2QGNA

Crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
244
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGETPSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 79
structure length 244
sequence length 313
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 2qgnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qgnA01
2A7QA 3LVRE 3WRYC 3KQNA 3LD9A 1E0KA 3U7EB 3DDCA 1T6NA 2P67A 1XEXA 4BUJA 4ZPXA 1COWA 3U7HB 1RJ9A 3JVVA 3EPKA 3AP2A 2QMUA 2WJGA 2RGAA 4GI7A 1CBUA 1W2HA 2RH5A 4DXAA 1QVAA 5EXTA 1A7JA 3HPRA 5JCPA 3A8TA 4P4SA 2WOOA 2ONJA 3IPYA 5FOTA 3I62A 4IOMA 2HYDA 3PV0A 1RVDA 1IAQA 1G17A 4OI1A 3UG6A 2MSEB 3FDIA 2OFWA 3BIFA 1ONBA 3IGFA 2W0MA 3QXSA 3J81k 1XJQA 4IKEA 5EE9A 4MKHA 4DVGA 4OHXA 5DYGA 3WNDA 3GEIA 8OHMA 4QBHA 4PO1A 3DM5A 3B85A 4DIEA 3MAAC 3A4MA 2FFAA 3R8FA 3QSYA 2H8KA 2BCJQ 4A8JA 5L3VA 1H8EA 4TZ6A 2G0NA 2AWOA 2WWFA 4RFSA 1E3MA 2P5SA 2O8CA 4TMWA 4MRVA 1E9RA 2ZRPA 4A92A 2G1KA 4M0LA 1ESMA 2VEDA 4JIMA 2F43A 2OFXA 1XMIA 2CLDX 2GJAA 3SR0A 1DAKA 4BLQA 2QZ4A 4LWZA 4BLOA 1TQ2A 2DWQA 3D8BA 3NXSA 1QG4A 4G0NA 5AUPB 5C4GB 5HR5A 4IDHA 2A5YB 2ZI5A 1F2TB 1V5WA 1A5TA 1U8ZA 1M6NA 2Q6TA 5FBWB 2DB3A 2RHMA 2BMJA 2ORWA 1Q22A 3QKRB 1SVKA 1CLUA 3GLIB 1S2MA 5HZKA 4M9QA 1OYYA 5EE3A 4NH0A 3MUFA 2B8TA 2NPFA 2XOKA 3A1TA 4YDHB 1P2UA 2D74A 1E0SA 2O0KA 3CBQA 1W4AA 3L0PA 4IXMA 3D3QA 5CB6A 1HUQA 3KX2A 4AURA 3ZIAD 2GBLA 2WTUA 3FWYA 1Q0UA 3ZVNA 4BE7B 4LGMA 1VYUA 2YWEA 4DCNA 1OLOA 1N6PA 3LXRA 3U3MA 1FTSA 1G41A 3CIOA 1OE0A 2I3BA 4PAQA 2C95A 1E6CA 4NYMQ 1KO7A 4NHOA 4AG5A 4KODA 3BD9A 4C3ZA 4AI6A 1Z47A 4XSGA 4G5OA 3AGPA 1AS3A 3AUXA 5GJWC 2Q9AA 2W2XA 3CX7A 1W0JA 5DYIA 3NBXX 2IXEA 2ZTSA 3WMFA 1FUUA 2ORIA 1CR1A 1ZM4A 4TQAA 3LA6A 4NYJQ 1G9XA 5CYPA 1N5LA 2XITA 1GNPA 4W7SA 2ZVQX 5EP1A 2J0QA 5FTKA 3ONWA 2OCYC 3NC0C 2BBTA 4CEIA 3K0CA 4PZLA 5JBQA 1XXHE 2PJRA 2GCNA 2WWGA 3VR3A 1D9ZA 4HLUA 4HB2A 2HF9A 1ZM9A 1DADA 4UNPA 4D81A 3X1WA 3AM1A 4PAOA 2O8EB 2ZYVX 4JLBA 1OXTA 2ZROA 3TE6A 2ZRHA 4A2QA 2CDNA 2JIZD 3Q8XB 4JLAA 2VP6A 3L43A 3QQ5A 2ZRFA 3RRMA 1ELOA 1W49A 1OV4A 1JI0A 2ATVA 2AL7A 2ZYTX 1E2KA 2FV8A 5ANRB 5FI0B 2NO0A 4TQUS 3RHFA 3SC3A 1ZBDA 1U99A 1CJVC 1TEXA 4R2HA 5HKKD 1JR3E 4IDPA 4Q18A 3UANA 3KQUA 3EPLA 1DTSA 2QE7A 3A4LA 4TZ0A 4A0HA 1FMLA 3HR8A 1P4SA 4URVR 2VSOA 2BJVA 2AHOA 4IOLA 2VHJA 2D2EA 4CT4B 4NYIR 2GAOA 4A0GA 1IY0A 4A6PA 1A1VA 1G8YA 1ZNXA 3Q7PA 3UXMA 4AKGA 5CJ2A 4CVNA 2RKOA 3H0KA 4IW3B 2C9OA 1VIAA 1XFAA 2OAQ1 1K5DA 2UZIR 1KI1A 3A1SA 2ZRCA 1KK1A 1EFTA 1E32A 2GAAA 4ARZA 1D2NA 4C0SA 4OQXA 3PEUA 1BH2A 1D2EA 4MYTA 2O0HA 1VYVA 2ZE7A 3AVXA 4QG7A 1OFUX 4KLZA 4QL3A 4GOJA 1JEEA 1Y63A 2IYXA 2XTMA 3LX5A 1CJTC 4KFRA 4ZDWA 2CCJA 2D4HA 5F2EA 5BN5A 4TMXA 2IK8A 5EQTA 1GIAA 3F8TA 1Z5ZA 1UBCA 1E2PA 4BFVA 1TUIA 3LXXA 3WNCA 2EWWA 1E0AA 3CPEA 3RC3A 1N5IA 5HZHA 5FL3A 2C96A 821PA 2WMNB 3LQQA 3QY0A 5DLQC 5KSPA 5TARA 1W5SA 2GJ8A 1KDOA 4A8JB 4CF7A 1PVOA 1C9KA 2HXYA 4A8JC 4DUGA 2ZSAA 4QM6A 2ZQ5A 4MRSA 4LK2A 2GKSA 1XTJA 5FUXA 3WNBA 5H8WA 1RW4A 1AKEA 1WF3A 3VNUA 1AKYA 1WBDA 3PR1A 1SVSA 4PPNA 3EPJA 2UZ3A 5B58C 1E9SA 2C2HA 5L3QB 1E2IA 4K81B 3LAWA 2XB2A 3K0AB 1S96A 1XXHA 4G01B 2O8DB 2FJUA 1SVMA 1SXJA 3P26A 3B13B 3LVQE 5J4KA 3BB1A 1E2EA 5E7IA 1MRSA 5FPSA 3T12A 1IY1A 2H16A 4DJTA 2O8FA 1OH7A 2HYIC 3LRPA 4BECA 1ZJ6A 1P2TA 4D4KA 4FD2A 4JLKA 3RWMB 4MKIA 1D5CA 3TQFA 2OBMA 1P5ZB 4BFXA 2CBZA 5AUOB 3C5CA 2JEOA 3TJZA 1OFIA 4B3XA 3DMDA 2QPAA 3QPWA 2VL7A 4O2LA 4JL5A 1DO2A 4IOKA 3WBKA 4PSKA 3UMRA 2HF8A 4IJMA 4US0R 1N2CE 3VKWA 1R5BA 3BXZA 2JDID 4Q9HA 1U81A 1DVRA 1YVDA 3HYTA 2AR7A 4QBIA 2UKDA 2J59A 1VCNA 4XH9B 4YDSA 3U3OA 1AGRA 3VHLB 4JSYA 1GNRA 1LB1B 1NN1A 3MWKA 1G16A 1T5IA 3B1XA 4EPVA 1MO3A 1HEIA 3O47A 5BW8A 1AJEA 3FVQA 4FMBB 5TV2A 2GESA 2N46A 3B6EA 5FOWA 2C99A 1SULA 2NGRA 2P6NA 3BH6A 3U44A 2O8BA 1R4AA 4JVLA 2GK6A 2OFOA 1ZMXA 4ESHA 1ZD1A 3MJHA 3ND8A 4KBGA 2HLDA 5JEEA 5TB5A 1OH5A 1JR6A 2AWNA 2AFIE 2EFGA 3KKNA 1ZM3A 5JECA 2B21A 2VO1A 3EWAA 1N5JA 2JJ8A 3M0EA 1E2JA 5LD2B 4BLPA 2ZE8A 1A82A 2C04A 1T3LA 1S8FA 2JLUA 3NDPA 3TW4A 1ZNWA 1WMSA 1G7SA 2IYLD 3GLHA 4B74A 4BZXA 1YR7A 1G5PA 4QRHA 1KKMA 2OG2A 4ABYA 5KHOC 1S9HA 5LBIA 5EZ5A 3CNOA 4QBGB 1G4UR 4DCTA 3U60B 1WB9A 3GJ7A 5E7MA 1DAEA 3C7KA 4EAQA 2AXPA 4O0MA 2O5VA 1Z29A 1ESNA 1II8A 1Z0JA 3L8YA 5FL7A 4NL4H 4PPQA 3B8HA 3FE2A 4HI0E 1H8HA 4NMMA 4UXJA 2ZREA 1W4BA 1W44A 2FGJA 4LYHA 3BB3A 3TW8B 1ZNYA 1HT2E 4MKGA 4C2UA 3QEJA 2VHCA 4HAUA 1XEWY 2FSFA 3WYGA 3OF5A 3NHAA 4WZ6A 5GVSA 4LCBA 3FHOA 2J45A 5EP3A 2J7PD 4TLBA 2DWPA 2EU8A 1HE8B 2ZJ5A 4XWKA 1KY2A 1YR8A 3U6BA 2IS6A 1BIFA 3BB4A 2JJ1A 2OE2A 5FPTA 4C9BA 3V9PA 4F4JA 1GRNA 4P3YA 2CEAA 2Y8EA 1DARA 2ZS8A 4B3CA 2EQBA 2X77A 2ZJYA 5FTLA 4TWZA 4FN5A 4K8OA 2QBYA 2R9VA 2OO7A 1AK2A 3QOFA 1OPXA 4LHVA 2J41A 1XJ0A 2PCJA 1G3MA 3TGPA 4GNKA 3U4QB 3FMPB 3LY5A 1Q3TA 3T34A 5JSZB 5F9FA 2ZRLA 3BFXA 2B8WA 4R2IA 4NZYA 4AYWA 3TIFA 4LUCA 2ZRDA 2A5FA 3NDBB 4D82A 2BMEA 4KAXA 5IK2D 1BO6A 4MRNA 2CE2X 3ZZTA 4MYCA 2BJWA 4OHVA 3TK1A 2BEJA 4B43A 1G6HA 1FNNA 2I1QA 3VMFA 3K8YA 3SZRA 3M1IA 2WAYA 4JLMA 1JPJA 3AVOA 3ZQJA 5DN6D 1TNDA 