2QGNA

Crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
244
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGETPSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 79
structure length 244
sequence length 313
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 2qgnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qgnA01
1CU1A 2H16A 3KQHA 3A4MA 4EQ6B 2FDCA 3P27A 1VYVA 4BFTA 1P62B 4Q9LA 3CPEA 3HPQA 4DHEA 3NTUA 1X6VA 1RVDA 1VMAA 3HPRA 4M1OA 1DTSA 5AR1A 3W90A 1W0JA 4M1TA 4DLUA 3BERA 2WWXA 4B48A 4DIDA 1NF3A 1U8ZA 3HYTA 5JEEA 3QXJA 3WMEA 2MMCA 3TQFA 3W6OA 1T8TA 3CWZA 2B8WA 5JRJA 4TQAA 4EIWA 2XTZA 3SI7A 4PPNA 4ASUA 4UNPA 3ZZ0A 1XJCA 1C1YA 1IY1A 3WBJA 5C18A 2CCJA 3TVTA 2QPAA 5SZIA 3E70C 3H86A 2JJ1D 1W5TA 1DAIA 4GFDA 5KTYA 1QVAA 1FMJA 4URXR 4W5WA 2B6HA 1XXHA 4ZPXA 1VG8A 1Z29A 3NWJA 2GEVA 3QXXA 1CRPA 1ZINA 4JLMA 4DRZA 4MA4A 5KNBA 2QTVB 2GVZC 4JZKA 2A9KA 5EQTA 4DCVA 2ZE5A 2ZITA 1XMJA 4NDZA 4UJ5A 4PHGA 4IXNA 1L4YA 1D5CA 3I4LA 5IK2A 3W9YA 1W5SA 3B1WA 2GKSA 4DDUA 2GCNA 3NBYC 4PFSA 1K5DA 1KHTA 2RGEA 3M1IA 3BBPA 1OFIA 3HP1A 3MCAA 2DFLA 8OHMA 2QP9X 4ZKDA 5E95A 4DVGA 1Z28A 3T1QA 3SN6A 1FP6A 2VPPA 3UKDA 3KKNA 4O2LA 1EFRA 4ZDJA 4B3BA 1T4GA 2CVFA 1CJTC 1W0KA 1VKJA 4JYCA 4JVMA 4MYTA 1EFHA 1AA9A 3FKQA 2IXFA 2IYQA 1MH1A 4R2HA 5CB6A 1GNRA 2GDJA 4PC2A 5IRCD 3LWNA 4GOXA 4S35A 3GLGA 3UWKA 4C7OB 1NL3A 2A2ZA 4JBXA 1E9FA 4XVUA 1IJEA 1II9A 2VHUA 1P2VA 2F43A 3B1YA 3KB2A 3WHLA 4PZZA 1M34E 3AP3A 1YKSA 2FH5B 1SVMA 2WMNB 2X2EA 2XX3A 2JLYA 3W8RA 1CJUC 2Z43A 3QXHA 4NL4H 5KSOA 3MAAC 4YDHB 4DXAA 2XNDA 2OBNA 4KV9A 4ZO4A 2GJ9A 2G9NA 1CRQA 1ZNZA 2W00A 3B13B 4DT1A 4MDEA 3RWMB 4LPKA 3FFBA 1XBTA 5FTLA 1II8B 4FMCF 4W5JA 2CK3A 2C9YA 2J46A 2WJIA 4PQYA 3I5XA 3CUEF 3SYNA 4Y0AA 4KLZA 2XOKD 1HH4A 1AZSC 5BWMA 3QJYA 2IWRA 2ZU0C 4LBZA 4P3YA 4M2LA 4NONA 5HCNA 1E2PA 2XOKA 1UJ2A 1E98A 1ELOA 2W83A 2ORVA 1LTQA 2G83A 1N6NA 4IOKA 4TMXA 4DLXA 2QENA 4P4UA 1XB2A 2XJ4A 4TSFA 1N0VC 5HTKA 4UNSA 5AK0A 3D8BA 5D3MB 2GBLC 3ZQJA 4XOIA 2OLKA 2WKRA 4ZI3A 4LI0A 4XJXA 4O2RA 2V7QA 3QI2A 2QU8A 2IUTA 2XJ9A 1YJ5A 1ZU4A 3CONA 4FMCB 1KO8A 4M9XA 1E96A 5LB4A 1F2TA 4Q5IA 2HLDD 3PR1A 1MO5A 3T34A 1XEWY 1Z07A 4JIMA 4KVGA 1GZSA 4WA7A 2RH5A 1N6PA 2QMHA 3TAHA 2LCFA 2CBZA 2ORIA 3SE0A 3WYGA 5LD2C 1NG1A 4JJZA 5KDDA 2ZRAA 3UXMA 2YWGA 1G8FA 2ZRPA 3EZ7A 4JL5A 1RPZA 4BLPA 4F91B 3KFXA 4FINA 2AD1A 5CYOA 3ZGXA 2ORWA 3ZIAD 2PJRA 2IEZA 4C7OA 1ZP6A 2PEYA 2QMUA 2YINC 3N2IA 1W4AA 1NMXA 2FGKA 1GRNA 3GJ7A 3L0OA 2QM8A 3NDPA 4NCJA 4OJQA 4P32A 5FR1A 3W5JA 4DUGD 2V6JA 2YJTD 1XF9A 2ERXA 2EU8A 3HR7A 1OFTA 3UMRA 1SXJC 3O8CA 4NCIA 1KZ7B 4J0QA 1RC8A 2WOJA 4DZZA 1ZM2A 4OK5A 2OLJA 2GNOA 3GP8A 3CRVA 4BFWA 1G7CA 2ZRCA 1SZPA 2D06A 3IIMA 1ZM7A 3KTAA 3DM5A 2Q9BA 4HI0E 4CDGA 4B73A 2O5VA 3X1DA 4KHZA 3DM9B 3OIWA 2ZE6A 5E4FA 2CL6X 4WZBE 1CR1A 3TR0A 4RZ2A 1XWIA 2WTUA 1OFUX 3AF3A 2J3EA 3WY9A 2CCGA 3LY5A 1GP2A 1MR3F 1IJFA 1XD2A 4DB4A 4Z51A 4I4LA 5HPYB 4RSGA 1QHHA 3Q8XB 1T5IA 4WXPA 4KSBA 4JLPA 2ZVQX 4CEHB 2RGGA 4NCKA 4KSCA 3IQWA 4CRWB 1NI3A 4BRUA 1G3UA 1F2TB 1N0UA 1I2MA 1FFHA 4ARZB 3A4LA 4RD6A 1UKZA 221PA 3SBEA 5EJEA 3KDSE 1NBME 2QI9C 3FDIA 3ONWA 1XEFA 1G6HA 1KK1A 1RE0A 1KGDA 4IFEA 4ILEA 1XD9A 5EE3A 3NEJA 1P4SA 2G1KA 4IEEA 5IF9A 5E7JA 4TT3D 1N5IA 4PR0A 3AQ4A 1G21E 3L2OB 4HDQB 1IN6A 1E4VA 1NN0A 5KOYA 1N6LA 2FSFA 3F3YA 4BLOA 1XCGB 4V02A 2VSFA 2W2TA 4HDCA 5DO9A 4UNRA 1U0JA 1T0HB 5JMTA 4M1SA 5L3QA 1H65A 3QSYA 4BFXA 4MYCA 1JQJC 4B76A 2QTFA 1KK2A 5BYJA 1PVOA 4M22A 4X8OA 1W1WA 3P20A 3VFDA 3GJ0A 621PA 4WOPA 4G3XA 1ZIPA 3K0FB 5CM8B 3IEUA 2Q6TA 4Y0VA 5AWFC 3GLGE 2IX3A 1CXZA 1OW3B 1M74A 3K9LA 4MGIR 2KSQA 4TZ0A 1OHHD 1HA3A 1R10A 1E2FA 1UBCA 2CLSA 2ZRBA 1N0WA 4QXAA 5AJYA 4S2EA 4Q7JB 1TUIA 4FCTA 4LDJA 3RAPR 2GZHA 4DJTA 2ZJAA 3GJ6A 1X1SA 2IW3A 3L0IB 3BWDD 2QY9A 3A8TA 1SKYE 2QNRA 2RMKA 2Z83A 3I3SR 3O8BA 4LBWA 2IS6A 1WP9A 3SFZA 5A0FA 2OXRA 4QNRA 2Q21A 2ZANA 3W6PA 2GCOA 3MRSA 2HYIC 3H84A 3T5GA 3PUZA 2RGNC 3ADBA 3T06B 5FUYA 1NBMA 2ONJA 1WQ1R 4GP7A 2EW1A 2AHOA 1Z6TA 2EFGA 4N0DA 1KI9A 2ZETA 3I5YA 3DEFA 4YMWA 3N70A 4Q19A 2WOOA 1V43A 4OHYA 2VEDA 5M04A 4QKQA 3EIQA 1RKBA 2C99A 5JS8A 1UF9A 3CBQA 4DKXA 4FIDA 2R65A 1E2HA 1TF7A 1A2KC 5KNCA 4PSKA 1I4LD 1CP2A 5K8LA 1OE0A 1FNMA 3CRMA 3K8YA 1I4TD 2GK6A 5HR5A 4HLUA 1XPOA 4D4JA 4LX0A 4QG7A 2Q9CA 1UKVY 2J9RA 4V03A 5KDOA 1H8ED 1ESNA 3BIFA 1LF0A 3FHTA 1FTNA 2ZE7A 3JZAA 5DI3A 5J4LA 1KI7A 1S1CA 2ZSBA 1Q44A 3B7GA 4PO9A 3LFUA 4U02A 2ZM5A 1AIPA 1AKYA 3U3OA 1Z5ZA 3C4JA 4XVQA 1GNQA 4Q4JB 4NHOA 5HZHA 3LW8A 1E94E 2V6IA 4PPGA 1MRSA 2ZUBA 1PUIA 1W48A 1IN7A 4C0SA 2QT0A 1YZUA 2WIBA 2ZS7A 2R8RA 3FMOB 3U6BA 1H8HA 5JJIA 1ZW6A 5BQ5A 1OXSC 4CEJA 2VTKA 1D6JA 4AY2A 2AXNA 2CCKA 3ND9A 4LHWA 3SS8A 5BN3A 1Z0DA 1MO6A 3TAUA 4NMMA 1PUJA 5HZKA 1YZTA 2IYYA 4MGYR 2X77A 3X1WA 4GL2A 1EX6A 1N5JA 2OUKA 3TH5A 4BLRA 1GITA 1J99A 4BUJA 2ZEJA 4O25A 4AI6A 1JJ7A 3GLIE 3BB3A 2JLRA 2BMEA 2GESA 3B9PA 2GJKA 3MJHA 3RANA 1OLOA 1Z3IX 3OAAD 4GDFA 1OKKD 2B7BA 1OYWA 2ZREA 3B60A 1S8FA 5AUPB 2ODWA 2JIZA 4B3FX 1DADA 4NYMR 1HV8A 2ECKA 2X19A 1G8YA 1Z0JA 3CR7A 