2QF8A

Crystal structure of the complex of buffalo secretory glycoprotein with tetrasaccharide at 2.8a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of Buffalo Secretory Glycoprotein with Tetrasaccharide at 2.8A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 119
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2qf8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qf8A01
2D23A 1LG2A 1KQYA 2QPSA 4XX6A 3WD1A 3ARZA 1UWSA 1QNSA 4AIEA 3KWXA 1Q6GA 1J0KA 4GO8A 4LPCA 3VGEA 3L4TA 1AQ0A 3RILA 5EFDA 3WNLA 4UOJA 2IXVA 3WENA 4M80A 1MQPA 1ISWA 1CGVA 3N15A 3N12A 3A47A 1ISZA 1NWRA 1GHSA 3ZT6A 4AD3A 3NSNA 2D0FA 3K4DA 2WZHA 1VFOA 1VF8A 3EDFA 3NIYA 5A6JA 4JFWA 4W87A 3ARXA 3GBEA 2WMFA 3KL5A 2NT1A 2XVNA 1E4NA 3AROA 3CZ8A 5I2UA 3VX0A 2UY2A 1X6LA 2YDSA 1UKQA 3VIMA 1AVAA 2VRQA 3AIRA 3POCA 1C3FA 4AD2A 5ABFA 4W8AA 5JIWA 4WSJA 2DH3A 3WMSA 3WD4A 2ZOXA 4ZXLA 4PMVA 4EAMA 1W9BM 4PMNA 3PTQA 3GZAA 4B9ZA 2XGBA 4PMZA 5JIPA 3AMCA 4RL3A 1XCWA 4IM4A 4WKAA 1VB9A 4TVCA 1V0KA 1LL6A 2YLLA 2D0HA 4OIFA 3SUWA 5DT7A 5HDRA 1EA9C 3GM8A 2A3CA 2ZX9A 1WO2A 2E3ZA 1OINA 3CUFA 2YA2A 3LPPA 1PEZA 3GNRA 2EQDA 4JHOA 3BGAA 3WF2A 1E5NA 2CBUA 1CXLA 3I3EA 1TA3A 4MNLA 3ZSTA 1CZ1A 3EMCA 5D8WA 4JZ5A 1QBBA 5JBEA 3CO4A 1S46A 3ZR6A 3CZKA 4MDPA 4TTUA 4W8LA 3WL0A 2G4FA 3W6LA 2VC9A 1E70M 4L4OA 1V3LA 1GCYA 2WM0A 1EH9A 1LLOA 4CU7A 1FH9A 2E9BA 1B1YA 3L4WA 4UFLA 2W5FA 1W9VA 3O6AA 3OZPA 4MADA 1KGUA 1ISYA 4B15A 3B8SA 1F4AA 4PMQA 5AY7A 3CGTA 3K46A 1KR0A 3ZJKA 4XB3A 1E5JA 1NOWA 2WLYA 2BHUA 1UQZA 4H41A 2VZVA 4Y7EA 3WBEA 5HXMA 2VQUA 4NF7A 5I79A 1DTUA 1WKYA 2NW0A 3GXMA 1FH8A 3L4VA 3IAQA 4U33A 3AXXA 1W1PA 4HA4A 4P8WA 1MW2A 1YHTA 3SUUA 3VINA 1JIBA 5HPCA 2C8NA 2QMKA 1V02E 1CLVA 1OT2A 5I5RA 3CUJA 4YHGA 2BY0A 4CKQA 2DT3A 4JFUA 2VVNA 1E4LA 3T0BA 1M7XA 5JH8A 1SFSA 1JXKA 4AY1A 3ZQ9A 4P7OA 3K8LA 1V6VA 1V0LA 4GPNA 5D8ZA 3CHCA 1XSJA 1BTCA 5CZKA 3AIVA 1UH2A 1UKPA 3IANA 4OKDA 3MUAA 4ZENA 3RJXA 4W8BA 4CCEA 3AISA 1B9ZA 4S3JA 1Q6CA 2VZTA 4DWSA 4J3XA 3UR8A 4AIOA 1E15A 3VIHA 1JZ3A 1JYWA 2V38A 1B3XA 4PEEA 1FOBA 4UQAA 3APGA 3SCWA 2UY4A 1XD0A 2WHLA 1WPCA 1JYNA 1GVYA 2X05A 4U2ZA 1GORA 2JIEA 4P7QA 2WMKA 2EJ1A 5I0DA 2PWHA 4N0RA 1PX3A 4AD1A 2C7FA 5A69A 1B3YA 3WQ4A 1XSIA 5M5DA 1K9DA 1TCMA 1G94A 2DSZA 3DC0A 3I3BA 5A94A 1SR0A 4WKHA 1H0GA 4W5UA 5ABGA 4P8UA 4LYRA 3VDAA 3BSGA 1KCLA 1OIFA 2WBGA 4D6IA 5CGMA 3AHXA 2ZICA 3WH6A 4NI3A 2CKSA 2OWWA 2BXZA 2O9OA 1RH9A 4BF7A 3WDRA 3ARUA 2JEPA 1FP9A 1G0CA 4CVUA 5CSYA 1R87A 3VD4A 2E8ZA 1E72M 3RMEA 1HVQA 2O92A 4NRSA 4MNMA 2EPNA 2VCBA 3AS2A 1V3KA 4JKKA 4TOQA 1UWUA 1ZS2A 4H8UA 4W7UA 1UWRA 3EDEA 3K4AA 1R8LA 1L0PA 1B30A 3PBGA 2AAAA 1HIZA 1JD9A 7TAAA 4C7GA 3ZR5A 1JNDA 4QCFA 2G3JA 1FFRA 1PJ9A 3BAIA 2D24A 3VVGA 1UA7A 5D9PA 4J3SA 4JHZA 2ZWYA 1EDTA 3CMGA 1V3IA 5D9NA 3WNOA 1V0MA 4FK9A 4P8VA 3RJYA 5D9OA 4EKJA 1KGXA 3AJ7A 2DGAA 3D5HA 1HJUA 1V3HA 1LWHA 4U2YA 3VUPA 4B3LA 1NP2A 1LF1A 3VMPA 1CGTA 4GZEA 1HF6A 2BY2A 4H04A 1MW0A 3T2PA 2V3FA 2V5DA 1VFMA 3MU7A 4KGLA 1GJUA 2QPUA 4CD4A 2WSKA 4UQ9A 3W38A 1WZLA 4F9DA 4OZOA 5LA1A 5DEZA 1W1YA 4D6EA 3SUVA 2VR5A 2XJ7A 1W9PA 2E0PA 5D4YA 1JDAA 1WDRA 2XIIA 3CUGA 2VL4A 1GW1A 4J3TA 4PCTA 2G41A 5D9MA 4P8XA 4UNIA 4B16A 2OYLA 1EHNA 3M6DA 1QBAA 4N42A 4PTWA 1KXHA 3AZRA 2O9PA 2XSBA 1HKKA 3ARYA 4JL2A 1QI2A 3IJ8A 1GOMA 4M81A 5FL1A 4ZEPA 2DSWA 3ARQA 1W2PA 3WH8A 1QPKA 2Z1KA 4KWUA 5F7UA 3FAXA 5A6MA 1QHOA 3CHFA 1U33A 1TE1A 3UG5A 1KGWA 2WVTA 1HJVA 1OT1A 2BV9A 4B3KA 5FIPA 2OWCA 2A3EA 5JBFA 4C7FA 4F66A 4IISA 2J77A 3WNNA 1QI4A 3W28A 1J0HA 1NWTA 3AXIA 2ZXBA 1TFVA 3TTYA 3ARTA 4YN5A 2JEQA 3VKKA 7CGTA 1CGWA 3VM5A 4KRUA 4AZ5A 3A6OA 3WNMA 1WE5A 3M46A 5JBDA 1OGGA 4P7LA 3GNOA 1QNPA 2QV4A 1TUXA 5C70A 2AOSA 3THCA 2FGLA 3MMDA 3VIPA 1CENA 2W62A 2Y24A 3WQVA 1BGGA 1CTNA 1J0JA 4W89A 4H8VA 4U5IA 4BZYA 1NOUA 1RPKA 2CPUA 2GJRA 4TX6A 5BXPA 3WELA 1JZ2A 4MB5A 4TUFA 4ACZA 3MUIA 2IXUA 1XHGA 1UA3A 1W1VA 2WZEA 2ZUWA 4W93A 3OZOA 1W3HA 4Z2KA 1VJZA 2WC4A 2A3HA 2EPOA 3B9AA 1UZ4A 2J7CA 2YIHA 4HOZA 1HKJA 2VRJA 3AMLA 1W3KA 5IXEA 1HX0A 4QAWA 3ZJ6A 1NARA 3OB8A 1UR8A 4XZBA 1UWTA 3MS8A 1UQYA 3AXHA 1D3CA 4AZ6A 1E55A 3FN9A 4UQCA 2D0GA 3VGGA 3HU7A 1A3HA 4MPKA 1GQKA 5KEZA 1US2A 5EBAA 3O2LA 4ACZB 3W53A 3WMBA 4GXPA 3TP4A 1HXJA 3WH5A 1HKMA 5C8BB 2PB1A 2DT1A 1VIWA 3NJ3A 4CU8A 3QGVA 3VX1A 2WMIB 1B90A 3ZMRA 2G3IA 5A8PA 3VPLA 1HKIA 3WDIA 1BYBA 1DEDA 1UH3A 2UY3A 4M1RA 3GNPA 3VIOA 4MB3A 4GO9A 2CBJA 2JIWA 3HMCA 2EPLX 3VOCA 2BNJA 3VIGA 1TG7A 1XC6A 1UYQA 1QOXA 1YQ2A 1VEOA 1BG4A 3AICA 1XYFA 1PZ3A 3CUIA 1WZKA 4M8UA 3G6MA 2ZWZA 1J0YA 4JFSA 3MSDA 4J28A 1FHDA 4HU8A 4LQ1A 5A6LA 5BXRA 1AQHA 3WQ5A 3DHPA 1BQCA 2XYLA 3W25A 5ABFB 4A3HA 3AIBA 3FAWA 4MDOA 2PWDA 1UR9A 1MW3A 1MYRA 3VDHA 4H2CA 4M56A 4AISA 4DWSB 4LXFA 3PTMA 2XVGA 4YHEA 2GK1B 3F5KA 4W5ZA 3VIFA 4UR9A 1R85A 1H11A 3AHZA 1H2JA 3MUY1 4NZCA 7A3HA 3RM9A 4JIEA 4AD0A 1E6NA 3ARRA 3N17A 3T0AA 1V6WA 2BS9A 1JL8A 1Z32X 1XH0A 5IFPA 4ML4A 3VO0A 2D20A 1JXJA 5CPTA 3CHDA 1ISVA 5DFAA 4BA0A 4J7RA 3ZJ8A 2ZUSA 4UOQA 3VGBA 1MQRA 1O6IA 3EYPA 3F5JA 1QW9A 2V3DA 3WQ6A 3WMCA 2UY5A 2XVPA 1E73M 2AMGA 