2FNAA 2ODWA 3ZIAA 3CH5A 3LX8A 5G41A 2A30A 3H84A 1UBEA 5CK4A 3TAUA 1SHKA 4KI0A 3AKDA 4RFSB 3VR2A 2NMVA 1OIVA 1PUJA 4NCJA 1J7KA 2YZ2A 2CLSA 3A58B 3E1SA 3AV0B 4TTRA 5L3QA 2ZI3A 4HZUB 1YZUA 3GJ6A 3FKSA 1TAGA 2F1JA 5DI3A 3OE7A 3SBDA 2BWJA 2QP3A 2Q0HA 4DSTA 3CZQA 1ZD9A 4OI0A 3WMGA 4B34A 3AVQA 2HEIA 4IVPA 2Q3MA 4ZCLA 1E99A 4B73A 4M1WA 4A2WA 1KMHB 1W0JD 1G1MA 4JLVA 4Z8YA 2JJ1D 5EE0A 4XD7D 4A0FA 1EXMA 3IUYA 3EARA 5EXSA 3KZ1E 2O0JA 5AJVB 1AIPA 1XTSA 2ZYWX 5G40A 4G5GA 5HCIA 1EWQA 3FFBA 5FUWA 1XZQA 2V55B 2ZJAA 4UNSA 2OEPA 3RS4A 4DCVA 1XXHB 5E3HA 3AVWA 4RZXA 4Q19A 5AJWA 1R6BX 3HR7A 4PSAA 3QENA 2DFTA 1MO4A 2GZDA 2QMHA 1UF9A 3B5JA 2FU5C 2ZANA 4GRAA 2OM2A 2D7DA 2AKAB 1R0WA 2VHUA 1G8PA 4RCZA 4DEXA 2HJGA 2IS2A 1NY5A 4OK6A 5FR1A 5BN4A 1T3HA 2PZEA 3CRVA 3CR7A 3W5JA 2NZJA 3TAHA 2QROA 4OHZA 4DLXA 4Q66C 1OFTA 1Z07A 4NCHA 4PZYA 1P73A 3CUEF 1S1CA 3VNVA 1TQ6A 4HLUC 5FTNA 1QVRA 3H4MA 4WXRA 5DI9A 3TVDA 1KI3A 4JKIA 3CRMA 4Q5IA 1JR3D 1Q20A 1RFLA 3DMNA 4OQFA 4V0LA 2JLZA 3LWNA 4JS0A 1FOEB 3BBPA 1TADA 4D26A 4QJ4A 2ZI6A 3N70A 1VPLA 1ZNZA 4HAZA 1N6KA 4YMWA 3ZVRA 3K0FA 3Q5EA 5DO9A 1W4RA 3VQTA 2JLVA 2PZFA 1YRBA 4JBXA 3THXB 1EGAA 2ZYUX 3L82B 4JVMA 4O2RA 3GEEA 3UIEA 2D62A 3T15A 1K8RA 1XTRA 2PX0A 2XZOA 3SDZA 2JASA 5H1YA 4L9SA 3GJ3A 1K5GA 1KI4A 3IO3A 4MGIR 3FHCB 1KI8A 1WRBA 2GJ9A 4IVRA 1P2VA 3ZVMA 1OJLA 2YINC 4PX9A 4BLRA 4RD4A 5AJZA 4Q1BA 3RWOA 4IDNA 5F3WB 1I2DA 2BM1A 1DG1G 1OT3A 3QPVA 2FFBA 1DBSA 3TH5A 3NBFA 2IF2A 2AD1A 4B6EA 4JMPA 1E9DA 1GRRA 4Q47A 2A5GA 4OJQA 2ZE6A 1U90A 4NPHA 3P27A 2VH5R 2EFCB 3BJIC 4LJ5A 2X8AA 1EFUA 4TTPA 3ZS9A 3MCAA 2WKQA 2CL6X 3ZS8A 1GFIA 1UJ2A 4RD0A 1NKSA 2ODEA 3TUIC 1IXRC 3QKTA 2V3CC 3K70C 1VTKA 1F2UA 3QXCA 4ZCMA 2FEMA 3SNHA 4LOAA 2QAGC 3EIEA 1QDEA 2FSGA 5GVRA 3PFIA 2H92A 2D06A 1GL6A 4KFSA 4B48A 3IEUA 4YMTA 1VECA 2KBFA 1JJ7A 3VX3A 4DLZA 1X1RA 1FX0A 2VBCA 1TQDA 3B9PA 4ZIRA 2Q21A 3SFZA 4BWYA 1P62B 4PFSA 1WA5A 1L4YA 2QA5A 4FW9A 4EUNA 2Q3FA 1X8KA 3EASA 4L9WA 3QF7A 4TSFA 1N5KA 1SKYB 2IYQA 2QQEA 5CLLA 4MKFA 3VFDA 4JL6A 1CIPA 1E1QD 1F60A 3M6AA 2J0UB 4TTQA 4AYXA 3ADDA 1SVOA 4GP7A 1F48A 1A2BA 2ANBA 2JJ2D 1AQUA 1G7RA 2ZS7A 2ZVPX 4AD8A 2BEKA 3HJNA 4FWTA 4G5RA 3Q9LA 3MWYW 1XPUA 1KAGA 3I8XA 1VG9B 1RRGA 4PC1A 4Q9JA 2YVUA 2AK2A 4CW7A 1NL3A 2G3YA 4HDOB 4HATA 4NCNA 3L2OB 4Q4AA 1XD9A 4KXFB 4CEJB 2GA8A 3ASZA 2FWRA 4ITRC 5E4FA 3RDPA 4KHZA 3FKQA 4EDHA 4ILEA 2K5UA 1P9RA 1S4QA 4DDVA 3PUXA 2W58A 5EE5B 2W2TA 1AS2A 3Q85A 4ASUA 5A0FA 3Q7QA 1SGWA 4KJZA 2H7VA 4KV9A 1G7CA 3IQXA 2N42A 4DCUA 2GBLC 3OEHD 5KPJA 3X1YA 3SOPA 5CB8A 3KFVA 3OFND 1II9A 4GMXA 1CJUC 2OHFA 1EFRD 2FZ4A 2WIBA 2IWHA 1LY1A 3AVPA 3HDTA 4H1UA 4Q1AA 5BQ5A 3BK7A 3R20A 1ZU4A 5J40A 3BE4A 3PEWA 2PT5A 1E9CA 5FPKA 1IJFA 3UWOA 4C4PA 3THWA 2OV2A 5JWHA 5J4YA 3IIMA 4BFUA 2QE7D 3GFTA 1P7CA 2IEZA 2VTKA 2YJTD 5KU1A 3W90A 1P61B 2B7BA 2MMCA 3H2YA 1U2RA 3K0AA 3LFUA 4Z8XA 3AVUA 1FFHA 4FCVA 5FR2A 1YU9A 1CJMA 1QHXA 3R9XA 3W8RA 4IVQA 3HU1A 2FFHA 1G64A 2FEOA 5D3QA 1HE1C 1D2MA 1VIYA 4IEEA 5EUMA 3VU9B 3EC2A 5HCNA 2AN9A 4M9XA 1SHZA 1P75A 5GJCA 2QP9X 1CXZA 4I81A 4JL8A 2VSFA 4TT3D 4TL8A 1CULC 2IYUA 1IM2A 2QY9A 4HDQB 1PLLA 3L0IB 4G1UC 1ETUA 4QGFA 4RD3A 2KB0A 3MWLA 5IHPA 3DZDA 4M53A 1W5TA 1II0A 2ZE5A 1G8FA 4L15A 1JAIA 2WAXA 3LBIA 2GK7A 1NKTA 4ESVA 3UMSA 1PJRA 2GZAA 3BWDD 4L5BA 3PUYA 2JAQA 5FBQB 5EXXA 1NF3A 2IYVA 4O3MA 2QSZA 1E2GA 4KSBA 3AF3A 2ZRIA 3T35A 3RYTC 1GG2A 4QJ3A 4D0LB 4TT3A 2QN6A 2XEXA 3FTQA 2X19A 2ZJ8A 4D4LA 5K8TA 3GLIE 4XD7A 4LBYA 4C7OB 4ZO4A 2PBRA 3UATA 4XWOA 1G5TA 3IHLA 2J7KA 2IT1A 3TLXA 1KOFA 1XCGB 1JB1A 1IY2A 4PQFA 4QFMA 5FFMA 3X1ZA 3X1DA 5JS8A 2ZSFA 3KJHA 1R0YA 3WYFA 4JJKA 1E9EA 4CEIB 3QI2A 2H17A 4Q1CA 2VF8A 2BVNA 4BPBA 4G3XA 1T3SA 2V7QA 1OXSC 2IUUA 3FPAA 2P0EA 4BFTA 1ZAKA 5TMPA 3AKEA 3KB2A 3C15C 2ERYA 4E03A 3KTAB 1Z06A 2H5EA 3LW7A 1E2MA 1M7BA 2VSXA 1VYTA 5DIFA 1NN3A 2OUKA 4XIGS 4LX0A 2Z0MA 1RYFA 2P65A 1KI6B 3UKDA 3RANA 4GZMA 1XB2A 2BBSA 1P9NA 1KTVA 4HUQB 3AVVA 1A4RA 1NSTA 1TF2A 2OBLA 1U0JA 2ZJ2A 3IDQA 4XTCS 4JBWA 3C14C 4UXHA 4W9MC 4KCGA 2P6RA 3KQKA 1NBME 1IN8A 3U5ZB 4M1OA 4QHSA 3SJAA 4UNRA 4C0QC 2ZR9A 4PPGA 3RAPR 2DHRA 5JFGA 4ZIRB 1AM4D 4GL2A 4LRWA 2BKUA 4M9SA 3QXXA 2P5TB 4QJ5A 2DFNA 4TMTA 1T0JB 1DAMA 4M8NE 2TMKA 4AKHA 1BS1A 5G3ZA 3UG7A 3TNFA 1VG0B 1Z83A 2OT3B 3ZH9B 2CHGA 3ZDQA 1WBBA 2REXB 4BZQA 2G0TA 3SYKA 1XD8A 3V4FA 1SZPA 3REGA 4QKQA 2XGJA 1YZTA 1ZW6A 4V02A 1UKEA 5CDFA 2YC2C 4B6FA 1EFRA 1GZSA 1KI9A 1I2MA 3KUCA 4QHTA 1Z08A 4MDFA 1AS0A 1NMZA 3NWJA 4GDFA 4GT1A 2ZRNA 2BV3A 3CNLA 2RGDA 3WHKA 2J3EA 2W6ID 3I92A 5LD2C 3VKGA 3T1TA 4BRUA 2JATA 4X8LA 3WBJA 1XPRA 4JLPA 4US2R 1X6VA 2IXGA 1OW3B 2EFHB 3EX7C 2PLRA 2QSYA 2FE4A 3CO5A 1GKUB 3A1VA 4D4JA 4RVCA 5DGXA 4BFSA 4NE2A 3LLUA 4UNNA 2DYKA 1G3RA 3WYAA 1M7GA 4DBLC 4YMSA 5JCZA 1J8YF 3PQCA 2XNDA 4HZIA 2VHTA 2FF7A 5J5CA 5EUQB 2WWIA 3K0EA 1EWRA 2GVZC 3GLFE 4QNMA 4LJ6A 4NYJR 4ZKDA 1E4VA 3THWB 4DLUA 2BMFA 1RRPA 2H1LA 1RRCA 2E9SA 1JBKA 4MDEA 1XEWX 1N6LA 5CITA 4Q00A 4Z1MA 4ON9A 1XD2A 1NG9A 4HDCA 3EG5A 3GFPA 2CK3D 3K09C 4HUTA 1TF5A 1KMHA 2ZJBA 4W5JA 4X8OA 1ZD8A 