2QFFA

Crystal structure of staphylococcal complement inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
EYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Staphylococcal complement inhibitor: structure and active sites.
pubmed rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase inhibitor
total genus 29
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2qffA00
3D2EA 1DKXA 4F00A 4EZQA 4EZTA 4EZPA 4EZZA 1DKYA 3L3OM 3OHXM 3QNJA 4JWDA 4JWEA 3DPPA 3C7NA 4JN4A 4EZRA 4HY9A 1DKZA 5E84A 3D2FA 4EZXA 4R5LA 4R5GA 1U00A 2WINM 3T48A 4EZYA 2QXLA 4H6HA 3T49A 3T4AG 4EZOA 4EZUA 4JWCA 3T47A 4EZWA 4R5IA 2KHOA 4JNEA 4EZVA 3DPOA 2QFFA 4EZNA 4F01A 3T46A 4E81A 4EZSA 4JNFA 4JWIA 5TKYA 4R5KA 4R5JA 4H6IA 4HYBA 3DPQA 4B9QA 4PO2A
chains in the Genus database with same CATH superfamily
3F7WA 2EWFA 3QNJA 4AZBA 4AZHA 3QE6A 2F7PA 1TQWA 5KBPA 2YLLA 3LLLA 2PMRA 4JNEA 4F01A 4E81A 4E3CA 3B51X 1TQSA 2FYVA 2OW6A 3KDRA 4NQIA 2OBMA 3T47A 3D4YA 1ZYLA 5C5BB 4KIKA 2ZXQA 3D51A 1Y2OA 3DX0A 2EFLA 3B52X 4R5GA 2QXLA 3DYTA 4AZCB 3O3OB 3FD9A 3ABHA 4IW0A 4AZGA 4UDYX 2GF4A 1DKXA 3EJRA 1GNTA 4EZPA 2MI7A 4NSWA 2X3XA 1O7DC 4M0MA 3BUIA 2GA9D 4EZWA 3BUPA 1QX1A 1HTYA 3CZNA 4BNEA 4D8JA 2YIAA 4AKVA 1OAOA 2X5CA 4AZ6A 4H6HA 1YWMA 1X04A 2OBLA 5FIGA 1E1DA 3LVTA 3HAHA 3HAIA 4FZOA 4F00A 3EJQA 3OK8A 1PS3A 3UITA 3BLBA 3BVWA 4EZXA 4IM0A 3T49A 3BUBA 4EZOA 2YL5A 4IWPA 1E2UA 3D50A 2JNSA 1SU7A 2OW7A 3VEBA 2Z0NA 3CKDA 1E9VA 3M3WA 2X3WA 4DCNC 3T4AG 1SUFA 4EZUA 4WPEA 3RPMA 1SU8A 3CVRA 1GN9A 4FZSA 4JL9A 1LQ7A 2YIVX 3DX3A 2D4CA 4JWEA 3CAZA 2Z8YA 4KIKB 5E84A 3BVTA 2F1BA 3DX1A 1U00A 3RV0A 4H8SA 4R5KA 3D2EA 2YL6A 4JLCA 4AZIA 1TQTA 4I1QA 3VEAA 3PLTA 1HWWA 2F7QA 3SOGA 1R33A 2Z0OA 2FICA 2KHOA 2EFKA 3OWGA 3VKHA 4EZSA 3QWEA 3HAJA 2Q13A 2NCZA 3B53X 4EZTA 4ATMA 4EZZA 1DKYA 3CV5A 2YKTA 3DPPA 1R34A 2OZNB 4R5LA 1QWNA 3BUQA 3ER8C 2F1AA 3EJPA 1W9MA 1QWUA 2O0I1 4WPCA 3KAVA 2RAIA 3EJSA 4FZPA 4H6IA 3D52A 3DPQA 4AVMA 2YL9A 4HR1A 3A98A 4JN4A 2F7RA 4AZ7A 2LXYA 3L3PA 3I39X 1O7DB 3CZSA 2V0OA 3O3NB 4EZYA 1JQKA 3T46A 3ZEDA 2RAKA 1X03A 3DX4A 2Q12A 3I04A 4EZQA 2F18A 3G9GA 2YLAA 3BVUA 3BVXA 3QA8A 3DDGA 1SU6A 4R5IA 2ALWA 2QFFA 1MJGA 2LM0A 5TKYA 2D1LA 1OA1A 3D4ZA 3ACOA 