1JI1A 1QHPA 2OSWA 2X1IA 2CBIA 2QF8A 2JF6A 1BVZA 5GNZA 3DYOA 3BC9A 2DSUA 3ALGA 5EB8A 3CLWA 4EANA 1LWJA 4J3VA 4UFKA 1UWIA 3SEPA 1OD8A 1JAKA 1JDCA 1PZ2A 2WWCA 3K1DA 2F8QA 3OG2A 4Q7NA 2ZX7A 2WCAA 5A6SA 3VD7A 1BG9A 4D6JA 3CUHA 1ISXA 4KRTA 3GTNA 3AI0A 3AMDA 2DPEA 5JUVA 2CBVA 1C8YA 1MWOA 5IFTA 4IPNB 5A6KA 4A3YA 3CBWA 4AW7A 1G01A 3L4XA 2VX4A 4HZ8A 3WDJA 1C93A 3WKZA 1IT0A 1KWKA 4GQRA 1NM9A 4PUDA 2VMFA 2BVTA 4MAZA 2O9RA 3N9KA 3UERA 2X0YA 1B2YA 1BFNA 4X0VA 4E4PA 1M53A 4QCEA 4E8DA 2E9LA 1TA3B 5I24A 4F9JA 2BXYA 2YJQA 2J7DA 5IDIA 4W86A 4QFUA 1UD3A 3CTTA 1UHVA 3OLIA 2WB5A 3FHAA 3WQWA 2DQXA 2WW5A 2X09A 4PSRA 2YL5A 3RDKA 1CGXA 2HVMA 1NWUA 3SCQA 2VVSA 1MW1A 1CGUA 4HPGA 1MXDA 1E1EA 4CD5A 4PSPA 4DWSC 4RE3A 3WDHA 3BAXA 4ATDA 2FHBA 5E6YA 5I77A 3ARVA 1KXVA 3SCVA 5GNXA 1QNOA 3BH4A 4AZGA 1DP0A 4RE2A 5A6BD 2CNCA 1EO5A 3GBDA 1SMAA 1GONA 1Q6DA 2OSYA 3KZSA 3AIQA 5E09A 1CDGA 1WDQA 3NCOA 1I1WA 1F4HA 3A4XA 2GDUA 2BFGA 2WMHA 1NP0A 3WUEA 1V6YA 5CLTA 1JYXA 2A3BA 4Q22A 1GZJA 2W67A 1K9EA 3NYDA 3BMWA 3WDPP 1VAHA 2WMGA 1W3JA 1J10A 4UOZA 1UR0A 2DDXA 2V3EA 3L2MA 2VCCA 3FNDA 1GOWA 3W27A 1JI2A 3NSMA 1FP8A 5I23A 3WBAA 3EDJA 1JG9A 1R86A 1WZAA 1QW8A 2ZXDA 3NUKA 2OYKA 5CG0A 5CXPA 1HL9A 2GFTA 4GKLA 5A1AA 3A4WA 1V3MA 2BVYA 4TXEA 1GQJA 1Y7VA 3VD3A 2WHMA 1C90A 4FLRA 4GI9A 3WSUA 2DT2A 3WL1A 3ZSSA 1MFVA 1UD2A 3PZIA 2Y2WA 1ITCA 1TZ7A 1JFXA 4D6HA 1HNYA 5BXTA 1E9LA 1VENA 4HMCA 2W61A 4JKLA 1X6NA 1MXGA 2WMIA 5BRQA 2CYGA 2ZX6A 1MFUA 3CZJA 4W88A 2Y4SA 5CLWA 5GNYA 3ZM8A 1PX4A 4AEEA 1ZBCA 2NT0A 3W26A 1CXEA 1G1YA 1NQ6A 4WKFA 1JAEA 1A47A 3PZGA 3N1AA 3KE0A 1CXIA 4PTMA 3PHAA 1JZ5A 3N13A 2FHFA 3RPMA 3GH4A 2XPKA 2ZUNA 3RIKA 1EOKA 1JZ7A 3VGHA 5A8NA 3DECA 4D6GA 3DHUA 1E0XA 4KH2A 2WVVB 4ZE5A 3BCDA 4PBGA 3G6LA 5E6ZA 4UQDA 5A2CA 5I3DA 2WCSA 4CCDA 1QI0A 3WUGA 2J7HA 3T2OA 3FW6A 1D2KA 1OBAA 1J01A 1C8XA 1W9DM 1OIMA 1OB0A 2VRKA 1Q6FA 5FKYA 5I6SA 1NWSA 3K8KA 1KB3A 4UFMA 2XFFA 3AS1A 4AIUA 1CLXA 1KWGA 5HNNA 4LX4A 1BF2A 3PZUA 3SUTA 3WDQA 1TVPA 1AQMA 2VOTA 4AZCA 3THDA 2J7FA 5AYBA 3CH9A 2EPMX 2ZUTA 1QHZA 1WZMA 2CXGA 1GPFA 1PIGA 1CBGA 1ODZA 2WK2A 2ESCA 3FY1A 1GQIA 1WDPA 2D1ZA 3GXIA 1SYTA 1XRVA 1V08A 4ZFMA 1C91A 1J11A 2WHKA 4M29A 4X0NA 3EMZA 5A95A 3W0KA 3VD5A 1EO7A 5EFFA 4WIWA 3NDZA 3VNZA 2WAGA 1K9FA 4XZWA 1JYVA 3UR7A 3W24A 5FOOA 3WUBA 4UZSA 4AZCB 1UD8A 3AHYA 5AC4A 2VZOA 4CD6A 4PTVA 4PN2A 1ZJAA 3GH7A 4E2OA 3EDDA 3VNYA 4IPLA 3PTKA 1GJWA 4LYPA 4D6CA 2WPGA 1VBUA 1I1XA 2E8YA 4HZ6A 5CPQA 3T09A 2ZUMA 3VILA 4D72A 1E0VA 2PWEA 3MSGA 4PMYA 3RO8A 2YBUA 2YOCA 3ARPA 4EK7A 4ZE4A 1HJQA 2J79A 2Y5EA 4R5EA 3MKKA 1E56A 1GOKA 1E3ZA 2J7GA 4FF5A 3ZT5A 4D71A 3WEMA 4DUWA 5BXSA 4CD8A 1OGBA 3AMKA 2VZSA 1BAGA 3QOKA 3AYRA 3B9EA 3AIEA 2BHZA 4UFIA 4JAWA 4WSKA 5A8MA 3DYPA 1OCQA 1CGYA 3QR3A 1OWQA 2YLAA 4JFVA 1XD1A 1ESWA 3MV01 1L8NA 3SCPA 1VFFA 1OGSA 1H09A 2J4GA 5BWFA 2WC7A 1H5VA 4U31A 1BVNP 3L4ZA 4ATLA 5DMYA 2GUYA 4QP0A 3GYCA 2PWFA 4HMEA 3WUFA 2VX7A 3WQ8A 3ARSA 3WH7A 2YA1A 2ZX5A 3WEOA 1JD7A 2IUZA 1IZJA 3II1A 4BS0A 2VQTA 3N04A 3TOPA 3WNKA 4D6DA 1TR1A 4DWSD 3SCTA 1V02A 5ABHA 1JFHA 4OJYA 1HJSA 2W4XA 4HOWA 3VIKA 4UQEA 3PN8A 5A2AA 4W84A 2CETA 3GDBA 2PC8A 4ATWA 4HMDA 2OYMA 3QHMA 2B31A 2WLZA 1ZBVA 4GI6A 3GH5A 1W91A 3N18A 2JF7A 2XWDA 4JFTA 1UD5A 2D2OA 1G9HA 3CZLA 3WY1A 1KBBA 3AFBA 3W29A 3HN3A 1V0NA 1JZ4A 3SUSA 4FLOA 5CSUA 1WCGA 1XYZA 3NDYA 1MVYA 4V27A 3FHQA 4KGJA 2WKGA 3UETA 1EHAA 3EDKA 4CGTA 5KZ6A 3BLKA 6TAAA 1GOIA 3ZIZA 1UKSA 4AD5A 2TAAA 2WANA 4MTVA 4V28A 4PMDA 4X9YA 2J25A 1KXQA 3L4YA 4OOUA 3WNPA 1HL8A 1HJXA 5ABEA 1J0ZA 3ECQA 2Y8KA 1E43A 4Z2JA 1TMQA 2PBGA 5FCZA 4TVDA 3RM8A 4AWEA 1IV8A 1CIUA 3A3HA 2Q8XA 1PPIA 4HA1A 2FH8A 3J7HA 3PZMA 5FD0A 4Z2GA 4A4AA 3B9DA 2F61A 2RGMA 4BQ2A 4P7RA 4OBRA 2Y8VA 1WAWA 2YDQA 4ZXOA 5AYIA 2MANA 3W82A 2XGIA 2J7BA 1W9XA 4PCSA 5ECUA 3M7SA 4KMQA 1J12A 4W85A 2FGZA 3O9NA 4HP5A 4W7WA 1R7AA 2O9TA 3AZSA 2EPKX 8CGTA 1E6XM 2WYSA 2HISA 1CEOA 1J18A 1GOOA 2X0HA 4C7DA 3QHOA 1DWGM 2J7EA 1R7OA 2ZXQA 1PX8A 2W91A 4OOZA 2C0HA 2PF0A 4CU6A 1VEMA 2PWGA 4UTFA 1DWIM 1E4IA 3LMYA 4M24A 1EQCA 5A8OA 4AC1X 3VDBA 1CPUA 2XVKA 1JF6A 5LA0A 4CCCA 4MAVA 1E40A 2GJPA 4CD7A 4QLLA 4J3UA 4QDMA 1P6WA 2CERA 1HVXA 4WF7A 5LYRA 1DHKA 3TTQA 5CQ1A 4AZ7A 4QLJA 3VGFA 2VR4A 2BY3A 3U57A 3VIJA 3ZJ7A 4JCLA 1UG6A 4DM2A 2WSPA 1V3JA 3CZGA 1KFWA 3PZTA 2CIPA 2Z1SA 3IK2A 3PZQA 1W9UA 1RP8A 3VDCA 3FXYA 1E1FA 3BMVA 1EDGA 4HU0A 1QVBA 1V6XA 2YL8A 2QHAA 1KQZA 1H41A 3CHEA 4WK9A 1B31A 4HOXA 3MUZ1 2BHYA 2E9MA 4S3KA 4AMCA 4CN1A 1XSKA 2X2YA 1CXKA 1ZB5A 3MV11 5FL0A 2YBTA 3OLGA 1HP4A 4UFJA 4MB4A 3K8MA 4DUVA 2W63A 1RD6A 3LPGA 1XH2A 1JF5A 1PIFA 4MJ4A 2X8RA 3VD9A 1UKTA 3CIVA 3TTSA 2EBNA 3TONA 4U5KA 2XIBA 4PUEA 5HBFA 4HZ7A 5E0FA 1B3WA 5C71A 1I75A 4HA3A 1E6SM 1EQPA 3CMJA 4ACYA 1M01A 1FHLA 5DT5A 3U7VA 3BCFA 4PRWA 1UOKA 2WHJA 2WVUA 2DIJA 3MO4A 2XHYA 2GK1A 4FLSA 3GXFA 1N82A 2CITA 4TX8A 1ZL1A 4UFHA 3WF3A 4BQ5A 1E6RA 5E9AA 4GINA 2JALA 1HP5A 5DO8A 3VIIA 2ZXAA 1ITXA 4AXNA 3UG3A 4CUCA 3D3AA 3SCRA 1BSIA 1AMYA 2CCRA 3OBAA 4Z2HA 5I78A 2A3AA 3ZOAA 1BPLB 4AD4A 2DSVA 4FMVA 3MMWA 3POHA 1Q4NX 1TVNA 