2QF8A

Crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of Buffalo Secretory Glycoprotein with Tetrasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2qf8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qf8A01
4J3UA 3ZMRA 3MKKA 5E70A 4AD4A 3HN3A 1B3VA 1YHTA 1JL8A 1J0IA 3F4VA 4KRUA 1EDQA 1OINA 4AZBA 2XJ7A 1JG9A 2VJXA 4F9JA 1KFWA 4AISA 4D6CA 2FH8A 1KXVA 2J7CA 1XD0A 3WQ5A 1UH2A 4UZSA 4AIUA 3AIQA 4CVUA 2BHUA 3GBDA 1VFFA 5JBFA 1LQ0A 4OJYA 1CXKA 4W89A 1NARA 3UR8A 5DF0A 3T0AA 4ATDA 1G1YA 1JAKA 3SURA 2Y2WA 1JAEA 1UKOA 4PTMA 1CECA 1XGZA 4PMYA 2BY3A 2VZTA 1GOQA 4M8UA 2WZIA 2YKKA 5LA1A 3WEMA 4PUDA 3SUUA 4ATLA 3VD4A 3AOFA 1QNPA 3FAXA 1JF6A 4QLKA 2DT2A 1UQYA 4U3AA 3WNNA 4C7DA 2A3AA 1E6ZA 2GFTA 5HOSA 3WDRA 3MS8A 1ISVA 3AS0A 1W3HA 2PC8A 1XH1A 4UFIA 3SUVA 2WANA 3CHEA 3QR3A 3W29A 1UWQA 5BRPA 1MQPA 1GVYA 4TVUA 1OWQA 5JIPA 3CZGA 1KXTA 4MNKA 3W26A 4AY1A 4CN4A 3MSDA 4DWSB 1OIFA 1MFVA 1UH4A 5CG0A 1F4AA 4W86A 2BY1A 3UETA 1QHPA 1UD4A 3SCWA 3U7BA 3VO0A 1JXJA 4UCFA 2JF7A 1CGYA 1H41A 1O6IA 1C7TA 3L4ZA 4CKQA 1H1NA 3VGEA 1HL9A 1XYZA 1FFQA 5CPQA 2BS9A 1JFHA 4CCDA 4H8HA 1WKYA 1VEOA 1W32A 1HVQA 3AHZA 3ZR6A 4CCEA 4HA3A 2D23A 8A3HA 1R7AA 1TUXA 5BCAA 2BNJA 1HT6A 4KWUA 3F5LA 2V38A 2PWFA 1ITCA 1GQJA 2D24A 2WZHA 5M5DA 4BF7A 2XG9A 3CUHA 1LJYA 1CLVA 2X05A 4R5EA 1UD2A 3SUWA 1UKSA 4UQBA 4WKHA 1I1WA 4D6DA 1CGUA 3PZQA 4UOJA 3DHPA 1ITXA 4XV0A 2AOSA 1DWHM 2PWGA 4HU0A 2O9OA 4CD7A 4IPNB 4P8VA 2DT0A 2VZVA 2OLHA 3ZT5A 4RE3A 1UR4A 2Y24A 2D2OA 2VMFA 3CGTA 3KWXA 1AMYA 1XHGA 3E1F1 1LG2A 2DH2A 2A3EA 4LYRA 3WD4A 2VVNA 3OG2A 2OWWA 2EXOA 1JNDA 4E2OA 4JHOA 3ARRA 2OWCA 2E9LA 2WLZA 2GDUA 3DYPA 5I0DA 3EMCA 3MSGA 3PTMA 1EGZA 1ODZA 5IHRA 2BHYA 5HBFA 2VI0A 3NSNA 5I2UA 1V6UA 2F8QA 2XVPA 3W6LA 4W87A 4PEEA 2E4TA 4WSJA 1MXDA 4AZHA 1G0CA 1WPCA 1H2JA 3WD2A 5A6BA 4AD2A 3AMKA 4GQQA 4N42A 4JL2A 1TA3B 2E9BA 4H7VA 4PRWA 3TTYA 1MQQA 5D8WA 1GONA 1BGAA 1GQKA 1B1YA 4UQCA 1X6NA 4PBGA 1HJWA 2ZX8A 1BTCA 2DIEA 4X0VA 4A4AA 5HNNA 4MB3A 2OSYA 2WVVA 3VGBA 3IAQA 4BQ5A 3T08A 4AD0A 2FH6A 4L4OA 1PBGA 1CTNA 4UOQA 1XC6A 2WWCA 3UERA 4J3TA 4PMRA 4TX6A 4D1IA 4GZJA 1JYWA 1BHGA 2JEQA 5GPRA 2DQXA 4P8WA 2VX7A 3N04A 2GDVA 4NZCA 2XFFA 3TTQA 1BYDA 4MTVA 2J7FA 1MWOA 5D9NA 2VT0A 2O9RA 4P8XA 3AHTA 1C92A 1CWYA 1BAGA 1E0WA 1C8YA 3WH7A 1JZ2A 5EFDA 2YBUA 3TTSA 1H0GA 3CZEA 2J74A 3VMOA 2J4GA 3N12A 2G3IA 2BVYA 3BC9A 4UQEA 3WF4A 3CLWA 3L4TA 1US2A 3BAKA 3NUKA 4JZ5A 1CXLA 1V02A 2VQUA 1WNOA 3ARXA 4FLSA 4NRRA 3FNDA 2QMKA 3CMJA 3ZOAA 1UR2A 3VOCA 2VOTA 1PZ2A 3A4WA 1ODUA 2GK1B 4H8VA 1ZBKA 2XM1A 1KBBA 2NT0A 2DDXA 4PMZA 1LL4A 4MNJA 4GQRA 4XZWA 4DUVA 1V3LA 4W7VA 2CESA 3BMVA 1UUQA 4HA4A 1FH7A 3WH8A 5A6BD 1EHAA 4MB5A 1OD8A 1JD9A 3CUJA 2XM2A 3ARQA 2DPEA 3AQUA 1E6SM 2PWDA 2X1IA 4JFSA 3W37A 1BGGA 3MMWA 3CZLA 4JCMA 2XSBA 1NOWA 3MUZ1 5A6SA 1E70M 1IZJA 2YLLA 3CUGA 3PZNA 3LPFA 1RP8A 1TFVA 1AQ0A 1OCQA 1QW8A 1CLXA 4FMVA 3WNLA 4QLJA 3VGGA 3CO4A 2DSWA 2CPUA 3VPLA 6CGTA 4MAVA 4H8UA 4P7LA 1WE5A 2D3LA 3RDKA 3EDJA 3VDAA 5CGMA 1W3LA 2OSXA 4Z2JA 1MW2A 2VL4A 3BAJA 4W8LA 3W53A 1E4NA 5IFPA 4C7FA 1W2PA 3ARUA 4HPHA 2F61A 1ISYA 5A2CA 5BROA 3KL5A 2BV9A 3BLPX 4P7QA 3WSUA 2GVYA 1J10A 4CN1A 2J7DA 1QI5A 1TZ7A 3AS3A 1XYFA 4WF7A 4HOZA 2WZEA 1W1VA 2ZX7A 1UD8A 2ZIDA 4BQ3A 1DWJM 2EPLX 1E6QM 3VIKA 4BZYA 3PZMA 1FOBA 2CERA 4WJXA 1FA2A 1BG4A 5A8QA 3POHA 1B30A 3AHXA 4OKDA 5CXPA 4W5UA 3GH5A 1KR1A 2G3MA 2G3NA 3PZ9A 3ARVA 3OZPA 4IUGA 5HPOA 1NM9A 3T2PA 1PX4A 1W9BM 4IPLA 3OGVA 4F9DA 1LL6A 5CQ1A 3CUIA 3WN6A 3WNOA 1E15A 3W27A 1E6RA 1EQPA 2EPOA 4TTUA 2YL5A 3ZJ6A 2CNCA 4GPNA 2BY2A 1Q4NX 2BXZA 3W28A 1XRVA 2C7FA 4JAWA 1CENA 3RILA 3VD3A 1UZ4A 3ZO9A 2V3DA 2XFRA 3CTTA 4AEEA 4W5ZA 2XWEA 2D0FA 1E1FA 1CXHA 4NRSA 4TVCA 3I3BA 1ISWA 3A6OA 2YBTA 2QF8A 3U7VA 3T2QA 4M29A 3WF2A 5ABHA 4ML4A 4UNIA 4EKJA 1J0KA 4WLCA 3JUGA 1V02E 4S3KA 2VQTA 4HZ6A 1W3JA 3O2LA 4B9ZA 1DWGM 1VRXA 4GI8A 5E9AA 3VD7A 2DGAA 2QPUA 3RM8A 3RO8A 2YL8A 2W4XA 1E40A 2VCAA 1CGVA 5I79A 3POCA 3HU7A 1H5VA 2TAAA 2WBKA 1B2YA 1G9HA 4PCSA 3UCQA 2CKRA 4PN2A 3VDBA 3CMGA 2JF6A 2J8GA 2UWFA 4D6EA 2XVKA 3QGVA 5A6KA 1P6WA 4J3WA 1TVPA 2E0PA 2XYLA 3GNRA 4ACZB 1UD3A 1VF8A 4OOUA 4CN6A 2PBGA 2GJXB 1KR0A 2QHAA 1BG9A 3VMPA 2ZX9A 3IJ9A 4H04A 1MW1A 1J0YA 3GTNA 1CBGA 3NSMA 5A69A 1V6XA 3IJ8A 1KQYA 3ZJKA 4V28A 1UR9A 1AQMA 1E73M 2A3CA 5LA2A 1NQ6A 3AZSA 3ZSTA 1EA9C 5A6MA 4YN5A 2YLAA 3W82A 2DT3A 1PX8A 3VDHA 1LL7A 4Z2GA 3N18A 4F8XA 3AS1A 1HN1A 5JBEA 1JZ6A 1QW9A 2C0HA 2VZUA 3L2MA 3WKZA 3PTKA 4BCEA 2VRQA 1GHRA 1BFNA 1QBAA 5I78A 3A3HA 5CPTA 1FP8A 3ARYA 3CZKA 2WMIB 2W66A 3VDCA 4UFJA 3WMSA 1KQZA 1HJVA 1I1XA 1VJZA 4EK7A 5HDRA 2V3EA 3AIUA 2CXGA 2VR4A 1G94A 1E4IA 2D1ZA 1JI2A 2ZICA 2YA1A 4N0RA 5E6YA 3L4VA 1MFUA 3VNYA 4U2YA 5TD4A 3WFLA 1HF6A 2ZXBA 2ZWZA 1K9DA 4AZIA 2NSXA 3VTRA 3VM7A 3SCTA 4R27A 3TTOA 1E0VA 1VBRA 1BQCA 5FL0A 2WW5A 2ZX6A 1B3WA 2QLYA 1BYBA 4HZ7A 1CGTA 3WH5A 1J0ZA 3GM8A 3AIEA 2E8ZA 5I3DA 5EFFA 3M46A 4U31A 2J7BA 3PZVA 1V3HA 1UD6A 2W62A 3UG4A 1BF2A 1JDDA 1U33A 3T2OA 4KH2A 3VGHA 3VX0A 1W1PA 2WVTA 2VR5A 4JFUA 3CZJA 3PTQA 1XCWA 