2QFFA

Crystal structure of staphylococcal complement inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
EYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Staphylococcal complement inhibitor: structure and active sites.
pubmed rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase inhibitor
total genus 29
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2qffA00
4HY9A 3T46A 4R5KA 1DKZA 5TKYA 4EZPA 2WINM 4H6IA 4EZYA 4EZOA 4JWEA 3DPQA 4EZXA 4JNFA 4HYBA 3DPPA 4F00A 4JNEA 4R5LA 4JWIA 2KHOA 2QFFA 3T49A 4JWCA 4EZVA 1DKXA 3C7NA 4EZUA 3QNJA 1U00A 3D2FA 3T47A 5E84A 4B9QA 4F01A 4EZWA 2QXLA 3T48A 4E81A 4EZTA 4EZQA 3OHXM 4JN4A 4R5IA 4R5JA 3T4AG 4EZSA 3D2EA 1DKYA 4PO2A 4R5GA 4EZNA 4EZZA 3L3OM 4JWDA 4EZRA 3DPOA 4H6HA
chains in the Genus database with same CATH superfamily
3BUQA 3DDFA 4EZPA 3CZNA 2GAFD 4HR1B 1TQUA 2JNSA 2YL8A 3T47A 1JQKA 3OHXM 3O3MB 4AZHA 3EJQA 3VEAA 4H6HA 4NQIA 3GI7A 5C5BA 2OBMA 2OBLA 3T49A 3CZSA 3C7NA 2EWFA 3T48A 3EJTA 5KBPA 3DYTA 3LMFA 4IWPA 3BVWA 3D50A 2RAIA 3LVTA 2X5CA 2MI7A 3CKDA 4IM2A 2YLAA 2YIAA 3DX2A 4NPHA 1URUA 4EZYA 4AZBA 4FM3A 3I39X 4AKVA 4EZOA 4FZPA 3BUIA 3KAWA 2QFFA 1MJGA 1DKXA 4FZSA 3DX4A 2RAKA 4R5IA 2YLLA 2EX3B 2OW6A 2C08A 3BUBA 3EJPA 4H8SA 1DKZA 1E9VA 2F1BA 4JWIA 3O3OB 4AVMA 1R5EA 4IM0A 1E1DA 3BUDA 2F7OA 4EZQA 2N3KA 2YL5A 3HAIA 5FLEX 3F7WA 1GN9A 3VEBA 4HY9A 4JL9A 1E2UA 4AZCA 3L3PA 4FZOA 4HR1A 3OK8A 3HAJA 1SU6A 3B52X 3ZEDA 1O7DC 1I49A 1DKYA 2GA9D 3QWEA 1Y2OA 4R5GA 3DPOA 2F1AA 2RT6A 4AZ7A 3B51X 2D4CA 3ERCC 3KDRA 3BVXA 1U00A 4JLCA 4B9QA 1OAOA 3SOGA 1QX1A 2YI9A 4ATMA 3VKHA 1GNLA 4DCNC 1TQTA 3CV5A 2Q12A 2YL9A 4F00A 2OW7A 3LLLA 3PLTA 4IM3A 3CAZA 2OZNB 2F7QA 4EZSA 4AZ6A 3Q0KA 4KIKB 2PY6A 4EZRA 1TQVA 3BUPA 2WINM 2WYHA 4DYLA 4JNFA 4BNEA 4R5LA 2O0I1 1TQSA 2Z8YA 2F7PA 3EJUA 1SU8A 4EZVA 4EZUA 4E81A 4AZIA 1ZWWA 3BVUA 3DDGA 2X3VA 3BVVA 3RV0A 3CVRA 3RPMA 2YKTA 3B53X 4AZGA 1YWMA 1I4DA 2ELBA 3D2FA 5E84A 2LM0A 3DX1A 2F18A 4JN4A 3QNIA 3EJSA 3I04A 3QA8A 1SUFA 2WYIA 2QKWA 2X3WA 3G9GA 2FICA 1LQ7A 2D1LA 2YIBA 3RV1A 3HAHA 1I4LA 2NCZA 2Z0VA 3ER9B 2YI8A 4AZCB 1WDZA 2JNKA 1OA1A 3M3WA 3DX0A 2GF4A 2FYVA 3QNJA 2Z0OA 2EFKA 3Q84A 1HXKA 3D2EA 3BVTA 3D52A 1GNTA 3O3NB 5C5BB 1HTYA 