2QFFA

Crystal structure of staphylococcal complement inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
b'EYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Staphylococcal complement inhibitor: structure and active sites.
pubmed rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase inhibitor
total genus 29
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2qffA00
4EZSA 4EZTA 3L3OM 1DKZA 4EZUA 2QFFA 4HYBA 3T46A 4JWDA 1DKXA 4EZYA 3DPOA 4R5LA 4JNFA 3T47A 4E81A 4R5IA 4H6IA 1DKYA 2WINM 4PO2A 4JWCA 5E84A 4EZQA 4H6HA 3DPQA 3D2EA 2KHOA 3C7NA 4R5JA 3T4AG 4R5KA 4EZRA 4R5GA 4EZVA 4F00A 1U00A 5TKYA 3DPPA 3T49A 4EZXA 4EZOA 4JN4A 4EZNA 3OHXM 4HY9A 4EZWA 4F01A 4JWEA 2QXLA 4JWIA 4B9QA 4EZZA 3D2FA 3QNJA 4JNEA 4EZPA 3T48A
chains in the Genus database with same CATH superfamily
4G6QA 1O7DC 1R33A 3M3WA 1GNTA 1MJGA 1ZWWA 3BVUA 2N3KA 1PS3A 2V0OA 1SU7A 5C5BB 4F01A 3CKDA 4KIKB 4H6IA 2Z0NA 1X03A 3BVWA 2F7PA 2FICA 2X3VA 4IWQA 3BUIA 2ND1A 1Y2OA 3GI7A 3KAVA 3D2FA 5FLEX 1QWNA 3DYTA 1DKXA 2ALWA 2OBLA 1DKYA 4JWCA 4UDYX 2GA9D 1O7DB 1I4DA 3CV5A 2GF4A 2Q13A 2OW6A 2PMRA 2WYIA 2Q12A 2ZXQA 4IM2A 4EZSA 1DKZA 1TQWA 2F1BA 4KIKA 4AZCB 2YLAA 3QE6A 1R34A 2MI7A 2WINM 2EFLA 3T4AG 3O3NB 4ATMA 4WPCA 3ER8C 4R5IA 2OZNB 3I39X 3DDGA 3HAIA 2KHOA 3Q0KA 3L3PA 1U00A 2C08A 3BVTA 4DYLA 2D1LA 2Z0VA 4M0MA 2OW7A 3QNJA 3LVTA 4EZTA 2QFFA 1R5EA 3EJRA 3DDFA 1TQVA 3DX1A 3RV0A 3LLLA 4HY9A 4I1QA 1E9VA 2RT6A 3I04A 2X3WA 2EWFA 3D4ZA 3T46A 3OWGA 3BLBA 2YL9A 2PY6A 3VEBA 3DPQA 4BNEA 3D50A 4UDXX 2LXYA 4R5KA 1OA1A 3O3MB 4FZPA 4EZVA 4IM3A 1UPXA 2ND0A 4EZWA 4JWIA 4EZZA 3L3OM 1HWWA 3QWEA 3CVRA 3QNIA 2YLLA 4IM0A 3B51X 3PLTA 4F00A 1TQTA 5TKYA 5C5BA 2EFKA 4E3CA 2O0I1 1GNLA 3CZSA 1ZYLA 3CAZA 3LMFA 4JWDA 4AZ7A 4JNFA 3RPMA 2FYVA 2YI9A 3ABHA 3QA8A 4IWOA 2YL5A 3A98A 2JNSA 3I2WA 4EZOA 3G9GA 1QWUA 2YKTA 2F18A 1SU6A 1WDZA 2NCZA 2QXLA 3Q84A 4B9QA 4AZIA 4JNEA 5FIGA 2YIVX 2YL6A 2F7RA 4HR1B 2RAKA 3EJSA 3EJTA 4IW0A 2D4CA 4AZHA 3T49A 3KDRA 4NQIA 1X04A 2YI8A 2OO2A 3BUDA 3EJUA 3I01A 3DX2A 3D4YA 4HYBA 3D52A 4AZCA 4JLCA 3ZEDA 4EZQA 4H6HA 1E2UA 4EZRA 1I4TA 4WPEA 3OHXM 3B53X 1GN9A 3T48A 4HR1A 3BVXA 1TQSA 2GAFD 3DX4A 1OA0A 3EJQA 4E81A 2YIBA 4NSWA 5KBPA 5E84A 4FM3A 