1ZL1A 1L0PA 1QOXA 3GXFA 3GZAA 3SCNA 5DEZA 2WPGA 1W9DM 3NDZA 3W25A 2VNCA 4M1RA 2YDSA 3WELA 1E72M 3CPUA 3AFBA 1QBBA 2YL9A 3NDYA 3VGFA 5D4YA 4Q22A 3FAWA 1JYNA 1IV8A 3PZIA 5FOOA 2DSKA 3GH7A 2XVLA 1X6LA 1DWAM 4J28A 3GBEA 4KRTA 1OB0A 1QHOA 1UKQA 1B3YA 1US3A 1ZBWA 2FGLA 1PIFA 1WZAA 1KCLA 1DWFM 2W92A 3G6MA 1E6XM 2VZSA 2OYLA 4D6GA 5A1AA 3GNOA 1HXJA 3EBVA 1SMAA 1UR8A 1XSKA 2FHFA 4GI6A 1QI0A 4GZEA 4J7RA 3MUIA 1BYCA 1UR0A 5M17A 3WNMA 2O9TA 1R85A 2G41A 3L4YA 4J3SA 4Q7NA 1S46A 3K8KA 3L4XA 1U2YA 1WDRA 1K6AA 2UY2A 3AROA 4CCCA 2UY4A 3ZJ8A 3O6AA 1H49A 4W8AA 1UA3A 1OD0A 1HNYA 4UQAA 1ZS2A 3A4AA 5A94A 3WEOA 1UWIA 3AIVA 1JYXA 3VD5A 4UFKA 5M3WA 3AZTA 4F79A 1JF5A 2MANA 4M80A 4PYSA 5IFTA 1HKKA 1J9YA 5DT7A 4ZXLA 2NW0A 1M7XA 4RL3A 2IXUA 2VX6A 1B31A 3UG5A 4LX4A 1SMDA 1UWTA 3WQ6A 6TAAA 4UZUA 4X9YA 3F5KA 2RGLA 4MADA 5A2BA 5E09A 3VGDA 1EO5A 2WSPA 3SUTA 1HJUA 3A47A 1D3CA 2WMKA 2VCBA 3SCSA 5CGTA 4BQ4A 4ZE5A 4NF7A 2ZUTA 4AD5A 2WMJA 2V3GA 3VKKA 1ZBVA 1V3JA 4W8BA 2ZE0A 4CD6A 2Y8VA 4AC1X 4GO8A 1XSIA 2PB1A 5AC5A 3UEQA 4PUEA 3BAIA 1HVXA 1WDQA 4ACZA 1VFOA 3WMCA 3AHYA 2VO5A 4D72A 1JZ7A 3ZJ7A 2XIIA 4AXNA 1H3GA 1UKTA 2EBNA 2VVSA 2JALA 2VZOA 2D0GA 1B9ZA 4WKFA 2UY3A 4ZXOA 1J0JA 1E4MM 2J79A 3THCA 1C3FA 5D8ZA 3VIIA 4LQ1A 1HKJA 1WDPA 1MW0A 3ZIZA 3B9DA 5FD0A 3M7SA 1H0IA 2YA0A 1E43A 4J3VA 1MVYA 5AYBA 3L4WA 5F7UA 3WD1A 3K46A 1CXEA 2BHZA 1HJSA 2J78A 2VC9A 1QI2A 3NYDA 3BMWA 4X0NA 4TX8A 1JIBA 5EMYA 3WL0A 1DEDA 1QNRA 4QP0A 5KZ6A 3BH4A 3NCOA 1SYTA 1GJUA 3SUSA 3WFZA 2CBUA 5C8BB 1TCMA 4D6IA 5A6AA 4AMCA 1OIMA 1ISZA 1VBUA 2D3NA 1ZJAA 3VUPA 3BAYA 4D71A 3EMZA 4B3LA 1V0KA 3BXWA 3DYOA 4DM1A 3M07A 3WMBA 5FL1A 1C8QA 4GKLA 4HMEA 1LWHA 4ZENA 3IANA 1IZKA 4OIFA 2YIHA 5ABGA 4KGJA 4U2ZA 1J18A 2BY0A 2Y4SA 3PZTA 3OGSA 1W1TA 1UWRA 1UHVA 2WB5A 4JCLA 1K9FA 3RJXA 1WZKA 5ABFA 1V6YA 4HZ8A 1NOFA 5BXSA 1V0MA 5FCZA 1QHZA 4YPJA 4XZBA 3GXDA 2EEXA 3WBAA 4MDOA 3A4XA 4HU8A 3BAWA 4V27A 3CH9A 2YL6A 2WHJA 4GZIA 4P7OA 3OB8A 3J7HA 4CU7A 3OLEA 5AC4A 1TVNA 3RMEA 1NH6A 1M04A 1UD5A 2OSWA 3WL1A 1UKPA 2GJPA 4LPCA 3WDIA 1JZ4A 4PMUA 2W91A 2WMFA 5GNZA 1HP4A 3D3AA 3MANA 3AJ7A 2ZWYA 2E40A 3CIVA 1VB9A 1A3HA 2VUYA 2J77A 1RD6A 1HX0A 4W88A 3WQ8A 4V2XA 2WKGA 3EDKA 4NSBA 5A8MA 3VIGA 2EJ1A 5BXPA 3ARSA 5A3HA 1BPLB 2W5FA 2WXDM 2YJQA 3AMCA 2JE8A 4MPKA 1GOOA 3N11A 3QHOA 3VM5A 4E8CA 2CKSA 4Z2KA 1M01A 1CYGA 2ZUVA 4K68A 1XV8A 5AYIA 2OWXA 3NSXA 3OIHA 4M24A 3AICA 3WUFA 3ZR5A 3W81A 4AW7A 4CUCA 3MUY1 5I77A 3EDEA 1Q6CA 1K9EA 1JZ5A 2PWEA 3II1A 3CZ8A 4DWSC 3VU2A 3N17A 1M53A 1W1YA 1FH8A 3AXIA 4AD3A 2JFEX 4D6JA 4AZ7A 4U5IA 1VEPA 1E1EA 2OYMA 1I75A 3VD9A 2Z1KA 3WENA 1TR1A 5CJ5A 2JEPA 3ECQA 4B9YA 1C91A 3VIMA 1ZB5A 1VFMA 7CGTA 4AYSA 1V08A 3DHUA 5JIWA 1UH3A 4UQDA 3TOPA 4PMXA 3AS2A 1D7FA 2WMGA 1NWRA 5A6JA 3WEZA 3CUFA 3D5HA 3CHFA 3SCOA 2AMGA 4AD1A 1RH9A 4FK9A 3WQVA 3IJ7A 4YHEA 1GHSA 3VIOA 3W6MA 1QNOA 3WBEA 3W24A 4URIA 1KXHA 2BVTA 4YHGA 1QVBA 2PBOA 4OUEA 4W7WA 1JDAA 1GJWA 5IHSA 1NWUA 1KGXA 1EO7A 2X09A 7A3HA 2X0HA 1CZ1A 4OOZA 3T0DA 1TA3A 3VMNA 5EB8A 2YDQA 2ZUNA 1FHDA 4DWSD 1KWKA 3ZT7A 4DUWA 4TOQA 2ZUUA 2GJXA 1J11A 4B15A 3PZOA 2WYSA 3SCQA 3WUBA 2BFGA 2E3ZA 3WH6A 3BCFA 1C8XA 3K8MA 1HKMA 2WCGA 1XD1A 1WO2A 1TE1A 3OBAA 1GUVA 4JFTA 1W9XA 3WQWA 1CXFA 3L4UA 3PZUA 4PCTA 4QLLA 1CDGA 1GOWA 4LXFA 2VTFA 3LMYA 1GCYA 3ZSSA 4QFUA 2YOCA 4C7GA 5FIPA 1OGBA 4FLQA 4WIWA 4H41A 4EANA 2VURA 5JUVA 1H11A 4B16A 1GQIA 3BLKA 1DWIM 1GNXA 1Q6GA 4P7RA 3AI0A 2FDMA 2O92A 2CIPA 1QNQA 5CPSA 4QCFA 1F4HA 1VJSA 2DSVA 3AIWA 1OM0A 2CETA 1IT0A 5E0CA 2J47A 2WCAA 3L2LA 1GORA 1EHNA 1XH2A 1X1NA 1DHKA 4AIOA 5GNYA 2F2HA 4PMVA 1JXKA 3B8SA 3TA9A 2BXYA 4JFVA 3U57A 4LYQA 3WIJA 4RE2A 2JIEA 2QMJA 3VINA 4CD5A 5LA0A 1BSIA 2D20A 4HA1A 3WDPP 1FP9A 2ZUMA 3TP4A 2G8ZA 4PMQA 2J7HA 3GNPA 3CBWA 3RJYA 2D22A 2XFYA 2CYGA 1XSJA 3THDA 2D0HA 2O9PA 4JKLA 3AXXA 3AMLA 1B3XA 4MJ4A 3WUGA 1EXPA 5IXEA 3APGA 4PTXA 4A3HA 3WH9A 5BRQA 2CITA 1M03A 2UY5A 3BGAA 3PN8A 2QPSA 2XGIA 1FH9A 4JL1A 1GOIA 2WC3A 4GINA 1UA7A 4TUFA 1PAMA 4QAWA 5AY7A 1PPIA 3N9KA 3BSGA 4KMQA 1TG7A 3OGRA 3MMUA 3MV01 3WDJA 1HIZA 3MO4A 3AMDA 2CBJA 4Z2HA 5DFAA 3LPOA 1PX3A 2GSJA 2FHCA 2A3BA 1NP0A 3MUAA 1CGXA 4UR9A 1HJXA 4FLRA 3WNPA 1LF1A 1JI1A 4JIEA 1A47A 3AMGA 5E0FA 4U3CA 2WHKA 3KL3A 2J7EA 1WAWA 2QV4A 3VX1A 1VIWA 2ZUSA 2OYKA 3NJ3A 4P7NA 1C7SA 3S6TA 1B90A 1E9LA 5BWFA 1B3ZA 2GUYA 4PSPA 1RP9A 5E6ZA 4OZOA 2A3HA 3VIFA 2G4FA 4W7UA 4PMNA 3OLIA 2W61A 3FY1A 1BYAA 1LG1A 4MDPA 3WUEA 1BVNP 1ECEA 3VILA 1CPUA 7TAAA 2WM0A 1V3MA 3LPGA 2IUZA 1EDTA 3QHMA 1ZBCA 2B31A 3WQ4A 4BS0A 5BXRA 4RE4A 4B3KA 3SEPA 5KEZA 2IXVA 4IM4A 4WSKA 4AWEA 2GJRA 5D9OA 3AZRA 4A3YA 3WD0A 2HVMA 3RPMA 4EE9A 2ZX5A 3BCDA 1E5JA 5DT5A 1DTUA 1UZ1A 1V3IA 4M56A 2XUCA 1LLOA 3K4DA 1ZJBA 2C8NA 2AAAA 2EPMX 2EQDA 3KL0A 8CGTA 1KGWA 1N82A 3HJEA 4AZGA 5DMYA 1NOUA 5HPCA 4CGTA 3RCNA 3UESA 2FHBA 2ZXQA 3VNZA 3WF1A 3MV11 5JBDA 2V5DA 4AZ5A 2Z1SA 3K8LA 1DP0A 3FN9A 3WD3A 5A8OA 3SCVA 2J7GA 1PZ3A 2CHNA 2WVUA 1K9TA 1AVAA 1GQLA 1VFUA 3S2CA 3ARTA 2WBGA 4Y7EA 1QNSA 1W91A 1PEZA 2CEQA 2DSUA 3VVGA 4TXEA 4JHZA 3IAPA 3W0KA 