5FLEX 4HYBA 4B9QA 3RV1A 4IWQA 3BUDA 1UPXA 1DKZA 3EJTA 2OO2A 3BVVA 4DYLA 1I49A 5C5BA 2WYIA 4JNFA 4PO2A 2QKWA 3O3MB 1R5EA 2YL8A 3EJUA 2Z0VA 3QNIA 3DX2A 4AZCA 4AZ5A 1I4TA 1URUA 3GI7A 2YI8A 4EZVA 3DPOA 2RT6A 4EZNA 1I4LA 2YI9A 3I2WA 4IM3A 2JNKA 2GAFD 3DDFA 3ER9B 3L3OM 3OHXM 1OA0A 4EZRA 3KAWA 4HY9A 3ERCC 2ELBA 1GNLA 2RAJA 2ND0A 3D2FA 4FM3A 4IM2A 3T48A 2YIBA 2WYHA 1WDZA 2PY6A 2EX3B 4R5JA 1ZWWA 2C08A 1HXKA 4JWDA 3SYVA 3C7NA 2X3VA 3I01A 1I4DA 4NPHA 3Q0KA 4HR1B 2WINM 3Q84A 4UDXX 1TQUA 4IWOA 4JWCA 3LMFA 2N3KA 1TQVA 4G6QA 4JWIA 2F7OA 2ND1A
chains in the Genus database with same CATH topology
3D2EA 3F7WA 3RV1A 2EWFA 4JLCA 4IWQA 4D8JA 2YIAA 3VEAA 3QNJA 1UPXA 1OAOA 2X5CA 1DKZA 4H6HA 2KHOA 4JNEA 3OWGA 4F01A 3VKHA 2OBLA 5FIGA 4E81A 4E3CA 4EZSA 4JNFA 3B51X 1E1DA 2NCZA 4PO2A 3B53X 3O3MB 4F00A 4EZTA 4EZZA 1DKYA 3UITA 3DPPA 4EZXA 4R5LA 3KDRA 4IM0A 3T49A 2OBMA 3ER8C 4EZOA 3T47A 3GI7A 2YI8A 4EZVA 3DPOA 2RT6A 4EZNA 1W9MA 4IWPA 2YI9A 1ZYLA 3KAVA 1E2UA 4IM3A 4H6IA 3DPQA 2GAFD 2JNSA 1SU7A 3ER9B 4KIKA 3VEBA 3L3OM 3OHXM 1E9VA 3A98A 1OA0A 4HR1A 4JN4A 4EZRA 3KAWA 4HY9A 3ERCC 3I39X 1GNLA 2ND0A 3D2FA 3B52X 4FM3A 4IM2A 3O3NB 4R5GA 3T48A 4EZYA 2QXLA 2YIBA 3T4AG 1SUFA 4EZUA 1JQKA 3T46A 2PY6A 3ZEDA 3O3OB 2EX3B 3FD9A 4IW0A 4R5JA 4UDYX 1SU8A 1GN9A 1DKXA 3I04A 1GNTA 4JL9A 4EZQA 4EZPA 2YIVX 4JWDA 4JWEA 3C7NA 3QA8A 3I01A 4NPHA 2Z8YA 4M0MA 4KIKB 5E84A 1SU6A 4HR1B 1U00A 2WINM 2GA9D 4UDXX 4IWOA 4JWCA 3LMFA 4R5IA 3RV0A 4EZWA 2QFFA 2N3KA 4G6QA 1MJGA 2LM0A 4JWIA 5TKYA 1OA1A 2ND1A 4R5KA 5FLEX 4HYBA 4B9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2E A;  1DKX A;  4F00 A;  4EZQ A;  4EZT A;  4EZP A;  4EZZ A;  1DKY A;  3L3O M;  3OHX M;  3QNJ A;  4JWD A;  4JWE A;  3DPP A;  3C7N A;  4JN4 A;  4EZR A;  4HY9 A;  1DKZ A;  5E84 A;  3D2F A;  4EZX A;  4R5L A;  4R5G A;  1U00 A;  2WIN M;  3T48 A;  4EZY A;  2QXL A;  4H6H A;  3T49 A;  3T4A G;  4EZO A;  4EZU A;  4JWC A;  3T47 A;  4EZW A;  4R5I A;  2KHO A;  4JNE A;  4EZV A;  3DPO A;  2QFF A;  4EZN A;  4F01 A;  3T46 A;  4E81 A;  4EZS A;  4JNF A;  4JWI A;  5TKY A;  4R5K A;  4R5J A;  4H6I A;  4HYB A;  3DPQ A;  4B9Q A;  4PO2 A; 
#chains in the Genus database with same CATH topology
