3N9KA 4AWSA 2RDWA 2P5NA 3APTA 3W2NA 1EWEA 3L0KA 2RUDA 3UY8A 2DQXA 2EKGA 2GVYA 1L6WA 3QR1A 4JTCA 2HDJA 3IK8A 1CGVA 3VMOA 3LK6A 1G7VA 2D23A 2XN1A 2Y7EA 4LBUA 4H00A 5LGZA 2YW4A 4QG6A 3LLXA 3QPEA 2PUZA 2F21A 3KP1A 4QAWA 1YBQA 2EKCA 2WWCA 2C18A 3TOYA 4W93A 4ZOBA 3SQSA 5FJOA 2A85A 1TPWA 3BQ5A 3MTWA 4S2BA 1VD6A 1VYPX 1IWPA 1BXBA 3MMWA 1K8CA 3O6DA 3L21A 5KITA 1O1ZA 1DHKA 1TWSA 1PBGA 3P2VA 3W01A 3HPXA 3KTXA 1B6CA 2PF0A 1D7KA 5G2IA 3O5LA 1V5XA 3ARRA 3HQPA 3COTA 1S46A 2QKFA 2RJGA 4GOAA 1W5OA 2DT1A 4LF2A 5D8ZA 4DJDA 2A3HA 1LG2A 2VR2A 4GCAA 5DMYA 4IGNA 1TPH1 3WG6A 3WBAA 1S3HA 2PWUA 4UIOA 2N87A 1UUQA 1AH4A 1HL8A 3H70A 1KWGA 3VD4A 5I3IA 1G4TA 3GW3A 2XZ7A 2GSJA 1LUCA 1QASA 3ES8A 4JTHA 4WY0F 1IE7C 4CQ9A 4LNCA 2EPOA 3VNKA 3ZJ8A 1BL4A 4TTUA 1HKWA 4Q8TA 3P7YA 4XKYA 1S2AA 1W91A 1RBAA 3I6RA 4Q8NA 5DRIA 5HWNA 1KBIA 5GVJA 4UFHA 3GVWA 1BD0A 1KM2A 4Q8PA 5LIXX 5HW6A 1LRTA 3HPSA 3S2LA 4CNUA 3LBMA 4A2RA 4D2JA 3NQDA 4QITA 2ZTJA 2PS2A 3CQHA 4BJHA 4WIWA 1KM0A 4S3AA 1JYNA 2QCCA 1RJQA 2LLEA 4MSSA 3MHFA 3NQ8A 3IVTA 2O9RA 5DMNA 2VUYA 1IGWA 3C61A 3AHXA 3GNOA 2A5HA 2YXGA 1GHRA 4DZ3A 1W2VA 3CQKA 4IPLA 3MANA 2EG8A 4BI6A 1Q7QA 4CVUA 3K1GA 2YR1A 4MFEA 4NRRA 3CBWA 5DMMA 3CJPA 4PUWA 3BW4A 4HNTA 4HMNA 3TE9A 2LJ4A 1PIGA 3HQ1A 4LC6A 4ACZA 1RQEA 4UNLA 4FMVA 1AUSL 2PRMA 1TMQA 3FAPA 4JFLA 1BKSA 4ORMA 4DYKA 4DRKA 3U9IA 2D2HA 2XGIA 4IHCA 4IPPA 1XIIA 1M5WA 2VVSA 3OB8A 3G1YA 3SRKA 1ZJAA 2VGIA 4E4FA 1H7RA 2X40A 3ITTA 3VPLA 2HEJA 3W6LA 1MQRA 4W7UA 3JRKA 4KH2A 1MFVA 1SO5A 5BXPA 1NH6A 1W1B1 3KOZA 1J4IA 4ADTA 1J0HA 1NOFA 4JQ2A 3BXWA 1GOIA 1EQPA 1NU5A 1GRJA 1E1FA 1NWSA 4YTSA 5ABFA 3S9ZA 5C9ZA 5CJMA 2ZX6A 2QF8A 4FR6A 4CD8A 