1JQKA 2YIAA 4R5GA 3D51A 3DPPA 1YWMA 4JN4A 2LM0A 4EZNA 4AKVA 4EZPA 3HAHA 3BUPA 3RV1A 3ACOA 3BVVA 3T47A 4AVMA 1I49A 3D2EA 2F7OA 3F7WA 1SUFA 3SOGA 3CZNA 4EZXA 4D8JA 4JWEA 4EZUA 3B52X 2OBMA 1W9MA 1I4LA 4IWPA 3DX0A 3HAJA 1HXKA 3C7NA 3BUQA 1LQ7A 2WYHA 2ELBA 2RAIA 3BUBA 4AZ5A 2YL8A 4FZSA 4NPHA 3EJPA 3DPOA 2Z0OA 2X5CA 4PO2A 1OAOA 1E1DA 3FD9A 4R5JA 2QKWA 3VEAA 2X3XA 2F7QA 4AZBA 2F1AA 3OK8A 3O3OB 1TQUA 3DX3A 1HTYA 3KAWA 1QX1A 2JNKA 3SYVA 3ERCC 3VKHA 3ER9B 4EZYA 4R5LA 4FZOA 2EX3B 1URUA 2Z8YA 3UITA 4H8SA 2RAJA 4JL9A 4AZGA 4AZ6A 4DCNC 1SU8A
chains in the Genus database with same CATH topology
3ER8C 4G6QA 1ZYLA 3RV1A 3LMFA 4JWDA 1GNTA 4JNFA 1MJGA 3T47A 4R5IA 3I39X 2YI9A 3D2EA 2KHOA 2N3KA 3F7WA 3QA8A 4IWOA 1SUFA 1SU7A 3A98A 1U00A 2JNSA 4EZXA 4EZOA 4F01A 4M0MA 4JWEA 1SU6A 2QXLA 2NCZA 4B9QA 4D8JA 3QNJA 4JNEA 5FIGA 4EZTA 2YIVX 4HR1B 4EZUA 2QFFA 3B52X 2OBMA 4KIKB 1W9MA 4H6IA 4IWPA 3C7NA 4IW0A 4IWQA 2ND1A 3RV0A 3T49A 3KDRA 3GI7A 4HY9A 1E9VA 2RT6A 2YI8A 3KAVA 3D2FA 5FLEX 3I04A 4NPHA 3I01A 2EWFA 4HYBA 3T46A 1DKXA 3OWGA 3DPOA 2OBLA 2X5CA 4JLCA 1DKYA 4PO2A 1OAOA 4JWCA 1E1DA 3ZEDA 2PY6A 4EZQA 3VEBA 4H6HA 3DPQA 1E2UA 3FD9A 2GA9D 4R5JA 4UDYX 4UDXX 4R5KA 1OA1A 3O3MB 4EZRA 3VEAA 4EZVA 4IM3A 1UPXA 2ND0A 3OHXM 4EZWA 3B53X 3O3OB 4JWIA 4EZZA 1GN9A 3T48A 3KAWA 4IM2A 4EZSA 3L3OM 4HR1A 1DKZA 3ERCC 3VKHA 3ER9B 4EZYA 4KIKA 2GAFD 1OA0A 4R5LA 4E81A 2YIBA 2WINM 5E84A 2EX3B 4FM3A 4IM0A 3B51X 3T4AG 2Z8YA 1JQKA 2YIAA 3UITA 4R5GA 4F00A 5TKYA 4JL9A 4E3CA 3DPPA 3O3NB 4JN4A 2LM0A 4EZNA 1SU8A 4EZPA 1GNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZS A;  4EZT A;  3L3O M;  1DKZ A;  4EZU A;  2QFF A;  4HYB A;  3T46 A;  4JWD A;  1DKX A;  4EZY A;  3DPO A;  4R5L A;  4JNF A;  3T47 A;  4E81 A;  4R5I A;  4H6I A;  1DKY A;  2WIN M;  4PO2 A;  4JWC A;  5E84 A;  4EZQ A;  4H6H A;  3DPQ A;  3D2E A;  2KHO A;  3C7N A;  4R5J A;  3T4A G;  4R5K A;  4EZR A;  4R5G A;  4EZV A;  4F00 A;  1U00 A;  5TKY A;  3DPP A;  3T49 A;  4EZX A;  4EZO A;  4JN4 A;  4EZN A;  3OHX M;  4HY9 A;  4EZW A;  4F01 A;  4JWE A;  2QXL A;  4JWI A;  4B9Q A;  4EZZ A;  3D2F A;  3QNJ A;  4JNE A;  4EZP A;  3T48 A; 
#chains in the Genus database with same CATH topology