3EC1A 5JHHB 2VHTA 4TYYA 2CHGA 5L3VA 3X2SA 1N5KA 4GT1A 1XNJA 5ELXA 1NRJB 1NY5A 1YHNA 2V1XA 1U9IC 2H18A 2D2FA 3AP1A 2D7DA 4NCNA 3P1JA 3VTKA 2HF9A 2WJYA 3U2QA 1YQTA 2QAGA 4TSFD 2V4ZA 4BEBA 3KQNA 3A37A 1TQ2A 3A1WA 2JLXA 3RVBA 5H8WA 1XPUA 1R6BX 3LO5A 3MJRA 3NBFA 1OV4A 2FZLA 1N6RA 2GEUA 4DCUA 2QA5A 2HV8A 2VP2A 3MMPA 1UKYA 5EP1A 2FG5A 1WBBA 3NDBB 1P75A 3LNCA 1NVVR 2IS1A 1S0UA 1TUEA 4EUNA 4HLCA 1KSFX 1TL7C 3NBXX 5FTNA 5FTKA 4QFMA 3BFXA 4JKYA 1E1QA 3JZMA 3IKJA 4TYNA 4A8JC 3I92A 3NEYA 1OH6A 3KUCA 4OQLA 5JCZA 1ZCBA 4HB2A 4JMPA 4MKGA 1YVDA 3SHWA 1JR3A 1Q57A 2FF7A 2EQBA 1HEIA 4JBYA 3SJZA 3V00A 4DLSA 3SDZA 1OT3A 4DLRA 1WRBA 2GCPA 4IXMA 2ZR7A 4MUAA 2P2LA 2GJ8A 4DSUA 2C8VA 2AWOA 2FOLA 2BOVA 3FKSD 3BH0A 1GWNA 1P9RA 1RRGA 3EPHA 3W5IA 4FI3C 1JPJA 2GAAA 4P33A 3KTAB 4M9ZA 1W49A 2R9VA 4B6EA 1AJEA 4QJ5A 3NHAA 2HUPA 2NPIA 2KBFA 2IK8A 5C46F 4OHXA 2BMJA 4M8NE 5J5CA 3ZZTA 1UM8A 4JLKA 5CDFE 3K70C 5D3MA 4RKEA 3CX8A 4CYMA 2O8CB 1P72A 1ZD1A 5CM9C 3U3RA 2P6UA 1KIMA 2BVNA 2G0NA 2UVQA 2XAUA 3IHWA 3S1AB 2YWFA 2WSMA 1BMFA 2NZJA 4HLDA 4P4SA 4RVCA 3VU9A 2WAYA 2D62A 3ZDQA 1KI8A 2ZSFA 4C2UA 2B7CA 1VECA 2OHFA 4KBGA 2ODEA 2WJJA 4L15A 4L4UA 3BORA 3U7EB 3BFVA 2ZYTX 1GNPA 4LHXA 4LV6A 5JI3E 3CO5A 1NLFA 1TU4A 2FFBA 1OXTA 3MSXA 4OI1A 1P60A 1R8QA 1CEEA 1F60A 2HDNB 3IIKA 1D9ZA 1FNNA 5BYKA 2WIAA 1XMSA 3TNFA 4URVR 1P9WA 1ZU5A 1P9NA 3B1XA 4Q00A 5KO2A 1RRFA 4QC2A 4U00A 1XRJA 3VNVA 2IYLD 5FOWA 4IKEA 2OFWA 3LBHA 2HCJB 4HB0A 3QKTA 4TMVA 4D0GA 3AP2A 5JSZA 4DDWA 3NC1C 3KFVA 2ZS8A 1L4UA 2MMGA 4GP6A 3VR5A 4A0FA 2IS2A 3KZ1E 5GVSA 2QE7A 4N1AA 1HYQA 3CZPA 2FSGA 4GNKA 4DSTA 1DOAA 3FMIA 4JJKA 1Z0IA 4BFUA 1XEXB 4PPFA 4X8HA 2A5FA 3AF2A 3T61A 2VH5R 4KYUA 4LHZA 5CK4A 1VPLA 2GZDA 1H8HD 3THYB 3K70B 3U4QA 1E2DA 2PT7A 1RJ9B 4LC1A 4I99A 3QF4B 4QBHA 2QBYA 1YRAA 4V0LA 3VHLB 4RD1A 1ZC4A 1SQ5A 3C41J 4OI2A 1S2MA 1DE0A 4Q9HA 4ACBA 3AUYA 1JXOA 1TADA 3N5CA 5G3ZA 5P21A 2AWNA 1AS2A 5FUXA 1XFAA 2UKDA 1EXMA 2VP5A 4LUCA 2D3WA 1NKTA 1GKYA 4JBWA 4TL7A 3U7FB 4JL6A 3AF1A 3PG5A 1A7JA 2RGNA 1PLJA 3QG5A 3R7WB 2NO1A 2W2XA 3KJGA 1Q22A 4V0OA 1GM5A 1NVVQ 4A92A 1MRNA 3IBGA 3KJEA 4TMWA 2O8BB 2CNWA 1HT1E 1P7CA 3K09C 1SVOA 3RS0A 3THXA 3K1JA 3W8NA 2V3CC 1FW6A 1EK0A 2VYFA 1KDPA 2YHSA 1KY2A 5FPHA 4JSTA 2YOFA 1E2KA 4MRSA 1KNXA 3GLHE 5G41A 2WSSA 2DFNA 3CH4B 4XVRA 3GCGA 2VIIA 3SJCA 4HUQA 1TU3A 4A6PA 1Y3AA 2JGNA 2OESA 1XJQA 3BC1A 4GZLA 4A0HA 3R8FA 1M8PA 3GEHA 3QBVA 3GLIA 5E3HA 3RS5A 3W34A 3O47A 1BO6A 4F93B 5DHFA 1UKEA 3DZDA 1X1RA 4C30A 1MKYA 2EYQA 2FFAA 1XMIA 4URZR 1F6BA 1SGWA 3RWOA 2JDID 1KJZA 4G1UC 1G8PA 4PANA 5AUNB 1E0JA 1XZQA 3WNBA 4WAUA 1O3YA 3VAAA 2VP4A 5F2EA 1Q12A 4C4PA 3REGA 3VHXA 1QHYA 3EZ9A 4O3MA 2DB3A 2JLZA 3ZQ6A 4QBFA 3B2EA 4JLDA 5FFMA 4V0NA 4EPXA 2KE5A 4D4KA 2BCGY 4IFBA 2Q3FA 2AFIE 2CK3D 4NE2A 1SXJB 2A5JA 1U98A 1NY6A 2MSDB 3AGQA 4Q7MB 2QE7D 1Z0AA 3PEVA 3EZ6A 2WM9B 2NTYC 1K8RA 3WMFA 1JAHA 1VCIA 2Y8EA 2VP6A 3OEEA 2WZQA 4LBVA 5DYGA 5HE9A 2ZJ5A 2P5SA 521PA 2NQ2C 3K9NA 4QGGA 1HE8B 2GRJA 1LS6A 2ZE8A 3FVQA 4HZUB 4B3GA 2QSYA 2J7PA 2N42A 3FKSA 4LJ4A 2GK7A 2VHJA 2N46A 4Q1BA 5BN5A 3ZS8A 1FOEB 3ZD6A 3AVXA 4Z8XA 4JLJA 3VR3A 1GDDA 3CF2A 4H9GA 4GSYA 4IW3B 2ZRMA 4TTPA 4D0NA 3AKDA 3SBDA 4WVFA 2CE7A 1P5ZB 4TTRA 1CTQA 3PUVA 3B82A 4HDOB 1YZQA 1XCPA 1CR4A 2RGXA 5JFGA 4NU0A 3AKEA 1LS1A 1CJVC 5DSZA 1LY1A 4C0LA 1TQ6A 4TMKA 2G88A 2GXAA 3CZQA 3QG1A 3VX3A 5K8TA 2PH1A 4TWZA 1U0LA 2CNWD 4MRPA 3ADKA 4PAQA 2FX3A 1Z63A 3HU3A 3GLFA 3QBTA 4XWAA 2OSBA 3P4XA 4F4IA 4OK3A 1GKIA 3VR4A 3QEJA 4LRWA 5KPDA 1EGAA 1A4RA 3CPHA 1G3MA 3H2YA 3RS2A 3A6PC 4JLNA 5JWOA 4IVRA 2W58A 1GRRA 2CE2X 3UATA 3QXSA 1JR3E 4G01B 4Q21A 4RD2A 2EYUA 4A4DA 3ZD7A 1M7BA 1VIAA 3CF6R 2R6DA 4RZXA 4TYPA 3H4MA 3LRPA 4QJ3A 2IUUA 1VYUA 5DIFA 1AK2A 1VCOA 1E9BA 2CLCX 4TT3A 3GJ4A 3EA0A 4LPSA 2FEOA 1E2IA 3BAFA 2FJUA 3BE4A 1T3SA 3HYRA 3LV8A 4M1MA 2W6ID 4MDFA 2OCPA 1BH2A 5J4KA 4D82A 1IY2A 1OSNA 3NIBA 5KPJA 2ZJOA 2VF7A 2DCUA 3KB1A 4A8JA 1RRPA 4G5GA 3KKQA 4I1UA 3C14C 3UMSA 2GVDC 1U0HC 3WYAA 3I32A 3ZIAA 4I1OA 3NH6A 4FN5A 1D2MA 1GKUB 2ZSEA 1KO4A 1T91A 2N1BA 3LVRE 1KOFA 4OQMA 1GL9B 4Q4HA 1MV5A 2IT1A 4LWZA 2OILA 2ZI4A 3PENA 2DWOA 1L2TA 4ZIRA 5HKKA 1Y63A 1OF1A 5CK5A 3K0CC 2EFHB 3GFTA 3AM1A 1SVSA 2YWEA 3B85A 3PQCA 2P5TB 2DFTA 1GG2A 5AJZA 3BB4A 5TV2A 1G20E 4L9SA 4RCZA 1CR0A 1EFTA 3UG7A 1GAJA 4IDOA 2Z6VA 1WCV1 1XMVA 2DBYA 2K5UA 4WXRA 1BMFD 2WJHA 2A7QA 3ND8A 4P0TA 2BHRA 1Q1BA 3MWYW 1Z2AA 1QF9A 1C4OA 3OAAA 1G7TA 5JWHA 2JLWA 4ZCLA 1UPTA 1E4YA 1E1RA 1F48A 3QUSA 5LDDC 2YC2C 2BBSA 2AL7A 1AS3A 1ZNXA 3X1ZA 2ZRJA 1CJKC 2J0UA 2H1LA 4YMUA 4Q4AB 4KFTA 3FWYA 4JKIA 4MKFA 5G3YA 1DAGA 2L0XA 2BWJA 1R8SA 3KJHA 1BIFA 1DARA 1OIWA 1FX0B 2F1HA 4PSAA 4M9QA 3RC3A 2ZRHA 1XTQA 1GSIA 2QUZA 4JVLA 4Q1AA 5FOVA 3THWB 3A36A 3AVQA 2ZI7A 2IXGA 4KCGA 1Z0FA 4EPYA 1EFCA 4DLYA 5L3SA 1ETUA 3LW7A 1EWRA 2NOAA 4LHYA 3R9XA 1CS4C 4EPWA 4OKSA 2BBWA 1KO7A 4HUTA 1NJFA 4AG5A 1AQUA 3LX5A 1Z6YA 5IT5A 1FX0A 2GZAA 1XEXA 1JNYA 2EWWA 5JEDA 1FUKA 2JLVA 1KI6B 1YR9A 1CJMA 4PHTA 4ZI2A 3I72A 1NIJA 1ESMA 4PZLA 2VRWA 4Q48A 3C15C 3DKPA 1IN4A 3PVSA 