4U33A 1VAHA 2PWHA 2V3FA 5EBAA 1QI4A 5GNXA 2WAGA 2WLYA 1NWSA 3WF0A 4OBSA 3N1AA 4UQ9A 3T09A 1EQCA 1SFSA 5ECUA 2XHYA 1Q6FA 1OT2A 3NIYA 1L8NA 1OBAA 2PF0A 3FW6A 1V3KA 3GXIA 2VX4A 3KE0A 4MB1A 4BQ2A 2E9MA 1HKIA 4DUXA 1OSEA 1EOMA 1KB3A 4M81A 3CHCA 1Q6EA 2WKLA 5D9PA 4TTGA 2DSZA 4W85A 2VX5A 1C93A 5A2AA 4J27A 1ESWA 2NT1A 4UFMA 1E71M 2WWDA 2G3JA 4HPGA 1ZU8A 3UR7A 4D6FA 1XH0A 3MU7A 1UWSA 5I23A 1GVIA 4PMDA 1W9UA 4ZEPA 2VRKA 1XCXA 5GQBA 2J25A 1BVZA 2W63A 2J75A 1PJ9A 5I6SA 2WMIA 1EOKA 3LPPA 4U5KA 4ZE4A 1UOKA 4XX6A 3I3EA 3OZOA 3PBGA 4JKKA 2PI6A 3PZGA 2XSAA 3T0BA 4HMCA 1KXQA 2YA2A 1R7OA 1O7AA 1E5NA 3AIRA 2WVSA 1EH9A 4PTVA 5BXTA 1V6WA 1UG6A 2EPKX 4FF5A 3SIMA 1WB0A 5A8NA 2JIWA 3PHAA 3AYSA 1CIUA 4TVDA 1KBKA 4CU8A 2FGZA 3WDHA 3TONA 1CGWA 2E8YA 3WF3A 1V0NA 4NI3A 5FKYA 1UWUA 5DO8A 4CVWA 2ZXDA 1E4LA 3ALFA 4P8UA 3ALGA 1R86A 4XUYA 4ZFMA 4Z2LA 2XTKA 2X2YA 3SCRA 2J8FA 1WDSA 2WMHA 4UTFA 2WC7A 4PMOA 4MNLA 3AXHA 1G01A 3GDBA 3ARZA 3G6LA 4JFWA 1CXIA 3OA5A 3RM9A 3RIKA 2EO7A 4H2CA 1VENA 5CSUA 1NWTA 1GOMA 4E4PA 5CLWA 2CBIA 1NP2A 4CD4A 2BVDA 1GOKA 3W4RA 1UQZA 3ZQ9A 2Y5EA 5JH8A 1FFRA 1J0HA 5A8PA 1CEOA 4AZ6A 1HP5A 1U30A 2Q8XA 3HMCA 3ARPA 5CZKA 4AZCB 3UG3A 1GPFA 3N13A 3VIJA 1RPKA 3QOMA 3AISA 3DECA 2WSKA 1MYRA 2HISA 4WK9A 1E55A 4EAMA 1W3KA 3GXMA 4LGXA 4W93A 5ABEA 3K1DA 4ATWA 1R8LA 3OLDA 1J01A 2J62A 2GK1A 2VRJA 1JYVA 3F5JA 1JFXA 3EDDA 1C90A 2ZUWA 1GZJA 2WK2A 4M82A 1W9PA 4MB4A 5IDIA 4AEFA 1OGSA 4UFLA 4CD8A 3QHNA 2XVGA 3N15A 2DIJA 4D6HA 3U5UA 4E8DA 1JZ8A 4QCEA 4GI9A 1UR1A 2ZXAA 2VCCA 4J3XA 1R87A 1OGGA 1TMQA 5D9MA 1WZMA 1Z32X 1KWGA 3ZM8A 1E6PA 2XPKA 3AIBA 4UOZA 1FHLA 2DH3A 3I3DA 1E3XA 3QOKA 2ZOXA 2XIBA 3VIPA 1H4PA 6A3HA 3WY1A 1E0XA 1WP6A 2ESCA 2XWDA 4FLOA 1V6VA 1JZ3A 4CU6A 5A6LA 2RGMA 1GW1A 3B9AA 1HL8A 1E3ZA 3M6DA 3WNKA 4DWSA 1D2KA 2YDRA 4GO9A 3VIHA 4ACYA 1JDCA 3DYMA 1ISXA 3FXYA 3BSHA 1G5AA 1JD7A 5M03A 1H09A 2Y8KA 2WHMA 3OLGA 4W84A 1B0IA 4BA0A 2V5CA 1W9VA 1WCGA 1E6NA 4UFHA 3K4AA 5CLTA 3DC0A 2CBVA 3EDFA 4QDMA 9CGTA 3GH4A 3WDQA 1UYQA 4OBRA 4PSRA 5BYWA 3AHVA 5A95A 3W38A 4D1JA 1MXGA 4MAZA 3SCPA 1Y7VA 3FHQA 2WVVB 4HP5A 2CCRA 1EIBA 2WHLA 1EDGA 2WC4A 1JGIA 1MQRA 2X8RA 1W2VA 4MJ2A 4HOXA 2XGBA 3EYPA 3O9NA 1E56A 3EMQA 4HOWA 1KCKA 3GYCA 4JKMA 3KZSA 4DM2A 4L4PA 5C70A 3ZT6A 1YQ2A 1CNVA 4WKAA 1J12A 2DEPA 5I24A 1QI3A 4S3JA 3BAXA 1BLIA 1HJQA 2CHOA 5CSYA 2DT1A 4Z2IA 3AYRA 1VEMA 4MNMA 1Q6DA 3RM4A 4KGLA 4PTWA 3ARWA 5C71A 4XB3A 3FHAA 3IK2A 2WNWA 5HXMA 1AQHA 2W67A 1OT1A 2X0YA 1V03A 1PIGA 5I5RA 3CHDA 3B9EA 1WZLA 2XVNA 4F66A 4IISA 3MMDA 5LYRA 1QPKA 3U5YA 4AZCA 1JNEA 1KGUA 2WCSA 3KEHA 1LWJA 4GXPA 1MW3A 4GIAA 4HMDA 4HTYA 5ABFB 4AIEA 1V0LA 4LYPA 2EPNA 1SR0A 3SCUA
chains in the Genus database with same CATH superfamily
1CI1A 2RJHA 3R7MA 3MKKA 1K70A 3HN3A 1B3VA 1YHTA 4GOAA 2XINA 1Y0OA 1LDCA 1J0IA 2DZAA 4KRUA 2GGHA 1ZJHA 3K13A 1PV8A 2KGJA 1KFWA 2EG6A 4D6CA 4HYWA 2FH8A 1KXVA 4IFOA 4O1DA 1SSGA 2P1FA 1DKWA 3IJLA 3RU6A 5EL1A 3VAVA 4LJ3A 2BLEA 3GBDA 1ME9A 2CLPA 1VFFA 5JBFA 1PS9A 4C6OA 1LQ0A 4DRKA 5HW8A 1TELA 3CGNA 4OJYA 5CPLA 2HNHA 5DF0A 4IMFA 4ATDA 1G1YA 3W2KA 2EAWA 3SURA 3DESA 3KAHA 1JAEA 1ZJIA 1UKOA 2DUAA 1JEZA 3KBNA 1CECA 1XGZA 3ONBA 1GOQA 3TC7A 1F7BA 3H2FA 2YKKA 1S2CA 3SUUA 3VD4A 1QNPA 3MDYB 4L9YA 5AOUA 1SZFA 4OBTA 3S3GA 1GVRA 2PN0A 4WDWA 1EZ2A 3TIMA 2GFTA 5HOSA 2DJLA 1ISVA 4MSPA 5H2ZA 4GVFA 3CHEA 1ZALA 2CLLA 4GQBA 5BRPA 2AGTA 4TVUA 1NF7A 2ZZ4A 4AY1A 1S2UA 2Y5JA 1QOQA 4CN4A 1IEWA 4DWSB 1OIFA 1W54A 2DU2A 3H23A 4A8NA 5CG0A 3GKFA 1ICSA 1F4AA 3E0VA 4W86A 3UETA 1R9HA 3VO0A 4UCFA 5LGXA 3H55A 1ADSA 1F76A 2FYMA 1O6IA 4CKQA 3SR7A 3RX4A 3VGEA 4KPLA 3T4CA 4F48A 4Z42C 2DZVA 4KIRA 4CCDA 1DJHA 1WKYA 1VEOA 1W32A 2VN1A 1W5NA 1HVQA 4ZSUA 2X7WA 1NFGA 2QIWA 5CEWA 3TR2A 3EEGA 3F5LA 3C2VA 1ITCA 2C3ZA 5HANA 1V8EA 5M5DA 3KADA 1EJWC 1Z44A 1W5QA 4B5UA 2YFNA 3WH0A 4DROA 4UQBA 1XQLA 1RBOB 4LUYA 3D47A 5H8UA 1T41A 3JW7A 1ITXA 2AOSA 3HPAA 3MUXA 2PAJA 4MWAA 4Y96A 1B6CA 3FA5A 5FF4A 3AXMA 2DT0A 2VZVA 1FXQA 1E0TA 3OU8A 3B8WA 4M5PA 4O11A 4A3QA 1F8IA 5G1YA 4PC8A 3VKJA 2HPIA 2DH2A 2A3EA 3M1ZA 2VVNA 3OG2A 1H7PA 2EXOA 1ZAIA 4E2OA 4JQAA 4MUPA 2WLZA 2GDUA 1TO3A 3KACA 3W7HA 2XN2A 1ODZA 3FJ4A 3NNTA 2YSWA 2CLMA 4LCRA 5LIXX 5HBFA 4IX0A 5I2UA 3GSMA 2FFIA 4N4PA 3OA3A 5MKGA 3W75A 1IX5A 4W87A 3TWBA 3N2BA 5I06A 4WSJA 1J8VA 3NOEA 2PA6A 4A3UA 4EXAA 3IK4A 2C1GA 4RNHA 3SRHA 1MQQA 1BGAA 1B1YA 1YPXA 1X6NA 4DYKA 1TIWA 4JX6A 2ZX8A 3COTA 4NL1A 3OODA 2DIEA 1WKEA 3FYYA 5HNNA 4GNKB 4YNGA 4RZ5A 1OC5A 1YNQA 3H7UA 4IJRA 1H51A 3P3BA 2WWCA 4TX6A 3I4KA 4D8ZA 2JEQA 2E1WA 4LAKA 2VDHA 1LCOA 4IQLA 3URQA 1XUUA 4C1LA 2VX7A 2GDVA 3B06A 2HNEA 4DF2A 1BYDA 3PC0A 5D9NA 1U1HA 3JZEA 1C92A 3OEXA 1JZ2A 3T07A 1NFPA 3GNNA 4ZQNA 4O8AA 5TNVA 4PRRA 1LZOA 4MYAA 1H0GA 4ZOCA 4G8TA 4L1GA 2Z24A 5G2HA 2J4GA 2OKOA 4CCZA 1NMWA 4Q8PA 4JXCA 3HG3A 2FVMA 2OEJA 4UQEA 3WF4A 3CLWA 3UNDA 1K6WA 1US2A 3HQOA 4GY0A 4QSHA 4FP1A 3R13A 2VGFA 1PDZA 2CLIA 3CAWA 4NRRA 1B3OA 4JN8A 3FNDA 4FR1A 5CPMA 1EP2A 1PZ2A 3O6DA 3NZPA 1KM0A 1ZBKA 2BSLA 2QJNA 4X60A 3N9SA 2DDXA 1LL4A 4DUVA 4W7VA 