4B71A 4Q7KA 4TYPA 1TU3A 3KKQA 3EZ7A 1KDRA 2QTFA 1IN5A 4CGZA 2A78A 2CVFA 2WBLC 4EIWA 2XJ4A 3U7GA 4EFLA 2KWIA 2QAGB 1N6OA 1P9WA 3LH5A 1NRJB 4I99A 5CDFE 1TF7A 4JJZA 1E69A 3EAQA 4FCTA 1DG3A 2CMKA 4B32A 4I1OA 5FOSA 2JCSA 4BLSA 2QT0A 4AK9A 1WP9A 2W2VA 1KKLA 2D2FA 1AGPA 2WZQA 1NLFA 1CRQA 3B7GA 3DKVA 4LYFA 4WZBE 3FOZA 2H57A 3ZZ0A 1Z0KA 2ZAOA 2Z6VA 2D7CA 2FA9A 1IONA 5L8VA 2CK3A 2P2LA 1KJZA 5FOXA 3GLGA 1XDBA 3F0TA 2AFHE 4WVFA 1NMXA 1R5NA 4TL6A 4DIDA 1CKEA 2WSSD 4TLDA 1NJFA 4PAMA 1P60A 5SZKB 4F38A 2A9KA 3TUJC 1KMQA 2WJIA 1TTTA 4LBVA 4LC0A 4MYHA 1XNJA 721PA 2LWIA 5KPDA 1KSFX 1G8HA 2IC5A 1HYQA 1GILA 4AY2A 4Q9KA 4V0ME 3FFAA 4JBYA 1QHGA 3A4NA 4IFEA 1KI2A 3DHWC 3SI7A 3CH4B 4NYIQ 3ZD6A 1X3SA 3E2IA 4PO9A 2WPDD 4Q1FA 2ODBA 2BBWA 2H18A 2ZUBA 1WE2A 2QM7A 3C41J 4RKFA 2XZPA 3IQWA 2YOGA 5JS7A 1RE0A 2O8EA 4C0KA 1D9XA 5A5GA 2WOJA 3EIQA 4Y0AA 4UNQA 3PUWA 4MITA 5L3SB 3HP1A 2ASEA 2VQSA 4DDWA 1YZNA 2AD5A 3C8UA 3AVYA 2ZRKA 2FDCA 4AC9A 1JQLB 1OXXK 2Q3HA 3IIJA 4PANA 2QMOA 4ZV4A 2EVWX 2QL6A 1I4TD 3G5UA 2QRNA 1KI6A 4M22A 4Q4JB 1DAIA 5FUYA 3SE0A 2WHXA 3B78A 3QF4B 3MRSA 3FYHA 2GWHA 1OXVA 3GLHE 3N2EA 1E9FA 3PUVA 1LTQA 4ACBA 2CL0X 5JZVA 1EK0A 3CF0A 3MGCA 1TUEA 1WXQA 4LI0A 4Z1MD 621PA 3GLGE 3F3YA 2QGZA 4X8HA 5D3MA 3QVUA 1UADA 1IHUA 1W36B 5JWOA 3DOEA 2W6IA 4PHTA 3AH8A 4PC2A 5BWMA 4QGHA 3KJEA 5CK5A 5FBLB 2DWOA 1GAJA 1Z2AA 2OXRA 4LC1A 4JYCA 1TPZA 5TXGA 5LDDC 3FKSD 3K9GA 3KQHA 1DS6A 2GILA 1S9DA 3RS3A 2Z4SA 2GCPA 4YMUA 3F5FA 3PVSA 1W0KD 5L3RA 1CTQA 2FPKA 3SQXA 4EQ6B 1JXOA 2QNRA 3HWSA 1H8ED 1U8YA 1XX6A 4E07A 2GZHA 4U00A 1SVWA 1ZUNB 1G19A 1NVXQ 4YLGA 2HXSA 1J2JA 1BKDR 3QE0A 4Q4HA 1R5OA 4Q4LA 3RS7A 5KNDA 5FOVA 2X2EA 2ZI7A 2HJVA 3TUZC 1M1YE 2F9LA 1RC8A 3ZLJA 3EWSA 2W83A 4N0EA 4EPXA 3ETLA 1X8JA 1QHNA 3CNNA 3GCGA 5CM8B 1CRPA 4IDOA 5DSZA 4ZDIA 2GXSA 4IXNA 4LJ7A 1KZGB 1E96A 2PEZA 1O87A 3KUDA 2NO9A 4JLDA 1E1RA 1NY6A 2XOKD 4TLCA 2QORA 1VHTA 2RCNA 4BEBA 4CYMA 2W6JD 1IN4A 1E79D 3QNUA 1GKYA 4G5SA 4LJAA 2GRJA 3DM9B 1GL7A 2GNOA 5B57C 4F4CA 4DLTA 2NO6A 4UKDA 4OI4A 4BEJA 4XVRA 4ZI3A 3BC1A 2XB4A 1OXUA 4V0KA 2PJZA 4PSVA 2I4IA 3PXGA 3CWQA 5F9HA 3SJZA 1FQJA 3I5YA 1N0VC 1I4LD 2GEUA 3V4RA 3P1JA 4G5QA 4N0DA 1D6JA 5K8UA 2YOHA 4WXPA 4BLTA 2F55A 2HT6A 3DKPA 2WJYA 1CF4A 2O8FB 2AK3A 1E98A 4PHHA 2JLSA 3GLIA 2B92A 2GCOB 1SXJB 3K70B 2WJVA 2VP2A 2KI5A 4EJSA 3GPLA 3NC1C 1Q1ZA 2JIZA 4PC7A 5GJBA 4CT5A 4HLDA 4MRPA 3BFKA 1OIXA 1UDXA 3DL0A 2KBEA 1UEIA 4YMVA 1OB2A 4CDGA 4F7WA 2XZLA 4MYUA 2XXAB 3GJXC 3CKLA 1XBTA 2PH1A 1MRNA 4B35A 4URUR 4P4UA 1I4DD 1BYUA 3P4YA 2JDIA 4NYMR 4B33A 2R8RA 1UKZA 2IHBA 4GP6A 3K0SA 4DB2A 2AKYA 4L4UA 1JXMA 4B3FX 3K9LA 4Q7MB 4B76A 4D80A 2DCUA 4P32A 1MABA 3WXMA 4DSNA 3JVUA 2BMDA 4TYYA 4OQNA 2CJWB 2OXCA 4P31A 1WDTA 1XWIA 5J4VA 1N6HA 4LY6A 4CEJA 1MO6A 4EJSB 1LFDB 2WVJA 3GJ4A 2YKGA 2W6JA 2O52A 4PQYA 1PZNA 1YJ5A 1GITA 2GEDA 3EZ2A 4QGGA 4CRWB 2O8BB 4M9ZA 4DC9A 5FL7D 4LJ9A 3NBYC 1NJGA 2QU8A 1E2LA 3B82A 3N2IA 2Q9CA 3D7MA 4LHZA 4Q1DA 4Z51A 1TQ4A 2YC4C 5DNYB 5EE1A 4PXAA 4YQFA 3D31A 1X86B 5HE8A 3W8NA 1NN5A 2IYYA 1G5RA 2XJ9A 4OQMA 4F91B 3L0OA 4JVSB 1OHHD 4US1R 1KNQA 4Q7JB 1VG1A 4Q03A 1LF0A 4NDZA 2WV9A 1W46A 1Z8FA 1XTIA 4M21A 2LKCA 4RSGA 5IK2A 1VG8A 1ZP6A 4H9GA 1F3OA 5FI1B 1KJWA 3DEFA 3CX6A 4TN1A 1JEDA 4KO8A 4DT1A 3THXA 4JYBA 3Q5DA 4E09A 3VX4A 3CRW1 2WSMA 4QNRA 4GMDA 3BH0A 3R9WA 3LDAA 1XZPA 1T91A 2QGNA 1W7AA 4A36A 4PZZA 1E4YA 3JZMA 5JI3E 3REFA 2KSQA 2WKPA 2LCFA 5G3YA 4Q7LA 3C4JA 1KO4A 1X1SA 4PR0A 3I32A 1FNMA 1HY3A 2WKRA 4L16A 2NQ2C 4AIIA 3NEJA 1P6XA 3RS0A 4HB4A 4BFYA 3LV8A 1EESA 2EYQA 2V7QD 3W5IA 1QHYA 2WMOB 2C9CA 4A1FA 1COWD 1CU1A 2J7PA 5CIQA 1OF1A 4A15A 3OEHA 1W48A 4DRZA 2L0XA 4LV6A 4U5XA 2GHIA 3HPQA 2GJKA 1GUAA 3CF2A 2DY1A 4F92B 3QBTA 4F93B 4JKYA 3BGWA 1ZRHA 3VR4A 5JWRA 3AEZA 2ZU6A 1Y3AA 5BXQC 4TMVA 4S35A 1E9AA 1L2TA 4QXAA 5D3MB 3I61A 1KZ7B 3I73A 4WW0A 4DKXA 2HDNB 2RGNA 3TSWA 3K9NA 2R6CA 1G3UA 1W2GA 4QC2A 4Q4AB 4TL7A 2WPDA 1G4AE 2Z4RA 2R6DA 4IHQA 2GVDC 1JJVA 1AQYA 2V6IA 3K0CC 1FZQA 4MUBA 3ADKA 3GFOA 1YZGA 1NVVR 1KJYA 1Q57A 2CCGA 2ZSDA 2FSIA 3Q72A 4DWJA 1U8AA 5FPYA 1NLYA 1UPTA 2YHSA 5KO2A 4FINA 1RJ9B 4DZZA 1OKKA 2FH5B 2VHQA 1M8PA 3CW2A 2QRZA 1ZM7A 2CNWD 3PUZA 1Q21A 2QTHA 2ZITA 4MUAA 5KOYA 4DUGD 3U7FB 1W0KA 1SXJE 2NPIA 2ZM5A 2IEYA 1FTNA 2JJ2A 3IKJA 3CF6R 1FP6A 2IYTA 3BOSA 1M2OB 3GMTA 4M1SA 5DN6A 2G83A 1KAOA 2AX4A 2IX3A 2CHVA 1QHSA 4GSYA 1XTQA 2F3TA 3WP0A 1KNXA 2YYZA 4LYAA 4NCIA 4DLVA 2ZI9A 5HKKA 1XCPA 2OCAA 1G7TA 4WOPA 2RGGA 1Q12A 4BASA 5FBRB 3ZYCA 3RRNA 4L8GA 1CEEA 3IPXA 3WRXC 1O3YA 2F3RA 1JALA 3ZJYA 2YWFA 2C98A 2JLRA 1F2TA 2F9MA 5IRCD 3EZ6A 1Z2CA 4OKSA 1E9BA 3I4LA 1JAHA 1F5NA 1RZ3A 2BBOA 3SJCA 1N6IA 1GKIA 1UBGA 2GF0A 4JLOA 4HAXA 4EPWA 1AN0A 2V1XA 4II7A 2PT7A 3OAAA 1IJEA 4MH0R 2ZR7A 1YZQA 1Z22A 2OZEA 3AGQA 3SJBA 2IYZA 3U2QA 4C0LA 1F6BA 3VR1A 3ND9A 4ERNA 4PO8A 1Q1EA 3W6NA 5C1BA 3SHWA 2EWVA 3L0SA 1W47A 1HT1E 3CPHA 2Z83A 2Z43A 4A2PA 2C5LA 4B2LA 4IRUB 1CP2A 4KLNA 3O8CA 1EFCA 3T5GA 1NMYA 3MWJA 1N6NA 2IYSA 3NEYA 4HB3A 4HLQB 3U3KA 5FTMA 5E95A 4V0MA 3EC1A 4XJXA 1R2QA 3IBYA 1ZC4A 3P32A 