5C2JB 1IOZA 2CHVA 3OF5A 5K8UA 4CGZA 4Z1MD 4HAUA 3B6EA 3LXXA 4RFVA 2FPMA 4GOJA 4D6PA 1DBSA 1R4AA 3A1TA 2GXQA 3IHLA 5SZJA 3U60B 1CIPA 1DELA 1EG7A 4E09A 3SU8A 1DAHA 5FI0B 4NTZA 2ZYUX 3SC3A 3ZLJA 3Q7QA 3CNOA 5K8IA 3CM0A 4R9UC 4BGDA 1E1QD 2WWGA 3A58B 2QMOA 2O8DA 4UXJA 4B32A 4LV5B 3FE2A 1QG2A 1JEEA 3ADDA 2O0JA 5EE5B 4MRRA 3IEVA 5BXQC 1X8KA 3E1SA 2REBA 4Q7LA 5B64A 4II7A 1US8A 2W0SA 3PFIA 2KWIA 4HSEA 2CLDX 4A36A 3BK7A 1B23P 3CX6A 5C1BA 2VO1A 4G5RA 4US0R 1D9XA 4BEJA 3RS7A 3GFPA 5LB2A 2QZ4A 2ZUCA 2NO7A 3RABA 4PO1A 2PLRA 2WBLC 2OCAA 4UJ3A 1QZXA 4JLBA 1KI4A 1SULA 4YC7A 4GI7A 4MRVA 2GAOA 4B74A 2ASEA 1E2NA 5L8VA 2FU5C 2QMEA 2R62A 1QHNA 2WPDD 3MWKA 2QORA 3ADCA 4E03A 4B6FA 1EFUA 1OFHA 1EFRD 5FTMA 2HCBA 3EXAA 2NO9A 1SVLA 2WKQA 3U44B 2A5DA 5DI9A 1A5TA 2QROA 1RRCA 4PAOA 1IXSB 4LJYA 2GCOB 3OZXA 2ATVA 3N2EA 4YXWD 1KI6A 1E2GA 3TRFA 4A2WA 4D80A 2CXXA 3RLFA 1BOFA 1HT2E 2GBLA 1YZLA 1F3OA 2ZR9A 2A5YB 4PSVA 2IYRA 4LJ8A 4LYHA 2OFOA 1Q1QA 2CHQA 2ZI5A 2ZRDA 2CL7X 3CR8A 3H1TA 3FFAA 3IPYA 3IBYA 4FD2A 5B2ZA 3AVUA 1QVRA 3SJAA 3T12A 3UPUA 2E9SA 1CR2A 4QJ4A 3CRQA 5FPTA 2XXAA 1IBRA 1D8TA 2OV2A 4E5UA 2C9CA 5EZ5A 3K0FA 1E2LA 4OQNA 3TIFA 2FPKA 4GZMA 1IN8A 1E6CA 4GMDA 3RSLA 1Z8FA 2IWHA 3TSZA 6Q21A 3JVVA 1A2BA 1P61B 3Q3JB 1Q3HA 2PBRA 1U9IA 2PLFA 2PJZA 1MABA 2ZQ5A 3L0SA 3KX2A 3I73A 4A82A 4DIEA 1KJYA 2ZTSA 1B0UA 3T5DA 1FQKA 3DPUA 2D2EA 3FMPB 1F2UB 2HLDA 1CKEA 4HUQB 4Q1FA 5FUWA 1KSGA 2R6FA 1VYTA 3SZRA 2WMOB 3MFYA 1JPNA 5CLLA 4DLWA 3T1VA 4V0MA 1OJLA 1UBFA 5HCIA 2QTHA 2EFDB 3D31A 3DHWC 2KJQA 1HQYE 2RHMA 2JLQA 3AH8A 4GPTA 4ZDKA 5IK2D 4AKEA 1T3HA 4DDTA 3B78A 1SKYB 3KL4A 3QKSA 4HAWA 5FBLB 1NKSA 2I3BA 5TY0A 4EJSC 4RD0A 1E99A 5TXGA 5DNYB 3OFND 5LD2B 2JATA 1J70A 1CULC 4RY2A 5IHPA 4JLOA 1WF3A 3CLVA 3IQXA 121PA 2FEMA 5JZVA 1LV7A 2ANCA 4B3CA 4QHSA 2JASA 2IYTA 3RS3A 4YMVA 3GLFE 3T1TA 1GL6A 1PJRA 3QKRA 1R5NA 2HT1A 4G0NA 3CX7A 3QVUA 2XTNA 4JS0A 3LBNA 3OIVA 2R6AA 4QRHA 4N0EA 3LLMA 3CRRA 4XSGA 2H5EA 4BQSA 1OIVA 4KLNA 1N3BA 1U81A 2AX4A 3TUIC 4ESHA 2XSZD 4POAA 3CNNA 4E07A 1WXQA 4D0LB 5FI1B 2IYXA 3K09A 1RZ3A 2BBTA 4MH0R 2WICA 2LWIA 3PEUA 2E87A 3QPUA 4KO8A 3BB1A 4UNQA 5CLQA 2FSIA 2F9LA 3PEYA 3DZ8A 5TVKA 3FYHA 2OBLA 3CB4A 4B3DA 3RSOA 3AVPA 3QY0A 1YRBA 3FHOA 4NP6A 2RGCA 3W3AA 5EXXA 1W2GA 3G0HA 3OHMA 4L16A 1Z83A 1E9DA 2NG1A 5KDLA 3Q5DA 3K0SA 2XZPA 4KFRA 4LGMA 1QHXA 3AVVA 2GA8A 2R2AA 4K81B 2WWFA 2A3RA 4QGFA 3MD0A 2B21A 1NLYA 4IJMA 4XSHA 4RFSA 2H17A 4BFZA 3SYLA 3LD9A 1A1VA 2B92A 5FL3A 2F7SA 1DG1G 2V54A 2ZAMA 3GEIA 3SQXA 1OXXK 4PQFA 4MQBA 1XEWX 2P6NA 2ZSAA 4X8MA 4F4JA 3LH5A 3BH7A 2NMVA 5B58C 2BDTA 4BPBA 2ZR0A 2BEKA 2P6RA 2VQSA 3L0PA 1G3RA 2Z0MA 4CEIB 3LA6A 1P2SA 3L8ZA 1MO3A 1COWA 2XGJA 4WIAA 2RGAA 4WW0A 2CJWB 1AGPA 1KMQA 2BCJQ 1ZVQA 3FB4A 3Q5EA 4JLVA 4ZDWA 4B33A 3O8DA 5JCPA 3WHKA 2XZLA 2OBMA 3T35A 3G5UA 3AGPA 2RKOA 4ITRC 1ZM3A 1C9KA 4LV8B 2DR3A 2GJSA 3QF4A 2O8FB 1TAGA 4AWXA 2QPOA 4C3ZA 3HU1A 4OK6A 1KKLA 1NN3A 4URUR 1ZD8A 3AF0A 5E7MA 2C03A 3IIJA 4AYTA 3I8SA 2J41A 4B71A 1F2UA 3O8RA 1KDRA 4R2IA 1LVGA 4M21A 5KSZA 1E9AA 5EXTA 4TQUS 1ZNWA 3A4NA 4G5QA 1MT0A 1S4QA 4H1UA 2BJWA 1W0JD 4B2IA 4HZIA 1KI3A 3IILA 1R0YA 4KXFB 1EWQA 2IBMA 1TMKA 3NXSA 1YR6A 4PQRA 4UXHA 2RB4A 4HYYA 1MOZA 1VG1A 1LF5A 2GETA 3NBZC 1XCMA 1S9DA 3UANA 3THOA 3WMGA 2ATXA 4C9BA 1E0AA 2YC4C 1UBGA 2UZ3A 2FFQA 4M1YA 1NSTA 1S3GA 2P0EA 5JRZA 4ZCMA 3CH5A 4DWJA 4US2R 3TR5A 1BYIA 3E5HA 2I1VB 4CZ2A 5GADl 3I61A 3GLGB 2AD5A 2ZAOA 3C5HA 4JVSB 4MGKR 1GTVA 1CLUA 4HB4A 4TL9A 2IYZA 1NBMD 4LYFA 1RFLA 1E2MA 3EA5A 1SVIA 4IDNA 4F38A 4TMTA 2IUSA 1IM2A 4AYWA 4KBFA 1T8UA 2D74A 4KFSA 5UKDA 1H8EA 5BN4A 4A6XA 2WWYA 1ZMXA 2IF2A 4EPTA 1E0SA 4UKDA 4NBSA 4YXWA 4FWIB 4XTCS 2O8FA 3U3JA 4PC6A 1J8YF 4FW9A 1SXJD 3PEWA 4U7DA 2GJAA 2BMFA 4TMZA 1ZUHA 2JJ2D 3DKVA 4TQ9A 4XD7A 4ERNA 2OE2A 4IOMA 3C5CA 3GJ3A 4NH0A 3V4RA 1WDTA 1QBKC 3BFKA 5JJKA 1XPRA 1OYYA 1UEJA 1US8B 2P67A 3PIRA 1W47A 1DAKA 1XD2B 2IYWA 2G0TA 4U5XA 2Q9AA 2VBCA 1U8YA 2C77A 1E69A 1DAFA 1OXUA 4DBLC 4HLQB 5IDVA 3RC8A 1VCMA 2W6JD 3DO6A 1BS1A 4BLTA 2ZROA 4H1VA 1FL9A 4IVQA 1L7VC 2WKPA 2J0VA 3VKHA 2D7CA 2Z4RA 2YOHA 3KXLA 3R20A 3JVUA 4P31A 1ZM9A 3RNLA 2DWPA 2O0HA 1OKKA 3VKGA 2IF0A 2ERYA 2VP0A 1KAOA 2Z4SA 3ASZA 3PV0A 3QVVA 1S96A 4GMXA 4B43A 2HYDA 2YYZA 1G17A 3THYA 1QHSA 4BFSA 2ZJ2A 1ONBA 1W7AA 2J59A 2IC5A 2KBEA 2YVUA 4ZV4A 2WV9A 1E3MA 4BRWA 4D4LA 1GVNB 2QQ0A 1NMYA 3QKUA 4LJAA 3E2IA 1JI0A 4NYIR 2ZRNA 5J4VA 1RYHA 2A30A 3WXMA 4EDHA 4Z54A 5FOUA 2P65A 4A0RA 2QP4A 2B8TA 3EARA 2WJVA 4KVAA 4OJKA 5KSYA 1IN5A 2J5XA 1XTRA 4OL0A 4D2IA 4MUBA 4ASUD 2O8EA 5B30A 4PC3A 4FMDF 4Q47A 3AVWA 2CJWA 1XX6A 5H68A 1AS0A 1NVXQ 4GOKA 4IVPA 5FH9A 1JEDA 2UZIR 3KKMA 4QM6A 4B75A 2BJVA 1DPFA 2QG6A 2V9PA 4MITA 2RGBA 4RZ3A 5JLJA 1I2DA 3VU9B 2IS4A 2OZEA 4FWTA 3ZVNA 3AB3A 1RYFA 4BE7B 2BIFA 3OEHD 2GF9A 1X3SA 2LKDA 3BD9A 1V5WA 3K9GA 1KDTA 3L43A 4HAYA 4I81A 4C0AC 3AUXA 2FMXA 3VNUA 4OHVA 4R98A 4C2TA 1SXJE 2NIPA 2O0KA 1R2QA 4TYQA 4EJSA 1DAEA 4P4SB 3UK6A 3ASYA 5LPNA 1E79A 2DY1A 2CDNA 1ZBDA 2YNMA 2YWHA 1JXMA 1N6IA 4KU4A 2QGNA 4IDPA 1PV4A 1AQYA 2ANBA 