2Q71A 1SO5A 5DMMA 1UUQA 2Z1BA 1ONRA 4HA4A 1FH7A 3CUJA 2XM2A 1IT7A 2X1IA 4PB3A 5HMFA 3W37A 1BGGA 4L3NA 4IG2A 2DG4A 2PDUA 2Y7EA 2YR1A 3CB3A 1ZSXA 2V2HA 3MUZ1 1XYCA 3LSCA 1TCDA 2ZA2A 5EGRA 1TFVA 4FPSA 3PUOA 1CLXA 4FMVA 1J5TA 3GQYA 1TV3A 5LZLA 2E68A 3UWVA 1FKTA 4P7LA 1WE5A 2D3LA 4HN4A 5C55A 3RDKA 3EDJA 5CGMA 1E0UA 2QAPA 1IE7C 1DIEA 2OSXA 3S42A 4BF8A 1MW2A 2PDCA 3GNXA 1E4NA 1OABA 5JQ9A 1S2AA 4HPHA 3B8VA 1IEXA 3TYAA 1K02A 2QCHA 2GVYA 1QI5A 2D73A 1AQFA 1M6JA 1W1VA 1UD8A 4QJ5B 4BQ3A 1DWJM 3VIKA 3GUGA 3PZMA 3TROA 4C6NA 3OTRA 2CERA 4F2BA 1D3GA 3AHXA 1XLHA 4OKDA 5MKGB 5CXPA 4W5UA 4M51A 3KWSA 3TZFA 4QRNA 5EU9A 1PBKA 2G3MA 3S1WA 4O0QA 5HPOA 1X96A 4NJKA 3K2GA 2NQ9A 2H6RA 3OVGA 3TOYA 2QCEA 3FLUA 4IPLA 3OGVA 5CQ1A 1KFLA 3WNOA 3W27A 1ZRQA 1K7XA 1MNZA 4A22A 4XVEA 3TFXA 2W27A 2CNCA 4CQDA 3ODKA 3EB4A 1WUEA 4R7WA 3LM3A 3W28A 2C7FA 3IIZA 3RILA 1J6PA 4E2BA 1OX4B 1ZGDA 2DW7A 2YBTA 5C2XA 4JTEA 2FQIA 3WF2A 1H7NA 1DBTA 4QS5A 4UNIA 3GHSA 1EJSC 4XTIA 4Y9PA 5DIVA 3GHTA 3VK5A 3B9NA 4HZ6A 1L9WA 3CV1A 1KV5A 2Y70A 3O2LA 4Q8UA 1VRXA 5E9AA 3VD7A 3RO8A 4DB7A 1E40A 2VCAA 3I6EA 5KTLA 3EXTA 3TMQA 1XIDA 2WBKA 1G9HA 4PN2A 1RR2A 2J8GA 1D8CA 5TQLA 3KAGA 2YZ5A 4HJWA 2J88A 1WBJA 2XYLA 4ACZB 2OJPA 3PF3A 2Z4GA 1IEQA 4CN6A 1KR0A 1DJWA 1BG9A 2QS8A 1QPRA 2V5BA 3IJ9A 3TCZA 3SGGA 1TX0A 1D7KA 3DHFA 5A69A 4FB7A 3IJ8A 1Z48A 1CB7B 2VC7A 1SPQA 3ZJKA 1UR9A 3BLOA 2ISDA 1E73M 1NQ6A 5K4ZA 4N6EA 2QV5A 3IGUA 4I5RA 4ODOA 2VEFA 1XGEA 5HAOA 4ZPWR 5J04A 4Z2GA 3D3FA 3B0PA 1TPEA 1JZ6A 1HN1A 2I14A 2C0HA 2Y5SA 4C6FA 2FTWA 1L6FA 2PD5A 1RJQA 3MT1A 1BFNA 3QPYA 3A3HA 3MA8A 1KQZA 1HJVA 1I1XA 4EK7A 4JDYA 2V3EA 2B7QA 1G94A 2Q09A 1U5HA 3G1VA 4PR4A 4TYOA 2YCJA 3UWZA 4LSBA 4U2YA 1GOXA 1YW1A 1TPVA 2WJZA 1KM2A 4HHMA 4HU4A 2HEJA 3SCTA 2EPHA 2ZX6A 2XZ9A 1QCWA 2HQAA 3I7RA 3OO2A 1RJRA 1MMFA 2H9AB 3WH5A 4DBWA 3U4AA 3ZS4A 2PU0A 3BE7A 3M46A 4U31A 3PZVA 4C6MA 2OODA 3LV5A 2GZXA 1Q7MA 2EGZA 4PBEA 1A0DA 3T2OA 4GE8A 4BWLC 3VXGA 1TSIA 1XCWA 1L0PA 3IKDA 4K1WA 1KO0A 2YZRA 4DJFA 4O57A 4HA0A 3O5KA 2VNCA 4M1RA 4W9PA 1I2OA 3ABRA 3WELA 3W7JA 3RR1A 3VKBA 3SGZA 3AFBA 1QBBA 2BBFA 1OCBA 3NDYA 3VGFA 3ITLA 3TDBA 3W23A 3ZWTA 3P7YA 3A23A 3G1SA 5FOOA 4NNCA 3V5CA 1DWAM 4J28A 3UWQA 1ZBWA 2QYGA 1WZAA 1KCLA 3GTHA 2OKTA 5I3JA 4QS6A 3JYMA 2W92A 3EKZA 2W9MA 4DXKA 2QQ6A 2OYLA 4D6GA 5F2MA 3ES8A 5A1AA 3BDKA 2PDIA 3E2SA 1TE6A 3FXGA 1HQTA 1TV8A 3TK7A 3B8IA 5LIKX 1QI0A 2J13A 1BYCA 1UR0A 2Y61A 3VI2A 3WNMA 3KVMA 1IXNA 2O9TA 4M19A 4AU0A 3L4YA 1T0OA 3B0UX 1U2YA 4JYFA 1WDRA 1V6TA 1UJQA 4CCCA 3NVDA 3SY5A 4DO5A 1Y8BA 1HNYA 1H1YA 4L7ZA 4O52A 2HXTA 1JNSA 3WBXA 1JYXA 4IQ2A 4Y9OA 4ZFCA 3ZLGA 1R3RA 3FEMA 3AZTA 4ITZA 5REQB 6XIAA 4F79A 3L7RA 1JF5A 4M80A 3KOFA 4ZXLA 1M7XA 4PCFA 2NSOA 4RL3A 3CV6A 4DPQA 4BEUA 5DRCA 5LHEA 1XLLA 1W3IA 4Q6XA 6TAAA 4UZUA 3F5KA 3G8RA 4MADA 5CZJA 4J35A 4Q8VA 4PUUA 3NWRA 4DRQA 3P93A 2IW0A 1LP6A 3BPWA 4C1NB 3A47A 1D3CA 2WMKA 4ZE5A 4NF7A 1XLFA 2ZUTA 3AWOA 3N4EA 3HZ3A 2V3GA 2PDGA 3QZAA 2Y8VA 4HPXA 5LIUX 1XSIA 2DG9A 1AUSL 3S47A 3UEQA 4S3CA 2Y63A 2AAMA 4ZO9A 4DELA 4MKSA 4JYSA 5DX7A 1DQWA 1VFOA 1XIBA 2C0AA 3AHYA 4QDPA 1JZ7A 5G5IA 3AO0A 3ZJ7A 3RFWA 3W7RA 4AXNA 3VC5A 3KRSA 2ZTJA 2EBNA 1UW9A 1ICQA 2O7QA 3C86A 3N4FA 2FTYA 1B9ZA 1SO3A 1SW3A 4UXDA 3T44A 2UY3A 1DXEA 3ITYA 2GLKA 5D8ZA 1P1MA 1YATA 3W7DA 3VIIA 3VNDA 3TN6A 4QIBA 4DYJA 1DXFA 4HYRA 1MW0A 1UOZA 3ZIZA 2A1YA 3WZ0E 2PZNA 4EVZA 3F7JA 2ITKA 3V7PA 1BWLA 1PTAA 3EA2A 3G18A 1CXEA 2BHZA 4WRHA 2VC9A 4Q32A 3BARA 1EJXC 4TX8A 1Q1CA 3PANA 5EMYA 2PP0A 2P88A 3ELFA 2GWGA 3B0YA 2ACUA 5HQLA 3BH4A 1SYTA 2QW5A 1H1ZA 1YADA 3EB2A 3UY7A 4Q8MA 5ABTA 3E12A 2W79A 2V81A 3RX2A 4S3DA 1Q85A 2YXGA 3AC0A 5DLCA 4A35A 5U7SA 1C8QA 3PJTA 3SADA 3N3MA 3G3MA 4OIFA 4GUHA 4R0XA 4GYKA 4ODPA 4WDXA 4EOUA 4DAIA 3M44A 3Q4DA 4MKVA 2Q02A 4H6QA 1W1TA 1FWAC 1UWRA 3QV8A 1UHVA 4JCLA 4Q8NA 1V6YA 3P0XA 4HZ8A 3N9RA 1NOFA 1Q66A 5FCZA 3PFRA 2RKXA 3GXDA 1G4SA 5D2TA 1BVWA 2HROA 1JRCA 4RK8A 4NUWA 1L6WA 4QXIA 4P7OA 4KCVA 3AYVA 3J7HA 4ZOBA 3RMEA 3UGVA 2PGFA 1UD5A 1RA0A 3WL1A 2Y7GA 2MUCA 4PMUA 2WMFA 3O07A 2LGOA 2G95A 4JEJA 4YCPA 4L9XA 3ME3A 2E40A 5I7GA 3CIVA 1VB9A 1A3HA 1F6KA 2X1SA 3TSMA 4FX7A 1XLCA 3A12A 1J6OA 4NSBA 6XIMA 1FTXA 3ATZA 3B05A 2F21A 3UZXA 2DG3A 1BPLB 3MCNA 3BW3A 3AMCA 1GOOA 4E8CA 2FIQA 4QDWA 4ODMA 4O8RA 4K68A 3MO7A 5AYIA 3NSXA 4DQWA 1FWHC 2G5WA 1TV2A 2ZA3A 3TW7A 2OELA 1EF2A 3II1A 3UG8A 1M53A 3S5YA 3G0UA 2VC5A 1W1YA 1ML1A 4IL0A 1F07A 3TWAA 3OPSA 2JFEX 1W26A 4Q8OA 1KM5A 3WO8A 1QPNA 1I75A 3ABZA 3VD9A 1FKKA 1TR1A 2JEPA 2PEVA 4G7FA 4B9YA 4R7OA 1C91A 3CS2A 4WDTA 3QR1A 2I17A 5I3KA 4IIEA 1XIEA 4AYSA 3IRSA 4NI8A 2K8IA 1W8SA 4L72B 3AS2A 1NWRA 5A6JA 2OB3A 4LANA 1Q13A 5FJJA 3TQ0A 3D5HA 3SCOA 2AMGA 3TN3A 1SZGA 3TW6A 3WBEA 1KV8A 3BZGA 1BEUA 2BVTA 4DIAA 5CG7A 1QVBA 4NAFB 3HTWA 3VC6A 2X0HA 2ZR6A 4RDVA 3VMNA 3RYSA 2ZUNA 4DJEC 4DWSD 1KWKA 4TOQA 2GUBA 2ZUUA 4U84A 1G4PA 3HFTA 1EXBA 1J11A 4B15A 4CQ9A 1F6PA 1VCGA 2WYSA 2POZA 4BJHA 4HNUA 3BCFA 1C8XA 4MLJA 2Q3RA 3OBAA 2TODA 4E5TA 3WQWA 3L4UA 4N4QA 1BKSA 1AH3A 3MI3A 3SGUA 4PCTA 4L65A 