1KGDA 5KDLA 3I5XA 2PMKA 3IO5A 1GRQA 1DAHA 1P2SA 2RGXA 4RZUA 3KXIA 3PITA 4WZAE 2JA1A 4B47A 4ZI2A 2PZGA 2IYWA 2REBA 1Q1BA 1ZYUA 1DO0A 5EZ6B 2ECKA 3BFVA 3KL4A 1LVGA 4DLSA 5LB4A 2A5DA 3A6PC 3GLGB 1FQKA 5JEDA 3QXJA 4EFMA 3W3AA 4B2PA 3O8BA 3N5CA 3NH6A 4HB0A 3PJRA 3E70C 3FMFA 1XP8A 2VF7A 3E5HA 3NH9A 5UKDA 4ZDJA 1G6OA 2VYFA 4R98A 4UXIA 3ICEA 1FW6A 1GTVA 4MGKR 6Q21A 1GNQA 1ZC3A 1XMJA 3RS2A 3T1QA 1IQPA 3GLHB 2CCKA 1N3BA 2NG1A 4FWIB 3VHXA 2QI9C 2XNDD 1Z6XA 1KK0A 2G77B 1KDTA 1XTKA 4UQOA 4V0NA 1KHTA 3UK6A 5AWFC 4LHXA 4LYJA 1NP6A 4BFZA 1KSHA 3FMOB 1KSGA 2VRWA 2W00A 5J47A 2R65A 1HV8A 2HLDD 1HURA 3B1YA 3AQ4A 1BMFA 3NHBA 2ZUDA 3P20A 2OLKA 1Z6AA 5HPYB 1N25A 4WA7A 1TU4A 2RGNC 2R62A 5LB2A 4Q4JA 3SFVA 1KYIA 3VAAA 4D2IA 3S1AB 4DHEA 4FI3C 4JLJA 1Z0IA 4KVGA 3W6OA 3TQCA 3GLFA 3IBGA 5JHGB 3EW9A 4D4MA 5GADl 2ZRMA 4QBFA 4CZ2A 1ZINA 1LS1A 4YXWA 4EQ6A 4FIDA 3OESA 3OAAD 3TSOA 3GP8A 2JLWA 4XOIA 2IBMA 2QBYB 4U02A 1AZTA 2QAJA 1GVNB 1YZLA 1F2UB 2V1UA 2J0VA 3WP1B 2VP5A 1YE8A 4GZLA 2V4ZA 1U98A 1NIPA 3CM0A 4TMZA 4A9AA 3K09A 2KE5A 1ZCAA 4B44A 4MRRA 1LNZA 1Q3HA 3OIVA 1N0WA 1GWNA 2FGKA 2WSSA 3S1AA 4GBMA 4M1KA 1IXSB 4HAVA 4D25A 4HEJA 5JRZA 4YXWD 5CM9C 1TEVA 2XX3A 4RJLA 2ZETA 4M2LA 3VTKA 5FPHA 2IHYA 3TR5A 2DR3A 3TMKA 2O8CB 4ZKEA 1EX7A 3CLVA 2OAP1 1B0UA 4TLEA 2PLFA 2C78A 2J9RA 3BORA 4Q48A 3TRFA 1ANKA 3MFYA 1GL9B 4IOJA 4LSGA 3T06B 4WIAA 4NCKA 4KU4A 4Q01A 2YV5A 1BYIA 1G3IA 2C8VA 4DEYA 1CR2A 4NBSA 1DEKA 2WJHA 3WY9A 5DI3B 5JHHB 1M74A 1EG7A 4CEHA 3AKCA 4HZUA 1GOTA 4AKEA 4HAWA 2RGBA 2QAGA 4C0HA 5J4LA 1OKKD 3THYB 1QHIA 2BC9A 4URXR 4GOKA 1R0ZA 4UJ5A 2V54A 1VCOA 3MMPA 4LPKA 5SZIA 2V8OA 2NTYC 2OSBA 4POAA 5C18A 2XTNA 1S1MA 3GQBA 3U3RA 4C0JA 3KFXA 1YHNA 2I1VB 2F1RA 2F43B 4Q02A 2IYRA 3NKVA 3AP1A 4Z54A 4I1SA 2NO1A 2VP0A 1M34E 1QHHA 2IF0A 4FCWA 3O8RA 1OH6A 3NG1A 1XMSA 2MSDB 4QOSA 1J99A 1G8GA 4K46A 2FFQA 4D0GA 2JLXA 4C7OA 3T5DA 4AWXA 2R6AA 1J90A 3GJ0A 4IDQA 3W34A 1FMJA 3C16C 4P0TA 3SBEA 3QKUA 1LS6A 1OH8A 2FZLA 1FL9A 1YRAA 1Z0FA 1ZUHA 4WBSA 2RHDA 5C4MA 5K8IA 2EW1A 4TMKA 4A82A 2QM8A 1M7HA 3H86A 1KO5A 1P72A 1NVWQ 1SVLA 4U7DA 3UPUA 1UEJA 3B1VA 4AYTA 3GEHA 2OCBA 4Q1EA 1WQ1R 5KSYA 1GDDA 4A0RA 1VCMA 4OYHA 4OJKA 3ZQ6A 3OIYA 4B3DA 2CJWA 2PL3A 1VDZA 2Q9BA 3LQRA 4FXPA 2E87A 4O25A 3AKYA 4DT1B 3U6KA 4D6PA 4Y0VA 4EJSC 5TY0A 3VU9A 1MOZA 4MGYR 5DE3A 3TSZA 4B2IA 3OEEA 2OESA 1SKQA 4NONA 3B60A 3KJIA 4RFVA 3OIUA 4RY2A 5AJXA 1E0JA 3Q3JB 2X2FA 3EZFA 1E2HA 3SQWA 4JSTA 1G21E 4JLNA 3KB1A 2IUTA 4KFUA 4RD6A 2ATXA 4NU0A 1NVUQ 4RD2A 3EA5A 4EKDA 3FHTA 4RKEA 1YR9A 5EP4A 4PPFA 1NN0A 2WWHA 3KKOA 1MO5A 1L7VC 3ASYA 4OHWA 1R8SA 5E7JA 2FX3A 3OIWA 3A36A 1SXJC 4LJ8A 5AR1A 1Z28A 4XVUA 1YZKA 2IL1A 1T9HA 1XEXB 4URZR 1HH4A 5AUNB 3U4QA 3IEVA 2DFLA 4JT2A 3KQLA 3QIAA 4PQRA 1AZSC 1FX0B 1R7RA 4GOXA 2ZSEA 2A5JA 3KXKA 4UJ3A 3AF0A 2F6RA 2XNSA 4TQ9A 2REOA 4XTRA 3ICQB 2AXNA 1N6RA 1QF9A 2RMKA 5KDOA 4Q21A 3RS5A 3AP3A 3VKHA 2F1IA 4PC3A 3PENA 4I1VA 2GXAA 2ZU0C 1NBMA 2GXQA 2R6FA 5DISB 1XU4A 2YWGA 2KJQA 4DLWA 3B1ZA 4KBFA 3LBNA 1GP2A 5G53C 2QEQA 5DH9A 4EPTA 1Z0AA 4M1YA 3RABA 2X1VA 2EFDB 1XRJA 3EIHA 4BFWA 4B3GA 4GFDA 1JPNA 4QM7A 3GD7A 4AG6A 4XWAA 2PCLA 5C46F 4JZKA 4Q4HB 5KSOA 2J0UA 2ZRBA 3THOA 2HCBA 4A6XA 4URYR 3AF2A 4LV8B 3HU3A 3WMEA 2ZJOA 4IFBA 2WICA 3LBHA 4FMDB 3UWKA 1G3QA 3T61A 1LV7A 3B1WA 1U0LA 3M4YA 4KFTA 4DSOA 3H1TA 3QXHA 4EPRA 2ZRAA 1SXJD 5J4HA 4BRWA 2HV8A 3CRQA 3C5HA 3P4XA 3HU2A 3SYLA 5JJKA 3ADCA 2EFEB 4IEIA 3HYRA 2ZIAA 1Q44A 4KITB 1CR4A 3D6TB 1Z3IX 1PUIA 2ANCA 3KKMA 3QJYA 5EP2A 2G9NA 3VR5A 4N3NA 1UDWA 1KDPA 5GJVC 1DELA 1R0XA 2GCOA 5JRJA 4PTLA 4V03A 1KO8A 1NSFA 5JJIA 1LW7A 2ZXUA 2RAPA 5C2JB 5JI2E 1HA3A 1T4GA 1OHHA 1DOAA 3PEYA 3RSOA 2F7SA 1DAFA 2ZR0A 1H65A 1XCMA 3ZD7A 4TYQA 5FTJA 4HSEA 4F4IA 1W36C 1ZCBA 2GJSA 1EFHA 1KY3A 4WAUA 2FOLA 4DCSA 1EX6A 2A2ZA 4P4TA 1JECA 3BS4A 1B23P 3PG5A 2VA8A 2CL7X 521PA 1RYHA 1E1QA 2O8DA 1T0HB 4RCYA 1P3JA 4LHYA 5B30A 2MMGA 4NKRA 1DPFA 1MT0A 3DPUA 5IT5A 4ZDKA 3KKPA 1UM8A 1QHHB 5F98A 4A4DA 1G291 4W5HA 2ODNA 2XTZA 4RZ3A 3RSLA 5AK0A 2E1RA 4LPSA 1TX4B 1US8A 4S2EA 4FMCF 2GXUA 2XXAA 4MA4A 1KO1A 1UKYA 1SKYE 3JZAA 4RZ2A 2XSZD 3IIKA 1NNEA 1PLJA 1CJKC 2YOFA 3OE7D 2SHKA 3MSXA 5CJPA 3KXLA 2ZSBA 4LDJA 4LHWA 3R9IA 2IS4A 4M1TA 2JGNA 4HYYA 1S3SA 2VP9A 1C1YA 2W0SA 2D3WA 4QHYA 5K8LA 2FMXA 2FSHA 1NIJA 4R9UC 2NO7A 2FPMA 2DPXA 4TYWA 1OIWA 3PIRA 5L3SA 1S3GA 2V9PA 5IDVA 1E79A 2EYUA 3VR6A 1MABB 1QZXA 3A1UA 3OFNA 5TVKA 3L8ZA 2BIFA 3QG5A 1NG1A 2NIPA 4URWR 5SZHB 4PHGA 2ONKA 4HLCA 3DO6A 3DZ8A 5KNCA 1XMVA 3GJ5A 2ZI4A 3CX8A 3MLEA 3R7WA 1UAAA 1Z0DA 5FH9A 2A3RA 4CIDA 4X8MA 2ORVA 2QPTA 3AUYA 2B7CA 5SZJA 1L8QA 3I8SA 5DHFA 4NTZA 1C4OA 221PA 4JVNA 4TL9A 4C2TA 4C0BA 3IILA 2QUZA 4AKIA 4P33A 3RC8A 1JQJC 3EA0A 4ZCIA 1A2KC 2CE7A 3AF1A 1WCV1 2HT1A 2ZRJA 4LBZA 1ODFA 1D8TA 3GJ8A 2JLYA 3GLFB 3QF4A 4B3BA 2B6HA 5CYOA 1G20E 3G82C 3T1OA 3WHLA 3RRYA 4R71A 1G18A 4RD1A 3AVTA 2OLJA 3A1WA 2F1HA 1GSIA 3OEED 5P21A 4EFNA 4ACAA 4QGAA 2ZPTX 4DDUA 5A4JA 1HQCA 1Q1QA 2GEVA 3KJGA 1CR0A 4NP6A 4D0NA 1BMFD 2VP4A 1FP7A 1PV4A 3CONA 4DB4A 1V43A 1E2QA 4ARZB 