2QGNA

Crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
244
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGETPSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
total genus 79
structure length 244
sequence length 313
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 2qgnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qgnA01
4DLZA 2BKUA 3GCGA 1Y63A 1M74A 1Z08A 1Q21A 2B21A 4NL4H 3WYFA 4DT1B 1GDDA 4NYJR 1QBKC 2PH1A 2JDID 3AKDA 1G8YA 3KKQA 4FW9A 2D74A 2JAQA 4AC9A 2O8DB 3A8TA 2PCLA 2HCJB 5AUOB 3KZ1E 3VX4A 3W6PA 1XPOA 2O8BA 2W6IA 3EA5A 4KSBA 1NI3A 2W83A 3WNCA 4NYMR 5JS7A 1SKQA 5JHHB 1Q1EA 4B2PA 3HPRA 1FFHA 2EFCB 1SXJC 2KB0A 5JBQA 4HYYA 3K70D 3RWOA 4MYUA 2QUZA 1CJKC 4X8OA 4EPWA 1XD2A 1NKTA 1LTQA 4R9UC 1NN5A 1E4YA 2QNRA 2BMFA 2VP4A 4JLNA 2ZJ8A 4XVQA 2ZR0A 1WF3A 3AH8A 4KBFA 1GRRA 4MGIR 1QVRA 2P5SA 1MABB 2YINC 4AY2A 5EE5B 4OL0A 1AIPA 3FVQA 4MUAA 4TMVA 5C2JB 5KPDA 1P5ZB 2ZRFA 4NZYA 4M2LA 4PAMA 3TR5A 4IFEA 2ZRBA 1NBMA 4RY2A 3TLXA 4DVGA 1VHTA 3VU9B 2JJ2A 3QENA 3LVQE 4URWR 2XTZA 5CJPA 2VYFA 1E9RA 1W47A 2BKEA 4FWTA 3DO6A 2ZSBA 1US8B 3BC1A 3I92A 4LJ8A 3VHXA 4F93B 1UEJA 2WWYA 1J90A 3U60B 3B9PA 3GJ3A 3GEHA 3OEHD 3VR6A 1XTKA 4Q19A 3W6OA 1E9FA 2FOLA 5FI0B 2HJVA 3RANA 5FPKA 2NZJA 2Z6VA 3THXA 1JR3D 2CL7X 4Q9IA 3MWJA 3EIQA 4KSCA 1EX7A 2W2TA 5FTKA 4BLQA 2QRNA 3K0FA 1N5LA 2VP2A 2F1IA 4M1SA 3UG6A 5IDVA 1MV5A 4OHVA 2EVWX 3MWLA 3LVRE 3U3MA 4C0JA 3KJIA 1Z28A 1DAEA 2V6IA 3EPKA 2ZJOA 4MDFA 4CEHB 1HY3A 2RAPA 1KJYA 1KNXA 1R10A 1M8PA 5J5CA 1ZNXA 4A4DA 4PHFA 1EK0A 1D8TA 1WDTA 1G41A 1E0JA 4TTPA 3RS5A 4EAQA 2A5FA 2MSEB 2QEQA 3EIHA 1NF3A 3BH7A 5DLQC 3EZ7A 4Z1MA 3V4RA 4OI1A 2HT1A 4OQXA 3L0IB 2E87A 1S2MA 5L3QA 2NO1A 1GG2A 2BCGY 2EFEB 3JVUA 3THWA 3K9NA 1Y3AA 4ZI2A 1EFTA 3DDCA 4NCJA 2W0SA 3KXLA 3LWNA 1MOZA 3GLGA 3BFXA 4KFSA 2FSHA 1XMVA 3BGWA 4I81A 4Q7JB 3ADDA 4MGYR 