1X86B 2D4HA 2CL0X 3K0EA 4KI0A 3THXB 4L9WA 2PT5A 3LLUA 1SVKA 4A1FA 5FBQB 5C4MA 5AUQA 2ONKA 4NYJR 1X8JA 2Q3MA 5FPYA 4Q7KA 3M6AA 4AKIA 3DMDA 1FZQA 2EFCB 3CIOA 3U3MA 4QHYA 1XD8A 3QF7A 4JYBA 2J0SA 4YMSA 3PUXA 2ZIAA 2FSHA 4YLGA 5JHGB 1UAAA 2OAP1 5CIWA 1OPXA 1D2EA 1WA5A 2QL6A 2EWVA 2QP3A 4IHQA 4G5OA 3K0CA 3TVDA 5EE9A 4BZXA 4CIDA 1E2QA 5H1YA 2XTMA 4YDSA 3J81k 2QBYB 2WWIA 1E9SA 4DSNA 3OE7D 5DGXA 3QKRB 3EPKA 2F3TA 3RRNA 3EIEA 2QRNA 2WPDA 4OI4A 1JR6A 4K8OA 4D4MA 1TPZA 2ZU6A 2ZYVX 5TDHA 1K6MA 4NPHA 3TUZC 4QGHA 5EZ6B 3IDQA 4DDVA 1G5RA 1G9XA 1NN1A 1U8AA 1FMLA 3REFA 3TMKA 5KYKA 1Z22A 1WBDA 5FOTA 5G53C 2E1RA 3GJ8A 3IPXA 2VP9A 2QM7A 4K46A 3AF4A 2X8AA 4C0JA 2ZI6A 3S1AA 3I1FA 1PZNA 1M1YE 4W7SA 5GJBA 1EESA 2GWHA 2OEPA 1NMZA 4M9SA 2I4IA 3ZS9A 4EPVA 4ZDIA 2C95A 1YR8A 4EFMA 2JDIA 4ACAA 1I4DD 3EC2A 2QSZA 3F5FA 4Q01A 5DN6A 1Z47A 1R0ZA 3GJXC 3HU2A 4OQFA 3TUJC 1W36D 3RRZA 1T6NA 2DYKA 1TNDA 4XIGS 3ZVLA 4MGZR 3EZFA 5CJ2A 1JALA 1QHHB 3RYTC 1GUAA 1ZNYA 1U94A 3L82B 3OIUA 4HEJA 2AFHE 1COWD 3WRYC 1F5NA 4PPQA 4TTQA 1VDZA 1Z06A 1J90A 2FGJA 5GVRA 3EASA 2H57A 4CEIA 1II0A 1G64A 2V7QD 4ON9A 3X1YA 4MYHA 3BS4A 2W6IA 3VMFA 4B47A 1G7RA 3EWSA 1XDBA 4LOAA 3VR1A 1XXHE 2VL7A 3GFOA 3MWLA 4LC0A 3T1OA 3WNDA 4B34A 3U6KA 3U5ZB 1TTTA 1W2HA 4EKDA 3F8TA 1XTIA 2REXB 2JJ1A 1OHHA 1W4CA 1Z6GA 1QHGA 2O8EB 4Z1MA 2ZUDA 1JR3D 3FHCB 3G82C 1YZGA 1DAMA 1TQ4A 4JVNA 3TGPA 3NHBA 4MKHA 1L8QA 4XH9B 4OHWA 1KTVA 4DEXA 2F3RA 2F1JA 4QGAA 5DH9A 3R8CA 1NG9A 3LAWA 1ZYUA 1VG0B 1SHKA 2ZJ8A 2PL3A 1PLLA 1KMHA 1WE2A 4M1WA 3LVQE 5FUVA 4Q02A 4RD3A 1KK3A 1G3IA 2XB2A 4DUGA 2G6BA 3QENA 1FPMA 3QE0A 4AKHA 1E32A 4JT2A 2QAGB 3CWQA 3EIHA 3U44A 1N5LA 1OH5A 4LBYA 1ZC3A 4KITB 1AN0A 2JAQA 3TKLA 2BC9A 1DO0A 3A1SA 4EJSB 2OFXA 3FMFA 1IAQA 3PITA 1E9CA 1ZUNB 3UWOA 1ZM4A 3B1ZA 2BMDA 2W0MA 1N6OA 5BW8A 1XTJA 1P6XA 3Q9LA 1R0WA 1ZJ6A 3B8HA 4ARZA 4CT4B 2PEZA 2BKEA 5SZHB 1Q1EA 2FV8A 3WNCA 3VQTA 1KJWA 1S3SA 2RAPA 3WRXC 4LHVA 5EXPA 4TL6A 3THWA 1KI2A 4M53A 5AJXA 3TE6A 2AN9A 1Z2CA 4AYXA 2P3SA 1HY3A 1G6OA 1KSHA 3K0AB 4NYMQ 4MRNA 2CVHA 5B57C 2J7KA 2REOA 2YOGA 4KJZA 1KZGB 3NC0C 1VIYA 2VA8A 3VX4A 1XZPA 3DVLA 4NYJQ 2IEYA 5J40A 1TEVA 1HUQA 2V1UA 3LX8A 5ANRB 3ZVRA 5EUMA 2XITA 3QOFA 2CEAA 3SR0A 2VSOA 4PC1A 3LDAA 2BKUA 2WJGA 1G5TA 3D6TB 4PAMA 4DCNA 1IXZA 3SOPA 2IYUA 4LZZA 4HAVA 1W36C 4HZUA 2DHRA 1NN5A 4ZKEA 2O52A 2WWHA 1KKMA 1NIPA 3QPVA 4L8GA 1KMHB 1G4UR 3C16C 4FXPA 4KYIB 1UDWA 1W46A 2QGZA 3RHFA 4DC9A 1R7RA 2J1LA 2PZEA 2AKYA 5FPSA 2QRZA 4N3NA 4M1KA 2QT1A 4PHFA 4OQXA 5FPKA 3ZVMA 3CF0A 3OEED 5D3QA 1CBUA 4DLZA 4F4CA 3AKCA 4CT5A 4OI0A 3BH6A 3AVOA 5KUTA 2WAXA 4QBGB 2R44A 1E9EA 2X2FA 2NO0A 3EPLA 4FMBB 5FOSA 4IOJA 4Q66C 3VKWA 4BASA 3FTQA 2W6JA 2NO6A 1G3QA 3PUYA 5FBRB 1Q3TA 4TN1A 2QPTA 2WWWA 1FUUA 1E79D 4QBIA 4YONB 3HR8A 3FOZA 2HEIA 3OE7A 3AVYA 4CEJB 3ETLA 2F1IA 2ZS9A 4EPRA 3QIAA 5KU1A 2XZOA 3NKVA 3EWAA 3PUWA 5FTJA 2GILA 3HJNA 3OESA 1AM4D 3QKSB 2OM2A 4GRAA 1IQPA 4RFSB 4PTLA 4B3XA 1TF5A 1DS6A 4LJ6A 1CF4A 2G3YA 4TLBA 1ZUIA 2QN6A 3GQBA 1ZCAA 3F0TA 3GMTA 3U7HB 4LJ5A 4V0ME 4BFVA 3GLHA 5DI3B 4MKIA 2FN4A 5E7IA 5L3RA 3R9IA 2EFEB 3Q85A 4OHZA 2HJVA 3ZYCA 1YZNA 1GILA 1QHIA 4GBMA 1S1MA 4W5HA 2H8KA 1P73A 4TZ6A 3CKLA 1LNZA 4HATA 4TLAA 4W9MC 1OH7A 2AR7A 1TEXA 5DHAA 4QOSA 4R7ZA 2BM0A 3ZH9B 4JT4A 4Q4LA 1OXVA 5CITA 3SHFA 2OAQ1 4KAXA 3RDPA 4G5SA 4NKRA 3IGFA 1JJVA 3TSWA 5JI2E 1FQJA 4MYUA 5F9HA 1KNQA 2IL1A 4IOLA 1P2TA 1SXJA 2F43B 5EP3A 4QM7A 1EX7A 2WHXA 2YZ2A 2ZPTX 5GJWC 2C96A 4A8JB 1NNEA 3OFNA 1FTSA 2V8OA 4QNMA 3DL0A 4YMTA 4WZ6A 1Q0UA 4Q1CA 4DCSA 4PXAA 3EPJA 4IDHA 5DISB 1XU4A 1E9RA 3TW8B 1GL7A 1OB2A 3D3QA 2SHKA 4URWR 2YKGA 2ZJBA 2FPLA 4L5BA 3ICQB 2J7PD 4A0GA 1JAIA 2AK2A 4EAQA 3IUYA 4YQFA 3AV0B 4A2QA 2TMKA 5SZKB 5J47A 1P3JA 4X8LA 4A2PA 3MG9A 2C98A 2GHIA 3NVAA 2FNAA 3B5JA 2C78A 3BXZA 3L8YA 3SJBA 4HLUC 1HE1C 3BGWA 4TYWA 2W2VA 1NP6A 1HTWA 3LXRA 2C2HA 1TQDA 3GLHB 5FBWB 3T15A 4RJLA 3GLFB 2J0QA 4NZYA 1YR7A 3WP1B 4LY6A 4EFLA 2ZJYA 4XWKA 4EFNA 3VR6A 4RCYA 3KXKA 4DSOA 4R71A 4IRUB 2ZYWX 3R7WA 3BOSA 2ZRGA 4CW7A 3KQUA 1P2UA 4OYHA 4Q4AA 2ZRKA 2NZ8A 2G1JA 2J0UB 1E1RD 1DEKA 5HE8A 721PA 4JLAA 1YZKA 5CIQA 3SEAA 2OXCA 4QL3A 3GEEA 1KAGA 2PCJA 1NLZA 3NH9A 1JB1A 1HQCA 2R6GA 4LYJA 5J4HA 5JS7A 4JL8A 2KB0A 4QHTA 1FP7A 1Q20A 1KYIA 1Q21A 4LYAA 2FZ4A 3U3KA 1GFIA 1G8HA 4LJ7A 3U61B 1OH8A 1VHLA 3HWSA 2VHCA 1WMSA 5EE0A 1M2OB 3ZJYA 3FGNA 4B44A 3KUDA 4CEHA 1AKEA 4UXIA 1T5LA 3TSOA 2JLUA 4AKGA 2PMDA 2Q0HA 4AURA 3OIYA 4US1R 3CPJB 2JCSA 4JSYA 3A1UA 4HAZA 4PC7A 4Q03A 3IO3A 5JWRA 3MWJA 2PX0A 3I8XA 1M6NA 3DOFA 5FL7A 1RW4A 4ZIRB 1D2NA 3QXCA 5DYIA 5JSZB 2G77B 4C0QC 1J2JA 1M7HA 3PCRB 4Q1DA 2A78A 5DLQC 4WBSA 1U99A 2BEJA 3PJRA 4CVNA 3X1XA 1U90A 4D26A 4XTRA 2AK3A 2VLIA 1RJ9A 2J87A 2PZGA 2ZRLA 3U4QB 421PA 1QDEA 1IY0A 5GJCA 1YU9A 1U2RA 2XEXA 4BZPA 1R0XA 4DLTA 4FCWA 2BM1A 1KSJA 3QNUA 1IXRC 5CYPA 1JQLB 1UFQA 5L3QB 1KO1A 5JJLA 1J7KA 2ZJZA 1XJ0A 2GF0A 3WYFA 1NVUQ 3Q72A 3FPAA 2IXEA 4BFYA 3EAQA 2PCLA 2ZVPX 3P26A 2IYSA 3EX7C 4DEYA 2HT6A 4WZAE 1SVWA 1IONA 2X1VA 4F7WA 2DFKB 1Q1ZA 4RKFA 2OCBA 1E2EA 3HDTA 1G16A 