3U5UA 4FLOA 2WOQA 3WLQA 4UTFA 3KAIA 3ZT6A 1FP9A 2CW6A 1KV5A 3CTTA 4GUGA 5FEZA 4YWSA 2WMFA 1EOKA 2Z24A 3ZYZA 1KFCA 1YPIA 1EH9A 3H4GA 2HVOA 4BQ5A 2QUUA 1LL4A 3M0XA 3E02A 1FA2A 3GTHA 1ITXA 1ME8A 3T07A 4QIUA 1OJXA 5HQMA 4DXVA 3KRUA 1MRQA 1UPPA 4JFSA 3PJTA 3U0HA 2ZUSA 3BSMA 3TC3A 2PTDA 4ROQA 3NURA 1NWUA 1MRAA 3DC0A 5LNRA 4GI4A 2QVNA 2VD9A 3E2QA 5D30A 4X22A 3ABOA 3CWHA 2QT3A 3CB3A 2GDQA 1T99A 3NQCA 3M46A 1TB3A 2INEA 4D6GA 3PZOA 1GEHA 1NVMA 3STEA 2GUYA 3NQGA 3WN6A 3QV6A 4X61A 4JTJA 4EX4A 1TTQA 5K4XA 1L8PA 4P7OA 2A3BA 4B9ZA 1B57A 3W75A 2PPNA 3G5EA 2PDIA 4JQ3A 4MVAA 5DT5A 1B1YA 3MMUA 1J18A 2PZ0A 3DXIA 4J4KA 3STGA 4O53A 1FKTA 3JS3A 3NZQA 3TQKA 4S23A 1ZENA 3IAPA 3A3HA 3ANVA 1KA9F 1A0DA 2DQWA 3PY2A 2HXTA 4S3DA 1VCFA 3WDPP 1O95A 1OYAA 4L65A 2C3ZA 1ZQ5A 1XICA 3OGRA 2DUZA 1GJUA 5FI8A 1OX5A 2WKLA 4JHOA 1QNVA 3VIIA 1N1AA 4CU7A 3L2LA 3C56A 1NFBA 3DN5A 2VEGA 4IUGA 1JUKA 3PBMA 3WD2A 2DDXA 3T4WA 3MUZ1 1GYMA 1E9ZB 2G37A 1UZ1A 4DRJA 2PZNA 4A21A 4MADA 2KX9A 2QAPA 2GGEA 1I2OA 3F7JA 1PAMA 1UKQA 3IJ6A 5FACA 4KW2A 1GZJA 3EEZA 1VRXA 2Q3RA 2ZXAA 2JK2A 3PPGA 1DJGA 1TX0A 3HV9A 4Q33A 5H91A 1OFEA 4PTMA 4BEQA 1CNVA 3OYXA 3W25A 3TEVA 1ZJHA 3BURA 2TMDA 1O5RA 3VX1A 3ARQA 4NZ5A 2CBIA 5BOEA 4MNJA 4KF1A 4JTEA 1BWVA 2ISWA 5GJPA 3H24A 2PN0A 5LA2A 2BMBA 1P5QA 3LS9A 4ZQPA 2Z1KA 3RDKA 3N25A 4C6MA 5TF0A 4JS3A 1J4EA 3E0LA 1YIXA 2WSRA 3JU2A 3SCWA 3TFXA 1J0ZA 4R27A 3NL3A 1UHVA 1FWGC 3GU9A 1GKQA 2HRWA 2UY2A 1E44A 3LCHA 4NAFB 4IT4A 3BMVA 2DZBA 3UQNA 2PMQA 1ELSA 5BXRA 1DJZA 3CHCA 3EB2A 2KI3A 3LTPA 3ZLHA 2BY0A 4E0CA 5ABHA 3CQJA 4Z17A 5LHFA 5LKYA 5HWCA 3D3FA 2F6UA 2HSAA 3URNA 4N9DA 5SWUA 4O19A 4UTJA 1EOMA 4ZQOA 3W3OA 