2YIVX 3DPQA 2KHOA 2ZXQA 2YL6A 3ACOA 4JWCA 4E3CA 4I1QA 1R33A 2V0OA 4F01A 3ABHA 2QXLA 1OA0A 4D8JA 3D51A 1ZYLA 2LXYA 4EZNA 4KIKA 4EZZA 4AZ5A 5TKYA 1TQWA 4H6IA 1X03A 3SYVA 3KAVA 4JNEA 3FD9A 3D4YA 3EJRA 4IWOA 3UITA 4EZWA 3I01A 4PO2A 4M0MA 3DX3A 4NSWA 3ER8C 2OO2A 1O7DB 4R5KA 5FIGA 1SU7A 2PMRA 2ALWA 3D4ZA 4UDXX 3DPPA 2Q13A 2Z0NA 2ND1A 1I4TA 3OWGA 4IWQA 4EZTA 2EFLA 3T4AG 1QWUA 1X04A 4IW0A 3A98A 2ND0A 3T46A 4WPEA 2RAJA 1R34A 3BLBA 3I2WA 1W9MA 4JWEA 1QWNA 4G6QA 4EZXA 4HYBA 1UPXA 1PS3A 1HWWA 4R5JA 2X3XA 4UDYX 3L3OM 4JWDA 2F7RA 3QE6A 4WPCA
chains in the Genus database with same CATH topology
3O3NB 1DKZA 4EZPA 2WINM 1E9VA 2YIVX 3DPQA 2GAFD 4JNFA 4HR1B 4R5LA 4JWIA 2Z8YA 2KHOA 3O3OB 4JWCA 1SU8A 2JNSA 4E3CA 4EZUA 4EZVA 3T47A 4IM0A 1E1DA 1JQKA 4F01A 2QXLA 4E81A 1OA0A 4D8JA 4EZQA 3OHXM 2N3KA 3O3MB 1ZYLA 5FLEX 3F7WA 4EZNA 3VEAA 4KIKA 4EZZA 1GN9A 3RV0A 4H6HA 3VEBA 4HY9A 4JL9A 3GI7A 3B53X 5TKYA 1E2UA 4H6IA 2OBMA 3KAVA 4JNEA 4HR1A 2OBLA 3T49A 3FD9A 1SU6A 3B52X 3C7NA 4IWOA 3D2FA 5E84A 2LM0A 3UITA 2EWFA 4EZWA 3ZEDA 3T48A 4JN4A 3I01A 3I04A 1DKYA 2GA9D 4PO2A 4M0MA 3QA8A 4R5GA 1SUFA 3DPOA 3ER8C 3LMFA 4R5KA 5FIGA 4IWPA 2RT6A 1SU7A 3B51X 3ERCC 3KDRA 4UDXX 3DPPA 2YIBA 3RV1A 2ND1A 1U00A 2X5CA 4JLCA 4B9QA 3OWGA 4IWQA 1OAOA 4EZTA 3T4AG 2YI9A 4IM2A 2NCZA 4IW0A 3ER9B 2YIAA 3VKHA 2YI8A 1GNLA 3A98A 2ND0A 3T46A 4NPHA 4EZYA 4FM3A 3I39X 1W9MA 4EZOA 4JWEA 4G6QA 4EZXA 4HYBA 4F00A 1UPXA 1OA1A 3KAWA 2QFFA 1MJGA 4IM3A 1DKXA 3QNJA 4EZSA 4R5IA 4R5JA 3D2EA 4KIKB 2EX3B 2PY6A 4UDYX 3L3OM 4JWDA 1GNTA 4EZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY9 A;  3T46 A;  4R5K A;  1DKZ A;  5TKY A;  4EZP A;  2WIN M;  4H6I A;  4EZY A;  4EZO A;  4JWE A;  3DPQ A;  4EZX A;  4JNF A;  4HYB A;  3DPP A;  4F00 A;  4JNE A;  4R5L A;  4JWI A;  2KHO A;  2QFF A;  3T49 A;  4JWC A;  4EZV A;  1DKX A;  3C7N A;  4EZU A;  3QNJ A;  1U00 A;  3D2F A;  3T47 A;  5E84 A;  4B9Q A;  4F01 A;  4EZW A;  2QXL A;  3T48 A;  4E81 A;  4EZT A;  4EZQ A;  3OHX M;  4JN4 A;  4R5I A;  4R5J A;  3T4A G;  4EZS A;  3D2E A;  1DKY A;  4PO2 A;  4R5G A;  4EZN A;  4EZZ A;  3L3O M;  4JWD A;  4EZR A;  3DPO A;  4H6H A; 
#chains in the Genus database with same CATH topology