2J45A 5EUQB 2F9MA 1X8LA 4FMDB 4M4SA 4NYIQ 3P32A 4Q9KA 5JBQA 2FWRA 4PZYA 5F9FA 2BBOA 1QG4A 2I1QA 3TLXA 5AUOB 1Z08A 2O8BA 4XWOA 4DT1B 1JECA 3RRMA 1Z6XA 1VCNA 5J4YA 5LBIA 2MSCB 4Q9JA 4TLEA 2OT3B 1XXHB 4Q4HB 1S9HA 5JECA 3V9PA 2JEOA 4LSGA 1ODFA 3KJIA 3RRYA 4C0BA 4ZCIA 4BZQA 2IHYA 2QQEA 4PHHA 4ABYA 821PA 2VF8A 1N6HA 1PLKA 5A5GA 2JJ2A 2O8DB 5FBVB 3WBKA 2V55B 1DG3A 4DCTA 2PX3A 4XD7D 4RZUA 4C0HA 1G41A 4BLQA 5DE3A 5TB5A 4DLVA 2XXAB 2C9OA 4C0KA 1KO5A 4P4TA 1G291 1KI1A 1R5BA 1SKQA 4TLCA 1UBEA 1OIXA 3B1VA 2WVJA 5C4GB 3K9HA 5EP4A 3KXIA 3IO5A 3MLEA 2FFHA 3UG6A 5TARA 3K70D 2HJGA 3GJ5A 1JBKA 4BECA 1K5GA 1SHZA 4FCVA 3UMFA 4EQ6A 2LKCA 3TBKA 2ZI3A 1G4AE 1W0KD 2Z5FA 3BJIC 3TW4A 5G40A 5AJWA 4CF7A 3MGCA 1HURA 3AKYA 3ICEA 3RS4A 3DMNA 1DVRA 1YE8A 4ESVA 5HKKD 3LQRA 3LBIA 5KHOC 1LW7A 2OG2A 3M0EA 4IDQA 4OBEA 1E2JA 2QEQA 2EVWX 4HAXA 4D81A 2A5GA 2RHDA 1G1MA 1N6KA 1N2CE 2MSEB 3B9QA 1G8GA 2JA1A 3CNLA 1BKDR 5F98A 3K0AA 3U7GA 2JLSA 2H92A 1UEIA 3TK1A 2IA5A 2YV5A 4B2PA 3DDCA 4URYR 2NPFA 3QEOA 4LK2A 5AJVB 1DO2A 1VHTA 2IHBA 2JIZD 1IHUA 1T3LA 1LFDB 4NCHA 4V0KA 3K53A 1UDXA 3KKPA 2C04A 2C5LA 3SNHA 1QRAA 3BRWD 1XP8A 5F3WB 2ZXUA 2O8CA 1XTKA 4DB2A 1VTKA 5KNDA 2H7VA 2QAGC 1R5OA 1UADA 3AVTA 4I1SA 3LQQA 4TLDA 1AZTA 3CRW1 4AG6A 1KDOA 5CJPA 1LB1B 2XNSA 2BV3A 5FR2A 4B2LA 4AK9A 2AXPA 2ZRIA 2IYVA 3CW2A 4E22A 4RD4A 3W6NA 1ANKA 5DN6D 3I62A 2RCNA 2F55A 1E0KA 3M4YA 3EW9A 1G19A 4AD8A 2PZFA 2HXYA 1ZRHA 4IEIA 4KODA 5EP2A 1Z6AA 4Q4JA 1MABB 1XTSA 2VSXA 3GD7A 1RIFA 2DWQA 2XNDD 1AGRA 1VG9B 2ODBA 2XSZA 1TX4B 1GRQA 4Q9IA 1OB5A 5H70A 1WB9A 1M7GA 2HF8A 1N25A 1GIAA 1G18A 2GTPA 3D7MA 2HXSA 2F6RA 4AIIA 4D25A 1W4RA 2DPXA 1NJGA 1O87A 2PMKA 3SYKA 3WP0A 3SQWA 1ZIOA 4Q1EA 4UQOA 1T0JB 1W4BA 1G5PA 1NVWQ 2ODNA 3Q7PA 4Q18A 5CB8A 2CMKA 1KY3A 1KK0A 3A1VA 3QQ5A 3UIEA 3MUFA 3W3ZB 4BWYA 3GPLA 3R9WA 1J8MF 5L3SB 2VHQA 2NGRA 2F1RA 1MO4A 2AKAB 4PX9A 1G7SA 5KSPA 3KKOA 4F92B 3EG5A 2KI5A 2ZI9A 5A4JA 3H0KA 4TL8A 2Q3HA 2FA9A 4PO8A 3OEHA 3NG1A 3GLIB 1ZD9A 1NSFA 1A82A 4LCBA 3TQCA 2ZRFA 4Z8YA 2RGDA 5EE1A 4A15A 5FOXA 1Z0KA 2GEDA 3C7KA 2OCYC 5GJVC 4BLSA 2ZSDA 3C8UA 4UNNA 2GXUA 1ZAKA 2OO7A 5TMPA 2JJ8A 3AEZA 3EZ2A 3ECCA 4I1VA 4M0LA 1W36B 2GXSA 3P4YA 3KQKA 3KQLA 3DOEA 5EXSA 4AC9A 1II8A 5FL7D 4A9AA 4KFUA 1W44A 3PXGA 4B35A 3TJZA 5CDFA 3V4FA 3VR2A 1TF2A 3SFVA 4LJ9A 1BYUA 1GOTA 3QPWA 2XB4A 4O0MA 2R6CA 2QAJA 4HB3A 1T9HA 2WSSD 2FE4A 3ZZUA
chains in the Genus database with same CATH superfamily
1GZDA 3PB3A 1BC5A 1F06A 3IJ4A 3MAJA 3KQHA 4BPRA 4O08A 2BI4A 5GM1A 3TLCA 4EQ6B 2FDCA 1VYVA 3LC7O 1AUQA 3S8MA 2AA3A 3CPEA 3DUWA 3E81A 4HDRB 1JWAB 3RVSA 1W0JG 4MB6A 1X6VA 2CV1A 4EHLA 1VMAA 3JX9A 2ZR8A 5AVQA 2OFFA 8AT1A 4CPDA 4K6HA 3N39C 2XE4A 2J33A 2OHIA 2C3OA 3BERA 4M1TA 4WA8A 4KBYA 4DRYA 3HYSA 4M0KA 1DOHA 1Z4OA 2Q7HA 3V2GA 4RHXA 4IEFB 3W0LB 4BN0A 5A62A 3UH0A 5CJJA 4BNTA 3W6OA 5AKGA 1T8TA 3CWZA 3ORHA 3PJFA 4P84A 5P8WA 4G0MA 3I83A 3OH8A 3TNDA 3DH0A 1SBQA 3HXTA 3DWFA 4QYWA 2D1SA 3EE6A 3N9IA 3QEMA 4TYMA 2ZSIA 1O89A 1Q0QA 4IYJA 4D57A 1MDBA 5BW5A 1Y9ZA 3PA8A 4V39A 5C18A 1J5EO 3OQIB 1M34A 3O3OB 3DDZX 3HK2A 3LXMA 2XUGA 4MW8A 2EL7A 4QQ8A 2BHTA 2WZDA 4TLLB 1N2JA 1Q3KA 3KVVA 1VQPV 1PK9A 1XZLA 5DFAA 2GFIA 5IUKC 2C2YA 3RTEA 2C7RA 1QCYA 3MMSA 2X5OA 3O4FA 1XNGA 3OLCX 5KTYA 1PRYA 1Z73A 4RK5A 1REQB 4O4IB 4IX9A 1CVRA 4BQNA 1QQCA 1O95A 2C0CA 3ILXA 4N5DA 4AO7A 4DQLA 4Q9AA 5I6DA 1Q3EA 1DLIA 1OTXA 5A5DA 1BHO1 1DHTA 1Z29A 3QXXA 5SZHB 4K1LA 5M29A 1ZINA 2NZVG 4DRZA 1OGJA 2GN1A 5JANA 2DPLA 2A6PA 1VJ1A 4RL6A 3KDPA 3OZWA 4K9LA 1NP3A 2A9KA 3W7WA 2D2IA 2AMLA 2H4WA 3UCSC 4UHCA 5F78A 3TWOA 2C2OA 2ZITA 4X93A 4NDZA 4O3FA 5IXSA 4UJ5A 3GYBA 4PHGA 4IXNA 4ZYUA 3UO2A 3HB9A 1XNHA 3F98A 1USIA 3I4LA 3PKZA 1W19A 1GPWB 2GGSA 4WNAA 2P75A 1ZW1A 4FW8A 3WOHA 1WB6A 2WA4A 3RK1A 3FSRA 3PXCX 3BBPA 7REQB 3MCAA 3DXRA 5K6AA 2DBZA 5E95A 2YW9A 2R79A 2HO5A 3NJ8A 2ENUA 3SN6A 4C5CA 3UKDA 1C1HA 3LIIA 2ZYHA 3PNYA 3UAZA 2Q8NA 5IM5A 5B3SB 5T41A 1E3EA 1YQXA 1UBNA 2AOUA 1SA0B 2ATCA 2D13A 1CJTC 3EQ8A 1RI1A 3EXEA 1ZUQA 4HFRA 5WRFA 4ZGBA 1Q0TA 2CV0A 3C7DB 2Q0AA 4C21A 3FCEA 2IYQA 5K8CA 4R2HA 1Z4KA 1Y5IA 5CB6A 1GNRA 1OBHA 4PC2A 5IRCD 4N47A 1VIBA 1E89A 4GOXA 3PNVA 1X1BA 1GD1O 1V6SA 1CD5A 1SCNE 2YDYA 5J2UA 1E9FA 3OJXA 4P6VF 3ZE6A 4NH4A 2DC1A 3JQ7B 3K5HA 1ZAUA 3AFOA 2VHUA 4KR0A 1IHXA 4COKA 1L5QA 1IZYA 2ACEA 1ZHOA 1R6DA 3PE3A 1Z6PA 2QX9A 5DP2A 2NSJA 1SVMA 1NWHA 4JUAA 1P7GA 2E5LO 2Z43A 5FLKA 5LNK1 2EIJB 3CSSA 3HCWA 3DVQX 4YR7A 3MAAC 5KSOA 4NTXA 2J48A 1HNWB 3AG6A 2OBNA 4KV9A 4YAEA 5GONA 4AMYA 5LQSA 4RAQA 1CRQA 3B13B 1JR4A 1RBQA 5EJ6A 2PFSA 3CTPA 4UFOA 4DGQA 4DILA 4U39A 2JLBA 3JQ7A 3IR7A 4GPBA 1BT8A 4V2UA 5A3VA 3FFBA 1O03A 3T7JA 4B6GA 4D3SA 4LWOA 2C9YA 4DR7B 3DMFA 3CYOA 9GPBA 5C8VA 3HXPA 1NOJA 5JZ9A 4BKMA 3JCUZ 4Y0AA 4B5KA 2G9VA 5KYUB 1Z12A 4MVJI 4KLZA 4UBMA 3CCUV 2Q8QA 1VQ8V 3ZE2B 3G02A 1KEPA 2JANA 1AZSC 2NZYA 4AZ0A 4ARIA 2UU9O 4ZOLF 1D6NA 3QJYA 2ICAA 2ZU0C 2AHYA 1FDRA 2EQAA 3NOQA 5CBFA 1DBPA 4N7RA 1E2PA 2XOKA 5B6PA 2QUAA 2XMGA 3I8OA 4DLXA 4D5GA 1DWPA 4YP1A 2F93B 1MX3A 2MINB 4P4UA 5DCYA 1DKQA 