3A4AA 5CJ5A 3PZ9A 3OLDA 5A3HA 3F4VA 3I3DA 3TTOA 1U30A 2WBKA 1BLIA 2QLYA 2YL9A 3ARWA 1ECEA 2XSAA 3U7BA 1E6QM 4H7VA 1H1NA 4AEFA 4OBSA 1FFQA 2VJXA 5HOSA 1XCXA 2D22A 2F2HA 3AHTA 2BVDA 1QI5A 4W7VA 2V5CA 5GPRA 1K6AA 2G3NA 5CPSA 3LPFA 3MMUA 8A3HA 3ALFA 1UKOA 4H8HA 1OD0A 2WCGA 5E0CA 3JUGA 5LA2A 1GVIA 1ODUA 2DH2A 1BYCA 2WMJA 1CWYA 3M07A 3AS0A 2ZX8A 3WFLA 3AOFA 3UESA 5CGTA 5EMYA 1QNQA 1NH6A 1UD4A 1CYGA 2NSXA 2J47A 1BHGA 1X1NA 2EEXA 2GVYA 4Z2IA 1EOMA 4AZIA 4UCFA 5IHSA 4AZBA 4JL1A 4GQQA 1H3GA 3WH9A 5BCAA 2YDRA 2YL6A 1UD6A 3CZEA 4GI8A 1G5AA 2VO5A 3RCNA 5M3WA 3UG4A 4U3AA 5BRPA 1JNEA 1QI3A 3WD0A 2EXOA 1EIBA 1CXHA 3OIHA 2VZUA 3SURA 2VURA 3VTRA 1US3A 1GQLA 1DWFM 3QHNA 3W4RA 4UQBA 2DT0A 1VBRA 2GJXA 2VCAA 4NRRA 3BAKA 1FH7A 3WN6A 1HT6A 4MNKA 1M04A 3PZVA 5E70A 4FLQA 4GZIA 1UUQA 4HPHA 2FHCA 2VUYA 2EO7A 2JE8A 3AQUA 1SMDA 2ZE0A 1LL4A 3L4UA 6CGTA 2VX6A 1H49A 4DM1A 4D1IA 4CN4A 2XG9A 4YPJA 2J62A 4JKMA 1GUVA 5M03A 2WXDM 2FDMA 3AYSA 1VFUA 4PMUA 2CHNA 3ZT7A 1C8QA 1V6UA 3WFZA 2G8ZA 2WC3A 3WD2A 2J8GA 2XM1A 1JGIA 1LQ0A 1DWJM 5BROA 1IZKA 4BCEA 2GSJA 1XH1A 1UR4A 1E6PA 1LJYA 3VMNA 1WP6A 2OLHA 4Z2LA 4PTXA 3T2QA 1ZBWA 3SCUA 1E0WA 4WJXA 3W6MA 4HTYA 1CNVA 2GJXB 3AIWA 2E40A 3AS3A 1C7TA 2WVVA 1EDQA 4NSBA 2VT0A 4QLKA 5TD4A 1GHRA 2JFEX 3GXDA 5A2BA 1KR1A 3AMGA 2DEPA 2CHOA 4WLCA 3OGRA 4PYSA 1GOQA 4PMOA 1MQQA 9CGTA 1LL7A 3SCSA 4GZJA 4URIA 4AZHA 4R27A 1XV8A 3W37A 2D3NA 1H4PA 3WF1A 1C7SA 2WZIA 1JZ8A 3U5YA 1E3XA 4TVUA 4PMXA 2PI6A 1HJWA 2CESA 1E71M 1UR2A 3E1F1 2J75A 2FH6A 1KXTA 3WF4A 1UWQA 4F8XA 2XUCA 3T0DA 1J9YA 4GIAA 5M17A 3N11A 2V3GA 3VGDA 3UEQA 1GNXA 5IHRA 4LYQA 3AZTA 1D7FA 1WDSA 3SIMA 2J8FA 2ZIDA 3KL3A 3OA5A 1Q6EA 1BYAA 2RGLA 3BLPX 1PAMA 4F79A 1OSEA 3CPUA 2UWFA 3SCOA 2WKLA 3OGSA 2ZUUA 4MB1A 4P7NA 2CKRA 3IAPA 2OWXA 1DWHM 1O7AA 4BQ3A 3SCNA 1UH4A 1W3LA 1E4MM 2D3LA 1ZJBA 5A8QA 3F5LA 3VMOA 1WNOA 3S6TA 3S2CA 3AHVA 5BYWA 3LPOA 4XV0A 4OUEA 3WF0A 5HPOA 4D1JA 4D6FA 1ZU8A 2E4TA 3DYMA 3BSHA 3QOMA 2BY1A 1NOFA 1ZBKA 3BAJA 3TA9A 1B0IA 4JCMA 4M82A 5GQBA 4TTGA 1EGZA 3MANA 5A6AA 1DWAM 1VJSA 3ZO9A 2WVSA 1FA2A 1VEPA 3KEHA 2DIEA 4MJ2A 3OLEA 5AC5A 4V2XA 2GDVA 3T08A 4B9YA 2XTKA 2YKKA 3U5UA 4CVWA 1UR1A 2W66A 2J74A 2DSKA 1UZ1A 2XFYA 5A6BA 2VI0A 4U3CA 3BAWA 1RP9A 1JDDA 1M03A 3OGVA 3VM7A 1CECA 3WD3A 1QNRA 2VTFA 3NSXA 4LGXA 1BYDA 3IJ7A 2XWEA 3HJEA 3VU2A 1XGZA 1U2YA 2XM2A 1BGAA 2J78A 3UCQA 2PBOA 2VX5A 4L4PA 3KL0A 4UZUA 4DUXA 3BXWA 4K68A 1B3ZA 2XVLA 2ZUVA 2QMJA 6A3HA 5DF0A 2OSXA 2WWDA 3W81A 1OM0A 3AIUA 1KCKA 4CN6A 1WB0A 4J3WA 1W1TA 1HN1A 4EE9A 2VNCA 1H0IA 2YA0A 2CEQA 3IJ9A 1CXFA 1VRXA 1PBGA 4PMRA 2W92A 1JZ6A 4XUYA 1V03A 1J0IA 3EBVA 3PZOA 3WEZA 3PZNA 1C92A 3BAYA 2XFRA 1B3VA 4BQ4A 4E8CA 4MNJA 1K9TA 4J27A 3L2LA 1EXPA 4RE4A 1LG1A 1W2VA 1KBKA 4AYSA 3RM4A 3WIJA 1W32A 2WNWA 4IUGA 1E6ZA 2G3MA 3EMQA
chains in the Genus database with same CATH superfamily
4BI6A 2VGFA 2ISSA 1MRAA 1ICPA 1KRCC 4K38A 2PDIA 3B03A 4EP8C 4DO5A 3V0TA 2BDQA 1UPMB 3TYZA 5JXQA 2Y62A 4Y8FA 4AIEA 3KWXA 4GO8A 3C3NA 3TZFA 4LPCA 3OW1A 3UZZA 3PBMA 3ANYA 3L4TA 3G1HA 1AQ0A 3UCDA 4LAKA 2VEFA 1MQPA 1AZ1A 1CGVA 1TELA 3CV1A 1REQA 1DIDA 3KBVA 4LAMA 2R1NA 1GHSA 4AD3A 4IQLA 3ZXWA 3I6CA 4JFWA 4W87A 3EEZA 1FKJA 5T9CE 4MUPA 2XVNA 5DRCA 4MZYA 2H8ZA 1TRDA 4YU1A 3VX0A 1V7YA 1X6LA 3GVGA 1X97A 5EMKA 3OVQA 5LNRA 5ABFA 3GZ3A 4JPGA 3O5JA 2DH3A 4WSJA 4AC7C 4ZXLA 3DUGA 4E3TA 4PMVA 1N2VA 5B8IC 3TR9A 3G1RA 2R8WA 5DLCA 4RL3A 3HGJA 1EFZA 3S1XA 3GDMA 3GM8A 3HG2A 4L64A 3NQ7A 1AD1A 3KVKA 2E3ZA 3RU6A 2EQDA 2HVNA 4IGNA 3MVIA 3I3EA 1TA3A 4MNLA 1OFDA 2GOKA 3SQSA 1VYRA 2RFGA 3DEQA 4JZ5A 3ITLA 1QBBA 1POKA 2YPIA 3H4XA 3ZR6A 3CZKA 4X22A 3H53A 4MDPA 4Q4PA 4W8LA 2YW3A 2PDWA 1FWEC 4IOTA 3QY7A 2WM0A 2QR6A 4O16A 4JDBA 4CU7A 3KAGA 4LVDA 3P0XA 2ZR4A 3LGGA 2W5FA 1W9VA 3EA2A 3URQA 3OZPA 4K8HA 5I3IA 2PDNA 3B8SA 1F3EA 5AY7A 3SY8A 4FP1A 2EJAA 4A8RA 5BU6A 4AU0A 3C56A 4R0XA 2DJLA 5GJMA 1OQFA 2VZVA 1W1ZA 5HXMA 3ME3A 2NW0A 4CQDA 2HXUA 3W2NA 3L4VA 4GLEA 4NNCA 1PCKA 1NFGA 1OFAA 4IMCA 3TLQA 3AXXA 3TU9A 3QZAA 1FRBA 1YHTA 3SUUA 3VINA 3OTRA 1KCXA 4OBTA 2C8NA 3R5EA 1FHVA 3TNOA 4MWAA 5I5RA 3V35A 4I5RA 4H9YA 4CKQA 2DT3A 3FYPA 2VVNA 3N4FA 2GSHA 1QPFA 2QCDB 3BMBA 1SFSA 4L1GA 2W3ZA 4AY1A 2VFEA 3K8LA 3B04A 4ZODA 5H6HA 3UVAA 4PB5A 2EF9A 5JQ9A 7ENLA 4MWAD 4OKDA 3MUAA 4ZENA 5GPGA 4J2PA 1ZUAX 5LIKX 3T55A 3TW7A 3QLLA 3TSDA 3EOOA 4DWSA 5DMMA 4J3XA 4AIOA 3R94A 1JZ3A 3S46A 4JTHA 1ITQA 1FOBA 3APGA 4PMJA 4HB7A 2WHLA 3V7PA 1GVYA 1EJ7L 5CH9A 4KWWA 1XLBA 4QIUA 5HULA 3M0ZA 3NPXA 3MA8A 4TU1A 5I0DA 3B3DA 5GJNA 1IEIA 4B5TA 3NWRA 4WDUA 3OQEA 3PPFA 1L6GA 1ZCNA 1G94A 2VN1A 4DZAA 1OJXA 1H0GA 4INFA 1VPXA 4FSAA 5CGMA 4KERA 3E3HA 1UBPC 3WH6A 3Q58A 2C71A 3A12A 2BXZA 4H6RA 3TTEA 4C6FA 2OEMA 1XIGA 3ZLFA 1FQ0A 5DXXA 3RMEA 4YTQA 2P88A 5HR7A 1SW7A 3VE7A 4G7FA 1Q8AA 3R79A 2YCLB 1DJYA 2PWUA 1PTAA 3CV6A 5HR6A 4H8UA 1R8LA 2JKPA 4PFMA 3EPNA 2IW0A 3PBGA 4Y90A 2AAAA 4L4MA 3THUA 1UCWA 3ZR5A 4DUOA 2OO6A 4QCFA 4RLIA 1OC7A 2IQ0A 2RSEA 3VVGA 2GQ8A 4HK7A 4Q8VA 3SSZA 3KP1A 2Y6ZA 2ZWYA 2X7WA 5AB3A 3PAJA 1V3IA 5D9NA 3P61A 4L4LA 1V0MA 4P8VA 