 4G6Q A;  1O7D C;  1R33 A;  3M3W A;  1GNT A;  1MJG A;  1ZWW A;  3BVU A;  2N3K A;  1PS3 A;  2V0O A;  1SU7 A;  5C5B B;  4F01 A;  3CKD A;  4KIK B;  4H6I A;  2Z0N A;  1X03 A;  3BVW A;  2F7P A;  2FIC A;  2X3V A;  4IWQ A;  3BUI A;  2ND1 A;  1Y2O A;  3GI7 A;  3KAV A;  3D2F A;  5FLE X;  1QWN A;  3DYT A;  1DKX A;  2ALW A;  2OBL A;  1DKY A;  4JWC A;  4UDY X;  2GA9 D;  1O7D B;  1I4D A;  3CV5 A;  2GF4 A;  2Q13 A;  2OW6 A;  2PMR A;  2WYI A;  2Q12 A;  2ZXQ A;  4IM2 A;  4EZS A;  1DKZ A;  1TQW A;  2F1B A;  4KIK A;  4AZC B;  2YLA A;  3QE6 A;  1R34 A;  2MI7 A;  2WIN M;  2EFL A;  3T4A G;  3O3N B;  4ATM A;  4WPC A;  3ER8 C;  4R5I A;  2OZN B;  3I39 X;  3DDG A;  3HAI A;  2KHO A;  3Q0K A;  3L3P A;  1U00 A;  2C08 A;  3BVT A;  4DYL A;  2D1L A;  2Z0V A;  4M0M A;  2OW7 A;  3QNJ A;  3LVT A;  4EZT A;  2QFF A;  1R5E A;  3EJR A;  3DDF A;  1TQV A;  3DX1 A;  3RV0 A;  3LLL A;  4HY9 A;  4I1Q A;  1E9V A;  2RT6 A;  3I04 A;  2X3W A;  2EWF A;  3D4Z A;  3T46 A;  3OWG A;  3BLB A;  2YL9 A;  2PY6 A;  3VEB A;  3DPQ A;  4BNE A;  3D50 A;  4UDX X;  2LXY A;  4R5K A;  1OA1 A;  3O3M B;  4FZP A;  4EZV A;  4IM3 A;  1UPX A;  2ND0 A;  4EZW A;  4JWI A;  4EZZ A;  3L3O M;  1HWW A;  3QWE A;  3CVR A;  3QNI A;  2YLL A;  4IM0 A;  3B51 X;  3PLT A;  4F00 A;  1TQT A;  5TKY A;  5C5B A;  2EFK A;  4E3C A;  2O0I 1;  1GNL A;  3CZS A;  1ZYL A;  3CAZ A;  3LMF A;  4JWD A;  4AZ7 A;  4JNF A;  3RPM A;  2FYV A;  2YI9 A;  3ABH A;  3QA8 A;  4IWO A;  2YL5 A;  3A98 A;  2JNS A;  3I2W A;  4EZO A;  3G9G A;  1QWU A;  2YKT A;  2F18 A;  1SU6 A;  1WDZ A;  2NCZ A;  2QXL A;  3Q84 A;  4B9Q A;  4AZI A;  4JNE A;  5FIG A;  2YIV X;  2YL6 A;  2F7R A;  4HR1 B;  2RAK A;  3EJS A;  3EJT A;  4IW0 A;  2D4C A;  4AZH A;  3T49 A;  3KDR A;  4NQI A;  1X04 A;  2YI8 A;  2OO2 A;  3BUD A;  3EJU A;  3I01 A;  3DX2 A;  3D4Y A;  4HYB A;  3D52 A;  4AZC A;  4JLC A;  3ZED A;  4EZQ A;  4H6H A;  1E2U A;  4EZR A;  1I4T A;  4WPE A;  3OHX M;  3B53 X;  1GN9 A;  3T48 A;  4HR1 A;  3BVX A;  1TQS A;  2GAF D;  3DX4 A;  1OA0 A;  3EJQ A;  4E81 A;  2YIB A;  4NSW A;  5KBP A;  5E84 A;  4FM3 A;  1JQK A;  2YIA A;  4R5G A;  3D51 A;  3DPP A;  1YWM A;  4JN4 A;  2LM0 A;  4EZN A;  4AKV A;  4EZP A;  3HAH A;  3BUP A;  3RV1 A;  3ACO