5HKGA 2B81A 4TX0A 3NQ7A 2KR7A 4AHQA 4S3KA 2ZZ6A 1MQQA 2DSUA 4HK6A 4UQ9A 3TVAA 1DEDA 5I24A 1N55A 1R6WA 2NSOA 4IQ2A 3PTMA 3Q58A 3R5EA 4LS2A 3WK2A 4R0XA 3SY8A 1SZRA 4QDMA 4XBKA 1ZPTA 2V68A 3LYEA 2B31A 3W29A 1G5AA 1BVZA 3BARA 4KRUA 1J0IA 2DW6A 3TV8A 1LBMA 2HISA 3B0YA 4LOCA 4QSHA 3V4BA 1P48A 2QUVA 1UUMA 3LI0A 5JH2A 5HWMA 2CBVA 1TJRA 1EC7A 1KM6A 3HM7A 1GQKA 1TCMA 3GG0A 2VQTA 3K4WA 3M0VA 1F9CA 3U5YA 1UKOA 2A6LA 3S6OA 4Q7BA 4NL1A 2ZC1A 3FVMA 1UC4A 1T8XA 4HNUA 5BXJA 5JIPA 3ARWA 5FJIA 1A50A 3WH6A 4HNCA 3UR5A 2XM2A 4L56A 4DWSA 4DQWA 6TIMA 3OO2A 5BRQA 2E77A 5CZTA 1DBTA 4IXXA 1RPXA 3CT2A 4UC5A 1W8GA 1R46A 5K7JA 4JFKA 1TA3B 3P14A 2DJLA 1IXOA 2E8YA 2GLKA 2XP4A 4JR5A 3K13A 2R1LA 3EDKA 2CLIA 3BGJA 3CAWA 1XLMA 2P76A 1ODUA 3FJNA 1XI3A 3KS5A 5DCBA 3IACA 3HA1A 4XB3A 3HG4A 4I9MA 3GKAA 1FKBA 1DWFM 2A3CA 1FDYA 2PODA 2OFJA 2DU2A 1E9IA 5BU9A 1EGZA 3WLMA 1UWTA 4EF8A 3RIKA 6XIAA 5JBDA 3CL6A 3GDLA 2Z7KA 3VNMA 1X7IA 4NJGA 2CLOA 2X1SA 4N9EA 1F4AA 2PF8A 3W82A 3ITGA 5IDZA 3T81A 5E6YA 2OOFA 2OSWA 1EO5A 3WUGA 1QBAA 2QV5A 2GK1A 4GKTA 5AY7A 2CZEA 4LEQA 3KVLA 1K8XA 3TZNA 3M0JA 4IPIA 3NPUA 4I3GA 1RK5A 3BCFA 3VDGA 2L2SA 3MO7A 2XFYA 3HQNA 1K03A 4HSOA 5K9DA 1W9UA 3JVAA 1GT8A 4A05A 2DG3A 3LZ3A 4IIBA 3L4ZA 4WVXA 3RCNA 3G3MA 6XIMA 3W07A 5KZ6A 1POJA 2EJ1A 4A3HA 4AZCB 1BXNA 3M9YA 1QDSA 2QR6A 3LHTA 2C7FA 1V6WA 4UOJA 4JYDA 3HTWA 4C6LA 5FSDC 1FKXA 1HUVA 1H7PA 1AQ0A 2J6XA 4PMXA 2VTFA 1XIBA 1X7FA 3HJEA 3FSTA 2I56A 3GU0A 4WOZA 1VZWA 2XSBA 3VVGA 1UZDA 3TKFA 3UJSA 4W8AA 2NWSA 1VBUA 3L4YA 2HV5A 3KP0A 4GQRA 2NZLA 3T09A 3I10A 4DJDD 4LCSA 1TO3A 3A5VA 2WVSA 4Y7EA 2AGKA 3NDOA 4PFHA 4ERIA 5G5IA 5HULA 3RPDA 1JCHB 3KBWA 1R85A 