1XB2A 5CCBA 3WWEA 1VPTA 1QFYA 4TSFA 3R7AA 1YJ9V 4G0XA 1EVLA 1WZUA 5AK0A 3D8BA 4TUYF 1AMUA 2P79A 5IN5A 3LF2A 1FRQA 4DMMA 4XJXA 2V7QA 3N2YA 2QU8A 4XIIA 3L1IA 1TAQA 1F9EA 1YJ5A 1ZU4A 3CONA 3SXUB 4GX5A 3RVDA 4EG4A 3EFFK 1LVUA 1RM4A 4H37A 3K0KA 2HX1A 3PR1A 1VM6A 4KUMA 1YSCA 1KYXA 2F4VO 1XEWY 2ID9A 2PYZA 2ZQMA 1PDVA 3AI2A 3LVBA 3P0FA 4KVGA 3BREA 4WF9V 1MG0A 1N6PA 1XAIA 4KWHA 1Z18A 5GTHZ 4WA7A 1X42A 3FD8A 3WYGA 4M0MA 1NG1A 1RKUA 1B2RA 1I4WA 1PJQA 2DTXA 3SC6A 1ECPA 1CS0A 1VBMA 3GN1A 1G20B 3LMKA 5CYOA 2M1ZA 1GQSA 3ZGXA 4UFZA 1OFVA 2WD8A 4PGAA 3DC6A 3W9UA 2VPYA 4TVSA 2BZ0A 3GCDA 1QJ4A 1X9IA 3HN2A 3TJTA 1XV5A 2YINC 3N2IA 5H0IA 4FLZA 1R0SA 1NMXA 3L0YA 4MUMA 3T5AA 2MYTA 1QH1B 5BR4A 1GRNA 3L0OA 1IRXA 1YFLA 2QMQA 4DUGD 2DUMA 1HDYA 1TCAA 4CNQA 2ZUUA 2Q4PA 1L7MA 1RABA 1JMYA 1XF9A 2PZBA 4CKXA 1OFTA 3MAGA 1SXJC 3V1UA 4J0QA 1U7PA 2NSYA 4JWTA 1AGYA 4DZZA 3A05A 2WLMA 4PZUA 4LQCA 1NF2A 3Q9UA 1BN7A 5B1OA 3UMGA 2GNOA 1T6BY 1G7CA 5L4SA 1TZJA 3PLNA 3VR4H 3ZTWA 4EEZA 4F04A 4HI0E 3O03A 2VUUA 4B73A 2HIAA 3NHUA 1XL4A 2WUVA 1RWKA 3OFSA 5CCDA 1UQTA 3OHSX 3SMQA 3KB8A 1FFYA 1EYZA 1T5OA 3C6MA 4NPCA 2C83A 1EN6A 2CL6X 4RU1A 3O4RA 3DVAB 2UUCB 1RVV1 3CRNA 4FHFA 4N0PA 4YJKA 1IJFA 3ASNB 1BJTA 4JJGA 1XZCA 3DR5A 2IHKA 3KR1A 5EIAA 5TVGA 1ESCA 4NJEB 1MJFA 2C5GA 3HUDA 3O8OB 4AAYA 4DMRA 5HPYB 3WLMA 4DYDA 4D79A 1DIBA 1RWXA 1UFOA 3VR4D 2DMXA 1QHFA 2FEPA 4DAOA 1ZR2A 2ZTMA 1SVUA 2ZVQX 3AETA 5HKLA 4NCKA 5HNKA 2IZ1A 4NVRA 4I7ZB 1F2TB 1N0UA 1IZ7A 1IY8A 4RD6A 2Q4RA 3ZNQA 1UKZA 3KLMX 3L0BA 2GEJA 4QQRA 1WX1A 2XYVA 1XEFA 2WTXA 1Q50A 1RE0A 2Q28A 4XX1A 2G06A 4JN6B 4K9KA 4DIMA 3I9NA 4QATA 2PQMA 3PIIA 4ILEA 4DXHA 4FNGA 2QZ9A 4X71A 3PEYA 4G0ZA 3VGJA 3B52X 3QEMB 5L3GA 1WXEA 1XJ5A 2DUUA 4RJ2A 5DNUA 5IF9A 3R7NA 1OWLA 1QNFA 2H9YA 1GZ3A 3GUUA 3QWFA 4HN2A 3T3IA 1CUUA 3NTVA 3NYRA 3I45A 3D36C 3EWIA 4YRSA 1OAOC 4R81A 3KWMA 3ROFA 3HYCA 4QNNA 2QTRA 5E4JA 1ADYA 1O0SA 5HEKA 5A7GA 2W2TA 1DIHA 4HDCA 4F8JA 5MN5A 2YIBD 3OBIA 3F71A 3P2OA 4U0JA 1WXXA 1U2PA 4I2NA 1RWPA 1R74A 4LF8B 4BFXA 5BSKA 2DU8A 1T35A 3WFJA 1Q14A 1V8DA 5C1PA 3S8EA 1AKWA 4M22A 4RGQA 4DM3A 4X8OA 5A4MS 3VFDA 3GJ0A 3UEOA 4WOPA 4KQCA 5HJ2A 2J5RA 3HBJA 3K0FB 1M1KW 1HE2A 5EPEA 1GSAA 2Q6TA 4Y0VA 2OCDA 2DECA 3ZGVA 3GLGE 1QH1A 2IX3A 3DFZA 5HM8A 2P9CA 1M74A 5ALEA 2MR5A 5CHEA 1OHHD 1U3UA 4QWMA 4TZ0A 1HA3A 3O75A 2BLLA 3I1JA 3PHCA 5LC1A 3T41A 1ZJWA 3GPIA 1CQXA 5AJYA 1ADCA 2ODAA 1TUIA 4YCCA 4LDJA 4BKRA 3ECAA 4P58A 3L4BA 2IW3A 1XILA 5KX5B 2QY9A 3I3SR 4YLEA 2IS6A 2AQKA 1WP9A 3SFZA 3ESYA 3KSMA 4WNCA 4DV6O 4IHJA 4QNRA 3W6PA 1E5TA 1KYWA 1IJBA 2GCOA 2R6ZA 3TW8A 4PVCA 3T5GA 3HZRA 1EIZA 5CDHA 4UBIA 3WLLA 1UZMA 3L5OA 1E1CA 5ALYA 1RQ2A 1Z36A 4YO8A 1ZGZA 2ONJA 1PSWA 1K0UA 1J2UA 2RHCA 2XUOA 3UMYA 1XDUA 2NXNA 5G0WA 1A77A 1V43A 3EZNA 4UMEA 3PRKE 2BCCH 3L75H 2VN8A 3IVAA 4H0FA 1MA1A 3PJSK 5B2FA 5BR8O 1T0BA 2X2PA 3I1YA 3CBQA 1XGKA 4FIDA 3ZWYA 1O9GA 4CBCA 2D3TA 1TF7A 1YFKA 1A2KC 2R65A 5NLLA 2V58A 1XBLA 1I4LD 4PSKA 4PONA 4WY2A 1C7EA 4R8SA 1LZLA 1A88A 3BJMA 2F8SA 4CG0A 5L3BA 4HLUA 2O2IA 3L7LA 1XPOA 3JYLA 3CO0S 2X6BA 1FVFA 2H2DA 3DTVA 3IRVA 4FGJA 4KPYA 3GD5A 5JSHA 1QC5A 1PR3A 5IMSA 1UKVY 4MVQA 5A3JA 5KDOA 2OP0A 3GFQA 1LF0A 1IH8A 2QX4A 3FHTA 1FTNA 3TLGA 3V34A 3JZAA 2P9FA 5DI3A 5ITWA 2ZSBA 2WIDA 5LP1A 1Y4ZA 1AIPA 3FBGA 3LPLA 5CU7A 3R40A 2I2BA 3WSWA 1AKYA 1GPBA 3U3OA 5BV2P 1WW2A 3ZGYA 3TE7A 3C4JA 2NVUB 2Q07A 3BGIA 3KAJA 2QR5A 3M5CA 3KOOA 2PS9A 1DG9A 3R7SA 4AF7A 5FEUA 3L1VA 3QVJA 4FLMA 4PHCA 1RSOA 1BXRB 4G0PA 4OHPA 3SP1A 2NO5A 1YA4A 3BK1A 2R9IA 3WGQA 2ZUBA 1XPJA 1UJ6A 1YZUA 1ZJZA 2HF7A 3M3DA 2NTNA 3H1LH 2ZS7A 4GKJO 1BDBA 1MH9A 4HN9A 3V4PB 1GGKA 2FUG6 4WMLA 1FDWA 1Y74B 1H8HA 1ZW6A 3M6XA 5EIEA 2J9FB 2XODA 4WRRA 2VTKA 4E6EA 3PNOA 1GRCA 3QP9A 4DLPA 2PIAA 2WV7A 3LS2A 2QUKA 3SS8A 2VTBB 1XMQO 4FBLA 3P30A 4CC6A 1P33A 3A0HZ 3VC1A 5CVJA 1PUJA 2XUQA 1NVMB 2V74B 1YZTA 2IYYA 1RRMA 3P9NA 3SQNA 4WK6A 3ESDA 1Z45A 4GL2A 4NXMB 2OUKA 3TH5A 1Y74A 1T4DA 1KOGA 2ZBUA 3RROA 1C3EA 2DT5A 4AJJA 3GLIE 2P8JA 2BMEA 3IVCA 4YAGA 3MJHA 1P49A 1Z3IX 3OAAD 4GDFA 2CVZA 3VHQA 4CM8A 2CZGA 5JTUA 4RETA 3R75A 1H6BA 2PUVA 4FS8A 2JHGA 3B60A 4M8SA 3WYEA 1E3QA 1XLTC 2X58A 4II2A 2ODWA 4L3OA 1UWLA 2XNKA 5EHGA 4NYMR 5THXA 4DA6A 2FLKA 3FTNA 1QMGA 3L70H 2X19A 4GI5A 3W5HA 2C2ZA 2O2YA 3CR7A 3EC1A 3LPAA 2VHTA 2IUFA 4ZO9A 4CWAA 4U0KA 1NBIA 2VHYA 2XVMA 4B7ZA 1RLUA 1T2FA 5FWXA 2OV4A 4BMYA 3KQMA 1IC6A 2EZUA 2Q4OA 2D2FA 2Q4DA 2WYWA 4TOIA 1RJGA 3AP1A 3DBVO 3B20A 3ODGA 4MWTA 5LMUO 4F72A 3VTKA 3UMMA 3PKIA 4UEQA 5DW3A 1ZPDA 3BWVA 1MSWD 2YUTA 3IODA 1TC2A 1KYTA 1E8DA 5CYGA 3ZIAG 3QVLA 4BEBA 5I9SA 3KQNA 1TQ2A 1HZJA 1ZONA 1K97A 4GWLA 8GPBA 2JLXA 1XPUA 2FN9A 3R24A 3MJRA 4N18A 2R6JA 1WDKA 3QUQA 3UW1A 3PA6A 4C6TA 3D4LA 7ABPA 4BXOB 3NBFA 1OV4A 2FZLA 1G2OA 3K96A 1T34A 2HZBA 4JCOA 2WF7A 3ABQB 1YZYA 1ZK0A 4OYYA 2G36A 5ERGB 3RFCA 1W35A 4JU9A 1Q43A 4DCUA 4F11A 4WL0A 1OC4A 2GZMA 2J3KA 3LFHA 5IJAA 5LQAA 3NDBB 5HOEA 1S0UA 3BYZA 3A32A 3AKZA 4TKVB 2JFVA 3VDRA 2W4MA 1KSFX 1GGEA 2B4AA 4LH6A 3CISA 1WMDA 3Q10A 4TMFA 1EJBA 1JLRA 3IOYA 4XWYA 