 3F7W A;  2EWF A;  3QNJ A;  4AZB A;  4AZH A;  3QE6 A;  2F7P A;  1TQW A;  5KBP A;  2YLL A;  3LLL A;  2PMR A;  4JNE A;  4F01 A;  4E81 A;  4E3C A;  3B51 X;  1TQS A;  2FYV A;  2OW6 A;  3KDR A;  4NQI A;  2OBM A;  3T47 A;  3D4Y A;  1ZYL A;  5C5B B;  4KIK A;  2ZXQ A;  3D51 A;  1Y2O A;  3DX0 A;  2EFL A;  3B52 X;  4R5G A;  2QXL A;  3DYT A;  4AZC B;  3O3O B;  3FD9 A;  3ABH A;  4IW0 A;  4AZG A;  4UDY X;  2GF4 A;  1DKX A;  3EJR A;  1GNT A;  4EZP A;  2MI7 A;  4NSW A;  2X3X A;  1O7D C;  4M0M A;  3BUI A;  2GA9 D;  4EZW A;  3BUP A;  1QX1 A;  1HTY A;  3CZN A;  4BNE A;  4D8J A;  2YIA A;  4AKV A;  1OAO A;  2X5C A;  4AZ6 A;  4H6H A;  1YWM A;  1X04 A;  2OBL A;  5FIG A;  1E1D A;  3LVT A;  3HAH A;  3HAI A;  4FZO A;  4F00 A;  3EJQ A;  3OK8 A;  1PS3 A;  3UIT A;  3BLB A;  3BVW A;  4EZX A;  4IM0 A;  3T49 A;  3BUB A;  4EZO A;  2YL5 A;  4IWP A;  1E2U A;  3D50 A;  2JNS A;  1SU7 A;  2OW7 A;  3VEB A;  2Z0N A;  3CKD A;  1E9V A;  3M3W A;  2X3W A;  4DCN C;  3T4A G;  1SUF A;  4EZU A;  4WPE A;  3RPM A;  1SU8 A;  3CVR A;  1GN9 A;  4FZS A;  4JL9 A;  1LQ7 A;  2YIV X;  3DX3 A;  2D4C A;  4JWE A;  3CAZ A;  2Z8Y A;  4KIK B;  5E84 A;  3BVT A;  2F1B A;  3DX1 A;  1U00 A;  3RV0 A;  4H8S A;  4R5K A;  3D2E A;  2YL6 A;  4JLC A;  4AZI A;  1TQT A;  4I1Q A;  3VEA A;  3PLT A;  1HWW A;  2F7Q A;  3SOG A;  1R33 A;  2Z0O A;  2FIC A;  2KHO A;  2EFK A;  3OWG A;  3VKH A;  4EZS A;  3QWE A;  3HAJ A;  2Q13 A;  2NCZ A;  3B53 X;  4EZT A;  4ATM A;  4EZZ A;  1DKY A;  3CV5 A;  2YKT A;  3DPP A;  1R34 A;  2OZN B;  4R5L A;  1QWN A;  3BUQ A;  3ER8 C;  2F1A A;  3EJP A;  1W9M A;  1QWU A;  2O0I 1;  4WPC A;  3KAV A;  2RAI A;  3EJS A;  4FZP A;  4H6I A;  3D52 A;  3DPQ A;  4AVM A;  2YL9 A;  4HR1 A;  3A98 A;  4JN4 A;  2F7R A;  4AZ7 A;  2LXY A;  3L3P A;  3I39 X;  1O7D B;  3CZS A;  2V0O A;  3O3N B;  4EZY A;  1JQK A;  3T46 A;  3ZED A;  2RAK A;  1X03 A;  3DX4 A;  2Q12 A;  3I04 A;  4EZQ A;  2F18 A;  3G9G A;  2YLA A;  3BVU A;  3BVX A;  3QA8 A;  3DDG A;  1SU6 A;  4R5I A;  2ALW A;  2QFF A;  1MJG A;  2LM0 A;  5TKY A;  2D1L A;  1OA1 A;  3D4Z A;  3ACO A;  5FLE X;  4HYB A;  4B9Q A;  3RV1 A;  4IWQ A;  3BUD A;  1UPX A;  1DKZ A;  3EJT A;  2OO2 A;  3BVV A;  4DYL A;  1I49 A;  5C5B A;  2WYI