2P3SA 3OHMA 5BYJA 5DHAA 5IF9A 1U9IC 4C0AC 3DOFA 1T8TA 5B2ZA 1ZIOA 2QTVB 1E2DA 3B9QA 1MV5A 1ZM2A 1J70A 2IUSA 3K70D 2J87A 3UMFA 2GDJA 3NVAA 3QPUA 1XEFA 2PMDA 4XSHA 2OBNA 1R8QA 1TL7C 2BHRA 3MJRA 4I1UA 1RPZA 2QG6A 4M4SA 1YKSA 4N1AA 5KSZA 3CR8A 1MH1A 121PA 5H70A 3CZPA 2BCGY 2IA5A 2DFKB 1NI3A 2XSZA 2CLCX 3BH7A 2P6UA 5KUTA 4MQBA 1GM5A 2QT1A 2RGEA 2CHQA 1UBFA 1XF9A 3V00A 2YWHA 2ZEJA 4XVQA 3TR0A 2XAUA 2VPPA 3NBZC 2C03A 3W3ZB 2FPLA 1S0UA 3LO5A 1NVVQ 2IS1A 4TYNA 5AUQA 3G0HA 5TDHA 2G88A 1H8HD 3X1XA 4P4SB 4J0QA 3BERA 3FB4A 3SS8A 3B2EA 3BAFA 5JJLA 2WWWA 3THYA 421PA 3W9YA 1L4UA 4W5WA 2CXXA 2VIIA 4LZZA 4MGZR 3QEOA 1Z6TA 3ZZUA 4ASUD 4PC6A 3I1FA 1VHLA 5HTKA 4CEHB 2BDTA 3CWZA 2ZRGA 2QPOA 4LV5B 3ADBA 2V6JA 1IXZA 1VMAA 2R44A 2IWRA 4BQSA 2CVHA 1E94E 1E2NA 2ZS9A 5BYKA 1BOFA 4I4LA 1UKVY 3QG1A 3U61B 2DBYA 3FMIA 2R6GA 3PCRB 1KI7A 1U0HC 5EJEA 1ZIPA 3CPJB 1FUKA 3PEVA 1XD2B 3RNLA 1XPOA 2NZ8A 2R2AA 1X8LA 4TSFD 1QG2A 1OFHA 4KYUA 1LF5A 2GTPA 2WWXA 1RKBA 3IHWA 1VCIA 2NOAA 3QKRA 2UVQA 5KDDA 1U9IA 2J0SA 3TVTA 2G6BA 4E22A 1Z6GA 4DDTA 2BM0A 5M04A 3SU8A 3AB3A 3ECCA 2WWYA 4FMCB 2RB4A 3NTUA 1QRAA 3RVBA 4DLRA 2ERXA 4YC7A 3T1VA 2FG5A 5LPNA 5JLJA 1KK3A 1KK2A 4OBEA 5CLQA 4LBWA 1K6MA 1W36D 3O8DA 3OZXA 3QKSB 1E2FA 2MSCB 1IOZA 3LW8A 3QKSA 1UFQA 5AJYA 4E5UA 4OQLA 5FBVB 5KYKA 3EXAA 1JNYA 1R10A 1SVIA 1US8B 3CB4A 1IBRA 5FUVA 4EPYA 3K53A 2QENA 1JR3A 1T5LA 4OL0A 3K1JA 1HTWA 2GF9A 1W4CA 4LJ4A 4OK3A 4BZPA 3I72A 3QUSA 3ZGXA 1KIMA 2WM9B 2N1BA 5BN3A 2J5XA 2YNMA 4M1MA 1E1RD 4LJYA 2QP4A 3NIBA 4OI2A 3MG9A 5EXPA 2BKEA 3KTAA 2PEYA 3K0FB 5B64A 2ZJZA 1N0UA 3LNCA 1HQYE 1NBMD 3U3JA 2J46A 4Q9IA 2OILA 2PX3A 1XJCA 4TLAA 4KYIB 4OHYA 1VKJA 4BGDA 1RIFA 2C77A 1II8B 3TKLA 2RGCA 5ELXA 1OB5A 3SN6A 2HCJB 3U44B 3QVVA 1SQ5A 1PLKA 2HUPA 3DVLA 1IN6A 2ZUCA 1OSNA 2JLQA 3AF4A 4R7ZA 2C9YA 4GPTA 3R7WB 3LLMA 4YONB 5HE9A 5FOUA 5JMTA 1OYWA 2WJJA 1Z6YA 1DAGA 2Z5FA 1NLZA 4V0OA 2OCPA 3FGNA 4KVAA 2ZAMA 4KSCA 1IN7A 2QMEA 4PHFA 3TBKA 2QQ0A 2IW3A 3SYNA 5KNBA 2CNWA 1U94A 4HAYA 4DLYA 3QBVA 1ZUIA 4C30A 3RLFA 4B75A 5CIWA 3KDSE 3R8CA 1AA9A 1T8UA 3MD0A 4HUQA 1RRFA 3SEAA 1YR6A 3BRWD 2BOVA 3X2SA 2IXFA 4OK5A 3EPHA 2GETA 2LKDA 2WIAA 1TMKA 3EZ9A 4FMDF 3CRRA 4DSUA 1ZVQA 1CS4C 3SHFA 1YQTA 2G1JA 4Q9LA 1QBKC 2J1LA 1Z63A 5JSZA 1DE0A 1W1WA 1ZU5A 1MKYA 1KSJA 5KTYA 3W6PA 3A37A 1J8MF 3ZVLA 1MR3F 3RRZA 1FPMA 2FN4A 3I3SR 4H1VA 4JT4A 5H68A 3K9HA 2VLIA
chains in the Genus database with same CATH superfamily
2GERA 1O7JA 1GM7A 1YUMA 3EF3A 1HZJA 3KQNA 2G25A 3LD9A 3WDLA 2XD9A 1NXTA 1PTJC 1E0KA 4O3FA 5JASA 3MXOA 3WB9A 1XEXA 4LHEA 4Z4QA 2R7KA 5B7NA 4E1AA 2YQ5A 3CUSA 4Y6GB 3CX5F 3WB1A 2B5WA 4M7PA 3MXTA 4N7JA 5KNDH 1SNYA 3OM9A 4EW2A 3EPKA 1DCTA 4LEIA 1WCWA 1ZHFA 2NP6A 1UXIA 3KSUA 3KYIB 1W2HA 2RH5A 4XIFA 1JZTA 4NBVA 4JROA 2FN3A 5GZ3A 1WL8A 4WADA 1N2CA 5KKCA 2WP8J 3TE7A 2VXCA 3O3MB 4P4SA 1HGXA 1Y1SA 3NCHA 4I1IA 4MRAA 4S1TA 5FOTA 3SFTA 1NF2A 1RC1A 1IAQA 1S72V 1RVDA 1PI3A 3L05A 4X00A 3FRJA 4K40A 2Z2IA 1BQ0A 1KVUA 2OFWA 3H4IA 4RFLA 5EESA 1IK6A 4YUXA 2Z6UA 3MS4A 3IGFA 2W0MA 2CUKA 3F8WA 3KJFA 4LJKA 1Y4SA 3ESYA 3S2SA 1JEYA 5DYGA 3PQEA 4DQVA 3OH8A 2Z9DA 1ZONA 1Y6JA 4KGVA 3L07A 3INGA 4LDPA 3LYLA 4HHEA 3QELA 3VVLA 1Q0QA 3ER9A 4KIFA 3OEEG 4FNGA 1E3DA 1LSOA 3JYHA 2XDYA 2D8MA 3A4MA 3HE3A 5FWYA 5EHGA 2FFAA 3LY9A 3R8FA 4MB6A 3QSYA 5F33A 2VRNA 2VJOA 2H8KA 3BIJA 3K3WA 1DIOB 5L3VA 1RBQA 3QU7A 1XC7A 4ZZ0A 2TS1A 4U7FA 4BMOB 4TZ6A 4UCTA 3X43A 2G0NA 5IVIA 1COZA 3OTFA 2IJKA 1IURA 1ZVKA 3E3AA 3E82A 3FDFA 4I14A 1ISPA 2P5SA 4RFSA 4U8GA 3G9TA 4MKXA 4YBRA 4PA9A 2FSVC 5JD5A 2G1KA 4M0LA 2VEDA 1CX9B 4JIMA 1XREA 2F43A 3ABQB 4KGZA 4EF6A 3DQPA 1XMIA 2G38A 4RKWA 2QZ4A 4LWZA 5LP6C 1RVV1 3TLCA 3RIXA 4BNIA 1TQ2A 2QL9A 1QG4A 3I5AA 4G0NA 1Q82W 1OAKA 3RVBA 2AH5A 1DKQA 2Q6TA 4ZT7A 1M6HA 1M6NA 2GAFA 4FGZA 5THXA 4BTLA 2DB3A 4B3MB 2BMJA 1XLWA 2VLBA 1RRVA 3AUSA 3DHNA 4Z9FA 5BXZA 5FA6A 5B7PA 5C5EA 3UT5B 1ID8A 1EXNA 5FF9A 4NH0A 2NPFA 4LW8A 2XGMA 1SZJG 3BEDA 1BEEA 2D74A 4FZ3A 4HVLA 1K4MA 3L0PA 1VOTA 3D3QA 3K79A 5CB6A 3KX2A 4K6CA 2OLEA 1IOVA 4L7QA 2EQAA 4DCGA 3WAKA 2R86A 5K3OA 3UMJA 2PUVA 4HQFA 1JS1X 5JMOA 3JSNA 1A04A 1HZZA 5EJMA 1Z5WA 4PRZA 3SF8B 3ZLUA 4BE7B 4YRBA 5B3SB 1YUNA 1Q90D 4DG8A 4IIBA 2Y0DA 2EF1A 2ST1A 2ONZA 3I23A 3N2GA 3LXRA 3N74A 2I76A 3B40A 4LX8A 4QTUB 1PD3A 3IS3A 1PDVA 1IUNA 2I3BA 1TT5A 2YV2A 3H9UA 5GOZA 2AJLI 1AX9A 2VDMB 3UAVA 5F7XA 5K6AC 3CEIA 2OY0A 2PUGA 3GAFA 1AKUA 4KODA 1RBZA 4CKEB 2IY9A 4AI6A 1RI4A 1Z47A 5CT6A 5ALVA 1AS3A 2JJYA 2J5BA 2Q9AA 2W2XA 3RYFA 1P3Y1 2H7XA 1W0JA 5LN1A 3NHWA 1XK6A 2ZTSA 3GD5A 4KUMA 3H2BA 1PEKE 1PSZA 4DR5O 1CR1A 5JJNB 3FX7A 5AM4A 4NYJQ 1YJXA 3K1ZA 3NXKA 1VGRA 3C6ZA 3PSHA 4I3GA 3WK4A 5CYPA 3M33A 4D97A 4AILC 3DKRA 1HYBA 3UB3A 3SDBA 3UW1A 5I8WA 2XKAA 3BABA 3D9QX 4JX8A 4RC9A 3I1JA 2YS6A 4RESA 5EP1A 3SKYA 3V1LA 4Q16A 1V1MB 2J0QA 4P0PB 3CY6A 4L02A 4E14A 5HM8A 3AC0A 1WZ2A 1IL0A 1ZMTA 3NC0C 2BI7A 4OO3A 2HJHA 1QQBA 3EQ9A 5JBQA 1A9XB 2PH3A 4U7GA 4Z49A 1XXHE 1P91A 2GCNA 4FFSA 1CUAA 1X7XA 4KIJA 5ILGA 4BXOA 4HLUA 3QVWA 2EZOA 4KMRA 1JSLA 1CERA 2HF9A 