2OODA 3L65A 3AJ7A 2B7PA 3LCFA 4U2YA 4N9DA 5CZTA 5E9XA 1ZCCA 1CGTA 2YZRA 3TEVA 1KM2A 4FNSA 1ME8A 1MW0A 4GVFA 3EOSA 4NQ1A 2V5DA 1GEQA 1NFPA 3MU7A 4IG2B 3WQCA 3WLLA 1GJUA 4ODLA 1FKLA 4CD4A 3I65A 3W38A 1RQEA 2KE0A 3WJXA 4JFMA 1I45A 1QDSA 2NWSA 4F9DA 1J93A 5DEZA 1W1YA 3KRBA 4D6EA 2QT3A 4IF2A 5D4YA 3GWQA 4PCTA 2HXTA 4UNIA 4B16A 4HA0A 2OYLA 5C2CA 5EMMA 1B6CA 4HNCA 2YR1A 2PU0A 1KXHA 4GFSA 3BLFA 3S42A 2ZDSA 4LANA 1HKKA 2NLIA 3B8WA 4XVEA 3NFUA 4JL2A 1QI2A 1CCWB 5KTLA 4LAOA 2CFFA 3W7HA 1TO3A 4GIYA 3NZRA 4G9PA 3CWNA 1W31A 3TSBA 4J1OA 1EC9A 4Z1DA 5FEWA 3O5QA 3CHFA 1TE1A 3H7RA 1Q6QA 3LCWA 3UG5A 4XAFA 4UTWA 1HJVA 1F3TA 3EB3A 1TKKA 4B3KA 1EIXA 5JBFA 1TPFA 3W28A 1OCBA 2ZXBA 1TFVA 3TTYA 3BPWA 3LBCA 4NYUA 4YN5A 2Z2AA 3VM5A 4LT9A 3WNMA 4CEUC 4DAIA 4MLJA 3H2FA 2CWXA 4QT3A 4P7LA 2QV4A 3RN6A 5C70A 2AOSA 2FGLA 4JXCA 3W1PA 3P6LA 2Y7GA 4M7TA 4H8VA 4J9JA 4HU3A 3EPMA 4Y9AA 5BXPA 1J6YA 4ZOAA 3MO7A 3N2XA 2WZEA 4KCVA 1C9HA 4W93A 1L9WA 3GO2A 2A3HA 2J7CA 2GGEA 2YIHA 4HOZA 3GW0A 4XISA 4TX9A 1HX0A 3ZJ6A 4UNLA 1VLWA 5AHEA 1MEWA 2V67A 4XZBA 1UWTA 4AHQA 3PJXA 4GH3A 1D3CA 4OWGA 2FPYA 1GVEA 2G96A 2VM8A 1A3HA 1GQKA 1EUNA 5KEZA 4G1NA 1M1BA 2UBPC 3O2LA 2Z1BA 3PUEA 4MVAA 3W53A 4Q3MA 5A8GA 3R13A 1HXJA 3WLSA 5C8BB 1G7VA 2PRMA 2DT1A 3NPUA 4JFKA 1VIWA 2FDSA 3QGVA 3VX1A 2WMIB 6REQB 1B90A 4JFJA 3TVAA 1VS1A 1GJPA 4O28A 3TUUA 2FZ9A 3EXRA 3KCOA 3TKFA 3QEZA 3WQOA 4TYOA 3F4NA 1F74A 4XAZA 3IJLA 1W37A 5CC7A 2JIWA 4RNFA 2EPLX 2BG5A 3VOCA 3XISA 3N4EA 3G77A 4R3UA 1TG7A 4R53A 1UYQA 1XIMA 3W7RA 1WZKA 4M8UA 2PDBA 3PBVA 3M4HA 3WLOA 4IL2A 3SECA 2F23A 1UP2A 2ZWZA 3MSDA 3QH2A 1Y0EA 4ZQCA 1HGYA 4KT2A 5CPMA 3WQ5A 1ECQA 3DHPA 2XYLA 4YVPA 3EWUA 3W25A 3QY8A 3G0XA 5FESA 4M51A 3NZ1A 1K03A 4H2CA 3SGGA 3IUHA 3DFSA 2V68A 3M5ZA 4DI9A 2XSXA 4YHEA 1H61A 2GGIA 4U84A 4XZNX 3AHZA 3MHGA 2AQVA 2ZCGA 3MUY1 5H1WA 2Q5AA 7A3HA 1M7OA 2LGOA 4LAZA 2FFIA 4MKNA 1O60A 2OB3A 3RK8A 5T26A 3W07A 1Z32X 1KKOA 4LUSA 1J79A 3ENLA 5F4XA 3V0UA 5CPTA 4YS1A 4DPPA 1ISVA 3UWWA 4K39A 1HXVA 3TYDA 2WV8A 1KFBA 1O6IA 3W00A 1QW9A 2V3DA 3WQ6A 1GK8A 1JPDX 2UY5A 3RGTA 3JXVA 1QHPA 3DERA 2OSWA 2CBIA 3WLKX 2JF6A 5DX7A 5XINA 3A4JA 1DIKA 1JNSA 5IRPA 1VP5A 1LWJA 4MFEA 4J3VA 1UPPA 1OX4A 1UWIA 2YCKX 1JDCA 2WWCA 1TZZA 3DG3A 2F8QA 1VFHA 4Q7NA 5AYYA 5A6SA 1BL4A 2A7NA 2N87A 4D6JA 1K77A 1PL9A 3AMDA 2BOEX 3DDMA 1L1PA 1GG0A 2Q02A 5XIMA 2GYIA 5AKQA 2QXWA 5BMWA 2E68A 1O68A 1FKGA 4A3YA 1N1AA 3L4XA 4WUIA 4HZ8A 1IT0A 1WDWA 4IQJA 2AGKA 2WSQA 4GQRA 3GQYA 1P0KA 4PUDA 5BW6A 3CXOA 3RG6A 4MAZA 2O9RA 3N9KA 2X0YA 5E93A 1B2YA 3QMRA 4X0VA 4FIRA 3W72A 4BF9A 2PGEA 2J7DA 4W86A 3C3UA 3UPMA 1I2NA 1UHVA 4DO7A 2WB5A 5IBXA 4I6KA 3GDTA 2NSOA 1T41A 4YTRA 5HNRA 2WW5A 4LB3A 1LBFA 2POZA 2QCMA 3S9YA 3FFSA 1VCVA 2WZTA 1SJDA 1CGXA 4P5UA 4DROA 4UR8A 2DG9A 1PVNA 3EY6A 1E1EA 4A21A 4CD5A 3M47A 4IPPA 1VJIA 4H9ZA 3H21A 4GK8A 3T4CA 3UXLA 5G5IA 4ATDA 5FJJA 2R24A 2OZ3A 4H8NA 4FX7A 1KRMA 3TN6A 3B40A 1TX0A 1PYMA 2GWGA 4RE2A 5CSRA 3A9IA 3V1PA 5AZ0A 3KAHA 3AIQA 3NCOA 2PDKA 1NDYA 2Z00A 1F4HA 4PRTA 2GDUA 4H7ZA 4S3FA 3WUEA 2NQZA 3DENA 2KX9A 3AUOA 4Y8EA 3TJXA 4DJFC 1W1IE 2O56A 1GZJA 1TWIA 3NYDA 1VAHA 3W1TA 1O5KA 1J10A 4UOZA 1PIIA 3THAA 3PB0A 1UR0A 1NAL1 2GQ9A 3UF8A 4QJ3B 2D2JA 1LBLA 1GOWA 1WX0A 3EWBX 3NSMA 1MZHA 1LT8A 5I23A 2EHHA 2POTA 3NDOA 1R86A 1QW8A 2BLEA 3H6OA 1RQHA 1QZ2A 2FJUB 3M41A 1UROA 3A4WA 1KT1A 1PSCA 2Q6ZA 4R7WA 1FXPA 4ZA0A 2OEJA 1Y7VA 4ERGA 4JN8A 3N19B 1CX9A 4WGHA 2J8TA 3WL1A 3LBMA 1UD2A 2Y2WA 1HNYA 3G3DA 2VC5A 4NNBA 1WKEA 2GJLA 2W61A 2QYGA 1MXGA 2CYGA 4JY8A 2ZX6A 4IXXA 4MSPA 4M6PA 1PX4A 1I60A 5I7GA 2QGHA 1ZBCA 2NT0A 4R88A 1FKXA 4C6PA 4PULA 1LCOA 4ADUA 1M9HA 3NGFA 1SO5A 1A47A 1TE6A 3O7UA 3KM8A 4FXSA 3N13A 3RPMA 3GH4A 3TN4A 1EX5A 4PA8A 4ODNA 3W2LA 3DECA 4D6GA 4ZE5A 1ZQ5A 4LV9A 3WQGA 3TQKA 4Q8QA 5I3DA 1OC5A 4FIQA 4CCDA 3ANVA 5EKYA 1QI0A 2H9AA 3WUGA 2J7HA 1MEIA 4EX4A 2X42A 2RUCA 4C6EA 1D2KA 4KPLA 4RUBA 1C8XA 1W9DM 1OIMA 2Z0IA 4GFIA 2VRKA 1Q6FA 1NWSA 4UFMA 2HNEA 1FWBC 3AS1A 4AIUA 4JQ2A 2G95A 1CLXA 1W3NA 4ZPTR 3OJGA 3PZUA 4AZCA 1AQMA 3THDA 4KWSA 5AYBA 3CH9A 2EPMX 5BMXA 1QPRA 2QKFA 1R3YA 2QIWA 3P67A 4DQWA 2WK2A 2ESCA 1GQIA 3G5EA 1SYTA 2Y7EA 4ES4A 4FB7A 3NQ8A 3VFCA 2QUMA 8XIMA 3O5PA 3W0KA 1FUYA 5LIYX 3M5XA 3NDZA 5IDZA 1OEPA 1DXIA 5FOOA 3CIXA 3IGSA 3WUBA 4AZCB 1Q63A 3TZNA 3IIXA 4JHMA 4CD6A 2CW6A 3EDDA 4IPLA 3RPDA 4RZ6A 2WPGA 4U28A 4I9TA 4S3DA 1E9ZB 3T09A 2ZUMA 4UTMA 3WO8A 3O16A 4PMYA 1AL7A 3KOXA 4WY0F 1RXOB 4JTTA 1RJRA 2NXGA 2J79A 4F2UA 3E6EA 4HJWA 7TIMA 4FF5A 3ZT5A 4I3GA 4LC6A 1TPDA 2JK2A 2ONEA 4B5VA 1OGBA 3AMKA 2VZSA 1UASA 3AALA 4YYCA 5A8MA 3DYPA 2PDUA 3DAQA 2YLAA 4FAPA 1ESWA 3N6JA 4FZIA 1L8NA 3HIJA 5BWFA 2R6OA 1TJPA 1E1CB 1BVNP 1EQ3A 1OX4B 2HWGA 4ATLA 3EEGA 1UOZA 5XIAA 1L6SA 4HMEA 1E9YB 2VX7A 2GLKA 4OECA 3WQ8A 3WH7A 1T6MA 3OU8A 2ZX5A 4LUTB 3C0QA 3II1A 1AH4A 2VQTA 3TOPA 3RO6A 3AUJA 4D6DA 3I4KA 3SCTA 1V02A 2INEA 1HJSA 1W5MA 3PN8A 2CETA 3GDBA 1XYMA 3PJTA 3T78A 4LUSB 3NQEA 3SFWA 2WLZA 3EX1A 3AC0A 2P50A 2NX9A 3N18A 3E5BA 2XWDA 3GD6A 1G9HA 1DXFA 4AVFA 2IPWA 3FS2A 1V0NA 4NXSA 3KAIA 3UQAA 2C15A 