2GN6A 3AIKA 2FAXA 4QFMA 5IZ4A 3NBMA 3UO8B 3SJBC 3BDVA 1I80A 4JKYA 3RSFA 3WDSA 1A95A 3JZMA 3IKJA 2I4LA 3G17A 1V39A 2I2WA 3ZMSA 4WKPA 5H5NA 1VOTA 1W2BU 3KUCA 4M86A 3SKVA 2QY6A 2RD2A 2ZCEA 5GONB 1OZAA 4HDNA 4L27A 3VR2D 1J9ZA 4HDMA 4BNVA 2PE5A 2IHZA 4F2WA 3O0DA 4HB2A 3A3NA 4KWEA 1D09A 4MKGA 3SJZA 1Q57A 1Y1PA 2EQBA 1HEIA 1Z75A 3CLRC 3OTGA 4MQEB 3T3DA 5KSWB 3QO7A 4MLDA 4ZVUA 1OT3A 3TW6A 2JFXA 3U7IA 4OFZA 4EG6A 4PVDA 2FW0A 2C0QA 2NACA 4CG1A 4MQ5A 4MUAA 3T9FA 4PRLA 3KKKA 5J2UB 4PN7A 5A2QA 1SG6A 2R8XA 1UBJS 1P9RA 4KIGA 3EPHA 2D5CA 5C8YA 3OX4A 5CR9A 4FI3C 5IM4A 4ZHQA 5HFMA 3GVHA 4N5MA 2YCBA 1W73A 4G1VA 1GMGA 3E9QA 4QJ5A 4U7FA 1KL7A 1XNRO 1N4AA 4DV7O 1BWPA 2IIPA 2GKOA 3EY9A 1HW7A 4UMFA 2BZGA 1VYHA 3GDWA 3ZRWB 4M8NE 2AUMA 5KYYB 2V0GA 1MJ5A 2P8SA 1BGWA 3JQ8A 1XTTA 4Q4DA 5D3MA 4RKEA 4ZA2A 4LXUA 2IJGX 3CX8A 2JHPA 1Q5PA 1CQIB 1F1BA 1P72A 4NG4A 5EINA 2P6UA 3DUFB 2OV6A 3KBOA 5T4BA 3S1AB 1QLEC 3R3WA 2FDXA 3S81A 3U61B 4UFNA 2NZJA 3B9RA 4P4SA 5ALMA 3L8DA 4X62B 1UMKA 2IPLA 3FLBA 3LQ2A 3G7NA 2GK4A 1FD9A 4KBGA 2FUCA 3LQFA 4OQEA 4R7GA 1HWYA 3SPJA 3N2KB 3FH0A 3K35A 4X24A 3PXXA 2OWDA 4L15A 4L4UA 4X7BA 4ZQGA 2PS0A 2WT8A 5CYFA 3TD2A 2FTKA 5MDHA 3BFVA 2G07A 2ZYTX 2RB5A 1GNPA 1Z56C 2P2GA 3TI7A 3WTCA 4X9QA 2GJ4A 1P1CA 2QM3A 2RBGA 2VF2A 3CO5A 4HO1X 4LHXA 5JCXA 1MHPA 4BATA 2QJRA 2VTBA 4AJPA 3ASOC 1P60A 1R8QA 1Y37A 2LIVA 2LPMA 3IOBA 4NPAA 5KYTA 4MV8A 3DONA 3MERA 3IIKA 3LC2O 1GTRA 1NKDA 3BD6A 3U4MA 4GBJA 4HQFA 4URVR 2P4KA 1CDEA 4XQCA 1ZU5A 2FWJA 1CVLA 3CWBH 4UB8Z 1ZH0A 3CUVA 3FI0A 3RVKA 5KO2A 4LWQA 5A3QA 3AEQB 5LFAA 3A6GA 2XUPA 1FYXA 4L87A 1P7WA 3HVJA 3LBHA 4HB0A 4TMVA 3QKTA 4B3IA 1A9TA 3AP2A 3OLXA 4NQZA 4ND3A 1QFJA 2VATA 1QYRA 4CH3A 1QVFU 2WHPB 5GTDA 1BA3A 2IP2A 1NT2B 2BCEA 2ZS8A 3WLQA 2IU4A 3L6BA 1UPGA 2IS2A 4JYPA 5GVSA 4MIYA 4N1AA 1HYQA 3F47A 1QNMA 3UN1A 1T9CA 4IV0A 2ISSD 5IULC 3LUTB 1ABEA 1PZHA 1V37A 1N2ZA 4OGFA 1UDBA 2NTJA 4BFUA 1X92A 4X64O 1O0CA 5KHGA 1UMBB 4IL5A 4LK3A 4MP6A 3K70B 4UUJC 3KBBA 1VLJA 1RWWA 3F67A 1RJ9B 4NZMA 3ZWAA 5JDCA 4JJ8A 4N41A 2QBYA 5DOZA 5AKIA 3SXPA 1MB0A 1SQ5A 5B2EA 1AB3A 3N5CA 1OTHA 2F43G 2ZXFA 3A26A 1ONNA 3HO6A 4W5TA 2UKDA 4LUCA 3KPYA 2I4OA 5HUQA 5KNBD 2FCAA 1ZL0A 2Q69A 1C4XA 2JJYA 3KYJB 4HS4A 4CTOA 3JR7A 1P1JA 4GVPA 4JL6A 1N3YA 1V26A 4KNVA 4XX0A 5CLJA 3MCWA 1L7OA 4K6OA 1C9JA 4RK4A 3ZE0B 4D9GA 5JC1A 1V7CA 4HNAA 1PLJA 1XXLA 4CLHA 1XQVA 3HXMA 2Q5LA 2W2XA 4K9SA 2QN2A 4TZTA 4EA7A 1XU7A 4L85A 1GT6A 1JYEA 2O8BB 3JAMN 2F67A 2CNWA 3AM4A 1KEUA 3K09C 1ZI6A 3L05A 4Z7JA 4CI9A 2VDQB 3C7TA 3CPSA 4BO8A 3V42A 3K1JA 5IHXA 3NYIA 1H94A 1X7YB 5JBNA 4M99A 2WIKA 1EB9A 3STVA 2WSIA 1GAXA 2YOFA 1QK5A 1T1SA 4H33A 1HT0A 2H1HA 3AUSA 3NASA 3V8BA 4B46A 4BJ1A 1AQNA 2VIIA 5IW8A 2VAMA 4A6PA 4RDCA 2OESA 1C30B 3BC1A 3K30A 3KOYA 4DAEA 4RH1A 2FR8C 4YRIA 1RFYA 5CFZA 3HFJA 4R9VA 3TZBA 4P0PB 3EVGA 4C30A 3S5UA 2EKDA 4OD0A 2FFAA 1ENZA 1F6BA 1W2WB 4D4HA 1UC5B 2RC5A 2HVJC 3RWOA 1OD6A 3ML0A 3DLBA 1RCUA 1P0IA 4PANA 5AUNB 4KC0A 3U09A 1XZQA 4ND6A 2X8JB 3SIWA 1I9GA 1M1XB 4MW0A 1Y1SA 5F2EA 1OQAA 1U04A 3OT1B 3WNQA 4GECA 4AS2A 3EZ9A 5ECDA 3D43A 2DB3A 1IIRA 3ZQ6A 2YHIA 4NESA 3QA3E 3EVKA 4QBFA 2EC5A 3STUA 3V9AA 4NU5A 4A6DA 1VGQA 2XMZA 3HN7A 2KE5A 2RMKB 1LGYA 4YAJA 5KUKA 1Z2OX 2Q3FA 3QU9A 2IHVA 4MUHA 2A5JA 2ZPUA 1C7IA 3E9NA 1XE3A 5TGZA 2OO3A 5BVHA 2QE7D 2GYUA 1K75A 4C87A 3Q4HA 1HEYA 4WXYB 4CF6A 2NTYC 3TIXB 3K15A 5GGXA 3WO0A 3GARA 1VCIA 2VP6A 5DYGA 2WZQA 4LBVA 3WDLA 1YI2V 4BQFA 1GNLA 4P7KA 3OMXA 2YBDA 1HE8B 2GRJA 3V7YA 3DF9A 4P3PA 4RHYA 3SX4A 2QSYA 4LEIA 4B3GA 3HV2A 3F5QA 1R4MB 3U3DA 3IHTA 3NM4A 1LPMA 2B0JA 4JI0O 1RWVA 4RZSA 4H7EA 2B83A 4I9FA 2VJNA 3MB8A 3ZS8A 1H3FA 2I2FA 4O0LA 3DDNA 3ABIA 5D01A 1GDDA 1U2DC 3CF2A 1WZIA 2HA5A 2JAPA 2ZRMA 4TTPA 4EWLA 3EG5A 4OHRA 1Y4UA 3NWEA 4TTRA 4WCFA 1CTQA 2WJZB 3B82A 1QX3A 1V5GA 3EXIA 4HDOB 3OQJA 1PNRA 2H4HA 3AERA 4YUZA 4Q3BA 2X5KO 2PYJA 1TQ6A 5ESXA 2E85A 3GFVA 4UHBA 2C2AA 4WZBA 2IOFA 5CDUA 2HQOA 3F7NA 1LFAA 5ICSA 5K8TA 3Q8KA 1JR2A 4REOA 4CJXA 1U0LA 1LDEA 2Q1YA 1N5MA 2CDCA 2FX3A 4FT4A 4C7JA 3FOFC 2WW8A 4JBLA 4CCSA 4FFBB 3QVGA 1R50A 3GLFA 5C52B 2H48A 3QBTA 4Z3KA 5TQ2A 3P4XA 4DY6A 4JF3A 2CUGA 2V7PA 3HYNA 3QKIA 4OK3A 2FUNB 5AK3A 4M7PA 1B6GA 1GKIA 1MFPA 2IEBA 1HP8A 7AT1A 5KPDA 3MHSC 5M5BA 1PKXA 1A4RA 2J8ZA 3CPHA 4Q9DA 4ZAZA 3K9SA 3H2YA 3RS2A 1P7VA 4HNQA 4NZOA 1TT5A 1JHYA 4MS4B 4H6XA 4FNMA 4Z4HA 1FDVA 2OCXA 3C8MA 4BNNA 2I6GA 2P9EA 4UTZA 3AXTA 4IVRA 1E5XA 1ZKDA 3H13A 2G5CA 1PYOA 2PL9A 3NCHA 3MT7A 4RELA 4R0VA 4RD2A 3ZD7A 2JJMA 1TPYA 4OKNA 1VIAA 1GN3A 3CF6R 4UEJA 2ZIXB 4A4DA 3VKUA 3OMNB 1IUKA 3BFRA 1LUWA 2IUUA 1RAEA 4NV3A 2M6LA 4Z49A 4G4IA 1QIHA 1VF6C 4WUTA 2ZWIA 1RRKA 2RHOA 3IS3A 3GR6A 2B2NA 3HYRA 4M1MA 2Q6AA 4M83A 3R3YA 4F4DA 2AOUB 2C3UA 2ZDQA 3EXEB 1BH2A 5J4KA 3UQZA 1DDGA 3B48A 1NPDA 2DCUA 5JISA 3MA0A 5IXYA 3RBAA 3N6XA 3FVWA 5L53A 2IVZA 5EUCA 1VLQA 2HJHA 4TKUA 4UAJA 5GAJA 1FB5A 1SUWA 2ZSEA 3FI9A 3BWBA 2N1BA 5A6SB 3E5NA 1U3WA 5FXMA 3DLCA 5KI6A 2DHEA 1ULAA 4XDKA 1F8FA 2DWOA 1L2TA 4G0UA 2R11A 4O4LF 4BZZA 3F7OA 4PM4A 4ZIRA 5HKKA 3ENNA 