2PJRA 2ATXA 3ZS8A 2ZR7A 1R5NA 1KYIA 2BJVA 2N42A 3SQWA 3AKEA 3O8DA 3I3SR 4FIDA 3BBPA 4MDEA 4L15A 1E2FA 2ZRLA 2GXQA 5TV2A 1RZ3A 2DFKB 3SHFA 2ZIAA 1WB9A 4DB4A 4WZAE 1DG3A 2VP0A 3O8RA 1DOAA 2JDIA 5B2ZA 4KLZA 1E2GA 1VIYA 4BFWA 2AL7A 1KO4A 3D3QA 3DKVA 4N1AA 1U8AA 3TW4A 1PLLA 1HE1C 4I1UA 1G9XA 4A8JC 4IOLA 1W0KD 4KCGA 4R98A 3FMOB 4LV8B 3RRZA 1YZGA 3KQUA 2ZE5A 3QKSA 4RCZA 2O8EA 4ASUD 2BOVA 4GI7A 4TLDA 4B76A 4EFLA 2G77B 5DHFA 2QI9C 3GJ5A 2Z4SA 2V4ZA 1SVOA 3C5HA 5GADl 2PEYA 5HPYB 1E1RA 3ADKA 1F2TA 1I4DD 1MR3F 1TX4B 4OHYA 3VQTA 3ETLA 2VIIA 2OO7A 2XTMA 1R0WA 3RYTC 5GJVC 4D81A 4F91B 4M53A 3X1XA 1RFLA 2RKOA 5AUPB 5HZKA 1BMFD 3K09A 1N2CE 4EJSA 1Z6TA 1ELOA 1OHHD 3A36A 3RAPR 5DHAA 3N70A 5JS8A 2XZOA 2H16A 1E2DA 2QSYA 2IT1A 4TMKA 2XB2A 5UKDA 2OXCA 4DLRA 2F1JA 1NG9A 2OAP1 1SXJB 5KDOA 2QP9X 2UVQA 4GOJA 4PHHA 3AVWA 3QBVA 4IDHA 1Z0JA 1KI6B 3B1ZA 3EZ9A 4M9ZA 4GDFA 2QY9A 1FX0B 3JZAA 3SDZA 4E5UA 1RIFA 4JMPA 3EASA 3WMEA 2HYDA 5AJYA 1M7BA 2IXFA 3NG1A 4RFSB 3UMSA 3IBGA 1D2MA 1Z6YA 1N0WA 2XNDA 2ATVA 2CCKA 1CXZA 2ZVPX 4OHXA 2BM0A 4L5BA 1J70A 5FFMA 4PZLA 1CJMA 4NYIQ 2VEDA 5E4FA 4EFNA 5LDDC 4M22A 3TQFA 1FL9A 1KO1A 1ZJ6A 4B6EA 5J47A 1Q20A 1CP2A 1Z0AA 3QIAA 5HE9A 3VFDA 4EKDA 1KK3A 2IYSA 4IKEA 2CE2X 1IBRA 3PUZA 4BZQA 1TAGA 2PL3A 2ODBA 1LF5A 1RRFA 1DAMA 1T6NA 1QDEA 4JSTA 4CT4B 2V8OA 4NU0A 4BRWA 4AI6A 3B85A 2PEZA 1UBFA 1S96A 4L9WA 4YLGA 4Q7LA 2NO7A 2P0EA 3HDTA 3AUXA 5JI3E 1AQUA 3GFTA 4PQFA 2YYZA 4ZCIA 3FPAA 3PVSA 5JLJA 3HWSA 2TMKA 4O2RA 2CMKA 2WJVA 3TAUA 1Z06A 1MKYA 1CTQA 3LX8A 3TSWA 4AD8A 5G3YA 4QNMA 2J41A 2IYTA 2JASA 5DI3A 5E7MA 4DSOA 3OAAA 1L4YA 1COWA 3LAWA 3T1QA 2ZQ5A 4A0FA 1VHLA 4TSFA 1L2TA 4CW7A 3SBDA 4Q1EA 4A9AA 2O8DA 4PQRA 1P9NA 1KZ7B 4BASA 5H70A 2CK3D 4JKIA 3T5GA 1OYWA 1H65A 2QG6A 3A58B 4UKDA 5BW8A 1D6JA 4PPFA 521PA 1QRAA 4JS0A 3GLHB 1OSNA 1E32A 1W0KA 2PLFA 5JEDA 1PUJA 4II7A 3FOZA 1BYUA 