4V27A 1Q2SA 1UJQA 1KLZA 4KGJA 2PDJA 2PWVA 3CL6A 1YW5A 3LI1A 4LTSA 3GU2A 3EDKA 5KZ6A 3S5NA 3I6RA 6TIMA 4Z17A 2QVNA 2WANA 4W9QA 1Q85A 4PMDA 3QV7A 3A24A 5AYXA 4WDWA 1HL8A 1JCYA 1LDCA 3TW6A 2ZA1A 5ABEA 1J0ZA 4GD0A 1TJ0A 4C5ZA 1EP3A 1E43A 4Z2JA 1MEHA 3URNA 3RM8A 4Q8PA 1IV8A 4O1DA 5DITA 1XBVA 1FBAA 4HA1A 1PPIA 3PZMA 5FD0A 3CH0A 2F61A 3KOZA 2NVAA 4OBRA 1DYSA 3TDFA 2WKJA 1W9XA 5ECUA 3LSCA 4NZ1A 3H23A 3O9NA 4HP5A 1ADOA 1R7AA 2EPKX 3TOYA 1E6XM 4ZMGA 1UIOA 2X0HA 1UR3M 4US5A 4JX6A 1DWGM 2CLOA 3AYTA 3UW6A 4G6CA 2W91A 2XDFA 4F2TA 3DOPA 2PF0A 1A5AA 1VEMA 3RRAA 4UTFA 4OT7A 3C2FA 1PHQA 3VDBA 4KEZA 1Y5WA 4HJFA 5FF2A 4QDWA 2XZ7A 2CERA 4WF7A 4MGGA 2Q09A 5LYRA 2R1KA 3STGA 3VGFA 3ZJ7A 4X3ZA 4NZ5A 4C6MA 1PXGA 2RJGA 2C19A 4AG0A 1CLKA 3M0VA 3QR0A 1KFWA 3GTHA 4B91A 3VDCA 1ZP4A 3CT2A 3G18A 3BMVA 2Z6JA 3KHJA 2FQIA 4HU0A 1QVBA 2YL8A 4O0QA 4ONVA 4WK9A 2CZEA 2BHYA 3NXLA 4S3KA 1SO4A 3NI6A 3ZWTA 1ZFJA 3MV11 2YBTA 4A8IA 3V36A 2C6QA 3K8MA 2QV5A 4RZ5A 2QCGA 3E0IA 1YEYA 4JFIA 3LPGA 4U85A 9XIMA 5TNVA 3SIZA 1UKTA 3T42A 3RX4A 3KX6A 5HBFA 1EB3A 2P1FA 1B3WA 3BV4A 3GC5A 2YDAA 4ACYA 3ABXA 2HPMA 1E1CA 4PRWA 3ZLHA 2WHJA 4GX9A 2PLMA 1EF3A 5G4WA 4QS5A 2DIJA 3OVGA 1TWZA 5LIXX 1E6RA 4KIEA 2V2CA 5DO8A 4GYPC 2ZXAA 2EKGA 2DQWA 4AXNA 2MLZA 3UG3A 4EOUA 4O52A 3SCRA 4C6DA 4I7UA 1AMYA 2CCRA 5KSWA 1RVGA 5I78A 4X9SA 1EWDA 3ID7A 3W7KA 1S2VA 3VA8A 4HSOA 4BJHA 3O5MA 3A4AA 4NJJA 3PZ9A 1IEWA 1VBJA 1J8VA 2WBKA 1O5XA 4H7VA 5F2IA 4MZ8A 1RLDA 4RZBA 2D22A 2ZC1A 5HATA 3GS6A 1XM3A 3MW7A 4EXBA 1QI5A 2LLEA 3BOXA 4I7VA 3LPFA 1XCFA 3ALFA 5IOBA 1JCTA 4XWUA 4H8HA 1OD0A 3M0JA 2WJEA 1AH3A 3EX3A 1YRRA 2DH2A 4NNAA 1NF0A 3DC8A 3UESA 2WM1A 1UD4A 3DN5A 2J47A 5HW7A 1X1NA 4IPIA 1O94A 4UCFA 1H3GA 3WH9A 1JEZA 4O8RA 1NMVA 4GI8A 1IXOA 4OU1A 2VO5A 3RCNA 5G2IA 3JYMA 3HPSA 4S3BA 2PPPA 1QI3A 3VOHA 1FKWA 2XP9A 5CBJA 3SURA 1Q6RA 2Z26A 4A29A 3L7RA 3AU6A 1Z69A 3FK4A 4UWMA 4JTEA 4ECLA 3CWOX 3CV2A 1S5MA 4JYDA 5HWMA 2ZR5A 3BAKA 4QBXA 4WSHA 5E70A 5AFDA 1JVNA 3G1FA 1H60A 4GZIA 3OZYA 1L6FA 4HPHA 4IJBA 1EUAA 3AQUA 3UPBA 1SMDA 1U83A 4JTRA 6CGTA 3C2VA 2OJPA 1V93A 1GTEA 4D1IA 4YPJA 1H1YA 2C0AA 4ZB0A 4DJDA 2P3EA 1LM1A 1V6UA 1ADDA 1JGIA 1TV3A 5BROA 1IZKA 4I8YA 1D7KA 1UR4A 4L6HA 1JCXA 4WQ6A 3C52A 5FSEC 3LGDA 1QPLA 2Y85A 4MWAB 4JTDA 3AS3A 1C7TA 2WVVA 3CV7A 2VEPA 2VT0A 4C90A 4DX3A 1AG1O 1JNTA 3MVTA 4XZLX 4JGDA 5I98A 3CL8A 3FA5A 4IHCA 2PODA 2CHOA 3TJIA 1JQVA 4PYSA 4PMOA 3KZ7A 3N6HA 2ZQVA 3E5PA 4RX0A 3KCEA 4PEKA 4URIA 3M44A 2ZZ2A 4M6UA 3JW7A 3P0WA 4GYKA 3W37A 4NZ4A 3AAMA 3VZYA 5CJMA 4HARA 3W02A 1QK2A 1UMLA 4IPJA 2A5HA 1FCBA 1O66A 4IT1A 2CESA 4TX0A 1UR2A 1I0DA 2A1YA 3WF4A 3KOFA 1A7XA 1R0MA 1RA0A 2XUCA 1J9YA 4GIAA 1KV8A 4G2DA 2CC0A 3U2ZA 3EXTA 2ZQ0A 3AZTA 1FWHC 1WDSA 3VKCA 4O54A 1SGJA 1JCNA 4ORMA 3KL3A 3OA5A 2XIMA 1Z89A 3UJRA 2WZMA 1PS9A 2UWFA 3P82A 4P7NA 2FZBA 3OGSA 3KOWA 3IAPA 1A50A 1ONXA 4HHHA 1XIHA 3N29A 4ZB5A 3LTYA 1ZJBA 1E0TA 3S8HA 4JNZA 3F5LA 1WNOA 4UTHA 3A64A 3S2CA 2X1UA 3D46A 1PV8A 3WJYA 4K7YA 1GWJA 4RXGA 4XV0A 1NDVA 3HV9A 2HZGA 4ZTYA 2NZLA 5KZDA 5BRBA 2FVKA 4DEFA 3RXZA 3BAJA 1B0IA 3F2CA 1OABA 4C6QA 3QKEA 2V63A 3WK0A 1ZRQA 3E49A 1TPVA 1FA2A 1VEPA 3T6CA 5DBTA 2E67A 3SY1A 4FNTA 2ZQTA 4MJ2A 3T08A 1W0MA 1GRJA 4RJEA 1TMHA 3A5VA 3U5UA 1UR1A 5B7YA 2J74A 3PBWA 2DSKA 1UZ1A 3NQGA 3LM3A 3LTSA 4U3CA 1F8IA 1RP9A 1M03A 3MUXA 1BVWA 3OGVA 1S2AA 1ADSA 3VM7A 3WD3A 1QNRA 4L6DA 5H8UA 1BYDA 3I6EA 3IJ7A 3HJEA 4V1XA 4U86A 2G37A 1M7PA 3E0LA 1RBAA 1U2YA 2XM2A 2J78A 4O13A 4L4PA 2ISFA 1XDMA 2V69A 3H24A 3BXWA 3FOKA 3RR1A 2XH4A 2QMJA 6A3HA 2WWDA 3TJ4A 1Z7AA 1KCKA 4GGBA 3S0CA 1HN1A 1W5QA 3WLHA 2YA0A 2CEQA 1CXFA 2VWTA 3RNDA 3ZVHA 3GAYA 2W92A 4MYAA 2GZXA 1V03A 3EBVA 4HMNA 3PZOA 1QW7A 1A5BA 4HK5A 4BHYA 1C92A 1J4RA 2DIKA 3L2LA 1WQ5A 2Y7DA 4RE4A 3OHIA 4AYSA 4S3EA 1W32A 3BOFA 5HA7A 3WQEA 2WNWA 3R12A 1B57A 1XLLA 2DZVA 1HW6A 2D23A 3W7GA 3WLPA 3L0GA 3GKFA 1KQYA 4ZO8A 3R8RA 4L3NA 3WD1A 4ADSA 4EF9A 3EGJA 1UWSA 1QNSA 2OT1A 3HPXA 1Q6GA 4B4HA 1R9YA 1PZ0A 1YYAA 3CWHA 3JS3A 3WNLA 2KI3A 3MYOA 3APTA 2ZKMX 4M6VA 4AIBA 3N15A 3N12A 3L5AA 4GVIA 4IX2A 4LVFA 1FWGC 5M2FX 3ZT6A 1VF8A 1TJ1A 3NIYA 5A6JA 3ARXA 2PFHA 1QPQA 3IKGA 4GNJA 1B3OA 3KL5A 2NT1A 3QMTA 3CZ8A 3MJYA 1LORA 5HJLA 2ABAA 2YDSA 1NMWA 3VIMA 1AVAA 1WUEA 2ZA2A 2FTWA 1C3FA 2XZ9A 4H1ZA 3A3WA 2IKJA 3IARA 3WD4A 1WAUA 3WMSA 3NL3A 4EAMA 1W9BM 4PMNA 2QCHA 5HMSA 3GZAA 1J4HA 4QG9A 1XS2A 2GUBA 5JIPA 3AMCA 4IM4A 4WKAA 3S47A 2RDWA 2YLLA 3W2MA 1K8CA 1HTIA 3SUWA 5HDRA 2ALRA 1EA9C 2A3CA 3MI3A 1AJ0A 4EPEC 1OINA 2YA2A 3WLNA 1SSGA 3WF2A 1E5NA 2CBUA 3W71A 3ZSTA 3PNZA 3W1NA 5JBEA 3MQTA 4O53A 3CO4A 5FAJA 4ZQNA 1MUWA 4TTUA 4NI8A 2CLMA 2AWGA 3WL0A 4PRRA 4NJHA 2M2AA 4L4OA 1V3LA 2I57A 1LLOA 2E9BA 3IVUA 5HQMA 3NO3A 1K7EA 2RKXA 4IMFA 1DJIA 3LHZA 4HK6A 4MADA 3CGTA 1BKSA 3SQMA 2ZZ5A 2QS8A 1E5JA 3IJ6A 1NOWA 3SN4A 1Z41A 3F2BA 4ERAA 1PWMA 4Y7EA 3WBEA 3TJLA 5I79A 1D7IA 1WKYA 2QVHA 3GXMA 1PE1A 4NT0A 1FH8A 1VCFA 1W1PA 1TIMA 3P8IA 1OF6A 4HNUA 1HUVA 4FXRA 1AZ2A 1TX2A 1YNQA 2A7PA 3DG7A 4DJDD 3GTXA 5HPCA 4QITA 1CLVA 1XLAA 2OMAA 4CNSA 4E3VA 3LM7A 3CUJA 