A;  3BVV A;  3T47 A;  4AVM A;  1I49 A;  3D2E A;  2F7O A;  3F7W A;  1SUF A;  3SOG A;  3CZN A;  4EZX A;  4D8J A;  4JWE A;  4EZU A;  3B52 X;  2OBM A;  1W9M A;  1I4L A;  4IWP A;  3DX0 A;  3HAJ A;  1HXK A;  3C7N A;  3BUQ A;  1LQ7 A;  2WYH A;  2ELB A;  2RAI A;  3BUB A;  4AZ5 A;  2YL8 A;  4FZS A;  4NPH A;  3EJP A;  3DPO A;  2Z0O A;  2X5C A;  4PO2 A;  1OAO A;  1E1D A;  3FD9 A;  4R5J A;  2QKW A;  3VEA A;  2X3X A;  2F7Q A;  4AZB A;  2F1A A;  3OK8 A;  3O3O B;  1TQU A;  3DX3 A;  1HTY A;  3KAW A;  1QX1 A;  2JNK A;  3SYV A;  3ERC C;  3VKH A;  3ER9 B;  4EZY A;  4R5L A;  4FZO A;  2EX3 B;  1URU A;  2Z8Y A;  3UIT A;  4H8S A;  2RAJ A;  4JL9 A;  4AZG A;  4AZ6 A;  4DCN C;  1SU8 A; 
#chains in the Genus database with same CATH homology
 3ER8 C;  4G6Q A;  1ZYL A;  3RV1 A;  3LMF A;  4JWD A;  1GNT A;  4JNF A;  1MJG A;  3T47 A;  4R5I A;  3I39 X;  2YI9 A;  3D2E A;  2KHO A;  2N3K A;  3F7W A;  3QA8 A;  4IWO A;  1SUF A;  1SU7 A;  3A98 A;  1U00 A;  2JNS A;  4EZX A;  4EZO A;  4F01 A;  4M0M A;  4JWE A;  1SU6 A;  2QXL A;  2NCZ A;  4B9Q A;  4D8J A;  3QNJ A;  4JNE A;  5FIG A;  4EZT A;  2YIV X;  4HR1 B;  4EZU A;  2QFF A;  3B52 X;  2OBM A;  4KIK B;  1W9M A;  4H6I A;  4IWP A;  3C7N A;  4IW0 A;  4IWQ A;  2ND1 A;  3RV0 A;  3T49 A;  3KDR A;  3GI7 A;  4HY9 A;  1E9V A;  2RT6 A;  2YI8 A;  3KAV A;  3D2F A;  5FLE X;  3I04 A;  4NPH A;  3I01 A;  2EWF A;  4HYB A;  3T46 A;  1DKX A;  3OWG A;  3DPO A;  2OBL A;  2X5C A;  4JLC A;  1DKY A;  4PO2 A;  1OAO A;  4JWC A;  1E1D A;  3ZED A;  2PY6 A;  4EZQ A;  3VEB A;  4H6H A;  3DPQ A;  1E2U A;  3FD9 A;  2GA9 D;  4R5J A;  4UDY X;  4UDX X;  4R5K A;  1OA1 A;  3O3M B;  4EZR A;  3VEA A;  4EZV A;  4IM3 A;  1UPX A;  2ND0 A;  3OHX M;  4EZW A;  3B53 X;  3O3O B;  4JWI A;  4EZZ A;  1GN9 A;  3T48 A;  3KAW A;  4IM2 A;  4EZS A;  3L3O M;  4HR1 A;  1DKZ A;  3ERC C;  3VKH A;  3ER9 B;  4EZY A;  4KIK A;  2GAF D;  1OA0 A;  4R5L A;  4E81 A;  2YIB A;  2WIN M;  5E84 A;  2EX3 B;  4FM3 A;  4IM0 A;  3B51 X;  3T4A G;  2Z8Y A;  1JQK A;  2YIA A;  3UIT A;  4R5G A;  4F00 A;  5TKY A;  4JL9 A;  4E3C A;  3DPP A;  3O3N B;  4JN4 A;  2LM0 A;  4EZN A;  1SU8 A;  4EZP A;  1GNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...