2BLEA 1DE6A 4JCLA 5CBBA 3A6OA 1LT8A 5CC6A 4WSKA 3J7HA 4IMCA 2GJXB 4LB3A 1G69A 1XH2A 4EIVA 4LF1A 2OEMA 4NZ4A 3R8RA 1VEMA 1FWNA 3CEUA 1QT1A 4ZE4A 4OBRA 1XCXA 2QAFA 3ZZ1A 1ESWA 1QHOA 4J3ZA 1VLWA 4ATLA 5AZ0A 5A8MA 2CHNA 5DO2A 3BVJA 3FXGA 2EULA 4HNNA 1K9DA 4DJFA 3P93A 2WVVA 3O5DA 2VZSA 1K9EA 2XWEA 5I78A 5M03A 3VFLA 5E93A 2ZQUA 1HKJA 2XN0A 1ME9A 3S1XA 3VMPA 6TAAA 2VX4A 2UBPC 3EWZA 3STCA 1VCVA 3GTIA 1JI1A 5FIPA 5CC3A 5M1TA 1A5CA 1W5MA 4MM1A 3VILA 2RDTA 3KADA 4KETA 2PRHA 4HJFA 3SFWA 1ICQA 3M43A 6A3HA 3TJ4A 1GPFA 2LPVA 4R5EA 3CQIA 4V28A 1YTEA 4YHEA 1G6CA 2Y24A 3ARVA 2E6DA 1W56A 4GINA 4V1XA 3S6TA 2CXGA 3XISA 2GJLA 4PTXA 4GBUA 1D7FA 3W7CA 5E0FA 2CLFA 4XV0A 1ZTVA 2ZZ7A 4AW7A 4E2DA 1VEOA 1A4LA 1IZJA 1AQHA 2O56A 3NZRA 5B7ZA 2YIHA 1JZ6A 4XD6A 4DIPA 4QE4A 5H6HA 3PBWA 1W5QA 3O05A 4PCSA 3RM9A 4GYKA 4GK8A 2J8TA 3FSUA 2DVTA 2WJFA 1OK4A 3W1PA 2R91A 5G4WA 4U31A 4JL1A 3THUA 4DBSA 1BYCA 3WLPA 1XIDA 1OF6A 4DO6A 3AXHA 3PB2A 4Q4MA 5JBEA 5AC6A 1JCJA 3AIEA 1J4HA 3VCNA 2FZMA 3NI6A 3T2PA 3UA3A 4M7TA 1WKYA 1UP3A 2ZYFA 4GZ7A 3NJ3A 4DELA 1W26A 3M1ZA 2BGQA 1A5AA 3JYJA 1E6RA 1UBPC 4PRTA 2RKXA 4XZHA 3PRBA 1LBFA 1EO7A 1AJ0A 4A3YA 4JZ5A 3CV7A 3O16A 1B3YA 3UXAA 4CNSA 1XBXA 4H9MA 4B16A 7PTDA 4JNYA 4WKAA 2Q6ZA 3ARYA 2UZ5A 2WMIB 3CTLA 1TWWA 1NOWA 3CV6A 2G0WA 3FS2A 1PJ9A 3FGCA 2PDPA 4M56A 3RLUA 1QTWA 2WQPA 3RYSA 4M5PA 4ML4A 1NF0A 1LTDA 1XG3A 3AROA 2GJPA 3VMNA 3WLSA 2Q71A 1Q45A 5LHEA 3W7HA 5IBXA 3CUFA 1DXEA 1UD4A 1V7AA 3W85A 1I1WA 3RJXA 2CZFA 2V8ZA 3WQCA 4O2TA 2QLYA 3PZQA 5KETA 3YPIA 1V6VA 3K1DA 5HPCA 2J79A 5I2UA 4O18A 2YLLA 3VAVA 1OZQA 4GVIA 1JRBA 5D8WA 3PG9A 2HBVA 3WD1A 1VCGA 3SUVA 3A3XA 3V36A 5DANA 1SZEA 