4EPTA 1G3RA 2J1LA 5JHGB 1MABA 1P75A 1KZGB 3CONA 3HYRA 4ASUA 4DDTA 3TK1A 3E2IA 3NHBA 3TSOA 3MAAC 4GP7A 3WRYC 1HQYE 2ZRKA 1LFDB 1E2QA 1M7HA 2J7KA 2OCYC 3CRRA 4UXIA 3TQCA 3VU9A 1UKZA 3M4YA 4G5SA 5HTKA 2WPDD 3CR7A 4G5GA 3QXXA 5H68A 1AGRA 2RGXA 3Q85A 2ZSFA 5IK2A 2PLRA 2GJKA 1FUKA 3LD9A 3RHFA 5C1BA 1SXJD 4B74A 3AF3A 1OHHA 2OCPA 3ZD7A 4PHGA 3CNNA 1US8A 4OK5A 2AK2A 2C99A 3QNUA 3UWKA 4B71A 1KY2A 2O0HA 5JECA 4P32A 1N0VC 4Q4HB 4FCWA 4LJ5A 5DO9A 1OXUA 2PCJA 2XZPA 1PLKA 4B3BA 4DC9A 4KU4A 2RGAA 3CNOA 1YZLA 1Z6GA 2I3BA 4TQUS 1CS4C 4TL9A 3B8HA 1FQJA 3KJGA 1W5TA 2OBLA 3SFVA 4YMSA 2OBNA 5JJLA 3KFVA 1AZTA 3JVVA 1VG8A 1DS6A 2CLDX 1E1QD 4OI2A 4LOAA 4BLTA 2YOHA 2ZU6A 2NO9A 2BV3A 4OHWA 4D82A 4EPRA 4BLOA 1ZD9A 1GL9B 3F0TA 3N5CA 3QVVA 2DFNA 1N6PA 2VHTA 4MRSA 3EC1A 1A4RA 3K70C 3U7HB 3P20A 4CEHA 4K8OA 2RH5A 3RVBA 4XVRA 3DMNA 4TN1A 3SS8A 2QMEA 2BM1A 1KO8A 1X86B 3KB1A 4FXPA 2BWJA 3A1WA 3Q72A 4QJ4A 2J7PA 1G3QA 2GILA 4I4LA 3CF0A 4OHZA 3WYGA 5E3HA 5LPNA 3H0KA 4B2IA 1YZQA 1G64A 1E9DA 4RD4A 3I1FA 2AK3A 1E2LA 3K09C 5SZKB 4JLAA 4LPSA 1G4AE 4GOXA 2VHJA 3X1ZA 4DLWA 2YV5A 2CBZA 4D4MA 2B7CA 3PUYA 3VX3A 1YZKA 2YOFA 4LJ6A 4A0GA 4PSAA 2AX4A 1TQDA 2ZJ5A 4Q03A 2BBOA 2D7CA 3AEZA 2C95A 3ZH9B 3WHKA 2ZU0C 3T61A 5EJEA 1VMAA 1GWNA 3WRXC 3F3YA 1NJGA 4PSVA 1OKKA 2GCOB 5KHOC 2FX3A 5EP1A 1FNMA 5FPYA 5HZHA 5LD2C 2JLSA 3TGPA 1J7KA 1JALA 5L8VA 1NMYA 4B3FX 4DUGD 2WWHA 1KK0A 1IJFA 2JJ1D 2PT5A 3MSXA 4TYWA 3E1SA 1JAIA 2VF8A 1R0ZA 3A1TA 3FFBA 3D6TB 2D2FA 3GLFE 1Z6AA 1NVXQ 4RKEA 2PZFA 4Q21A 5FOVA 2NPIA 2BVNA 5EE3A 3AVQA 1GZSA 1VYTA 2CK3A 2NZ8A 4ZCMA 3TVTA 4B35A 4WBSA 2VPPA 4DSNA 4M8NE 1SKYE 2BMJA 1KGDA 1DADA 1RYHA 1ZAKA 1ZW6A 3W9YA 4IDNA 1XCGB 2HCBA 3V00A 4ZDJA 2YKGA 2GTPA 2IHYA 2H18A 2J5XA 1GRNA 1N6KA 2BBTA 4CEJB 2Z83A 2VRWA 3QEOA 621PA 5JSZA 2ORWA 1R6BX 4L4UA 4NONA 4DCSA 3AP1A 1W0JD 3PEVA 1X3SA 1XDBA 2IWHA 2G1JA 