2FZCA 3ZWCA 1ZM9A 2BSQA 1DADA 1C3XA 1QYRA 2HTEA 1TTQB 5JBIA 2Z1MA 1OWOA 3H5OA 4PAOA 5LZ9A 1WCYA 4V2IA 1ORTA 3ZQ4A 1NH2B 3IP9A 3Q8XB 4JLAA 1GAEO 2PKWA 3L43A 2FMIA 3VZPA 2OQIA 3HY6A 5I8PA 1A77A 1NOJA 4PG8A 5F1KA 5C35A 3A6DA 1CUDA 5HK9A 3LCVB 1DJNA 2AL7A 4PVDA 3ZEAA 3N2ZB 2ZDIC 2VKTA 1XTZA 1LDNA 1SC9A 1EQAA 1WM1A 4ZOLF 3TFOA 1JE1A 1SU6A 2UDPA 4AP5A 3ILYA 2MT9A 4DN6A 4EP1A 2HSWA 3TJTA 3AEQB 5E1BA 4ZGGA 1D3AA 5ILOA 4R2HA 1P7YA 1XZFA 4B9AA 4Q18A 1JIXA 3UANA 4BMZA 2ZNIA 1ESCA 4D92A 1Y98A 3EPLA 2AR0A 3C3JA 2XYGA 4JA2A 1JIVA 4A0HA 5AXDA 4DEVA 1AUOA 4GQIA 1FMLA 1SQBH 3RBZA 1ZY2A 2RSLA 2XECA 1P4SA 1YH3A 3H9QA 3P2JA 4D5EA 1AB6A 4URVR 3UMCA 2VDLB 4FBGA 1G98A 1QX4A 3LLSA 1PV1A 5EGSA 3WYBA 6YASA 2VNJA 4S04A 3MFQA 4IOLA 5CURA 5G0WA 3TQRA 1IY0A 3BVPA 1XHXA 3GP5A 1G8YA 5LM3A 1VGQA 3EIFA 1KU6A 4N01A 4F2PA 1SQGA 3I6MA 5DP1A 4IW3B 1W4ZA 4ZCRA 2PVPA 1HDJA 3WLQA 1P49A 2ZRCA 2M1XA 3OM1A 5CW2A 1QSGA 4MLPA 3LT5A 4ZQIA 1M8JA 2MR6A 3PQ3A 1FRFS 2QMZA 5J2TF 4C0SA 2HRBA 3C1UA 3L7NA 1QCDA 1C4WA 3PEUA 4KDRA 4QYSA 4MYTA 1P0MA 2ZE7A 5L9AA 3SM3A 1IVYA 1OFUX 4B7KA 2WD9A 4KLZA 4QL3A 2IYXA 4I55A 4ZDWA 1ZK2A 4BX8A 2BZ0A 3FYEB 2CVQA 5BN5A 4MSWC 2JIDA 4JAUA 5EQTA 3BMNA 3F8TA 3H5AA 1E2PA 3IQFA 4PLPA 4E4TA 2DCMA 3WNCA 4BO4A 1XVLA 3V4ZA 1E0AA 1CRWG 3NQ41 5CDSA 4EHBA 3RC3A 5AW5A 5BR4A 5C8DA 1Q95A 4TKUA 3SVLA 3AU8A 1EG2A 2C96A 3JVDA 1Y3IA 2WMNB 2C8JA 1MJGM 3JQQA 1EI9A 4KQEA 5KSPA 1JG3A 1QKKA 1W5SA 1IHDA 1O9GA 2BEWA 2B82A 2P75A 5TARA 4A8JB 4ZU1X 3EJ6A 4A8JC 4DUGA 4QM6A 1SOWA 1V1RB 1T3TA 3X2EA 4WKBA 3PDWA 2GKSA 1XTJA 3L1KA 5FUXA 5SYAA 3FLBA 3JPWA 4E88A 3CMEV 4V3BA 3ZE6A 3H8SA 4H7KA 1RW4A 3EQ2A 3ODPA 1N9KA 4JP3A 5H8WA 5I7UA 5BQOA 3VNUA 4TT3G 5EKXA 1AKYA 1WBDA 4V2UA 2UZ3A 1IIBA 4CGYA 1E9SA 4U9UA 4N6OA 2NTNA 3UJDA 2Z1DA 4MWSA 4IIJF 3VVCA 1Q50A 5LKRA 2A9FA 2CWDA 3IUQA 2UYQA 5DWVA 2ECOA 2VQ6A 2W37A 1X94A 2FQQA 3RIHA 2I62A 5JD6A 1TAEA 2RKWA 5FPSA 4DJTA 3K8OE 2H16A 3TI7A 2O8FA 1DL5A 3R5HA 3S1LA 4AULA 4KBYA 2HYIC 3ZJUA 1C2YA 2C4WA 4CFZA 3OQOA 3W4KA 2JEXA 5GV8A 4F5ZA 1Z8HA 1MJHA 1LK7A 2XMPA 4MUEA 3TQFA 5K4HA 1AKQA 2GD2A 2QMYA 2OXTA 5AUOB 2JEOA 1MG5A 2RHGB 1OFIA 5IWAO 2R68A 3FZNA 1JQDA 2ZB8A 1YL5A 3PFBA 3DMDA 4MI3A 2QPAA 3QPWA 1CS0B 2H1IA 5C8XA 4FFLA 3UQZA 4RS4A 4EJ0A 4ETMA 2AOXA 3OOHA 4KW7A 3VR4D 5BVGB 5A0VA 3CW9A 4MW5A 5EBLC 4PSKA 2HF8A 1XDSA 4CQMA 1Z8NA 2DETA 3ZE8A 1JEJA 3VKWA 3BXZA 4D7AA 5FEUA 2XQKA 2BOCC 2ZIZA 4Q12A 3C3WA 3GEGA 3HYTA 1RLUA 2UVPB 4GU5A 5DULA 1WNFA 4YDSA 4KE6A 5H83A 3U3OA 4QYWA 3ZU5A 1KAQA 4REQA 1GNRA 3NBAA 4EPVA 1YI1A 2QWNB 3ANLA 2AQKA 5GPBA 4F84A 4QATA 3EK2A 1EVEA 4K9DA 5C8ZA 3PE3A 1OCEA 1BN7A 2GESA 4TVSA 1QLEC 4QIWF 1QKIA 2IFTA 2P6NA 3G2JA 4TXLA 4E4YA 3OEYA 3T54A 4BN4A 5BV0A 1TPYA 3FNIA 2EJUA 2GK6A 3HA2A 4L72A 2QRLA 1ZMXA 3LUGA 4TVBA 4H3VA 4BJHB 1H3FA 3MHHC 1JF8A 1QCYA 3W6ZA 3IAUA 5LQSA 2DGDA 2QTZA 2OCCB 3TEJA 1K1EA 4IXWA 2J5QA 4A10A 5JEEA 1A4XA 4I5EA 1SBZA 1MN6A 2DRIA 2YNMD 3H6HA 2PTMA 3KKNA 3UJAA 5KTKA 1KBQA 2VO1A 1N5JA 2CJFA 2NNUA 5IJ0B 1H94A 2I71A 1N1EA 1KP2A 3ABKC 1HDRA 3GN1A 4BU1A 1XCJA 2O3UA 2YN2A 4K6KA 4J11A 2FXIA 5I9NA 5LA6A 1EX9A 3NDPA 3UMMA 2HG5C 4WECA 4KACA 1I5EA 3JW8A 3S2FA 3KSBC 4C7KA 3DWIA 3DDOA 4AS2A 2V0NA 1YR7A 3EDYA 4IZIA 1X92A 2OIEA 2GPAA 4CM9A 4IF4A 1UC4B 1UT6A 3BXPA 4EL0A 3U1BA 2V5UA 2X4DA 3CNOA 4B79A 1LNSA 1J9GA 3I6BA 4LSZA 4QBGB 5LOVB 4L8VA 2PXAA 1VRCA 4TXMA 3ZTYA 2IRWA 2PZLA 2BAGA 2PJDA 4PEVA 5E7MA 5C32A 2P2NA 3AG1B 4EAQA 2P62A 1LWNA 4O0MA 3Q3GE 5F73A 3T4UA 2O5VA 2JLBA 3ASVA 1MVLA 1Z29A 2J5RA 5JBNA 1JMKC 3ZDAA 1ZDMA 4A1OA 1UL1X 3B8HA 2GBGA 5EMNA 1B14A 2Q45A 4CIAA 2ZATA 3F46A 5KC9A 2FG6C 1RWXA 4PELA 3BB3A 1VSBA 1NS1A 1T15A 1XDUA 1ZNYA 1IHPA 3OQIA 3CCRV 3VDMA 2Q7EA 4C2UA 2DVMA 2QRVB 1XEWY 2FSFA 1N9ZA 2CT8A 5TISZ 1C1DA 4RK4A 4YH1A 1XQ9A 1O0SA 2IZZA 3FHOA 5F1YA 3IB6A 2J7PD 2R7AA 1TI7A 3DKKA 4CC6A 2DWPA 4BV3A 1CHNA 3NPAA 4XWKA 1YR8A 2IS6A 4EO7A 4ARCA 5PNTA 3BB4A 3INNA 1WPRA 5C53B 2RBKA 4YUYA 3V9PA 1CSEE 3UJ3X 4F4JA 4P3YA 1UJ6A 4Q6BA 3TIXB 3N27A 1IRXA 4JTCB 2FTKE 2ZS8A 4DQDA 2ZIUB 2CDAA 1ZUNA 2AMJA 4TWZA 1HYGA 2C2OA 2IVFA 4K8OA 5FWXA 2R9VA 4B6PA 3QOFA 1ZD5A 4YAUA 2FMKA 4LHVA 1UJ4A 2J41A 4JI1B 4X62B 3A4YA 5AHXA 2QHXA 4J1TA 1PDOA 4LWPA 3ZV6A 3TGPA 1E3TA 4X84A 3WYCA 5D51S 3LY5A 1Q3TA 3HVJA 3O65A 2Y99A 2IOFA 1LJ8A 1LU9A 5JSZB 5FWNA 5F9FA 3ZXSA 1FDUA 4NZYA 1M8FA 3RVRA 3TIFA 2WFLA 3STXA 2PLWA 4RWZA 3G6KA 4LGVA 2A5FA 4FDVA 3ZY6A 4KAXA 2PS1A 2H4WA 5WRFA 3JQAD 2UXCO 4DSZA 4MYCA 2HHHO 2W5UA 2CK3G 4JOCA 2HK8A 1EIZA 2WQ7A 2BEJA 1JHOA 2M2IA 2B1GA 1G6HA 3EISA 4L7VA 1FNNA 3VR6D 3A6FA 3VMFA 4JB0A 1Z2NX 3M1IA 2Y93A 1H5QA 4JLMA 4C08A 4HGYA 4LK3A 4LP8A 1EBFA 5DN6D 2C0PA 3CH5A 3LX8A 4IQGA 1R3LC 1UBEA 1TD9A 2IU3A 2UXBB 1SHKA 5AVRA 4NJMA 1O94C 3VR2A 3GT4A 2MWMA 5AK4A 4NCJA 3E1SA 2CLSA 2DX7A 3T1CA 4GUNA 1BSVA 1FFGA 2BJHA 2H4FA 3FR8A 3I2IA 1V3TA 4BYMA 4PBRA 4X7RA 1BHO1 1H2BA 1MOQA 3GJRA 4TRJA 1TAGA 1T0BA 4Q3AA 5DI3A 3OE7A 4MV7A 3SBDA 4X91A 2Q0HA 4DSTA 1N1DA 1P7PA 4CMJA 4OUDA 4YAEA 1X2EA 3GDGA 4B34A 1TJ5A 1P4AA 1QYXA 1KAEA 4YJ2A 3OT4A 4CIBA 2Q3MA 