 3BUQ A;  3DDF A;  4EZP A;  3CZN A;  2GAF D;  4HR1 B;  1TQU A;  2JNS A;  2YL8 A;  3T47 A;  1JQK A;  3OHX M;  3O3M B;  4AZH A;  3EJQ A;  3VEA A;  4H6H A;  4NQI A;  3GI7 A;  5C5B A;  2OBM A;  2OBL A;  3T49 A;  3CZS A;  3C7N A;  2EWF A;  3T48 A;  3EJT A;  5KBP A;  3DYT A;  3LMF A;  4IWP A;  3BVW A;  3D50 A;  2RAI A;  3LVT A;  2X5C A;  2MI7 A;  3CKD A;  4IM2 A;  2YLA A;  2YIA A;  3DX2 A;  4NPH A;  1URU A;  4EZY A;  4AZB A;  4FM3 A;  3I39 X;  4AKV A;  4EZO A;  4FZP A;  3BUI A;  3KAW A;  2QFF A;  1MJG A;  1DKX A;  4FZS A;  3DX4 A;  2RAK A;  4R5I A;  2YLL A;  2EX3 B;  2OW6 A;  2C08 A;  3BUB A;  3EJP A;  4H8S A;  1DKZ A;  1E9V A;  2F1B A;  4JWI A;  3O3O B;  4AVM A;  1R5E A;  4IM0 A;  1E1D A;  3BUD A;  2F7O A;  4EZQ A;  2N3K A;  2YL5 A;  3HAI A;  5FLE X;  3F7W A;  1GN9 A;  3VEB A;  4HY9 A;  4JL9 A;  1E2U A;  4AZC A;  3L3P A;  4FZO A;  4HR1 A;  3OK8 A;  3HAJ A;  1SU6 A;  3B52 X;  3ZED A;  1O7D C;  1I49 A;  1DKY A;  2GA9 D;  3QWE A;  1Y2O A;  4R5G A;  3DPO A;  2F1A A;  2RT6 A;  4AZ7 A;  3B51 X;  2D4C A;  3ERC C;  3KDR A;  3BVX A;  1U00 A;  4JLC A;  4B9Q A;  1OAO A;  3SOG A;  1QX1 A;  2YI9 A;  4ATM A;  3VKH A;  1GNL A;  4DCN C;  1TQT A;  3CV5 A;  2Q12 A;  2YL9 A;  4F00 A;  2OW7 A;  3LLL A;  3PLT A;  4IM3 A;  3CAZ A;  2OZN B;  2F7Q A;  4EZS A;  4AZ6 A;  3Q0K A;  4KIK B;  2PY6 A;  4EZR A;  1TQV A;  3BUP A;  2WIN M;  2WYH A;  4DYL A;  4JNF A;  4BNE A;  4R5L A;  2O0I 1;  1TQS A;  2Z8Y A;  2F7P A;  3EJU A;  1SU8 A;  4EZV A;  4EZU A;  4E81 A;  4AZI A;  1ZWW A;  3BVU A;  3DDG A;  2X3V A;  3BVV A;  3RV0 A;  3CVR A;  3RPM A;  2YKT A;  3B53 X;  4AZG A;  1YWM A;  1I4D A;  2ELB A;  3D2F A;  5E84 A;  2LM0 A;  3DX1 A;  2F18 A;  4JN4 A;  3QNI A;  3EJS A;  3I04 A;  3QA8 A;  1SUF A;  2WYI A;  2QKW A;  2X3W A;  3G9G A;  2FIC A;  1LQ7 A;  2D1L A;  2YIB A;  3RV1 A;  3HAH A;  1I4L A;  2NCZ A;  2Z0V A;  3ER9 B;  2YI8 A;  4AZC B;  1WDZ A;  2JNK A;  1OA1 A;  3M3W A;  3DX0 A;  2GF4 A;  2FYV A;  3QNJ A;  2Z0O A;  2EFK A;  3Q84 A;  1HXK A;  3D2E A;  3BVT A;  3D52 A;  1GNT A;  3O3N B;  5C5B B;  1HTY A;  2YIV X;  3DPQ A;  2KHO A;  2ZXQ A;  2YL6 A;  3ACO A;  4JWC A;  4E3C A;  4I1Q A;  1R33 A;  2V0O A;  4F01 A;  3ABH A;  2QXL A;  1OA0 