4PL1A 3VKDA 3WMCA 1HXVA 3NDYA 1QPFA 1TV2A 4BEUA 4QXIA 1RD6A 3BLKA 4UZSA 3V35A 1S5WA 1QMLA 1ZP3A 3SDOA 2X09A 1FTXA 2HTMA 2D2JA 1IEIA 2NQHA 3T08A 4AF0B 4DZIA 1FH8A 2CLLA 3C5QA 4LUIA 1JYVA 3I7QA 2ZADA 1WKFA 1CXKA 1Q6QA 1V7YA 4OQVA 3FAWA 2RH9A 1M65A 1NARA 2Z1XA 1WOBA 4XAZA 1EKOA 4JFUA 1J6YA 1KV8A 2WV8A 1G67A 4HJWA 3QW4B 4GC3A 3LGDA 1GKPA 4F79A 2PGRA 3B9EA 2OLSA 3CHFA 5KZDA 5EYWA 1N8FA 3MJMA 5T9BG 3UXKA 1J4RA 3B8IA 3KAOA 3KHDA 4DBEA 3HGJA 1UJQA 4FOKA 2JFEX 3G18A 2DT2A 2PDJA 5J8LA 5C9XA 2P8CA 3U3HA 2BGSA 4DUXA 3C0LA 1RR2A 5HMSA 3V7PA 2HK0A 4C6CA 4UTWC 1RLCL 1DWIM 4TO8A 4OJYA 2IS7A 3DEQA 3DFYA 2QJNA 4IJRA 4RCXA 3GE7A 1RUSA 3DHFA 2BWGA 3PM6A 1TPDA 1V79A 3H2CA 3ZMRA 3W7NA 2F61A 5D2TA 2VOTA 1I6NA 5GQBA 4GHRA 1UOZA 3G3DA 2AL1A 3GX9A 3A3WA 3TTYA 3CZGA 1HJXA 1R3RA 1U5JA 2FTYA 2NXIA 5A8OA 1W3TA 3IJLA 2J47A 4H8NA 2OYKA 5AYZA 4C1LA 4P8UA 2G96A 3GXDA 1XG4A 4RV3A 2PP3A 4W9PA 1VS1A 1S2WA 5HNUA 4DXKA 1VP5A 4HHPA 3I3EA 3SN0A 1BLIA 5E9AA 4J9JA 3G2GA 2CZDA 1PYMA 1HO1A 1N82A 1XYFA 5AYBA 5EBUA 1O5QA 1PO9A 2ZIDA 3W7JA 4U85A 3VUPA 1CB2A 1E56A 3LG3A 4IMAA 1H1NA 3BZJA 4G7EA 1SPQA 1IEWA 4Q4SA 2RSEA 2OX4A 3FXYA 3ID7A 3OTRA 3NO5A 5I3FA 3NYZA 3SJNA 3NIYA 1R9YA 3SCVA 2O9OA 3WNMA 1D3GA 1TV3A 2FZBA 1UA3A 5CGTA 3TCEA 4FXFA 1PTAA 1YW5A 3LRLA 2PWGA 2PFHA 3VI2A 2ISVA 1GEQA 3N2OA 5CGMA 1Q65A 5I7GA 1F8MA 2GVEA 4DZHA 2DT3A 1RD5A 1JGIA 3VCCA 4QS5A 1DIDA 1XWYA 1W32A 4ZVJA 4HCHA 4DWSD 1KT0A 3AHZA 2OLHA 3LPOA 4UTMA 3BC9A 4BF9A 4N4QA 4ZQCA 1A0CA 2A21A 3SGUA 3FEQA 1ZL1A 1DIOA 1LWJA 4QS6A 2VUNA 4K2SA 3XIMA 1E0WA 3B8DA 4IQJA 2PE4A 3NL2A 3IV8A 1US3A 4GUFA 1KFEA 2I17A 5MKGB 5EB8A 4DRSA 4WKFA 1TIMA 1UUOA 5A6BA 4HOWA 