1XAJA 1VQ9V 1E99A 2R1ZA 4DM7A 2JS3A 4YJ3A 1XZAA 1NJ6A 3LL4A 3PF9A 1TFUA 1Z16A 4UEWA 3MYRA 1EBUA 4ME6A 1K6EA 3QLEA 4XD7D 3F6CA 2PMFA 4F11A 2ODQA 3IVMA 4A0FA 4X1YA 3T3NA 1IBKO 3EARA 4F0JA 4L28A 1WKVA 4ZK2A 4EF4A 2PUWA 3KZ1E 1AF7A 1PDWA 3CNHA 5A4KA 1AIPA 3CJHB 3CJTA 3QXGA 4XVCA 3G0HA 2BR4A 1V11A 3ZH9B 3VHRA 3G68A 1JTFA 4MT8A 4UNSA 2X9LA 2OEPA 2GR9A 3U7QA 3RIMA 3DOCA 2JLZA 5AI8A 4KKXB 1UZLA 5IYZF 3RS4A 3SIPA 1JU9A 1R0LA 2UVPA 4F6LA 3GVCA 3WGYA 2JEYA 5CM2Z 2P6PA 3WLLA 4PSAA 2QD2A 4MW6A 1COWG 2XASA 3UK1A 3B5JA 1R3IC 3NASA 4CQMB 2AYZA 1PK8A 2ZANA 3LJKA 1GVHA 4EHJA 2EKDA 2D7DA 5KMGB 1VQKV 3N0TA 1E6EA 3HYLA 4HKTA 2KKWA 2AKEA 2HJGA 3MTJA 2K2WA 2D1RA 2ZOSA 2Q3LA 1T3HA 2PZEA 2EZ4A 2W2KB 1P0QA 2HJ9A 3B6JA 3OZCA 4RZHA 1O97D 2J0EA 2VYVD 2Z30A 3LT2A 4RJIA 5ECWA 4EUSA 2OKGA 4DLXA 3ISTA 5LMZA 1OFTA 2ZJ6A 3AG7A 3H7AA 4OMDA 4U7HA 3MHSC 1SU7A 2ZIGA 4HDAA 2X4LA 2YZMA 1M34B 3FTDA 1FXHA 4UBKA 5PGMA 4GM0A 4HLUC 1OXBB 3DXZA 5BNWA 3HEMA 1R5JA 3H4MA 4X64O 3ZWBA 4BZWA 1PJBA 3K0BA 3VDQA 4Y67A 2LPMA 3HA3A 5EC8A 3L7YA 5JNTA 3UY4A 3CRMA 1RAHA 1EUDB 2XMSA 1TT7A 1IQ0A 4K9QA 1CLEA 3DMNA 3BBPA 4LF9O 1O6BA 1TADA 2ZI6A 2CXNA 4BO1A 4B3JA 4D6XA 3G1UA 2R6ZA 2OHVA 5DO9A 2Z1NA 1V26A 1W4RA 3L8DA 3NT2A 4NTYA 1NU8A 1YRBA 2WQZA 3G5MA 1EGAA 1X1BA 2PS3A 1NV9A 3EXHB 1GLVA 3BRQA 1OCZC 4NC9A 4MOWA 4ZEWA 1Z0SA 1CQWA 3HJRA 3E48A 2D62A 3T15A 1PG0A 1NGSA 1NFQA 5K3EA 3DL2A 1IB0A 1T26A 3A1NA 1DU4A 3SDZA 4BRZA 3ZY4A 4DNQA 3CX3A 3U60B 4BO0A 2IZ7A 1VLHA 1PYOA 2GUZA 1KI4A 3JRXA 5B3JC 3LIIA 3W5VA 2VSYA 3F74A 4H1HA 3RFXA 5FAKA 1QRSA 4EF5A 2PGGA 4GEGA 5LYJA 2QJ1A 2GJ9A 2NW6A 1P2VA 3ZVMA 1OJLA 3LP6A 4AMVA 1T6YA 3L8CA 3D59A 1ILWA 4P08A 1B3QA 1CZRA 3NJRA 3NW9A 3TNYA 2GSMB 3UF0A 3DDHA 1WOYA 4Q1BA 3LL7A 4K6OA 4YAKA 3EWNA 3V3TA 2GK4A 2Y2VA 1I2DA 4RHYA 1XNRO 2C94A 3QO5A 1OT3A 5KVQA 2UYGA 3PEEA 3PYLA 2O3RA 4OUKX 2IF2A 4R1SA 4ZAGA 4K0KO 4HC4A 4B6EA 2NVOA 1GRRA 1O89A 2A5GA 4PR3A 1HDOA 4UHJA 1QAOA 3L7IA 4NPHA 4RMHA 4LJ5A 1FQWA 1G2OA 2QRHA 5LHHA 1EFUA 2GPNA 2Y9PB 3L9WA 4FJ0A 4OU5A 4C21A 4ZCTA 3CXRA 3HWWA 2CL6X 4HNVA 1Q7BA 3RARA 1MNGA 4CIWA 4P3KA 2H1OA 4FYXA 4L4YA 3NHJA 3A2MA 1U3VA 1ATZA 1BNCA 3QKTA 3O7MA 1VTKA 2CLOB 3MCWA 2C29D 3VZQA 1QVGU 1F2UA 4QWWA 1RHUA 2SKDA 2Z5UA 2ZBUA 3EIWA 4H08A 5EHQA 3F9IA 3SNHA 3QWBA 1XRMA 3PFIA 3PRKE 1EZJA 4DS3A 2CXPA 1SXHA 1AZWA 3M9WA 3MZ0A 1VECA 2WLTA 1JJ7A 4R1NA 5D3ZA 4MIYA 2E74B 1YACA 1C0IA 4BN0A 1XRSB 3AB7A 2VBCA 4I4TB 1CIJA 3DPSA 4BWYA 4LRUA 1YCHA 5G1NA 1L4YA 4LVOA 5ICSA 1Y7TA 3I9JA 4FW9A 1QJ4A 4JR1A 5ALLA 1PW5A 4LZAA 4RJTA 2IHNA 5LQRA 1KU9A 1DP4A 1ECBA 4TSFA 5GIOE 1N5KA 1Y8CA 4B9EA 3EWIA 1GYPA 4DW0A 3VFDA 3QUAA 2HA6A 1QYCA 1E1QD 1PL7A 1UOQA 1YQXA 2P40A 3FZYA 5I5EA 4KRFA 4AYXA 5K99A 4ALKA 5TJ9A 4IG4A 1V0JA 1AB3A 4C20A 4M38A 3QEBZ 5CN0A 3FAVA 1CB0A 1QM5A 5MGNA 4AD8A 1N36B 1MUUA 2BEKA 1AUPA 1ZN2A 3UBMA 1AQJA 3HDJA 4P86A 3OWOA 5D86A 3HDHA 1LRLA 3RHSA 1CY2A 1RMYA 4QPNA 3S2YA 3APOA 2FZVA 2Q6LA 2JD2A 1RI1A 2VN8A 2VSQA 4LXHA 1MC5A 3TRHA 2NSLA 3COZA 5JALA 3U1TA 1XNQB 3L2OB 1XD9A 4MAFA 4KXFB 4ITRC 1LPPA 1XVIA 4F4FA 2EIMB 1T9GS 5J3JA 2JKVA 4EG4A 2JARA 1JDTA 3PUXA 2W58A 4TKLA 2BKVA 4KHPO 2C83A 2W2TA 3B9RA 5AH0A 5EE5B 3WGOA 5KIAA 4OQEA 3TM4A 2BGUA 5BY2A 1MDFA 3JD4A 4OSOA 3B1JA 1U8CB 3Q7QA 3RVSA 1THTA 3A9RA 1E1CB 2HNKA 1P45A 1CQIB 2VWKA 2N42A 4DCUA 3EMVA 4MVZA 4RPIA 5CB8A 1UQUA 1CS0A 2PYIA 3OFND 1GEEA 3GAAA 4YRPA 1R3UA 3A2LA 2P3OA 1MW9X 2XLBA 5DEOA 1CJUC 1R37A 3A28A 4QDUA 1Z7EA 2CC2A 2ET6A 4NMLA 4LSMA 5HS4A 4J0DA 2QTNA 1Z33A 4Q1AA 5BQ5A 3PQ6A 3R20A 1PVVA 1IVNA 4LFBB 1F17A 5LOVF 1NQVA 1XKQA 1YDGA 4CM8B 3WTBA 3THWA 1BXKA 3EEBA 2DULA 3AFGA 2VCYA 4KMSA 2ZSKA 3GUZA 3IIMA 3K30A 3GFTA 4WZAB 4Z2YA 2YJTD 3IEKA 3VOTA 4DIUA 4QTTB 2D00A 2HIMA 1P61B 1N2GA 3VDXA 3V80A 2CHFA 3LFUA 4FX2A 4X1OA 4Z8XA 4D6YA 1FFHA 1MBZA 4JQYA 5FNZA 3AVUA 4K1LA 1V7ZA 4P9PA 2QTGA 2F1MA 4HEQA 3HBMA 5DCWA 5ES3A 2BFDB 2FFHA 1AP6A 1ZXBA 3FYDA 4QOEA 2EJRA 3BKXA 3K0HA 1H23A 2XAFA 1I10A 2FWIA 4K3VA 2AN9A 1IG3A 2XUKA 4C3VA 1IPFA 4D79A 2KLHA 4PGMA 3LUTB 2Y66A 4MUFA 4G1UC 3GDWA 1K27A 3ORQA 3X3HA 1SQ0A 1S2LA 1DFGA 2KB0A 3OZTA 4DV1O 3ILSA 2Z5VA 3R5KA 2RHBA 4CHGA 3ZWAA 2X86A 4HNGA 2LDBA 3DLIA 5HJ5A 1II0A 2GK3A 3IE0A 4KQMA 1IM8A 5KI6A 1EFDN 1JAIA 2B1IA 3D3JA 4KNWA 4H2DA 4EI9A 2MIIA 4ESVA 1NKTA 4RQTA 3CIFA 3KZVA 4QOJA 2GZAA 2QTAA 3H0CA 3TLGB 3PUYA 4BNYA 2C42A 1RLTA 1P5JA 5F4BA 5JMPA 2JAQA 3BE6A 2PWZA 5FBQB 4F8EA 1QP0A 1NPTO 2IYVA 3AX6A 8ABPA 4R68A 1E2GA 1JYEA 2FWNA 4XCXA 5ELLA 3RYTC 1DNPA 2RAFA 3F2VA 3NWEA 4CMEC 4D4LA 3K32A 2ZJ8A 4LDRA 2JZOA 4RTPA 3GLIE 1YD7A 4XLLA 5NULA 3A2FA 2QKYA 5A6SA 3EQ7A 1W94A 3MYYA 2H51A 4IV0A 3TBHA 3IHLA 4K5QA 3NV7A 2Q07A 1N3LA 1RXIA 2C3PA 4IQ0A 2DWEC 4PQFA 4DXHA 4RENA 1TLTA 2ZSFA 5EZYB 1DINA 1W30A 2F3PA 1VP9A 3HRKA 1E9EA 3PFKA 1MQAA 3UCSC 1NBOA 1X1EA 3EZGA 1H0SA 4NAVA 2ZT7A 4UREA 4DPKA 3SC2A 4BPBA 1V1MA 1R6NA 2O20A 3VR6H 1R6DA 4BBAA 2IUUA 5B4UA 1FZTA 1WLYA 4N82A 1O6CA 1JTEA 1Y1LA 2XDQA 3FCAA 4BFTA 1C7ZA 3AHFA 5P8WA 3AKEA 1WDLA 3C15C 4N3BA 3V2UA 2Q73A 3VTAA 1KJ8A 3KHKA 2PZSA 3OHPA 