2KJQA 1QHIA 3FKSD 3SN6A 5FBWB 1GKYA 4M1KA 4W5HA 4GMDA 3IPXA 1Z6XA 2ERYA 4QC2A 3KTAA 2WPDA 1GAJA 1Z0FA 3A1SA 4JYBA 2IL1A 1T9HA 4C4PA 1NMZA 3R8FA 2GHIA 1SXJA 2OLJA 1OJLA 5DE3A 1JPJA 3DL0A 1GRQA 2AKAB 2J3EA 3TNFA 3BOSA 1KI6A 1H8EA 2ZROA 2N46A 2ZVQX 3B1YA 5FTLA 3TUZC 3KQNA 1FX0A 3BB3A 1FNNA 2OAQ1 2A7QA 2Q3MA 2J59A 2OILA 1YQTA 5D3MA 4AYXA 4H1VA 4DBLC 4JLOA 5CB8A 5JFGA 2BJWA 1XBTA 4LBZA 5LB4A 2W0MA 3MWYW 4BZPA 2BHRA 4WXRA 3GFPA 3BK7A 3QXHA 3O8CA 4DSTA 4WXPA 2XB4A 4TLCA 3NH6A 5FR1A 4D25A 4WIAA 3TMKA 2QORA 4BRUA 2EWWA 4LYHA 4CF7A 2R65A 5JRZA 4R71A 3EPJA 5FL7D 4O2LA 4D2IA 3K0SA 1SVSA 4HB2A 3T5DA 1EG7A 3LW7A 2IHBA 5CYPA 2ZRJA 3ADCA 5GVRA 2ZI5A 4F4CA 3CZQA 3KXKA 4UNRA 5GVSA 4OBEA 5B64A 1DG1G 4M1MA 4EIWA 1XTQA 4LHXA 3B5JA 4AIIA 2GWHA 3CKLA 1EFRD 3LQRA 4URYR 4YMTA 1W2HA 3VNVA 1XTIA 5G40A 4LZZA 2J0SA 4PXAA 4NBSA 2FPLA 4GL2A 5CDFA 2Z5FA 3EIEA 5KYKA 2IYVA 4L9SA 4UXHA 2FA9A 2ZYWX 1G291 5EZ5A 4NCHA 4ZV4A 1FMLA 2R6DA 1Q22A 1ANKA 4JLBA 2H17A 3LLUA 1GILA 4NYJQ 2QTVB 4PC1A 1XEWY 3QJYA 1KI3A 1D9XA 4G5QA 4E09A 1NMXA 2GCPA 2QQ0A 3P26A 2H7VA 4ZIRB 4Q48A 4XD7D 4C0QC 3ZDQA 1EFCA 2CHQA 2ZRCA 1YRAA 4GT1A 4A6PA 1XF9A 3FKQA 1OB5A 1ZNZA 2ZREA 1N6OA 2DBYA 1GL7A 1ESMA 4MKHA 2XSZA 3CX7A 3GLHA 1CRPA 4JLDA 5EXXA 1E79A 1A5TA 2HLDD 4XSGA 5FH9A 4OI0A 3SQXA 3R7WA 2DR3A 2RGEA 3RDPA 4BWYA 3BIFA 4B47A 1EESA 1U94A 2BBWA 1CR0A 1XZPA 4MKFA 1AS2A 5JWOA 1DPFA 2F43A 4PZYA 1VCMA 2G9NA 3EA0A 4TL8A 3M6AA 4MH0R 1ZD1A 1NN3A 2V9PA 3GLIE 5LD2B 3PUWA 1G17A 2REBA 3QUSA 4B3XA 4JKYA 2XXAB 1RC8A 2DFTA 1W0JA 1G5PA 1Z29A 1YR7A 2JIZD 4A6XA 1D2EA 1S3SA 2GESA 4FN5A 4Q9JA 1KK2A 2Z0MA 1M1YE 2YOGA 4A92A 1YR6A 2NTYC 4LJ4A 3U44B 4A8JA 4PTLA 2FGKA 3PJRA 3DVLA 3HU3A 2FV8A 1Q0UA 2OESA 2YJTD 4B75A 4W7SA 4IXMA 3AP3A 2FNAA 3SJZA 4AG6A 3ASYA 3T1OA 3TRFA 3SZRA 2HXYA 4RJLA 3K9LA 3QY0A 3BFKA 3J81k 4D0LB 2Q6TA 2NGRA 2J0VA 2RGBA 1QHYA 