5DN1A 2BY0A 4JX5A 4OE7A 3GG1A 1E4LA 3T0BA 3HMJG 3TWBA 3DKJA 1PKMA 3ANUA 4R9OA 2OG9A 1V6VA 4GPNA 1R3WA 4HPXA 1XSJA 3EA3A 1BTCA 3UR2A 3B06A 1TV2A 1UKPA 3IANA 1TTIA 1WV2A 4JQ1A 2FKEA 2BMBA 2QUTA 4W8BA 2JQXA 3AISA 1FY6A 1S5WA 4S3JA 1JCJA 1TJRA 1ONRA 2RUSA 3VIHA 3UZYA 1B3XA 1TPWA 3LCLA 1JYNA 1IWAA 2Y63A 4Z1AA 3SR7A 2I7GA 1TV4A 4RNHA 2JIEA 1TPH1 1XXXA 3WJSA 1H1ZA 2ZC8A 4WD0A 3TK7A 1PX3A 2C7FA 2QEZA 3WQ4A 1XSIA 3LDVA 3TCZA 1WBHA 4DN1A 2R82A 5REQA 3Q65A 2PMQA 3I3BA 5A94A 1SR0A 3SRKA 4WKHA 4W5UA 4WEVX 3BSGA 4DHGA 4D6IA 3P74A 3REQB 3SRFA 2ZICA 2WNZA 3T8QA 3GE7A 1YXYA 4MJMA 4HYWA 2KGJA 1QNVA 1RH9A 3WDRA 1O1ZA 3LLFA 1FP9A 3R10A 4CVUA 2FZNA 5CSYA 1R87A 2E8ZA 3K5XA 1DXEA 3NTYA 1XGEA 2VCBA 4ZS6A 4TOQA 1ZS2A 4W7UA 2REQB 1UWRA 3EDEA 1L0PA 4S3GA 3CU2A 1HIZA 3I4EA 3UT0A 2NX3A 2G3JA 3BAIA 4LVAA 3U9IA 5C9WA 2ZRZA 1Z8AA 1Q7ZA 2VEGA 3HO8A 4KRZA 4DBUA 3DBPA 4EKJA 1KGXA 3D5HA 4AEOA 3LHWA 4HNLA 2GVLA 4GZEA 3CAQA 2BY2A 2NVCA 1X7IA 3NPVA 1SZEA 1VFMA 3WQFA 3WBXA 3E74A 2QPUA 1SVDA 5A6TC 3W7PA 1FKRA 1TRIA 4HYVA 2G4JA 1WZLA 3VZXA 2PTYA 2XP6A 3SUVA 3TYUA 3IWPA 4IFOA 4A6GA 2XJ7A 5CC6A 3F4CA 5FJUA 1ZY9A 3KAFA 1KV5A 2XIIA 3LU2A 2P3ZA 3CUGA 3THQA 5BWAA 3C86A 1GW1A 4J3TA 1JUEA 2E1DA 2G41A 2YFOA 4P8XA 2DZXA 3HURA 1EHNA 1HO4A 4IIFA 1A5LC 4PTWA 3SZ8A 3A5FA 1KFCA 2XSBA 2BBFA 2PN0A 3HPZA 3M0HA 5EY5A 4M81A 5FL1A 4Q8WA 2DSWA 3EXSA 3W70A 4GXMA 4F3HA 2X1RA 2YX0A 1Q1CA 5F7UA 2IKIA 5C0QA 1YLVA 4UTJA 3U2OA 3H70A 3TWAA 4N4PA 1X6UA 3DGRA 3S5ZA 4F0KA 2BV9A 2OWCA 2A3EA 4YTUA 2CLIA 4C7FA 4IISA 2J77A 2QJIA 1SM9A 3MBDA 1NWTA 5F1VA 1XYLA 5TF0A 1YPXA 2JEQA 1CGWA 1K02A 3KTSA 2K8IA 5D2TA 4LC8A 1OGGA 2QCNA 3ZS4A 4GVGA 3THCA 4PUJA 1FWWA 1Q13A 1T8QA 2W62A 4PL2A 5I07A 4KR0B 3WQVA 1OK4A 1XRSA 4W89A 1J0JA 2GJRA 3W76A 4LJ3A 3WELA 5C54A 1JZ2A 2IXUA 1XHGA 3QPZA 4C5YA 2DVTA 2XN0A 2EPOA 3B9AA 1UZ4A 3M9YA 3AMLA 5I00A 1W3KA 5IXEA 1NARA 3M5YA 1UR8A 2EG7A 3B8IA 2RDTA 1UQYA 3FN9A 4QXIA 4A3QA 4ZVJA 3VGGA 4C65A 2IS7A 2EKCA 2ANUA 3LENA 2X16A 3C5QA 3H2CA 2C16A 3WH5A 2GGGA 4WXZA 2PB1A 3NJ3A 4CU8A 4MZ1A 3EKZA 4DRNA 1ICQA 1NU5A 1NEYA 2FVLA 1BYBA 2PGRA 2PDGA 1W6TA 5LKYA 2VEMA 4M1RA 1F6YA 3H54A 1O4UA 3Q45A 3WMLA 4DELA 3M5VA 3HMCA 3RLVA 1WKDA 5CBIA 1MNSA 1XC6A 2PBCA 1QOXA 1YQ2A 3PWGA 1BG4A 4AB4A 3CUIA 2P8BA 4DBEA 3M1ZA 4JFSA 3N3TA 2V0TA 1FHDA 4DI8A 2BVWA 4R7JA 5C7VA 1G6CA 1BQCA 5EMLA 4HPJA 1XIEA 3D6NA 1AODA 4MDOA 2PWDA 1MW3A 3TCSA 3VDHA 1H50A 1DJZA 4XUGA 4IGHA 1JQXA 4AISA 4DWSB 1P0DA 3PTMA 2F9RA 2XVGA 2BGSA 4H7CA 1OF8A 1YTDA 4NZCA 3PFMA 4G5DA 3RM9A 1NDZA 4JIEA 4AD0A 5HMDA 3S2NA 3H4GA 4REQB 9RUBA 2D2HA 5TBOA 1V6WA 2BS9A 1JL8A 5CZSA 3WX7A 3IIVA 2ZZ1A 2GGHA 1ME7A 1BTMA 2X30A 4XTIA 3VO0A 3JU2A 2D20A 4YTSA 2ALDA 4IP5A 1EJRC 5AHLA 2QCDA 1JXJA 1XRFA 3PA7A 2I9EA 1P1MA 7REQA 1ZENA 2XIOA 4J7RA 3RLGA 3P7YA 2CZVA 1JDEA 1T0OA 4NX5A 3F5JA 3MHUA 4GC3A 1U1JA 4MWAE 5TQLA 2XP3A 4UR7A 2AMGA 3JR2A 1HQTA 3DYOA 2RURA 3BC9A 2ZRVA 3LCXA 3MB9A 2PPGA 1VFSA 4EANA 4RW5A 1OD8A 3SEPA 1JAKA 4L9YA 5D03A 3IGXA 2WCAA 3T4WA 4NNRA 3BARA 1PYFA 1TPUA 1BG9A 4RNIA 3WBWA 3FX4A 3CUHA 3AI0A 1FWFC 4PUKA 2DPEA 4I5XA 5JUVA 3S9IA 4GY1A 3VKBA 3LI0A 4O57A 5A6KA 1GPWA 4HBKA 1NTHA 4AW7A 4N7QA 2VX4A 4LVBA 4WRHA 1GW9A 1OFRA 4IUOA 5C7HA 3VNJA 3UWEA 1NM9A 1IT8A 1F3WA 3T05A 2JGQA 5HUPA 2BVTA 2DU2A 3MDWA 3O5OA 1VD6A 1J96A 1ZTVA 4E4PA 1M53A 4QCEA 1XLMA 4RR4A 1TA3B 3GVVA 3MUCA 2BXYA 3DKLA 4O17A 2YJQA 3EOLA 1RBOB 1LUCB 3EA1A 2E25A 2PP1A 1UD3A 1TMLA 3GTYX 3OLIA 4M7SA 4O10A 3O5EA 6ENLA 2YFNA 3FHAA 3WJZA 1K8XA 3VABA 2X09A 5BXJA 3GUWA 2YL5A 3WK2A 3RDKA 3MP4A 3T7VA 3NVDA 4H01A 1X1ZA 3TSMA 3SCQA 4EAYA 3A13A 4XD3A 1S2UA 5LXXA 4PSPA 2QJHA 5RUBA 3WDHA 4LYKA 1F9CA 2FHBA 2C91A 2HNHA 3G8RA 5E6YA 3LHYA 5I77A 3OVPA 4O15A 2XH2A 3K2GA 4WJ8A 2BZNA 1FDYA 4AZGA 5CC5A 1SMAA 4XAGA 5FI8A 1I4NA 3BG5A 1GONA 4HD5A 4LUJA 4OGZA 1Q6DA 2BXVA 2OSYA 3QQ0A 3IRDA 3KTCA 3LK6A 1WDQA 1I1WA 1XPYA 3VCNA 2E6YA 5HQEA 2E6AA 1IZCA 1JGMA 1JYXA 3GDLA 4PCFA 4Q22A 1K9EA 3GW3A 2WMGA 2Y1HA 1A0DA 1K4HA 3BZGA 5DIVA 2DDXA 1ZALA 2BASA 3FNDA 1JI2A 3B9OA 1W17A 1FP8A 3CB8A 2Y5SA 4HT3A 3WBAA 4TV5A 4AF0B 1JG9A 1G7UA 3KBMA 5JH1A 1RCOB 2ZXDA 3C0JA 4DLFA 1BEUA 4HCLA 3R25A 1HL9A 5EYWA 5A1AA 3OVRA 2Q3RA 3R89A 3K30A 4FO4A 1GQJA 1IYXA 2H8XA 1EYMA 1V4YA 1J2BA 1UUMA 4GBUA 2Y89A 4GI9A 3CUXA 2DT2A 4DWDA 3ZSSA 2Y70A 3M6YA 1P7TB 4JEJA 2VCDA 3GSMA 4X60A 3O15A 4HMCA 1BF6A 1V77A 1W1B1 1MFUA 3CZJA 2E09A 4W88A 2Y4SA 1LOSA 4WDXA 4N9EA 3W26A 1W5PA 5FJTA 1JAEA 3N2BA 3KE0A 4XSMA 4DXKA 4PTMA 3O0FA 1JZ5A 3W1RA 4PGLA 3B97A 3W7QA 1KM3A 1JZ7A 1DIEA 3BQ5A 3RLHA 2WVVB 2VELA 3OODA 1ELSA 1M65A 4KW2A 3BCDA 3TLLA 4QQ3A 1H7RA 3A9BA 4UQDA 5A2CA 1PKNA 3CC1A 4C1NA 1QPOA 2G5WA 1UC4A 1VQTA 4DRHA 1F2JA 3NL2A 1OBAA 3TW9A 2I9UA 4JIPA 3W1MA 5K4ZA 2YZ5A 3CL7A 3T40A 3PSWA 1DQXA 3NRKA 4JIIX 5AYZA 1OB0A 3LB0A 3LZ3A 3EWWA 5FKYA 1A5SA 4C6CA 3TQ0A 2LJ4A 1J5TA 1KB3A 1S38A 2J27A 3U2EA 4LBUA 4UXDA 3EX4A 3H2MA 1ZCOA 1KWGA 3RLUA 5HNNA 1BXBA 1TSIA 3H12A 4ZBCA 4JTQA 2TRSA 3SUTA 3UYCA 2VOTA 3V3WA 3UXKA 2J7FA 2INZA 4XSLA 4JN6A 2ZUTA 4ZB2A 2PDYA 1GPFA 2PE4A 3WCZA 2D1ZA 