1E3ZA 2PDXA 2OQHA 3V1PA 2OMAA 3WQVA 5KSWA 4OWGA 3URQA 2YL5A 3W2UA 1D8CA 4REQA 1ZSXA 3WDHA 3W7RA 2V81A 1MQPA 3VGEA 1REQB 4TVUA 2WJZA 4GJ1A 3PBUA 4UR7A 4NNRA 4R34A 1H1ZA 1T11A 5EFFA 4HD5A 2Y7FA 3GAYA 5CSRA 3LTSA 1CGUA 3WENA 2PBCA 4U4MA 3IVUA 1G94A 3PWGA 2YBUA 3BV4A 2YCLB 1OFRA 1JFXA 4PODA 1V51A 5XIAA 3O5PA 3GVRA 3OU8A 3KXQA 3QHMA 4AUBA 5CG7A 1ISXA 4OV4A 1EA9C 4J2PA 4GVGA 3MSYA 4D8AA 2JKEA 1JZ3A 2J74A 2E6FA 4TV5A 2YXXA 1WOAA 1XLHA 4PUJA 1O12A 3N17A 3T8LA 4TVCA 4K1WA 5ABEA 5HR7A 5FF0A 1S1RA 3GPKA 1UH2A 1KFJA 1PVNA 1FKHA 1CECA 1JUBA 2WZHA 5HXMA 1VGAA 3L67A 3IVSA 2DZXA 2ZUUA 3IKGA 5I02A 5HR6A 2G5WA 1DTUA 5BRBA 1KXTA 4XZLX 3W73A 2J77A 4BZYA 4Q7NA 3DKJA 4KEVA 4JQ1A 2VMFA 4FXRA 4MNLA 3ICJA 5IFPA 3KLKA 3LNMA 1KM4A 4AX6A 4MDOA 3PR2A 5GJNA 2JKPA 4GIVA 3UYCA 1JCXA 4WOQA 2I57A 4P7QA 3WLRA 3CL7A 4PMVA 3LXBA 4L4OA 4ZO9A 1QW8A 2A7PA 2EG6A 4PBGA 4HBEA 4E8GA 3HFTA 1VIWA 3EX3A 5FOOA 3IIOA 1QW9A 4UTTC 2AKMA 2DSZA 4L6DA 3AMKA 3TTOA 4MGVA 2BXYA 3C3NA 3QEZA 4MNKA 2R9RA 5HOSA 4OBSA 2XIJA 1TX2A 1UCWA 3RMEA 5I5RA 1ODZA 5E9XA 4LCQA 1MYRA 1DWGM 2IKGA 1XLBA 4IP7A 1R3TA 1E55A 2ZBTA 1OCQA 1K4GA 5CKSA 3PZNA 2QPSA 3NAVA 1H62A 1QJWA 3SCQA 1GVFA 3W1NA 2P3ZA 3ZOAA 4JBRA 3PULA 2HS8A 2WCSA 4GFSA 3AUJA 4NX5A 1XYBA 4H4IA 3QR0A 5JH8A 5DBTA 1R3YA 1W3KA 4HPJA 2MNTA 3DC8A 4RZ4A 2ZA3A 1OB0A 4EE9A 1O5KA 3UVAA 1OF8A 3THCA 4HA0A 3W1RA 3WQFA 3AU6A 1EUNA 1JNDA 2GQ9A 2ZICA 3EDJA 1LLWA 2INFA 4D6EA 4PGLA 4LW7A 3W0KA 4LYPA 4ODQA 3VDHA 1V8EA 2ZQVA 2WSPA 3GTYX 4AXKA 2QCMA 4GVFA 1XIGA 4JN8A 2PU1A 4QAIA 1WAWA 2VENA 4R7JA 3KWSA 4IX0A 1SR0A 1I2RA 1AZ1A 2V3FA 4KCUA 3KVKA 2EJAA 3TCZA 5D37A 1TWZA 1Q6GA 4QBXA 2POTA 3QY8A 5T91A 