1XJQA 4MUBA 5DI9A 3MUFA 1ZIOA 2ZE8A 1CRQA 2EYUA 3OEED 4LHWA 4G3XA 3KDSE 1LNZA 4R2IA 1KO7A 3U61B 4V0MA 2OFXA 3HPQA 4ZPXA 1TPZA 2GETA 3CWZA 1Q3HA 5DYIA 5DNYB 3QF7A 2VSFA 4BEBA 2GZDA 4V02A 1XPRA 3D31A 1LF0A 2DPXA 2ZI7A 2OCBA 4A2PA 4DCUA 3ZD6A 1Z83A 4OJQA 1UDWA 5KOYA 2YC2C 1XX6A 3U7FB 4RSGA 2CL0X 3IKJA 3NBYC 3U5ZB 4YONB 2QAGB 3VR5A 2KI5A 3HJNA 3LDAA 4YMWA 4P33A 1EFRA 1HH4A 3PIRA 3EXAA 3MWKA 4C9BA 1F2UA 5EP4A 3B60A 1M7GA 4P4TA 3L43A 4U7DA 2FFQA 3M0EA 4JLPA 1H8HA 3LXRA 1XJ0A 1QHGA 1Z2CA 4TZ0A 4ACAA 4IOKA 4GMXA 1G18A 4QHYA 1XTRA 4EPXA 4FINA 2AR7A 1W44A 2NO0A 3IPYA 4RKFA 2FEMA 3SJAA 4DLTA 3BH6A 4GNKA 3FHCB 1CEEA 1MO4A 1DEKA 3K1JA 1X1SA 4QBHA 3BB1A 2DY1A 4C0KA 2ZRGA 4HATA 2IK8A 4GPTA 4NCNA 4GZMA 1FTSA 4JVSB 4A0HA 4LRWA 4B2LA 1UFQA 4LGMA 4Q1AA 4I1VA 3QKRA 5F9HA 2YZ2A 4C7OB 1L4UA 3FDIA 1WRBA 4V0KA 4HLUA 3FMFA 2VP5A 3B78A 3K9GA 3W8NA 4DCTA 1W7AA 4XTCS 3O47A 1T3SA 1YRBA 4CEJA 2ZM5A 4PC7A 3BD9A 5JI2E 3I62A 5J4YA 5EQTA 4M1YA 3I5YA 4PPGA 1HEIA 2Y8EA 3OIUA 5DISB 1TF5A 3SHWA 4LX0A 3PEWA 4KXFB 1T3LA 4TZ6A 2ZYUX 2XOKD 2MSCB 4DKXA 1BH2A 4G0NA 3A4LA 2JIZA 1U99A 2CEAA 4Q1BA 2V3CC 3R8CA 2A30A 1CR4A 1NN0A 1RE0A 3BFVA 3LW8A 1XXHE 1UDXA 4F4IA 2VP9A 5H1YA 1OE0A 1W4AA 4R2HA 5FI1B 3WMGA 4Q01A 4HZIA 3IHWA 1NSTA 1VYUA 1KSJA 1FP7A 2F7SA 4AKIA 1UM8A 1XJCA 4FCVA 5CK5A 5EE1A 2AFHE 4QGHA 3QPVA 3CR8A 1GNPA 1KSGA 2PMDA 3UK6A 3AVVA 2IYQA 4CGZA 4AKHA 1U2RA 3EWAA 1OH6A 1KKLA 5BQ5A 1N6HA 5FTNA 1ZC3A 4MRNA 5FR2A 4TL7A 2ZAOA 2IF0A 1DO2A 1J99A 4PC6A 4EQ6B 4F4JA 5KSYA 1KIMA 1JAHA 2OEPA 3LBHA 1IN8A 4WZ6A 1GIAA 3RC8A 5TB5A 3OEEA 2FH5B 3PXGA 1WBDA 1EGAA 4C0BA 1ZCAA 2J0UB 3KKNA 3QE0A 2XJ4A 4ESHA 3REFA 3OIWA 4TL6A 2OFWA 4FCTA 3RSLA 4IW3B 3CH4B 4QHSA 2D7DA 1NBME 1X1RA 1ZUHA 1ONBA 1S9HA 1P6XA 1AS3A 3U7EB 3QI2A 5BN5A 4PZZA 2D06A 4V0NA 1N6NA 1Q57A 3DOFA 1ZINA 4IJMA 3TBKA 4C0LA 1W46A 3U6BA 2O5VA 4WOPA 3V9PA 1HE8B 