4O14A 3KDNA 4OVXA 4KQNA 4QFUA 3TJIA 3R79A 1FKRA 1H63A 4YTQA 4GCXA 4H41A 2VURA 1H11A 2Z2BA 4IPXA 2PDWA 4ZB2A 2XISA 1XYAA 1Z3NA 3CAKA 3QRHA 3AI0A 2FDMA 2O92A 3RRAA 1PSCA 5CPSA 4QCFA 2BVWA 3HBLA 1VJSA 3AIWA 1XW8A 4C6JA 2J47A 2WCAA 3FIGA 1J96A 1GORA 4FN2A 1X1NA 2Z7KA 5L6UA 3B8SA 1A5OC 3TA9A 1EIXA 2Z29A 4CQCA 1VRDA 1Q2SA 3R12A 4AHPA 3VINA 4G2DA 1BSIA 2ZUMA 3TP4A 2QULA 1UJPA 3QTGA 1K8XA 2D22A 3AUJA 1OFOA 3THDA 5DIUA 4DF1A 4IT6A 2JGQA 1OY0A 1I0DA 3LM7A 5IXEA 1OCNA 4A3HA 3MW7A 4YU1A 3S9YA 3BGAA 5FEWA 5XIMA 3D0CA 1R38A 4JL1A 1GOIA 1WOBA 2WC3A 5FJOA 4YVPA 1GQNA 1Q6QA 1PAMA 3PG9A 4DO4A 4N6FA 4FIRA 3KFTA 1DORA 2Y8UA 5EMKA 4IICA 3MV01 5AVNA 3MO4A 2DJXA 3AMDA 2J8TA 3BK0A 4QEEA 2GSJA 3QPZA 1CGXA 2RDWA 2B7PA 3G1RA 1P48A 1LF1A 3O3RA 1JI1A 5D32A 4Z17A 4EAYA 5E0FA 3KL3A 2QV4A 5DCBA 5BMXA 5XIAA 1GVEA 3VUSA 1R3VA 5BWFA 1ZP3A 4ZO6A 3GG8A 5E6ZA 4OZOA 2A3HA 4XWUA 1I8JA 3M5XA 4XAGA 2DQWA 3NOYA 4I9MA 2W61A 4E4UA 3BVJA 4JHMA 3AUOA 1BVNP 2B7NA 4J1OA 3H6OA 3IJQA 2QCFA 2LJ4A 2B31A 3WQ4A 2QUTA 3M0IA 3EA1A 4J4NA 1XDMA 3WD0A 4EE9A 4ZMGA 3HPSA 1E5JA 4TIMA 5DT5A 3REQA 5BWAA 4GH3A 1UZ1A 4LUTB 1AD4A 3K4DA 1EYEA 2ABBA 3C3NA 4YVXA 8CGTA 1KGWA 3H21A 1X1ZA 3CB8A 3N4AA 3HJEA 2QCDB 1NOUA 4MY1A 5HPCA 2FHBA 2ZXQA 1EJTC 3V0TA 4AZ5A 4GJ1A 3WD3A 4FAPA 4Q4SA 2CLKA 2F38A 1VFUA 1WX0A 3S2CA 2C18A 3ARTA 1P0BA 3STCA 1QNSA 3KDOA 3UJ2A 3W2UA 1P6BA 2CEQA 4JHZA 3IAPA 5CPNA 3NI6A 3LLXA 3N2TA 3O5MA 2HMCA 1O5KA 1B4KA 1TJ1A 5KITA 1Q65A 1MRAA 5TF0A 4IMCA 3LBMA 4ZO7A 3H4WA 4Y9NA 3T8QA 1EQCA 1SFSA 2PWUA 1SU5A 3OHMB 2OLSA 1WBHA 1LUCA 3W88A 2NVCA 1OZMA 3NQVA 3FW6A 2P0IA 3KE0A 3H54A 3LQLA 1EOMA 5D9PA 5F4XA 3PAOA 3K30A 3V16A 2YCKX 5DY3A 1U1JA 4W85A 1MZRA 2POTA 5C6MA 4H01A 1W56A 2I9UA 4PUNA 2IS7A 2ISWA 1VPQA 4UFMA 3M64A 3FCPA 3KOZA 2KFWA 1D9EA 2XP5A 4F40A 2QDEA 2Z00A 4EXBA 3E74A 3FAPA 4DZ5A 1W9UA 1TCOC 4GFIA 4IIFA 4ZEPA 3EPOA 5G1MA 1XCXA 1T40A 2J25A 3HGJA 3SY1A 4UMCA 1EOKA 3LPPA 2BOEX 5D05A 4ZE4A 1M9HA 2I57A 2MNTA 3PBGA 4GXWA 4GX9A 4GJJA 1K77A 2PI6A 3ITCA 4OT7A 4DI9A 2WJEA 2XSAA 1FCBA 4X2PA 6TIMA 1AW2A 2YA2A 4Z1BA 3WLPA 1YTDA 5LIWX 3GXTA 2KAUC 3AIRA 2WVSA 1W1ZA 2E6DA 3GW0A 2XP3A 1L2QA 4E4FA 2V9DA 3BGGA 1RCXB 3PHAA 4H7CA 4YWIA 3LQGA 4QE4A 4A8IA 3L23A 1W31A 1WKDA 3W7LA 1V0NA 3VYLA 4H9UA 3O0KA 5FKYA 5DO8A 3OOBA 1YDYA 3RHGA 3TNOA 3UF8A 4Z2LA 4JFKA 1CT5A 2X2YA 1EP3A 2WMHA 4UTFA 4B5WA 4E2DA 4PMOA 1IT8A 3CXOA 4XKMA 3GDBA 3PA7A 3M0KA 4DT4A 3C0SA 3QPEA 4D9PA 2XSXA 5AZ0A 3RXZA 2AWGA 1J4RA 3UZWA 3O6CA 1NWTA 3BQ5A 2PP1A 3W4RA 1UQZA 3PJXA 3ZQ9A 5HQEA 5JH8A 1EF3A 1O5XA 2ONEA 3W70A 5SWUA 3GDRA 4YTSA 3G2GA 3F2DA 1GPFA 3V5OA 2QUNA 3OVRA 2WQDA 4YL2A 3AISA 5REQA 4EAMA 1EJVC 8TIMA 1W3KA 3LNMA 1M1BA 1UC5A 4K8EA 1ONXA 4TV5A 4ATWA 3TC5A 1UUMA 3NQGA 2VRJA 3B0XA 3A21A 4EPEC 4ZCWA 1FWCC 3UQBA 2ZUWA 1W9PA 3PP7A 3U0HA 3KCOA 4UFLA 3WJXA 4DRMA 3S5OA 1GGOA 3U5UA 2YPIA 2QIIA 1UR1A 2ZXAA 1JPIA 4J3XA 5HWNA 1TMQA 1OGGA 2QJMA 2XP7A 1DYSA 5D9MA 1TPDA 1WZMA 2PDPA 3MWAA 3ZM8A 3T05A 1E6PA 4UOZA 1Z42A 3I3DA 2RUCA 3SN1A 1PKYA 3PJUA 2ESCA 2NQZA 3HGRA 1V6VA 4FLOA 5CZ0A 4I9AA 3SY8A 1R47A 5A6LA 2RGMA 1X98A 1HL8A 3DKLA 1VC4A 4GO9A 4AQLA 1JDCA 1EEPA 4Y8EA 2E5CA 3KCJA 3A22A 1H09A 2WHMA 3RITA 3NVTA 1Z89A 1B0IA 6REQA 2ALDA 4BA0A 7XIMA 2AGKA 2YCIX 3C0QA 4K36A 1E6NA 4LF2A 4I90A 3DFPA 5CLTA 4LV9A 2CBVA 4OBRA 1EBGA 3AHVA 3W38A 3TQKA 5F4SA 4D8AA 3P74A 3KS6A 4HD5A 5MHBA 4HOXA 1MQRA 2X8RA 3IUIA 3HV9A 1PYFA 4NHVA 4FXFA 1P7TA 1E56A 1LRNA 3MHFA 3EMQA 4LS1A 4PCPA 3GVGA 3NQEA 4L4PA 5C70A 1XISA 3ZT6A 1Q2RA 2OQYA 4QEHA 3FDKA 2CHOA 2NLIA 3TYBA 8RUCA 3DGBA 2PDNA 2XN0A 4KGLA 4BFAA 4PTWA 4E3VA 3P60A 3FHAA 2PV2A 1AQHA 4AY7A 2NQ5A 1XIJA 3B9EA 1WZLA 3LI1A 3DEQA 4IISA 3IVTA 3MMDA 1VKFA 1J2WA 1ROUA 1XX1A 3KEHA 1KKRA 1O5RA 2OEKA 4GXPA 4DHGA 5CSSA 3L0KA 1MW3A 2HVNA 2RJGA 2FDSA 4KCWA 3M5YA 1EGVA 2DZXA 3PBVA 5A6TC 3GU2A 5ABFB 1R46A 1V0LA 2EPNA 2Z27A 5D2YA 3UI4A 4ERAA 3IUHA 1US0A 4CQ8A 3A64A 2GL5A 4AD4A 3TXZA 1NQKA 4J40A 4LU0A 1EDQA 1OINA 4O15A 1XRSA 4EWJA 3GS6A 2X1RA 3NYZA 2P3ZA 1Z7AA 1UBSA 4G56A 2ZRWA 5HW7A 4AIUA 4UZSA 3O05A 3FJ6A 3W7IA 2WQPA 3M41A 1LRQA 3DG6A 1TR9A 4CVUA 1O4UA 1HO1A 2JQXA 1T6MA 2BHUA 2ZC1A 1VFLA 1K3UA 3GTFA 1Z69A 2YBVA 4MFDA 3DENA 1IR2A 4RV8A 3T0AA 2RDTA 3LXBA 1JAKA 1NY1A 2OTDA 3MP4A 4I7UA 3LTYA 4H8NA 7TIMA 3DUGA 1T99A 4Z1YA 3AU2A 2BASA 1Q7ZA 1M5WA 3LS9A 3CNYA 4PMYA 3PRAA 2WZIA 2RSEA 4S1FA 4IXHA 5LA1A 3WEMA 3AOFA 5JH1A 4WOZA 4BEQA 1JF6A 2DT2A 1SFLA 1UQYA 4OE7A 2A3AA 2ASHA 3PRBA 2VFFA 2NX1A 3ZZ1A 2Y0FA 3TSBA 3EXSA 3FSUA 4LB4A 3W29A 1TREA 1UWQA 2NLYA 5BU6A 1NU5A 5A8GA 1VR6A 1OWQA 5JIPA 3CZGA 4MNKA 4JTTA 1MNSA 3IS4A 4JTGA 4GVGA 1MFVA 2BY1A 2TMDA 1QHPA 1UD4A 1K4GA 2Y85A 3EKGA 3V3WA 2Y62A 3SQSA 3ZR4A 2P5NA 1A3XA 3G5EA 1H41A 4ZR8A 5T9BG 1XYZA 1FFQA 4YTRA 3BJSA 3LCWA 1GYNA 1R3QA 2QJJA 5HT1A 3ZR6A 3AHZA 4R9OA 5G4EA 1Y5WA 1PIIA 1ROTA 4XD6A 3AU6A 2FFCA 3PM6A 3RMJA 1QZ2A 3WBWA 1GEHA 3LCLA 1H61A 4H00A 1Q45A 3NM1A 3EX1A 4P61A 3QY8A 1YNPA 1GG0A 2D24A 3UCCA 4EF8A 1THFD 4ALDA 1DJXA 4JFIA 1WQ5A 2A0NA 3CUHA 3VAWA 1CLVA 4DNHA 1BKFA 