4HU3A 3OA5A 1RY8A 4DWDA 1O7AA 3GVVA 4CN6A 1PKNA 2HPMA 4IT6A 1TTIA 3RR4A 4BF7A 4CGTA 3EA2A 5DY3A 4L4MA 1KKOA 8XIMA 4UUIA 4B3ZA 2PC8A 2BBFA 2Y62A 1HGWA 4UTHA 4HA1A 4W7WA 2ESCA 3ECQA 3M7WA 2ACRA 2OPJA 1POKA 1P1MA 3EPOA 1KTBA 1SJAA 2R1NA 1D3CA 4NRSA 3UJEA 4IQEA 4QG9A 1GVRA 4A8NA 4CQ8A 4INFA 3P61A 3RU6A 4M8UA 3T4CA 1JF6A 3T2OA 4AY7A 3CUIA 1FHUA 4J3VA 3IV3A 4PFMA 3BMBA 3LBOA 1QOQA 3SCUA 3R2GA 1K3UA 1E1CA 3OYZA 2ADAA 2YPIA 4BK9A 3SSZA 3S0CA 2R1KA 2W27A 1UW9A 3STFA 3NSXA 3NXLA 4GQBA 4Q6JA 4JEQA 2XG9A 4KCTA 4YNGA 4FX8A 3DFHA 5CQ1A 4BI7A 4FOUA 1GZGA 4FF7A 2OX1A 4PUUA 2ZR6A 3G8EA 1PZ2A 1ONXA 2ZZ5A 4LWWA 3KWXA 4PTDA 2H9AB 3M4HA 3PUDA 3IEBA 4K3ZA 4G6CA 1ZFJA 4O50A 1OYCA 1LRQA 3LDVA 3K4DA 3FKKA 1HVQA 4YTRA 4XIAA 1QPLA 1X1ZA 5TQLA 3GFXA 3AIVA 2DZVA 4J40A 3P6LA 5ENLA 2PDGA 1YDNA 1FHLA 1ZY9A 3DFTA 3DBPA 4HBOA 4AMAA 3MUIA 1DOSA 2YYUA 3PR9A 1MSSA 2C0HA 3LCLA 4ZXLA 1JPDX 4V2XA 3GNDA 1HJUA 1W1PA 3VNZA 4U3AA 4EWJA 1C8XA 5HJLA 1EF2A 1WKEA 3IANA 3LCIA 1EJ7L 4ODRA 3MO4A 5C71A 4JKLA 5EKYA 2BVYA 1YNQA 3RX3A 3SRDA 4ICCX 1LROA 2B7PA 4JTUA 3CU2A 3KBVA 3OZMA 3LM7A 3TQPA 1Q8JA 4PEEA 4W85A 1WE5A 1EBGA 1PE1A 4X0VA 2DP3A 1W0MA 5FESA 4A6GA 1JL8A 4JQ4A 4HCLA 5HW7A 9XIAA 4GQQA 5G2HA 5HWJA 4AD3A 3R0KA 2PWVA 1FWHC 3CUHA 5FEPA 4Q8QA 2ZE0A 2VGBA 3UWVA 3ABRA 1B9ZA 3WQPA 1XD0A 2HS6A 5CAHA 2G3FA 1YXCA 2DVXA 3CMFA 4HB7A 4I5RA 3U6WA 2WLZA 1R9ZA 4FZIA 4IQDA 1NQ6A 4OFCA 3W1MA 4H3DA 1QPRA 4C5YA 4Z2JA 1YBQB 4W86A 2E68A 4RE3A 2ZX9A 1PKYA 3GXFA 1Z32X 3A9IA 4HOXA 4XZNX 2NX9A 3MPGA 1EZ2A 1Q6EA 3P62A 4FEZA 4Y8FA 3AYSA 3BL3A 4OZOA 2CHOA 2XN2A 1F7BA 4ZO7A 4F40A 3NO1A 1FWIC 4YL2A 4DXXA 3PZGA 2NWRA 4S3CA 2PPPA 3S4TA 4HBKA