1XRVA 2ZR6A 3G1AA 3Q67A 4LS2A 1V08A 4N6FA 4ODMA 2NV2A 4M29A 4NX0A 4C6BA 3EMZA 4YMZA 5A95A 3N2MA 4QE4A 5DIUA 4ZQRA 4G50A 4XAYA 4ZPVR 4WIWA 3MHFA 3VNZA 1GVOA 1QAPA 3LLDA 5AHNA 3UR7A 4IIHA 4LCQA 2ISDA 5DMLA 3QYSA 5HT1A 3AHYA 2VZOA 3GYEA 3SBFA 2JBMA 2KFWA 1K7XA 3GX9A 3HGOA 3GH7A 3VNYA 5CPLA 1GJWA 4AX6A 4GCAA 4D6CA 1OY0A 3H9RB 3FGCA 2Z29A 1VBUA 1I1XA 1I2RA 1XLEA 4HZ6A 4ORIA 3KRUA 5EBUA 3UWYA 3TQPA 2PWEA 3V4BA 1VCGA 1EJTC 5CPNA 3UA4A 1Q65A 2OQYA 2YOCA 3ARPA 4ZE4A 3LRKA 1ZPTA 2V2DA 3LA4A 4R5EA 3OQ8A 1E56A 6REQA 3KLLA 1E3ZA 3H2EA 4QX4A 1DVJA 2PEVA 3PJWA 4DUWA 1GYMA 1U5JA 4CD8A 3CB3A 1U1UA 3AYRA 3QOKA 3G2GA 2BHZA 4JAWA 3BWWA 1A4MA 1A5UA 5D75A 2VC7A 4WSKA 1TQXA 1QWKA 3QR3A 4JTLA 4IIDA 6XIAA 5ABTA 2FLIA 3MV01 4NAFB 4DT4A 3W87A 1VFFA 1OGSA 3QC3A 1XFCA 4U31A 1R5YA 4UTIA 3UCCA 3SJ3A 5DMYA 3QYQA 2GVEA 2GUYA 4QP0A 1GVQA 3GYCA 3ES8A 3WUFA 1F76A 4RK8A 4LH8A 3SQLA 3PP7A 1IZJA 4QSHA 4FPSA 2CXEA 4PCNA 2V6AA 4DWSD 2IQTA 1OK6A 3VNKA 2FIQA 2E6DA 1GZGA 2W4XA 4HOWA 3OOQA 4UQEA 3E38A 4ATWA 2Y78A 3KUMA 4EWND 3KZPA 3QSRA 3QHMA 4ZO6A 3H8AA 4HNTA 3GH5A 4QIBA 4DZ3A 1UD5A 2D2OA 2EGZA 3WY1A 1KBBA 1OVDA 1YATA 4DRJA 2JGYA 3SUSA 3W88A 5CSUA 2O7QA 1YIXA 4O0ZA 4ZOBA 3FHQA 3PUOA 5LHEA 3GNNA 3CO8A 3LUOA 3UETA 5FEPA 1WXZA 3S6DA 3MWCA 1XR2A 1VYSX 3BLKA 3G1XA 1KRBC 4GACA 2C1GA 1UKSA 1QCWA 4AD5A 1Y5VA 4KIRA 3W2KA 2J6VA 4MTVA 3RAOA 2J25A 3DESA 2NQHA 3AWOA 5HKGA 1JPMA 1UBSA 2Y8KA 3NTPA 4JIHA 1U22A 1OZMA 3CPGA 5KZMA 1BWKA 2F4EA 1CIUA 2ISWA 1ONEA 3FKRA 3UGVA 2ETNA 1VBHA 3W1UA 4DBDA 1XUZA 3RU8X 3J7HA 4D8ZA 3RPTA 3H7VA 5C2GA 3SADA 4BQ2A 4HSNA 5FF0A 4HBOA 5AHIA 3PPGA 4IJCA 3W82A 3M7WA 4Z08A 4HBEA 2YB4A 1J12A 2IPJA 3R4IA 4LB4A 4Z0SA 4CCZA 3RF9A 4Q4KA 3O07A 1CEOA 2Q71A 1J18A 3VNMA 4LALA 3AO0A 3GR4A 1FKSA 4YCPA 4C7DA 1ZAIA 4LAYA 1GZ1A 1ZP3A 3USZA 1R7OA 2OFNA 1FKTA 2ZXQA 5FF7A 3IUIA 2DZPA 3FSTA 4CU6A 2PWGA 1DWIM 3UPWA 5A8OA 2Y5JA 1TJ2A 4XG1A 4J4OA 3BUVA 4WHBA 2XVKA 3L68A 1JF6A 2G0WA 1EZ2A 3MDUA 2GJPA 3DH7A 2PPNA 5C9UA 1FCQA 3TTQA 4AZ7A 5L9FA 4QLJA 3E2SA 2BY3A 3U57A 4JCLA 4E4FA 1DJXA 3PBUA 1GVSA 5CKSA 3FYYA 3S6OA 1B4KA 1QU4A 1MNZA 1GT8A 3PZTA 4ASTA 5LZLA 2CIPA 1JCMP 4DIPA 1UZDA 3R0DA 3BLLA 4GGQA 3OYXA 4JQ3A 3N2TA 4O1EA 1FCUA 2PV3A 1PDYA 5K2ZA 3L21A 3E0VA 1KQZA 1LRNA 1B31A 3MUZ1 5AZ1A 3HOJA 2NXIA 3P8JA 4UMAA 2WJZA 1IGSA 4CN1A 1ZB5A 2YXOA 4ODKA 3R8HA 4UFJA 4MB4A 1RY0A 4DUVA 3MY9A 4DH0A 2WJDA 1XH2A 1PIFA 3CIVA 3TTSA 3M0IA 5DCEA 1OHLA 2X41A 1KFEA 3EKLA 3GNDA 3O05A 1KCZA 2J24A 5E0FA 1SZNA 3A22A 5LSMA 1FVPA 1S2WA 4HA3A 4DY1A 1EQPA 5LGXA 2CLKA 5DT5A 4FX6M 1KC7A 4DXVA 2PS2A 3KWSA 3STPA 1UOKA 2WVUA 4WY0B 2PRLA 3L66A 2GK1A 5I3FA 2E1WA 2B5UB 3FA3A 3UQBA 3WF3A 4BQ5A 1QUMA 1FJDA 1KTNA 4WZHA 4KEMA 4GRSA 1Q6IA 3SRHA 1BSIA 5U4NA 1SUXA 3OBAA 5HUOA 3ZOAA 3PK7A 5AOUA 5LNUA 5FEXA 1WA3A 3MMWA 3POHA 4L80A 1TVNA 5A3HA 3NL6A 1BLIA 1O1HA 4ODRA 1E6QM 3BQ6A 1H1NA 3IVSA 1XLGA 3N3MA 4OBSA 1FFQA 5HOSA 1OX5A 2F2HA 3AHTA 4DRQA 2BVDA 1QK0A 4W7VA 3LXCA 4K2SA 2R1LA 4L1XA 5HNTA 5F2LA 4K37A 4ICMA 2MF9A 2VGBA 1AW2A 1I9CB 2M1IA 5E0CA 2IKHA 4N19A 4QISA 3GHSA 5LA2A 2WMJA 3TN3A 1G69A 3AS0A 1TV7A 2HCVA 1XLHA 1QNQA 4S1FA 2M08A 4GY7A 5T91A 2XP7A 1J4EA 3FJLA 3UI6A 4HGXA 3G1DA 5I06A 3CHVA 2XGZA 3DI1A 5BCAA 2YDRA 2ZZ4A 4Q6XA 3CZEA 4W9OA 1G5AA 1L8PA 5H91A 2HMCA 2RAGA 4RDVA 3UG4A 4KF1A 4U3AA 4AWUA 5BRPA 3SGZA 3WD0A 2DFAA 2EXOA 1EIBA 4KCWA 2VURA 3VTRA 1GQLA 1DWFM 3W4RA 4UQBA 4DPQA 5CJNA 3VYLA 1LWIA 4S3AA 3XINA 1FH7A 4EACA 4RDZA 1HT6A 4JBRA 4MNKA 2QCEA 4FLQA 2KZHA 4WGXA 4ZQMA 1UUQA 2EO7A 2KO7A 4K8GA 2ZE0A 1SPQA 4L61A 3KP0A 1H49A 4DM1A 1A3WA 4JTIA 2XG9A 2Z27A 4K6AA 1BXCA 1GUVA 5M03A 2FDMA 3AYSA 1VFUA 4PMUA 3ZT7A 1XIFA 3WFZA 2J8GA 2XM1A 3KACA 4O19A 3UJEA 4JTGA 3KCJA 1KNWA 1DWJM 4FS9A 4LEQA 2GSJA 4M1BA 4NG3A 3HV8A 1E6PA 3UD6A 4UUIA 2OLHA 3T2QA 1ZBWA 4QG6A 4PTDA 4HTYA 1NIUA 2X1SA 3A21A 3T9PA 1X39A 1EYEA 3AIWA 4L1WA 4A22A 4JD4A 1GKPA 3CMFA 3GVWA 3HBLA 3DCPA 3H2NA 1KBJA 1RALA 4KEUA 3MP5A 1GHRA 1JVWA 1V79A 3GXDA 3CYVA 3NO5A 1LUCA 2Q8ZA 1KR1A 2OU4A 2DEPA 2OLAA 1LP6A 3H55A 3V5FA 5CC3A 4R9XA 1VLIA 2X0SA 3NURA 3FV9A 4FX8A 1RJPA 1AFSA 5FJRA 2DVXA 1D6OA 3IS4A 5HQLA 4J4NA 1M6JA 1R9ZA 3WQPA 4HIBA 4R27A 2ZE3A 1XV8A 3MI6A 3P93A 7PTDA 4HHPA 1H4PA 3WF1A 3HQ1A 4YIWA 1T96A 3UZWA 4PMXA 2PI6A 3B9NA 4O0KA 2I14A 2TSYA 3W7MA 4Q4RA 2FKPA 2J75A 1FKIA 4C6LA 4ZSUA 1KXTA 3BO9A 1P6CA 4BR1A 4HNOA 3KBNA 2V3GA 2KR7A 4DRMA 3OYZA 3PUDA 3GU1A 1T5AA 1YE6A 3W83A 2XN2A 3ODKA 3U3HA 3QKZA 3V5CA 5AVHA 3ORWA 5DQPA 1OSEA 3CPUA 2V81A 3K4WA 1F40A 3BLEA 3SCOA 3TR2A 1IEXA 4A3UA 1Z48A 5CBBA 3CJPA 1TUFA 3LNMA 4DZHA 5AVNA 3PPHA 2OWXA 3TE9A 4BQ3A 4CQ9A 1KBLA 2ODOA 1E4MM 5A8QA 4B5NA 3VMOA 1TZ9A 4EF8A 3KS5A 3S6TA 2O7SA 3PFRA 2AMXA 2V8ZA 1YPIA 3AHVA 5BYWA 3S1GA 4US5D 3LPOA 1VHCA 4OUEA 3H2AA 1NJJA 5HPOA 4D1JA 3WJWA 3GXPA 2CZFA 4F4RA 4N9CA 4LRSA 1OC6A 2OTDA 4NJIA 1Q3NA 3QF0A 4REQA 3IRSA 4XQ6A 1F8AB 1JPIA 3N2CA 3TA9A 5GQBA 1EGZA 1ZAHA 3B4YA 1SZRA 7ODCA 4UTUA 3ZO9A 3QLDA 3VZZA 1EA0A 3C0SA 2DIEA 2C1HA 4I90A 3NO1A 5AC5A 2GDVA 4C1LA 2XTKA 1B4EA 3FYOA 2V5KA 3I6TA 5A6BA 5BZAA 1KLYA 5BU9A 