4R5EA 4X61A 3BLEA 3SUWA 1UKSA 4CNSA 1EPVA 3IJDA 9XIAA 1OK6A 1OFAA 3RCMA 4C6KA 1I1WA 4E38A 1TMHA 2MLYA 1CGUA 2QDHA 3GTXA 4UOJA 3W7GA 4XV0A 3CMFA 4N9EA 3L67A 3UYCA 1NSGA 2O9OA 2AKMA 3ABSA 4GNJA 4IPNB 4RJEA 4P8VA 1TYGA 2HSAA 1IQ8A 4ECLA 4RE3A 3WLHA 1UR4A 2D2OA 2B81A 3C5QA 3CGTA 2A21A 1QK0A 1WXYA 3P81A 3E1F1 4HYVA 4IGNA 2D69A 4Y6GA 3PRDA 1OFQA 5FA5A 4UTMA 4JHOA 3OBEA 3O16A 2E9LA 1VD6A 3DYPA 4KCTA 1UB3A 1EGZA 1OFBA 2NQLA 4INFA 2VI0A 3C56A 1V6UA 4HN8A 2XVPA 4GACA 4MLRA 4QE1A 4PEEA 5HUOA 4HCHA 4GC3A 2DW6A 5JU6A 1G0CA 1WPCA 1H2JA 1VFHA 5A6BA 4Q4RA 3KVJA 3MTWA 3UJRA 1TA3B 4KQZA 4A8LA 1QWKA 1GVOA 3C2OA 3SN4A 5AHLA 4UQCA 4PBGA 3LZ5A 1HJWA 3G0SA 2ATMA 4XD4A 4A4AA 4I6VA 4AWUA 4MUZA 5LNVA 1TPFA 1MUWA 1SVDA 4BQ5A 2OT1A 2WSRA 3R8RA 3T08A 1J93A 3UBPC 1QMLA 4JX4A 4L4OA 1PBGA 1CTNA 5CGQA 1RLDA 3MQTA 1XC6A 3VFCA 3C2RA 4D1IA 1HXVA 4WXZA 1T5AA 3V0SA 1O66A 2CLOA 1F3WA 4NAEB 1GVFA 4NXKA 4H6KA 2XFFA 3TTQA 1XRTA 4MTVA 4NZFA 1FWSA 2OLAA 3INPA 2VT0A 3H4XA 3LX9A 3UXAA 4C60A 4P8XA 2FVKA 3LG3A 4US5A 1E0WA 3WH7A 1C8YA 1EB3A 5CC6A 3T78A 1X8CA 4JN6A 2CZDA 2Q3OA 3G0XA 4DJDD 3N12A 2Q01A 1TVLA 3BC9A 4O28A 1DHPA 1O1ZA 3MI2A 4DO7A 4JIRA 5AYXA 3FA3A 4FX8A 4CNOA 4IFKB 1CXLA 3EKLA 2A7PA 3CL8A 2R8WA 4I7WA 4C90A 5AB3A 1V02A 2VQUA 1B57A 3W7EA 4N9BA 1FWEC 2PGEA 2P53A 4O1BA 3PG8A 2IPWA 3ZOAA 1PWMA 1UR2A 3NZRA 3HM7A 3WLKX 3S5SA 3UA4A 4L1XA 4WY0B 3TYUA 3RLUA 2VXNA 4GQRA 4UNLA 1RY8A 5AC8A 2BX7A 1KT0A 3GG0A 1FBAA 3BMVA 5FJIA 1W5OA 3O15A 4MOZA 3ARQA 3AQUA 4JOMA 5B7YA 3MMWA 1REQA 3CZLA 1X6UA 1NOWA 1P5BA 2HXUA 5GPGA 1E70M 1YMYA 3CUGA 1SQ7A 2RHGA 3G1AA 1ZCCA 4Z0SA 4QLJA 3VGGA 3RF9A 5PTDA 5K9XA 3WG6A 4LVAA 2G96A 1Z9AA 3C4UA 1AJ0A 2CPUA 4MKNA 4JTQA 4KR0B 5JMUA 4R88A 4H8UA 1EA0A 3TU9A 5K7JA 7REQB 3UZJA 4E8GA 2ZRZA 1EKOA 1TTQA 2VL4A 3BAJA 3I4EA 1BL4A 3W53A 3RUBL 2XPAA 2DZWA 2RUSA 1JNTA 2F61A 2ZKMX 1Q5MA 4Q4PA 4LBUA 4LUIA 3AS3A 3E0FA 1XYFA 3MJYA 4XD3A 1RBAA 9XIMA 4WF7A 5IRPA 2ZX7A 3UY8A 4HCDA 1QDSA 4YYFA 2HK0A 5G2IA 3EY6A 3O5LA 4BZYA 4M6PA 1FOBA 5LNUA 2WKJA 3POHA 1B30A 4BY3A 3H70A 1KR1A 4GFSA 4IPJA 1GKQA 3ARVA 4QG6A 1NM9A 4O1CA 3DBNA 3MZNA 2PD9A 4J9JA 3MP5A 2PF8A 3WN6A 4DJFC 1E15A 3HFYA 3URNA 1OZQA 4DBSA 4TTUA 4UTIA 5BOOA 2M2AA 4I5UA 3BGJA 1PE1A 3HV8A 3VD3A 1GZ1A 2V3DA 3CTTA 3GK0A 1FKWA 2D0FA 4CNNA 1E1FA 3IVSA 3CYVA 4OFCA 2REQB 4AYGA 1KFBA 4BKNA 2BOGX 1PKNA 4TW7A 4ML4A 4HNTA 4K38A 1FWRA 3UF9A 4YIWA 4S38A 3WYZA 3KOXA 2B7OA 3JUGA 4X22A 2ZA1A 1RQHA 4S3KA 3R94A 3HGOA 3H12A 2GUUA 4GI8A 2FPVA 1ZPTA 4X2RA 2P8CA 2E67A 1CGVA 4M6VA 2P76A 3GPKA 2A6NA 3B8TA 5GJNA 1SFTA 1B2YA 2CKRA 2KZHA 2R82A 4WX2A 1DXIA 2UWFA 4D6EA 2XVKA 1P6WA 2LLEA 2O0TA 2PTZA 3UI5A 4M6UA 3GNRA 1VF8A 2I56A 4UMAA 3TXVA 3RCYA 3S5ZA 1K7FA 3KM8A 2ZDRA 5C9UA 3DN5A 3NTYA 4H04A 4AWSA 4GGBA 3IIXA 2TPSA 3E5BA 3R58A 4GIVA 3UXIA 1FKIA 2PDYA 1N8WA 4LUJA 3GVQA 3H8AA 4E0CA 3CL6A 1X39A 4FALA 2A3CA 4IIBA 3ZSTA 3R0UA 4R33A 3UD6A 1EA9C 1FWWA 3R0KA 3C2YA 4A8RA 1PX8A 5DELA 4FI4A 4LW7A 3N18A 4TV6A 3GD6A 4F8XA 2EKGA 2UBPC 3QW4B 3WKZA 4CNTA 4OECA 3MYOA 3VNJA 3WQPA 1GHRA 4XAYA 4KEVA 3R4IA 4PFMA 5I78A 4RKAA 1AFSA 2MF9A 4UFJA 3WMSA 1CLKA 3QJAA 5HDRA 3AIUA 4HCLA 2VR4A 3UVAA 3KX6A 1E4IA 2QGHA 1JI2A 2ZICA 2YA1A 4N0RA 3O7UA 3LMZA 4HNCA 3E9AA 5K3VA 3S4TA 3DAQA 2QKFA 4AZIA 2NSXA 3VTRA 1DJYA 4GJIA 1E0VA 1TIMA 1BQCA 2WW5A 1TRIA 3ABXA 1B3WA 2F7FA 2QLYA 1BYBA 1J0ZA 3TC6A 2E8ZA 5I3DA 2G3FA 4GRSA 5I09A 1KRMA 3T55A 2YXXA 1JDDA 4JIPA 3VGHA 2CLEA 3MDWA 3VX0A 4KFPA 3GDLA 1S5NA 3PTQA 1ZL1A 4GUIA 5CC7A 4JTKA 2DVXA 5DEZA 2WPGA 4IFKA 4D2JA 1FKFA 4KF1A 3TNBA 1KFJA 3O5RA 2YDSA 3EX6A 1OVDA 5T9CE 3LGDA 1PCKA 4O16A 2ZZ3A 1JYNA 2VP8A 1IV8A 3PZIA 1N7KA 3GH7A 2A85A 4ZQCA 1A4LA 4KRTA 1FHVA 1QHOA 1US3A 3S2LA 1U22A 4ODKA 3MP3A 7ENLA 3H2OA 4Q3MA 3EGJA 2ADAA 2A4AA 2E1DA 5FI8A 1K8CA 1CB2A 4N02A 4ICNA 4PE8A 2KI3A 4I8YA 1UR8A 2VYOA 4GI6A 3MCMA 1NAL1 4EPBC 1QFEA 1TWSA 1XI3A 2WNZA 1R85A 2AKZA 4J3SA 1Q6OA 4IIDA 2HPMA 1NELA 4RDYA 2VHLA 1XYLA 1KFCA 1YDVA 2UY4A 3B40A 1YE4A 4H6RA 1UA3A 4Y2WA 2OZ8A 2C1HA 5BOEA 3M0ZA 3C61A 1QPFA 3A4AA 2CZFA 1S5VA 1XPGA 3SFKA 4Q6JA 3WEOA 1M5YA 3GNDA 3W87A 3QEZA 2MANA 4GH1A 1T96A 1J9YA 5DXYA 1E9YB 3P8IA 3NL2A 3LNPA 2AQVA 4QAIA 3KOWA 1TPUA 3CC1A 2PPGA 2F2DA 1SMDA 3FA4A 4D8LA 2FMOA 4X9YA 3K4WA 4Z08A 5CAHA 4LY4A 5E09A 4W9OA 2I9EA 1EO5A 2MLXA 4HK5A 1D6OA 1J6YA 2F2KA 4LBSA 4EWND 2VCBA 3HPFA 3WQEA 3REQB 1JUBA 2WMJA 3VKKA 1ZBVA 1E1CB 2AL2A 4AC1X 3VZYA 1F73A 1JUKA 4PUEA 1UR3M 4XUGA 1WDQA 3WJZA 1SZNA 5BRBA 4ACZA 4ZPTR 2XIIA 3TH6A 4A3RA 3DI1A 2G37A 4AX7A 4GY7A 4XZNX 1E4MM 3AALA 3THCA 3M0LA 1FWIC 3VOGA 1WDPA 3M7SA 2R24A 4MHBA 1E43A 1G7UA 1LYXA 4J3VA 1MVYA 3L4WA 5F7UA 2O4MA 3WD1A 2INFA 1HJSA 2J78A 2HBXA 1D7HA 1VCFA 4IX2A 2JGYA 2O56A 3VCCA 2A6LA 3N2MA 3GIQA 5KMYA 4I9TA 1DEDA 1QNRA 1DJQA 3NCOA 1GJUA 3SUSA 3EA3A 1G67A 2CZ5A 1MEWA 3O1NA 1XDJA 3PAJA 1TCMA 1JULA 3WLSA 4AMCA 4DWDA 1ISZA 2D3NA 5AHEA 1JGMA 1QO5A 3U2CA 3EMZA 4B3LA 3DYOA 1CW2A 3LTSA 3M07A 4G1KA 2ISVA 4IJBA 5IBXC 1XIHA 3VNKA 3TR9A 5HUAA 3JRKA 2YIHA 4C6QA 4DN1A 3UP8A 2Y1HA 4U2ZA 3NEVA 2H9AA 