3GFSA 3UH1A 3P9SA 2K4MA 3I30X 4B6RA 1ARZA 1M6VA 3O3MB 1RHRA 1TZ2A 4S1NA 1LV8A 1NW6A 2P5TB 3AM3A 5I7SA 4YJGA 1QOPB 4H0LB 4MQLA 3R5XA 1S4MA 1CR0A 1HDEA 4BVLA 3THRA 1GAJA 1LW6E 4IDOA 1WCV1 2K5UA 2DBYA 4YQYA 5B1AB 3CW9A 2BGIA 3OA2A 1O7JA 4G4SP 4D9NA 5HVNA 1FJXA 2CD9A 3TMYA 3P9IA 3DC7A 2ZCVA 1OI3A 2CYBA 1J0DA 3OZEA 2PO7A 1MGOA 4PYRA 1QF9A 1G6KA 1TD9A 3GH1A 3OAAA 1G7TA 3GFBA 4MTXA 3W7SA 1C29B 5H7XA 5BSGA 3I5AA 4B7XA 4PS1A 1E92A 1CK4A 1E1RA 4LOIA 4NBLA 1TYZA 2EFJA 2I71A 2VQ3A 3CN7A 1PR6A 3PI7A 5IBQA 1GADO 5B4TA 4H4EA 3VHLB 4PX3A 3R7BA 3VPXA 1CJKC 4Y2RA 3MPOA 1JIJA 4DV4B 3BWCA 2CNBA 1YR1A 4MVJF 5G3YA 5CAEB 3TTSA 3KQTA 2DFPA 2ESRA 4RADA 4YAFA 3H9VA 4R3NA 4OJTA 3OECA 3TETA 4JVLA 3FPKA 3ZHQA 1NYQA 3CS5A 4BQPA 1H5NA 4BWGA 2X8LA 4DLYA 4QPZA 4LHYA 4HRXA 1NE2A 5HG0A 4EPWA 2FEKA 3R9XA 1W581 1XROA 2ZIEA 4IIYA 5EA2A 2HK6A 3EC7A 2HU7A 5A2GA 1WOMA 3E9DA 3WI7A 4BJ5A 5K6RA 2OOSA 3Q3IA 5ALKA 1Q7EA 3ZK9A 4BGEA 2GZAA 5BRJA 5MGNA 3V8QA 3OTQA 1WNSA 3LJKA 4YJ3B 2ZATA 5BNWA 4PHTA 1T8RA 4I9WA 3RBZA 3F5MA 4CFYA 3CGWA 4BTLA 2P3LA 5F51A 4FJ1A 3I9FA 4WFJA 3AW9A 2DYSC 2XUJA 4BP8A 5HZMA 4JA2A 2PAAA 2HD4A 3CMAV 2PYDA 4PLPA 4QFDA 5T5QA 3RH0A 4CGZA 3J80N 1KQSU 4BBAA 5ALTA 4F4LA 4D6PA 1DBSA 1R4AA 5KMGA 3L8HA 4DUZB 3V7NA 4CS4A 1CRZA 1FYWA 4H0NA 1EP1B 4LF9B 3U60B 1CIPA 3KAKA 2ZB4A 2MTBA 5EWLA 4J6FA 3E3LA 3Q8WA 4QZVA 2AJDA 5D87A 3OU2A 2KB1A 4PSUA 1SU6A 5FI0B 4MVSA 1YJCA 3Q7QA 3SC3A 3UAGA 5K8IA 3CM0A 4BWAA 1D2DA 1ZN7A 1E9VA 4H35A 3S2YA 4BNLA 4CUJA 1FXKA 2WWGA 2QMOA 1FRNA 1M6YA 4UXJA 3KQSA 1QB7A 4EEKA 4CKCA 3SGIA 2QRUA 3M6LA 1K7CA 3GCZA 1QWSA 2O0JA 2VXYA 2GDZA 4ZQIA 1EK6A 5B55A 4MRRA 5BXQC 5DN6G 1YDWA 3UO3A 3SR4A 2E76B 1U3DA 2Y0EA 1ZJ5A 3AESB 4II7A 4P30A 2G6TA 2W0SA 2KWIA 3DV0B 3N2KA 4QJFB 2ODQA 3BK7A 4HSEA 4WGFA 1X1DA 4LCEA 5CAEA 1B23P 1F51A 2GBGA 2FQYA 1D9XA 5DNDA 1H2MA 3RS7A 4BEJA 4ZODA 2ZUCA 5KNBH 2F62A 3UQ8A 1T2CA 2OY0A 4W5OA 1QZXA 2HHCA 3CT6A 3ZWXA 1VQLV 3AFGA 4YC7A 1C3JA 2EJRA 2W6PA 2GD0A 1OC2A 1QR6A 3T1HO 4GVXA 2FU5C 2NZXA 1QHNA 2EBWA 1E60A 3N2ZB 5EGSA 3RUHA 1ZH2A 4IYRA 1OFHA 4S2UA 1THMA 3DFMA 4CKBB 1Y6FA 2P06A 1YJ8A 2HCBA 4B4KA 1IZ3A 2WKQA 4DWVA 2A5DA 1A5TA 1JJIA 4I14A 2QROA 5FWAA 5JXJA 1Q74A 3GJTA 1ORVA 2BH9A 3GVCA 1E3IA 3CRAA 2BZSA 1WLEA 3UYKA 3KTDA 3ZDBA 4W4KA 5GTIZ 1FVOA 5CVCA 4CF4A 2SKDA 4D80A 1HDOA 1YL7A 1LLCA 2TYSB 3AMVA 3G2PA 3PXDA 3R9KA 1HT2E 3H1AA 5JOQA 4HQKA 4AFNA 4XLTA 4IYHA 4Q34A 2WA1A 3JWIA 3EVDA 2C1XA 1DC3A 1JQ0A 3LCJA 1L7BA 3OZCA 3IQEA 4LFAB 1TTPB 2R97A 3H1TA 3FFAA 3HFRA 5MF6A 2F8TA 5C5DA 1U0NA 3MWFA 3SJAA 2W6OA 1DDOA 5CTAA 4QEKA 1FQOA 3URKA 1RRVA 2E9SA 3VZCA 5KVSA 5I9NA 2R4QA 2VDOB 4PHZA 1RM5A 2XXAA 1EWKA 1FU4A 2CFOA 4JJ6A 2OV2A 4NZZA 4Q3KA 5C3UA 3ITEA 2A9HA 3LDFA 4X3OA 1LPAB 5EZ5A 4OQNA 3ULKA 2FPKA 1E6CA 3AF6A 4KDEA 3OTFA 4X1IB 2BJHA 2OYSA 4GPD1 1L1EA 2VQEB 5DNCA 3OE7G 5JXIA 1U1EA 4Y2PA 2NP6A 2G9QA 2FX5A 1RMYA 2P6PA 2PG3A 5IUJC 4L9AA 1VCHA 2G67A 1J5XA 1YCHA 2YV2A 4OJYA 3RI3A 4BO3A 4DIEA 3T5DA 4F2HA 3BX1A 3FWKA 3IV6A 1U0EA 1WV1A 4AI8A 1NASA 4M98A 4BNJA 3FMPB 4FYKA 4MVJE 1ECLA 1VRVA 4Q1FA 1KSGA 3HKEB 1BA2A 5BUZA 4WCFB 1WHSB 2XQFA 2WUWE 3H2ZA 3ICPA 1JPNA 1GPNA 1HFWA 3DXFA 5CLLA 5K0CA 3OEEG 4ZTZB 2ATEA 3SPXA 2QTHA 4ZDKA 1V1MA 3D31A 3AH8A 1HQYE 3DHWC 2JLQA 5T3UA 2Q5CA 3LKZA 3QKWA 4JB8A 1KF0A 2FEWB 4NK4A 4P83A 4UUNA 2J5KA 3B78A 3QKSA 4GH5A 3KZOA 3I6MA 1ZI9A 1FTYA 3LCMA 2I3BA 2I2CA 3FPSA 1YE3A 5TY0A 1E99A 2QUHA 1SUSA 4EJSC 2VP3A 4K6CA 4YK7A 2GAFA 2E4ZA 2VKQA 2WAAA 3HKEA 1VPVA 3MW8A 3RVLA 1R4NA 3LOUA 2A9JA 3FDZB 4JGIA 2VA9A 4RY2A 3EB9A 2ONZA 5IHPA 1KY4A 1SUBA 1X1QA 2D59A 2DUNA 2J09A 3TRIA 4E2ZA 1QLJA 2Q6LA 3WKAA 5ISMA 2DBQA 3BMOA 1YMQA 2GFQA 5IJZA 4CCYA 5CNIA 3HVIA 4ER3A 1OJ7A 2DX7A 3D0RA 1M10A 2OQ2A 2R7MA 3FPEA 2BEUB 3R0ZA 5KTMA 1VQ1A 3RGBA 3C98A 3E3MA 1R5NA 4RPKA 4G0NA 2IODA 3IBSA 3PC4A 1K3FA 4JS0A 5JNUA 1H2SB 2R6AA 3BULA 4QYTA 1FBNA 5JARA 3ZWCA 3CRRA 5DKFA 2H5EA 4EHJA 1AI6A 1FLAA 5C51B 2H8GA 1RAFA 3WGGA 5CUQA 4MUGA 1G6Q1 5L3ZA 4M8IA 5J9FA 4DS3A 3LUJA 3KCXA 1ZGCA 2CJXA 4C4OA 4WI1A 2WLJA 2W2KA 4EM6A 1W4LA 1SF9A 1WXQA 1Z9BA 5FI1B 4OYRA 4NBWA 1SMKA 3S68A 1MW8X 1F4VA 2VDKB 3STZC 1UP7A 3VVMA 1H6AA 2WTAA 1UXGA 3K09A 4FSDA 3TSOA 1OLXB 3KXDA 4MH0R 3AIIA 5DTRA 4CKZA 2QSAA 1EDZA 2E87A 2XD9A 2POQX 1BZYA 4UNQA 3L9XA 4AWAA 2QRHA 2PKWA 3ZIUA 3MMZA 3F5DA 3FYHA 3BJZA 3DEIA 4JUIA 3RSOA 3WK4A 1VLLA 2Z2KA 3CX3A 4EG0A 4R5HA 4NP6A 3FWPA 1WAZA 2RGCA 2V5VA 2W2KB 5EXXA 1XAHA 4L16A 1Z83A 1E9DA 5F64A 1TZKA 3IAFA 2I3AA 4G36A 4KFRA 3ZEIA 3AVVA 4BKPA 1CQZA 2EATA 2V65A 3EXHA 2ETVA 1DCMA 4KXUA 4BO6A 4Z1VA 1QORA 1T9ZA 2V3VA 3IQGX 2H17A 4U2KA 4GOOD 1NA5A 1TKCA 1GM7A 3PNLA 5AW3A 3IPAA 3K5PA 3N0TA 1OWNA 5KQMA 1Q1GA 4PDMA 3GEIA 9ABPA 2DKFA 1T2NA 3DTVB 3EDCA 2WWVD 1FCJA 1XEWX 4KYTA 4F4JA 3DKRA 3E8SA 1SCUA 3GRRA 3VZQA 5JMOA 3TGLA 1YB2A 1HK7A 1O4WA 2BEKA 3TOZA 2VQSA 3M70A 1DB3A 2G09A 2HEGA 6GPBA 2PRIA 3DBHB 1WA8B 2G1UA 2Q8PA 3KU4A 3L8ZA 4LXIA 1MO3A 5FWDA 4ZI7B 1U3FA 1K9MW 3UT5A 2ZWPA 2RGAA 1NUUA 1N1MA 1PFYA 4JLVA 3SQOA 4ZDWA 4L5YA 4C89A 3ZDFA 1JFSA 1FSPA 4KZPA 3ZX5A