3WLMA 5F2MA 3HFYA 1CECA 1OFQA 3TAOA 1OCJA 5G4EA 2VTFA 1S3HA 3DHFA 3R43A 1DKWA 2R91A 4UCGA 3W9ZA 5I3KA 2PDFA 4LFYA 4HYRA 4KFOA 4ZGYA 2J9XA 2PBOA 1QT1A 4UZUA 1CI1A 3UJ2A 1VZWA 2V2HA 5JMUA 1B3ZA 4DZ5A 2OSXA 4A35A 4XBSA 3AIUA 4TMBA 4CN6A 1WB0A 4J3WA 1W1TA 2VNCA 5CPOA 4AAJA 3IJ9A 1ZLPA 2DUZA 1PBGA 4PMRA 3G0SA 3IVTA 2VD9A 4LOCA 1YMYA 2REQA 5DELA 1KKRA 4MNJA 3FDGA 1K9TA 4LW7A 1G4TA 4J27A 4NAEB 4JTJA 1W2VA 1K7FA 2ZDRA 4IUGA 4GXWA 4W9TA 2TODA 1ZK6A 2NV9A 2HK1A 1FCVA 1DHPA 3REQA 3ITTA 4YWSA 2QPSA 4KS0A 2HE8A 1EJVC 4XX6A 1EYWA 3ARZA 3W7OA 3QW4B 5J5DA 3WLQA 2RDUA 1VFTA 3KCLA 4E5TA 3VGEA 1J0KA 3N4AA 4QJ5B 4R34A 4D9PA 1EZWA 1OADA 3RILA 5EFDA 3HG4A 1N8FA 3CPRA 4G8TA 1JRCA 3WENA 4GBDA 4M80A 4E2BA 4OV4A 4AY7A 3KABA 3A47A 3WK3A 2MUCA 1ISZA 3EX6A 1NWRA 3NSNA 2VKZG 3K4DA 3AXKA 1VFOA 3EDFA 3LHUA 4CEXC 2WMFA 3T8LA 1A5OC 2I5GA 1E4NA 3AROA 5I2UA 4IGMA 3ITCA 1DTNA 3WYZA 2VRQA 3TC6A 3KDNA 1EGMA 1RA5A 3POCA 4QJ4B 4F40A 1ROTA 5JIWA 3R2GA 4MM1A 4HNNA 4GJIA 2ZOXA 3LXBA 1U79A 1WOAA 1I6NA 4DZ2A 2QQ6A 3PTQA 4B9ZA 4CNUA 2XGBA 3QVQA 3DIPA 2QAFA 1XCWA 4TVCA 1V0KA 2P4VA 4CQ8A 4HN4A 1QOQA 2D0HA 4OIFA 5DT7A 4NYYA 2ZZ3A 2MLXA 1BD0A 2CU0A 1JULA 4GABA 1Z9AA 3BGAA 4JQ4A 1CZ1A 3EMCA 3S5YA 4NASA 4U10A 3NGJA 4Z1BA 2PRHA 2PP3A 5EMJA 4DAFA 1I2OA 3UY8A 3KLKA 1ENUA 1E70M 2IPFA 1GCYA 4GUIA 3QPYA 3VE9A 1FH9A 5CCZA 4MOZA 3O6AA 2HTMA 2PTWA 5I02A 1KGUA 1ISYA 3QV8A 1F4AA 4PMQA 2QNEA 1YDOA 1KR0A 2QCCA 3ZJKA 1IEQA 1SW0A 4IIGA 4R33A 3UZ5A 5HWJA 3W01A 1UQZA 3DFHA 4Z1CA 4GJ1A 2VQUA 2XPBA 1DTUA 5EPDA 4NZJA 5E1QA 3I7RA 5MKGA 4U33A 2Y0FA 4HA4A 4GIRA 4P8WA 3NQ6A 1JIBA 3PY2A 2QMKA 1V02E 1MZRA 3WBYA 1OT2A 5HTGA 2Q3OA 1RLCL 4JFUA 1F05A 2CLPA 3WFAA 1UC5A 3R7MA 1JXKA 2F6XA 1P0BA 3ATYA 3FDKA 1RR2A 1D7HA 3LMZA 3ZQ9A 3RUBL 4GISA 1V0LA 1BKFA 4DRKA 3HTWA 3MT1A 2FMNA 5CZKA 3KBJA 4DJED 7XIMA 3RJXA 4ML9A 1FWDC 4EVZA 4H9VA 1B9ZA 3ATZA 1A4LA 2RUDA 4C02B 1Q6CA 4HCDA 1KFLA 3UR8A 1E15A 2OO0A 4OVXA 1JYWA 3QQWA 2V38A 1CT5A 4UQAA 1BRLA 4PEEA 3SCWA 2UY4A 3O3RA 2QUUA 1BXNA 1SJCA 4NL1A 4P7QA 2WMKA 4DJEA 4DBSA 2PWHA 1IQ8A 4N0RA 4AD1A 4ADTA 3TIMA 1B3YA 3UZJA 2MNRA 2GVGA 1EC8A 3T1GA 1K9DA 5CZJA 2XFWA 4Z0JA 2E6FA 1K8YA 3VDAA 1KCLA 2FZ8A 3QGAC 2B7QA 5D2YA 4NI3A 2OOFA 2CKSA 4KFPA 2OWWA 2O9OA 4H6KA 3ARUA 4LAVA 2QDEA 2JEPA 3UBPC 2XISA 4J4KA 3VD4A 2E77A 4CNPA 3TMQA 2O92A 4IG2A 5HINA 4ZOEA 2EPNA 3HZ3A 1V3KA 3VOIA 1NF7A 4IFKA 4PUMA 2FTYA 2GPTA 4PL1A 3K4AA 4ERIA 3IPWA 5D2WA 4GUGA 3QRHA 2BX7A 1B30A 4H19A 3ZVHB 4C7GA 5G1MA 1F6KA 4ZL1A 3QFWA 3W2JA 4L6OA 2D24A 1UA7A 3UA3A 5D9PA 4JN7A 5FACA 4ZTXA 1AH0A 4JHZA 1EDTA 3CMGA 3C8FA 4MJZA 3WNOA 3RJYA 3R58A 5D9OA 5K7JA 4K1WA 5CEWA 2DGAA 4NAEA 4FNUA 1HJUA 1V3HA 1LWHA 3VUPA 1NP2A 1DOSA 4XIMA 3VMPA 1HF6A 2PDMA 3TFXA 4H04A 3TXVA 3T2PA 3KRZA 2V3FA 1JJKA 2YCLA 4DF0A 3FLUA 1YW1A 3OO2A 4KGLA 3COTA 2WSKA 4LAWA 1OFPA 4XKMA 1YXCA 2VR5A 1JDAA 1WDRA 3EPOA 2TPSA 1X8FA 3VAWA 2MLYA 2ON3A 5D9MA 3NL5A 2NWRA 1H7PA 3UJFA 3H7UA 2HROA 4N42A 4FR1A 3GTIA 5CG7A 3AZRA 3GFZA 1A5CA 3PM6A 3UXDA 3IJ8A 1XQLA 3TC3A 2GQ3A 3ARQA 1W2PA 3WH8A 3C2OA 4S38A 1QPKA 2QULA 3LV5A 4ICNA 4NY2A 1FWSA 2B7NA 5A6MA 4JICA 4HKPA 3FVMA 2BTMA 4YCOA 3STFA 1IT7A 1DJNA 3SB0A 4IPXA 2W9MA 2WVTA 3AYVA 5FIPA 4F66A 3WNNA 2FZDA 2E5BA 3C2RA 2PTDA 2ACUA 3ARTA 1OG6A 3F2DA 3VKKA 7CGTA 4J3ZA 4KRUA 4AZ5A 1YDNA 3A6OA 1WE5A 3M46A 3QJAA 5JBDA 3ZLGA 1D3GA 3LHTA 3UQNA 3GNOA 3HB9A 4WJEA 1QNPA 2WNNA 1IR2A 4LY4A 1TREA 5D02A 1KFJA 1BGGA 1DJHA 1CTNA 1XIIA 4U5IA 3EWZA 3VOFA 1XLKA 4BZYA 3B8DA 3GU0A 4MB5A 4TUFA 4ACZA 1RBLA 2OX1A 1NSJA 1W1VA 3NZQA 3GUGA 2ZUWA 1BWVA 1WUFA 2AQWA 2DZUA 1VPQA 1W3HA 1VJZA 4F0RA 2D73A 1AL8A 2VRJA 4MY8A 4QAWA 1A0CA 4O4VA 1XP3A 4XAPA 3MS8A 3S4TA 3AXHA 3U2CA 1E55A 4UQCA 2D0GA 3STCA 4MPKA 4FR6A 1US2A 1W3IA 4D2JA 4Q33A 4ACZB 2VDGA 3TDBA 4GXPA 3TP4A 1HKMA 2L2SA 3ZMRA 3IEBA 2HS8A 5A8PA 3VPLA 5F2GA 3R0KA 3SJNA 2RHGA 4IP7A 3G24A 1DEDA 4NIRA 1SJBA 2UY3A 2YCEA 1RZMA 4B5XA 3VIOA 4MB3A 2C13A 4GO9A 4IQDA 2CBJA 3UJSA 1GKRA 4UTWC 4JTKA 3Q2DA 3QGKC 3VIGA 1RV8A 2ZZ7A 5AC6A 3PWAA 1VEOA 3AICA 1XYFA 4I9AA 4IT4A 3G6MA 4MKSA 1J0YA 4J28A 3CLMA 3UWUA 4H9XA 4HU8A 2NXHA 3GIYA 5A6LA 3QBUA 1AQHA 5FJIA 3MCOA 4UC5A 4YL2A 5ABFB 3AIBA 3BLIA 4B2DA 2PTZA 1O5QA 5FEZA 4O8AA 2C3ZA 1MYRA 3H2OA 2Y88A 4S39A 7REQB 4UR9A 2WO5A 2AL2B 3B0YA 3ZZ1A 1H11A 4LEFA 1B5TA 1H2JA 3L5MA 3BK0A 4BI7A 3QC0A 3T0AA 1GVRA 1AW5A 3BMXA 3UNTA 1EP2A 1XH0A 3VKJA 4ZFCA 5IFPA 3M43A 2EPHA 5K9XA 2IKGA 1TV5A 5CZ0A 1RK6A 3IUDA 3ZFHA 5DFAA 1N8WA 3W75A 4BA0A 2PLKA 3ZJ8A 2GJNA 3UI5A 2XU2A 3UXAA 4LS1A 1R47A 3OIXA 1QO2A 2PD5A 1Q6OA 5I3HA 2P0IA 2X1IA 3PR9A 1VFLA 4FHAA 1HGWA 3URBA 1ZHAA 3NPWA 3ALGA 3CLWA 3PS7A 3EB4A 2VUNA 3IV8A 4JQAA 1VGAA 3H26A 2Z28A 3VD7A 2Z1VA 2PURA 3GG0A 4KRTA 2F6KA 2Z2BA 2CBVA 1R3QA 3RCYA 1C8YA 3PC0A 1MWOA 5IFTA 3FJ4A 1UMYA 1U5HA 1TCOC 3BV7A 3O6CA 5JH2A 3WDJA 1O95A 3WKZA 5MHBA 4MYXA 4BY3A 3ISIX 3PF3A 2FAPA 4S3CA 1UUOA 1POJA 3M64A 3UQIA 3UERA 5I09A 5K9CA 1Q7MA 4E8DA 1XW8A 3LY0A 1OX6A 1XI3A 3NOYA 1RQBA 4QFUA 4E0CA 4DYKA 3CTTA 4Z42C 3W1AA 4HPNA 3WQWA 3V75A 3URAA 1TVLA 2OGYA 4PSRA 4N6EA