2Y4SA 3O06A 2EULA 3OGSA 3EWYA 2D9FA 2LPVA 4XISA 2QUUA 5ABFA 5FJPA 3GB6A 1V0MA 2PDKA 3HIJA 4QNEA 3CIWA 3MMTA 4ZB0A 4YPJA 2EG7A 4MDOA 2VDGA 4MWAD 2WHJA 5H6HA 3OLEA 4LWWA 4FXJA 1NH6A 5HK4A 2OSWA 1UKPA 3BW4A 1X38A 4LPCA 3AJXA 4MWAC 1XIGA 3CQJA 2W91A 4OU1A 1QATA 3MANA 4ZSTA 2QVNA 1XG4A 3XINA 5U4NA 3KAIA 2OX1A 2J77A 1RD6A 3ANYA 3R0DA 1VFSA 3UWWA 2CU0A 2V2DA 3LCGA 3WQ8A 3QMTA 1F3TA 3DZ1A 3TCSA 3S5NA 1QOPA 1F40A 3S9ZA 3VIGA 5BXPA 2FTPA 5A3HA 1R0MA 4OV4A 2JE8A 3N11A 3VM5A 3CQKA 1OF8A 5FF2A 3W02A 4Q4MA 4GUJA 4HARA 1XV8A 2NV9A 1SUXA 4HHLA 3WUFA 3AICA 3V1HA 4AW7A 3MUY1 4G9PA 1Q6CA 3A24A 1JZ5A 3CL7A 3QW3A 5GVJA 3TCEA 1PKLA 5LIYX 3N73A 3OVPA 4D6JA 1OCJA 3Q58A 4AZ7A 4GABA 4JIQA 3KCLA 4FSAA 4U5IA 3RGCA 1E1EA 1OF6A 3HPXA 1JPKA 2NV2A 2NX9A 3GYEA 4O4WA 4RX0A 1OADA 4TX9A 5JIWA 3DHUA 3THQA 2BG5A 4DUOA 1UH3A 3TOPA 3W1UA 3IK8A 4KT2A 4K1GA 4PTNA 3WEZA 5E9XA 3CUFA 1KM1A 5I02A 4JBRA 3VIOA 4EACA 1QNOA 4UTUA 4B2DD 5D2VA 3GTYX 3W7NA 1LORA 3C3UA 4YHGA 4OUEA 1JDAA 3W00A 5IHSA 5F2GA 1NWUA 1RXOB 2X09A 2Z25A 1AJ2A 7A3HA 1CZ1A 1TA3A 5EB8A 4NU7A 3ZT7A 3A3WA 4FNQA 4KRZA 4ODLA 4GI4A 3CAVA 3PZOA 1NTHA 3SCQA 3WUBA 3EWBX 4HVXA 3V18A 1HKVA 1HKMA 3GO2A 5HR6A 5FJRA 5FSEC 1CXFA 3WK1A 1LOSA 4QT2A 1LWIA 3R25A 3QTPA 4IGMA 5DN1A 2OFNA 1WOAA 1X7FA 1UPMB 1X8FA 1XIIA 1GCYA 4DBEA 1MO0A 2FB2A 1UPPA 1BQGA 5FIPA 4KWSA 4IOTA 1OGBA 4WIWA 1VBGA 4NASA 2FZNA 2YCLB 4HBKA 4B16A 1GQIA 3SQLA 4X3ZA 1DWIM 4NZ4A 1GNXA 1Q6GA 2PP3A 3HQPA 4OUIA 4REQA 1F4HA 3NPXA 1OM0A 4IP5A 1ZCOA 5E0CA 3H2AA 3BG9A 1EHNA 3DGRA 4XVDA 2F2HA 1JXKA 1OYAA 3QV7A 3U57A 3PUGA 5I00A 2JIEA 1HZYA 3OOQA 4ERIA 4CD5A 2D20A 4H9YA 4HA1A 4OHQA 4O0ZA 3WDPP 3VKDA 1A7XA 4IXXA 2G8ZA 2J7HA 3GNPA 1A5CA 1YRRA 3PJWA 4A29A 1XSJA 2V5LA 4JKLA 1YYAA 1KRCC 3AMLA 4Q7IA 4MJ4A 4PTXA 3L5AA 4DRNA 1MXSA 2GYIA 4AMAA 2QPSA 2XGIA 5G1TA 4WVXA 5I07A 1UA7A 4GIEA 4BK9A 5AY7A 1PPIA 4U28A 4IIGA 4QHRA 5B7ZA 3MMUA 2R1KA 3WDJA 3VABA 1NF0A 1EPXA 2XIJA 1XFCA 1QW7A 2FHCA 3MUAA 5HKGA 3PB2A 4UR9A 3WNPA 3SJNA 2INEA 4JIEA 2WHKA 3S6OA 4KEUA 4PFHA 2ACRA 2Z1VA 3VX1A 1VIWA 4V15A 3N6HA 5FJTA 4YJ5A 1C7SA 1KLYA 4QTGA 3ANVA 1B3ZA 2GUYA 3N6JA 4GYJA 2G0WA 1RP9A 2M1IA 3VIFA 5F1VA 2G4FA 3OLIA 3EWXA 4ROQA 3P8JA 1FWBC 3UW6A 2YCLA 3WK3A 1KFKA 2WM0A 1V3MA 1ZTVA 3LPGA 4DZAA 3PTDA 1EDTA 3VOFA 4BS0A 1AZ1A 4DNMA 3P14A 3ZVHB 1B4EA 5KEZA 1NVMA 4IM4A 4WSKA 4IMAA 3AZRA 3HA1A 1DQUA 3GDKA 2XUCA 1LLOA 1ZJBA 2C8NA 1DIKA 4AXKA 1Q8AA 1N82A 3TYEA 5H1WA 1VPYA 2GSEA 4AZGA 3TKFA 2I1OA 3RCNA 5E93A 3WF1A 1N8IA 5JBDA 3FN9A 2ZQ0A 1V7AA 1IWAA 3OVQA 2QNEA 3SCVA 2J7GA 5HW6A 1PZ3A 4BI7A 3LRMA 2FAPA 3NR0A 4IIHA 2FZBA 1PEZA 4ZO8A 5FACA 3VVGA 3OZMA 1VHCA 2AQOA 4U33A 1VAHA 2PWHA 3LCHA 4QE5A 4DRHA 1U5VA 2WAGA 3GXNA 4JTAA 2E5DA 1FKDA 4RUBA 3N1AA 3DFSA 1KTCA 3NFUA 4YTTA 3M5ZA 3OYXA 1NEYA 5HJLA 1V3KA 3GXIA 4KIEA 3STGA 3FSTA 4MB1A 4BQ2A 2ZC8A 1HKIA 1R3YA 4DUXA 3VDGA 3CWHA 1HKWA 2GGEA 2WKLA 2DY3A 2Z6IA 4FA3A 4TW8A 4LAVA 5A2AA 4J27A 2NT1A 2L2SA 4C65A 1E71M 4S39A 4NT0A 1OX6A 4LAYA 2YW4A 3TC3A 1A5BA 1ZU8A 1YE6A 4DRSA 5BW6A 4QG8A 3S1XA 1UWSA 5I23A 4HSHA 4FNPA 2VRKA 3QV6A 2FGBA 2J75A 1H7WA 2EG8A 1F5ZA 5I6SA 4LVFA 4HBOA 4P5UA 4B5NA 3GY1A 4XX6A 5C9WA 3PZGA 4E3TA 1MRQA 1MZHA 2ANUA 3T0BA 4A21A 4HMCA 3T7VA 1KXQA 1R7OA 1S3TC 3OHIA 4NYUA 4IP4A 3W2JA 3QKZA 2PCEA 5BXTA 1EH9A 1V6WA 1SZRA 2EPKX 5A8NA 2JIWA 3AYSA 4TVDA 1KBKA 4CU8A 3KTCA 3WDHA 3N25A 1YKWA 2E8YA 2PLMA 3GHUA 3W1NA 5FEPA 4HPJA 2ZXDA 1E4LA 4PZVA 3TYCA 1KM3A 1R86A 4ZFMA 2XTKA 3GU9A 4NAEA 3TJLA 1WDSA 5KINA 1W0MA 1G01A 3SN0A 2GDQA 3ARZA 3PWAA 3G6LA 3OA5A 1GT8A 1XG3A 4NJHA 1IXQA 1VENA 2Z1WA 5CSUA 4GIRA 2ISFA 2OCZA 3Q94A 4TMBA 4E4PA 2CBIA 1NP2A 3GC4A 2BVDA 3A13A 4HSNA 3L0GA 2GOKA 1A5KC 3TQVA 1HP5A 1U30A 2Q8XA 3HMCA 4M6QA 5CZKA 1UC4A 1TTPA 3VIJA 3PPGA 4PULA 1K1DA 3DECA 2XFWA 2F6XA 4W93A 1XKYA 2RUDA 1R8LA 3OLDA 4RPQA 1FY6A 1XYBA 1JYVA 3OYZA 3TJ4A 3F5JA 2V8ZA 3V1PA 3NA8A 5E5CA 4LRSA 4GISA 2E28A 1P43A 2D2JA 4AEFA 1RHCA 2XVGA 3N15A 3TSDA 1DJZA 4E8DA 3BMBA 3UQNA 5CZTA 5C5YA 4TX0A 7PTDA 3QGKC 3TYDA 2KO7A 2VENA 1R2RA 3F4CA 3AIBA 1FHLA 3B8UA 3QOKA 1YPIA 3QC3A 3VIPA 1H4PA 2PDFA 2XWDA 3ORWA 1JZ3A 4CU6A 4UC5A 4LB3A 3B9AA 1E3ZA 3M6DA 2PPNA 2YDRA 2DP3A 4ACYA 1EFZA 5DBUA 3DYMA 2V6AA 2C13A 4AC7C 1QT1A 4PA8A 2XGZA 3BSHA 4GIYA 5JXQA 3ZYZA 1OC7A 1L2UA 4W84A 4MPQA 1WDWA 5HJYA 1Y65A 4UFHA 4QDMA 1S2TA 3GH4A 3WDQA 3LGGA 5BYWA 5A95A 1R2TA 2HS8A 4D1JA 1M7OA 1R3SA 1MXGA 4MAZA 4M0XA 3SCPA 2WVVB 4MJ2A 1L6YA 3TN5A 5ENLA 1ITUA 2O4QA 1RVKA 1NSJA 1TQJA 3GYCA 3KZSA 3R2GA 4JKMA 4L6HA 4DH0A 3B97A 2OX4A 3W86A 1UIPA 1GW9A 2V69A 2GSHA 3Q37A 4S3JA 3LDVA 3MSYA 3BAXA 1KD0A 2ZBTA 3QZ6A 4U10A 1VEMA 1Q6DA 1KKOA 2ZRYA 4KKXA 3ARWA 4FX6M 4DBUA 2W67A 1OT1A 3KBWA 4KFOA 5D75A 1VHNA 2X0YA 3F4NA 1V03A 4XSMA 4OWGA 2R1NA 3KTXA 2GVEA 5LYRA 1Q6RA 3U5YA 5I98A 4AZCA 1JNEA 1Z6KA 4R53A 3GU1A 2WCSA 1HUVA 3N14A 1RUSA 4K2SA 4HMDA 2PDBA 2XIQA 2QCCA 1PWLA 4LYPA 1TWIA 1SR0A 3SCUA 1QPQA 1F8MA 4NJIA 1P5QA 4EF9A 4XZMX 3STPA 3U9IA 1JPDX 2YYUA 4WHBA 3F4WA 4DBDA 2G50A 3TAKA 4W4QA 4AISA 3N3TA 4RDWA 2WSQA 4IF2A 1EBHA 