A;  4D8J A;  3D51 A;  1ZYL A;  2LXY A;  4EZN A;  4KIK A;  4EZZ A;  4AZ5 A;  5TKY A;  1TQW A;  4H6I A;  1X03 A;  3SYV A;  3KAV A;  4JNE A;  3FD9 A;  3D4Y A;  3EJR A;  4IWO A;  3UIT A;  4EZW A;  3I01 A;  4PO2 A;  4M0M A;  3DX3 A;  4NSW A;  3ER8 C;  2OO2 A;  1O7D B;  4R5K A;  5FIG A;  1SU7 A;  2PMR A;  2ALW A;  3D4Z A;  4UDX X;  3DPP A;  2Q13 A;  2Z0N A;  2ND1 A;  1I4T A;  3OWG A;  4IWQ A;  4EZT A;  2EFL A;  3T4A G;  1QWU A;  1X04 A;  4IW0 A;  3A98 A;  2ND0 A;  3T46 A;  4WPE A;  2RAJ A;  1R34 A;  3BLB A;  3I2W A;  1W9M A;  4JWE A;  1QWN A;  4G6Q A;  4EZX A;  4HYB A;  1UPX A;  1PS3 A;  1HWW A;  4R5J A;  2X3X A;  4UDY X;  3L3O M;  4JWD A;  2F7R A;  3QE6 A;  4WPC A; 
#chains in the Genus database with same CATH homology
 3O3N B;  1DKZ A;  4EZP A;  2WIN M;  1E9V A;  2YIV X;  3DPQ A;  2GAF D;  4JNF A;  4HR1 B;  4R5L A;  4JWI A;  2Z8Y A;  2KHO A;  3O3O B;  4JWC A;  1SU8 A;  2JNS A;  4E3C A;  4EZU A;  4EZV A;  3T47 A;  4IM0 A;  1E1D A;  1JQK A;  4F01 A;  2QXL A;  4E81 A;  1OA0 A;  4D8J A;  4EZQ A;  3OHX M;  2N3K A;  3O3M B;  1ZYL A;  5FLE X;  3F7W A;  4EZN A;  3VEA A;  4KIK A;  4EZZ A;  1GN9 A;  3RV0 A;  4H6H A;  3VEB A;  4HY9 A;  4JL9 A;  3GI7 A;  3B53 X;  5TKY A;  1E2U A;  4H6I A;  2OBM A;  3KAV A;  4JNE A;  4HR1 A;  2OBL A;  3T49 A;  3FD9 A;  1SU6 A;  3B52 X;  3C7N A;  4IWO A;  3D2F A;  5E84 A;  2LM0 A;  3UIT A;  2EWF A;  4EZW A;  3ZED A;  3T48 A;  4JN4 A;  3I01 A;  3I04 A;  1DKY A;  2GA9 D;  4PO2 A;  4M0M A;  3QA8 A;  4R5G A;  1SUF A;  3DPO A;  3ER8 C;  3LMF A;  4R5K A;  5FIG A;  4IWP A;  2RT6 A;  1SU7 A;  3B51 X;  3ERC C;  3KDR A;  4UDX X;  3DPP A;  2YIB A;  3RV1 A;  2ND1 A;  1U00 A;  2X5C A;  4JLC A;  4B9Q A;  3OWG A;  4IWQ A;  1OAO A;  4EZT A;  3T4A G;  2YI9 A;  4IM2 A;  2NCZ A;  4IW0 A;  3ER9 B;  2YIA A;  3VKH A;  2YI8 A;  1GNL A;  3A98 A;  2ND0 A;  3T46 A;  4NPH A;  4EZY A;  4FM3 A;  3I39 X;  1W9M A;  4EZO A;  4JWE A;  4G6Q A;  4EZX A;  4HYB A;  4F00 A;  1UPX A;  1OA1 A;  3KAW A;  2QFF A;  1MJG A;  4IM3 A;  1DKX A;  3QNJ A;  4EZS A;  4R5I A;  4R5J A;  3D2E A;  4KIK B;  2EX3 B;  2PY6 A;  4UDY X;  3L3O M;  4JWD A;  1GNT A;  4EZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...