1ITZA 1M7BA 1SCIA 4DR5B 5DIFA 2VDPB 1RPNA 1XK7A 1CEZA 2X7RB 1RYFA 4GKBA 1GPNA 1AROP 4G5FA 3G2NA 5KVSA 1UPXA 3ZCXA 1XB2A 1A27A 1KTVA 3I2HA 4E2ZA 1NSTA 3DE0X 1TF2A 2OBLA 1U0JA 2XVAA 4ZCSA 4CZZA 2QM0A 4IFIA 3ZHOA 1U6JA 1FVOA 1SKAA 5DVZA 3ZGNA 2R66A 2QX6A 2Q0SA 1D5WA 5ABPA 1TQHA 2FWPA 2A0UA 3KPYA 1EZZA 2X0NA 2WT9A 3VKVA 3R0QA 3U5ZB 5COBA 4QHSA 1DGSA 1THZA 3SJAA 4G5YA 5KHKA 4EMUA 4BGVA 2JIZG 2ZTHA 2RJNA 4GKAA 5JFGA 1GH6A 2DP4E 5BSVA 3HA5A 4M9SA 2OTJV 1JYSA 2FPPA 4TTSA 3UW3A 1F8YA 1DAMA 1QRDA 5DECA 2TMKA 1I4OA 1W35A 4GXNA 1N7IA 4M87A 2AHZA 5A3SA 4AJ9A 5CIYA 2QDOA 4RULA 1EUCA 4JAVA 2HN9A 3TNFA 2AMYA 2CUGA 5DT9A 3KPWA 1ABFA 1S89A 5J1TB 1LUWA 5ARDA 1XMOB 1QV6A 4MV3A 1IDSA 5F2KA 3DEKA 4QYIB 1SZPA 5E2BA 4YIKA 2H06A 3D6HA 2ACVA 3JWGA 3O83A 4NARA 1YZTA 2CGEA 3KQTA 1BWRA 3LDGA 3L79A 2WFZA 3U39A 4DRXA 2IUEA 2YC2C 5CDFA 1XVUA 2X22A 4B6FA 4M7WA 1BW9A 1KI9A 3H4TA 3MB8A 3NOVA 2D5BA 3RRFA 3MT8A 4QHTA 3G4SV 1KVTA 3LGSA 4MWCA 4MDFA 1EZVH 1NMZA 2P30A 2WTEA 2W71A 2WLHA 4GT1A 3E1KA 3MCUA 2RGDA 4CCYB 1J33A 3I92A 2W6ID 5LD2C 4JPRA 2QU7A 3AJDA 1P80A 2I2FA 1LK0A 1J9EA 4KO4S 1W6RA 2OYQA 3B12A 3DC2A 5EWLA 5LR6A 2IXGA 1JSRA 2NNWB 3OQVA 4D8YA 3IUMA 3D36C 4E5PA 4FYKA 2CVZA 1JQKA 1XWWA 2IIVA 2QSYA 3LUBA 5IYBO 3RVNA 4EX6A 5ADUS 3PU6A 4KN8A 1P1RA 4RSHA 1KOGA 5KJ6A 4N8DA 3ICCA 4D4JA 3RVYA 4RVCA 1GGHA 3OLQA 4TLMB 1IVSA 4QEZA 3TZCA 1WVMA 2Q50A 2G0AA 1F20A 1I6KA 5EIBC 1M7GA 3O2QB 4DARA 1KKUA 4XCQA 2XRFA 2VDNB 5K3AA 2J33A 3TLYA 2AB0A 2UZAA 3CVXA 5LBQA 2C5SA 1YRQA 3WOVA 5F23A 5J5CA 2P7IA 1KWGA 4ALJA 4EGJA 4LF8O 1VCHA 1JTVA 2GVZC 4QNMA 4YO7A 4BZZA 1RWOA 4LJ6A 3M7MX 2XVZA 5KHAA 1NNLA 3K1AA 4D26A 3QSGA 2BMFA 3RAFC 1WDWB 1P19A 1RRCA 5K0NA 3EEQA 1JT2A 3DQZA 4XVHA 1CUWA 1NT4A 3AILA 3FPHA 2CVOA 2E9SA 3IUNA 5T6MA 1LRKA 3SQLA 3V7WA 3RC1A 3U7RA 5CITA 4Q00A 2HEPA 2TYSB 3K09C 2BFEB 4R1PA 4X8OA 1KMHA 4W5JA 2ZBVA 3HFGA 4B71A 4CDNA 4Q93A 3CPWU 1P5FA 2QAIA 4XAQA 4DIKA 4YR9A 5C80A 1TU3A 1VFNA 2QTFA 3AR8A 1RFYA 3AYXB 5J2TB 1J23A 1N5OX 2XJ4A 1BS9A 2X8JB 1N0JA 1LA2A 1ZWKA 3OCCA 1EP3B 3PR3A 4Q0MA 2ZYHA 3N2KA 4PZAA 2JL1A 4GLJA 1N77A 1UBMS 4TV8B 1IUOA 2BFFB 4E08A 2BPOA 2WA3A 4NIMA 2OZLA 5FOSA 4ZI7B 1AQNA 5JSKA 4POOA 2HUNA 4TT8A 1VE9A 2C3MA 3SSNA 5CD1A 1D09A 4R0MA 4ZYUA 3H1LH 2N3ZA 4LYFA 4WZBE 3RUHA 5L3EA 3ZZ0A 2ZAOA 3ZNPA 5J2UB 5KHJA 4UU1A 3TMAA 4CLOA 1GO3F 4N0MA 2X6RA 4AB1A 2I2DA 4RV5A 1LD3A 2CK3A 3LHIA 4OSEA 2P2LA 3OCWA 2UYOA 3DE2X 4RK5A 5FOXA 3S55A 4FHEA 1U2TA 3WTCA 2C7BA 3ZIUA 5EQJB 4LZLA 1P2BA 1XYVA 3CC8A 4B6QA 2WSSD 3ZLBA 4DIDA 2WF7A 3IFXA 1PTKA 4GXTA 5SZKB 2A9KA 4MK4A 4E46A 4F38A 2CLHB 2PTGA 4G5HA 3IESA 1FXUA 1JSZA 1EP2B 721PA 4AXXA 4KRYA 4LQLA 4HL6A 5EKSA 3KYDA 3R3HA 1F12A 1CUXA 4J6FA 1GILA 1VLLA 1BXRB 2C7VA 4DA7A 4HQ0A 3IR7A 4JENA 1BDBA 1TO1E 2RH8A 1QPZA 2WLLA 3FFAA 4II2A 5F64A 3A4NA 4DR3B 4IFEA 2L2QA 4ZVRA 2OA0A 3ZD6A 1K2WA 5KTMA 1UOPA 5ADVA 2I6FA 4PO9A 2WPDD 1EUZA 1XJWA 1J0XO 1GT6A 3NDIA 3BMXA 1RHKA 3JTEA 3VJKA 2G5GX 4WVLA 1RZRA 2J67A 1RE0A 4X66O 4NENA 3SOZA 4C0KA 2W0XA 2AQHA 2WOJA 3EIQA 3EH1A 4IZHA 4UNQA 4Y0AA 3SJ7A 1L1EA 3K5NA 1RI5A 1DZ3A 3H1PA 4O4HF 3H2ZA 5L3SB 3DBRB 3HP1A 2DT5A 4YPFA 4C06A 4DDWA 1OFVA 4ZU3A 3AVYA 1RCUA 1ADGA 1JQLB 1OXXK 5IM5A 1UDAA 3IIJA 3R3XA 4PANA 2X0JA 4GX1A 1DCKA 2JI7A 2QL6A 1I4TD 4I8DA 2QRNA 1DQRA 3ECAA 3B78A 3QF4B 5SICE 3FYHA 3WLMA 3WFVA 3N2EA 3FUCA 1O96B 5JJEB 4U9HS 3VPFA 3N86A 5C5IA 2UXNA 1LTQA 1Q15A 2A1UB 4JODA 4OYRA 3RRJA 5JZVA 1EK0A 2AOUA 2WZBA 4NXMO 3MGCA 4N3CA 4MTXA 3H0EA 3I9OA 4PI0A 4IIFA 3F3YA 4OHKA 1T2FA 4TZTA 2YYSA 4WD3A 5D3MA 3TXYA 1I2AA 4UOEA 4YI5A 5JQGF 4UEQA 3AH8A 1WAMA 2MK3A 4PC2A 1Z13A 4K88A 1F23A 5ICMA 4PX3A 1BE8A 2H1HA 3H1AA 3ZE0B 1QWOA 1TPZA 3CZRA 3L6BA 1TW2A 1KB9F 3FWHA 4B3MO 4HX9A 2Z4SA 1SPXA 4YMUA 3MD9A 2PUSA 3NLLA 2PZAA 3HR4A 2I7TA 3EG9B 5KNBH 2YHBA 2SICE 1U6KA 1JXOA 2P5OA 3H13A 4HAIA 3TNJA 3DDWA 2DXIA 3MEQA 2F00A 1XCOA 2NXJA 3JYQA 1YFKA 3DEZA 3MWDA 4HDRA 4YMIA 4IIEA 2XQVA 3WL5A 1EK6A 2OVFA 1NR7A 1MX3A 4CV0A 2EWMA 3RS7A 3E9QA 3E3OA 2FW6A 4HDMB 1KZHA 1ZWLA 3EE6A 4CMIB 2HRQA 1M1YE 3ZLJA 1CUSA 2W83A 2HKIA 1UMBA 4CMBA 1C9DB 1GQQA 1X8JA 3GCGA 4I5IA 4L6AA 1JILA 2G1UA 4MQMA 4OY3A 2F4NA 3HJUA 4D8TA 4FD3A 4XQGA 2UUCO 4LJ7A 3EZYA 4DV5O 1KZGB 4ISBA 5T41A 4D4KA 4V0RA 2NO9A 4BATA 1E1RA 1NY6A 3BWCA 3C3BA 4TLCA 4KR7A 2BGNA 1IMOA 5K2MA 4HH3C 3HLKA 3IJEB 3WC4A 3W2EA 5EWJA 5LDHA 2ZT9B 2W6JD 1K3UB 3QNUA 1GKYA 2ZAIA 2XUJA 2GRJA 3DM9B 5JQWA 2LJ2A 4F6EA 5FYQA 1K75A 3O90A 4Z6KA 1BVYF 3Q2IA 4XVRA 4MB2A 2YZGA 3BC1A 5COAA 4V0KA 3DWGA 4QU9A 5FO0A 4Z2AA 4HBGA 1XLTA 5ADWA 4X94A 1SC3A 2B30A 1FEZA 2VS0A 1PGJA 1ZQ9A 2IOQA 3P2YA 1FQJA 4WI1A 5HUJA 3V4RA 1H2GA 1YJBA 4OX9B 3B3QA 4O2BF 4C4RA 5K8UA 3SJBC 3RK4A 2HD4A 3BVOA 1DWOA 4MO2A 5A62A 1HDEA 2YMLA 3EIXA 2XUQA 4BLTA 2V6FA 5IN4A 2F55A 5IASA 1DLIA 4ALMA 3CGGA 1R27A 3QFCA 4ZTBA 3CCVV 2EKLA 4Y2RA 2ZB3A 1FFYA 2QVBA 4QPKA 2IY7A 5B3KA 4OHFA 4Q39A 1RQXA 3HKBB 2GCOB 5AI6A 2WTXA 4A5SA 1SXJB 3OU7A 2B69A 3E5MA 1VE3A 3K70B 1WVGA 2IPOA 1MEEA 3EHBB 2A9JA 2HU5A 2WIJA 4OUDB 4U0JA 4W82A 2O8NA 4EJSA 1Z88A 1U80A