1JCYA 3WQ5A 4IMEA 1UMLA 2RDXA 3IPWA 2NQJA 3AIQA 1OG6A 1ONEA 1B5TA 3M4HA 4ZOEA 2OZ3A 3DFYA 5C9ZA 3RX3A 1CXKA 3IIVA 4W89A 1NARA 3UR8A 1PDYA 3THUA 3M5VA 2F6KA 3UQAA 1JQVA 4O18A 4FNSA 1V51A 4GGQA 2OMAA 3VKCA 2BY3A 4MG4A 2VZTA 2X40A 1S3HA 4LVGA 2E7FA 1WKFA 5DMLA 2PZ0A 2IPJA 3S1UA 1MEHA 4QLKA 4U3AA 4C7DA 2QZRA 1E6ZA 4PH6A 3BOLA 4JQ3A 2BZNA 3WDRA 3AS0A 1R30A 1W3HA 2PODA 4UFIA 3DFNA 2XP6A 4N9CA 4UWMA 3FYPA 3W6YA 1GVYA 3EWCA 3ITTA 4FAMA 1TV7A 1QO2A 4XTDA 1K7EA 1KXTA 3W26A 2PV3A 1EZWA 3MSDA 5HULA 3MKVA 4C6DA 4C6LA 2ZR4A 4H9XA 5HMSA 3TJXA 4R7JA 1JXJA 3V5FA 5GJMA 3TA6A 1CGYA 3W1PA 1EC9A 4IGSA 1H1NA 3R1ZA 1PZ1A 1VH7A 5CPQA 2BS9A 1JFHA 1XICA 4CCEA 1K8ZA 4HA3A 1O1HA 2D23A 4ZZ9A 1R7AA 1TUXA 4KBXA 4MF4A 3EIPA 2FMNA 2BNJA 5BCAA 3L68A 3VNLA 3W85A 3G77A 3BLIA 4X9SA 1ZAJA 4U85A 1GQJA 3WFAA 4J2MA 3EX2A 3NGJA 3LXAA 1LJYA 2X05A 3W7CA 5LXEA 2QCGA 1F3EA 3O5IA 4WKHA 5XINA 4ZODA 2CZEA 4IPPA 3MHUA 4GY1A 2C6QA 3WLOA 3DXIA 1T11A 3LHYA 3ID7A 2XIOA 1DWHM 2LKNA 3E2RA 4CLMA 2P4VA 4CD7A 3BLDA 3IARA 4NY2A 2OLHA 1VLWA 2GVLA 1A5SA 3L66A 1FHUA 3SBFA 3LUOA 2X30A 5EMMA 3KWXA 2IKHA 3NO5A 3WX7A 1LG2A 4LOCA 3PWIA 2OWWA 1ZNNA 3BV7A 3O5PA 4KWOA 1KCXA 4LUTA 3T1GA 4K6AA 2OWCA 2TYSA 4NZ1A 3MDUA 2WSYA 1U5JA 3FKKA 3FX4A 3EMCA 3PTMA 3UWUA 1EJRC 3QC0A 5IHRA 4XAFA 2WM1A 1SZEA 1TPWA 3NSNA 3VCRA 3M6YA 2F8QA 1I2PA 2VFGA 2E4TA 3WQCA 3T0CA 4AZHA 1A5LC 3LERA 3R43A 4LUSA 4ES4A 3WD2A 3EWWA 3T81A 5FSDC 1JDEA 1FD9A 2UV8G 4H7VA 2E9BA 4PRWA 3TTYA 4ZOAA 5D8WA 2O55A 3W2MA 1GQKA 5H91A 2AL1A 4BF5A 2SFPA 3FFSA 3UU0A 1BTCA 3UPWA 2FPTA 2HRWA 4WSHA 3LSBA 3IGXA 4MB3A 2Z2UA 2OSYA 3VGBA 3A4JA 3QQ0A 4DF0A 3PNZA 3LBCA 4UUIA 1KA9F 1OFEA 4QJ1A 5K4XA 1RALA 3GC5A 1P0EA 3LB0A 4PMRA 2NZLA 5GPRA 1XBZA 1LRTA 1A49A 2DQXA 1WYIA 2CC0A 3SB0A 3SRKA 4K37A 3PS7A 4P8WA 3PWGA 4NZCA 2Z2AA 4NQ1A 3TDFA 2IKJA 4TW6A 4GBUA 1MWOA 1ITQA 3HG4A 4GXMA 3UI6A 2EHHA 3U8GA 4IMGA 1XC4A 3NAVA 3NQ8A 4I9JA 5EFDA 1J2BA 2YBUA 2VFIA 2QT3A 3TTSA 2J74A 3VMOA 2BVYA 3T6CA 2PDXA 3L4TA 3BAKA 3ICJA 3NUKA 4PUKA 3C2EA 4JZ5A 1LTDA 1PVNA 4GUGA 5AECA 4O54A 3UJSA 1J4HA 3ARXA 4QJ4B 4DIPA 1X97A 2QMKA 3W71A 3VOCA 2BGQA 2VOTA 3O6YX 1RPXA 3KBMA 2GK1B 4H8VA 4H9MA 3B4UA 1KBBA 4XQ6A 2QJGA 4O50A 3ZFHA 2NT0A 4PMZA 4H9ZA 1XM3A 1N2VA 2XH7A 3N34A 3VE9A 1V3LA 2CESA 1B54A 2V5JA 5D04C 3JU2A 2IQ0A 4XK2A 1B9BA 1EHAA 4MB5A 1OD8A 1JD9A 2VGIA 2DPEA 3L0NA 2PWDA 4JFSA 1WXJA 2XSBA 2VC6A 1MSSA 3BQ6A 3MKCA 3MJMA 1Q63A 5A6SA 1L8PA 1I2QA 3PZNA 2YLLA 5TAOA 4B91A 1RP8A 4IQCA 3QFEA 1KLZA 1ADOA 1QW8A 3WNLA 1Y0EA 2F84A 3NQ7A 1PTGA 3QBUA 1QUMA 5CBJA 4UTTC 4GNVA 2DSWA 2VD8A 6CGTA 3QSRA 5AC7A 2IMRA 2XU2A 3GDMA 4OGZA 4GVHA 5AHMA 4C6BA 1LROA 4G7EB 2BB0A 3ABOA 4W8LA 1E9IA 2FPYA 3GVVA 3PPFA 3Q65A 1TZ9A 1ISYA 3VNIA 2BV9A 4P7QA 3O5FA 3WSUA 4ODRA 2J6VA 1J10A 1XBXA 2J7DA 4CN1A 5HWCA 3BG5A 4HOZA 1F2JA 2WZEA 3DHDA 2PGWA 4S2CA 3ZVIA 2EPLX 3DFQA 1XIMA 4WJXA 2JKPA 4F0KA 1FA2A 4H3DA 3GH5A 3ABQA 2VFHA 3OZPA 4A6GA 3T2PA 1PX4A 3O0FA 1W9BM 4F9DA 1QRQA 1K03A 3M47A 3VNMA 3NO3A 1DIDA 2YL5A 4A05A 4GPNA 2A3LA 4O1AA 1EP1A 1Q4NX 1CENA 3CM4A 3CQIA 1YDOA 3L65A 4AEEA 2DZUA 1EYMA 3HF3A 2XWEA 5HQMA 3CASA 2Q6ZA 4J4KA 4NRSA 1CXHA 3I3BA 1ISWA 2QF8A 3U7VA 2W6RA 2H90A 5LHFA 2CLFA 3FJLA 1V79A 1FKJA 1LBFA 3EWUA 3FVMA 4EKJA 2IPFA 1YEYA 1OEPA 1RCOB 5D02A 1I45A 4WLCA 4O1FA 1V02E 2VQTA 1W3JA 4B9ZA 4JN7A 4B5TA 3LHZA 4LEQA 1A5AA 3LLDA 1I4NA 2OPJA 1I60A 4MJZA 3NGFA 3EOUA 5I79A 4G2PA 1H5VA 3SO7A 4LCSA 1GVSA 5AHNA 2XN1A 2A7NA 3CMGA 5BZAA 2XH4A 3U48A 3SFWA 5A6KA 3QGVA 4DX3A 3B7XA 3WMLA 2PBGA 3LCIA 2GJXB 3R5EA 1H60A 2QHAA 1F05A 2VGGA 2ZX9A 2VFDA 1MW1A 1J0YA 4X63A 4GK8A 3KZPA 1UP3A 4G1NA 4DO6A 3A5FA 5CBBA 3T0TA 4Q8TA 4XD5A 5DQPA 3NRKA 4RDZA 6PTDA 5EKYA 1IF2A 1P1XA 4WGHA 2J27A 3AZSA 5A6MA 4YN5A 4RCXA 3W82A 2XDFA 2DT3A 3CGMA 5FESA 1R3TA 3LYEA 3VDHA 3AWNA 2MLZA 3AS1A 5JBEA 3A9IA 4ASTA 3L2MA 3UGRA 1VZWA 3UPMA 1H5YA 4CEXC 3TTEA 3I10A 4C5YA 4PUJA 1ICPA 1IR1A 1JJKA 1QBAA 5CPTA 4FIQA 1FP8A 2ZTKA 1JCNA 1VS1A 3CZKA 4IQDA 2WMIB 3VDCA 2OR2A 4Z1AA 1VJZA 4O12A 1S5MA 2M08A 4E2VA 1A0CA 3L4VA 5HMEA 5F1UA 3VNYA 1IZCA 5TD4A 2ZXBA 4MMWA 2ZWZA 1K9DA 3UXDA 1QK2A 4YXGA 3TTOA 1D3HA 3UZYA 1QPLA 1YPFA 2OO6A 4LH8A 4JTIA 1V7YA 3P62A 2ON3A 4ICCX 2QCLA 1YBQB 4HZ7A 1CGTA 3GM8A 3LZ3A 1W5PA 1G4EA 2J7BA 4JTRA 1UD6A 4KFNA 4US6A 4LNCA 3UG4A 3C2FA 4DLMA 4JYDA 1KBLA 2ZQUA 1U33A 4NNRA 5FAJA 1U83A 4AEOA 1T7LA 4DLFA 4MIMA 3O5DA 3NZ1A 1W1PA 2PURA 1DPMA 2OZTA 2VR5A 1QU4A 4ONVA 3GXFA 3GZAA 3SCNA 1TB3A 5F2LA 1JDFA 5FF0A 4Z0JA 4QSFA 2PSNA 3QVQA 1QNVA 3W7PA 2YL9A 3H53A 3BSMA 3FAWA 4HSOA 2E6YA 3W1MA 3HURA 3TQPA 1NFBA 1PKMA 2XVLA 4C6IA 5BNKA 1X6LA 1IEIA 3O5EA 2CW6A 4ZL1A 1UKQA 1B3YA 3MHGA 2FGLA 1PIFA 3CQ0A 1LBMA 3NPVA 1E6XM 3G1YA 2ZZ5A 1OC6A 3CK5A 3CPRA 5HJXA 2GQAA 3GNOA 1HXJA 3EBVA 4TQTA 3S6DA 2Z7GA 2FHFA 4GZEA 4J7RA 3MUIA 3KXQA 5M17A 3PUDA 3HQ1A 4V1XA 2VM8A 3EB3A 2OG9A 3LHWA 3CEUA 3NZQA 5I03A 2G41A 4Q7NA 1S46A 2OQLA 3K8KA 2IQTA 3L4XA 2BMBA 3QN3A 4F0SA 1DJNA 3P5YA 5LNSA 2UZ5A 1K6AA 2DFAA 1UBPC 4UTHA 1FDYA 5HWJA 4DZIA 3W72A 3ZJ8A 4W8AA 5M2FX 3L2IA 4O10A