A;  4JNF A;  4PO2 A;  2QKW A;  3O3M B;  1R5E A;  2YL8 A;  3EJU A;  2Z0V A;  3QNI A;  3DX2 A;  4AZC A;  4AZ5 A;  1I4T A;  1URU A;  3GI7 A;  2YI8 A;  4EZV A;  3DPO A;  2RT6 A;  4EZN A;  1I4L A;  2YI9 A;  3I2W A;  4IM3 A;  2JNK A;  2GAF D;  3DDF A;  3ER9 B;  3L3O M;  3OHX M;  1OA0 A;  4EZR A;  3KAW A;  4HY9 A;  3ERC C;  2ELB A;  1GNL A;  2RAJ A;  2ND0 A;  3D2F A;  4FM3 A;  4IM2 A;  3T48 A;  2YIB A;  2WYH A;  1WDZ A;  2PY6 A;  2EX3 B;  4R5J A;  1ZWW A;  2C08 A;  1HXK A;  4JWD A;  3SYV A;  3C7N A;  2X3V A;  3I01 A;  1I4D A;  4NPH A;  3Q0K A;  4HR1 B;  2WIN M;  3Q84 A;  4UDX X;  1TQU A;  4IWO A;  4JWC A;  3LMF A;  2N3K A;  1TQV A;  4G6Q A;  4JWI A;  2F7O A;  2ND1 A; 
#chains in the Genus database with same CATH homology
 3D2E A;  3F7W A;  3RV1 A;  2EWF A;  4JLC A;  4IWQ A;  4D8J A;  2YIA A;  3VEA A;  3QNJ A;  1UPX A;  1OAO A;  2X5C A;  1DKZ A;  4H6H A;  2KHO A;  4JNE A;  3OWG A;  4F01 A;  3VKH A;  2OBL A;  5FIG A;  4E81 A;  4E3C A;  4EZS A;  4JNF A;  3B51 X;  1E1D A;  2NCZ A;  4PO2 A;  3B53 X;  3O3M B;  4F00 A;  4EZT A;  4EZZ A;  1DKY A;  3UIT A;  3DPP A;  4EZX A;  4R5L A;  3KDR A;  4IM0 A;  3T49 A;  2OBM A;  3ER8 C;  4EZO A;  3T47 A;  3GI7 A;  2YI8 A;  4EZV A;  3DPO A;  2RT6 A;  4EZN A;  1W9M A;  4IWP A;  2YI9 A;  1ZYL A;  3KAV A;  1E2U A;  4IM3 A;  4H6I A;  3DPQ A;  2GAF D;  2JNS A;  1SU7 A;  3ER9 B;  4KIK A;  3VEB A;  3L3O M;  3OHX M;  1E9V A;  3A98 A;  1OA0 A;  4HR1 A;  4JN4 A;  4EZR A;  3KAW A;  4HY9 A;  3ERC C;  3I39 X;  1GNL A;  2ND0 A;  3D2F A;  3B52 X;  4FM3 A;  4IM2 A;  3O3N B;  4R5G A;  3T48 A;  4EZY A;  2QXL A;  2YIB A;  3T4A G;  1SUF A;  4EZU A;  1JQK A;  3T46 A;  2PY6 A;  3ZED A;  3O3O B;  2EX3 B;  3FD9 A;  4IW0 A;  4R5J A;  4UDY X;  1SU8 A;  1GN9 A;  1DKX A;  3I04 A;  1GNT A;  4JL9 A;  4EZQ A;  4EZP A;  2YIV X;  4JWD A;  4JWE A;  3C7N A;  3QA8 A;  3I01 A;  4NPH A;  2Z8Y A;  4M0M A;  4KIK B;  5E84 A;  1SU6 A;  4HR1 B;  1U00 A;  2WIN M;  2GA9 D;  4UDX X;  4IWO A;  4JWC A;  3LMF A;  4R5I A;  3RV0 A;  4EZW A;  2QFF A;  2N3K A;  4G6Q A;  1MJG A;  2LM0 A;  4JWI A;  5TKY A;  1OA1 A;  2ND1 A;  4R5K A;  5FLE X;  4HYB A;  4B9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...