1R2QA 1OPXA 3OFND 5CYOA 2ASEA 4Q66C 3MJHA 2J0QA 2R2AA 3RS3A 3UMRA 2WV9A 1WP9A 1U8ZA 3GJ7A 4B3CA 4F92B 3THOA 4XWOA 2QBYB 2WZQA 1CULC 2QMUA 1UBCA 4B34A 2I4IA 4LSGA 2IS2A 4J0QA 2VBCA 2QGZA 4JBWA 1XD8A 1WQ1R 4JLKA 3HU2A 4ABYA 1E2HA 4ZIRA 1RJ9A 1AN0A 3C15C 3L8ZA 4KFRA 2CVFA 2OSBA 3AVPA 4U5XA 4QBFA 5DIFA 1TEXA 2JGNA 4ZDKA 1IM2A 1NIJA 3IIJA 2W6JD 1CIPA 4NH0A 4OYHA 2ODWA 1ZP6A 3CRQA 4URUR 1U98A 1MRSA 1P9WA 1OH5A 2F3RA 1XEFA 4HDQB 1GKIA 5EXPA 1YHNA 4XWAA 3WBJA 4XH9B 2GEDA 1RRCA 1W1WA 8OHMA 1G5TA 1Q12A 3ZVNA 2EU8A 2V55B 3REGA 1X8JA 2F3TA 1R0XA 2VHQA 3B1VA 3LX5A 2A5JA 3OEHA 4NCKA 3WXMA 2ZI3A 2WJJA 4TYNA 4LCBA 4BZXA 3CRW1 1T8TA 1JR3A 2QAJA 4FMCF 2XXAA 1CLUA 4UJ5A 4B6FA 1F48A 3W5IA 1XTJA 3AVUA 3CM0A 2R8RA 3K0AB 1TF7A 4QHTA 5TXGA 4AYTA 4LC0A 3IDQA 2VL7A 1C1YA 2A5DA 1K5GA 2H5EA 3B6EA 1YZNA 4FI3C 2XOKA 4DCNA 3GLGE 1NVUQ 3HP1A 3HYTA 3IBYA 5KUTA 3BAFA 3KUCA 4Q1FA 4C30A 1OB2A 1V43A 3RRYA 2YWFA 4MRPA 3GFOA 4KODA 4Q1CA 4BUJA 2QM8A 3G5UA 1E2KA 4TTQA 2NQ2C 1T91A 2HYIC 4YXWD 3T1TA 3U3OA 2ODEA 3DEFA 3ZVLA 3AGPA 1J8MF 4AURA 3ZVRA 5H8WA 2G0TA 2CLCX 1G8HA 3RS4A 2ONKA 1U0JA 5KSOA 5M04A 1CR1A 2ZRIA 3MFYA 4LI0A 2C9CA 2GZHA 4O25A 1A2KC 4JJKA 4KV9A 3EZ2A 4Q5IA 3QF4A 1A2BA 4HLUC 4X8LA 2ZJYA 2ZITA 2GRJA 2D62A 3T35A 3ZLJA 3Q9LA 5FOUA 3ZZTA 5K8LA 3A4MA 1RRPA 3I73A 1O87A 1R8SA 3FHOA 1G16A 3CWQA 2ZYTX 4GOKA 4Q00A 4KI0A 3EPLA 4NPHA 5F98A 2DCUA 4LJYA 1S1CA 4DT1A 1MO6A 3CRVA 2QA5A 1BOFA 1VIAA 3BORA 5EZ6B 3FFAA 5B58C 1LW7A 3NKVA 1QHNA 5HCIA 3LY5A 3KQHA 1IN7A 3MLEA 4MA4A 2F9LA 3THYB 2W2VA 1DAGA 1I4LD 1OFUX 2JLRA 2QMOA 2WKPA 3L0OA 2WJYA 3Q8XB 2ECKA 4HAYA 1CU1A 1XCMA 4KVGA 3W5JA 1G8PA 3RNLA 1JB1A 2FMXA 2WWWA 2VSXA 3TW8B 5KSPA 1KKMA 1E98A 3EWSA 3WHLA 3OFNA 1IAQA 4W5JA 4DB2A 3W3ZB 1ZBDA 2QPOA 2BCJQ 1NKSA 4C0HA 2EWVA 2QTHA 1AKEA 1P72A 3A6PC 4JLJA 3KJEA 2Q9AA 2ZJAA 2XEXA 4KLNA 5FPTA 1KDPA 2E9SA 1GKUB 2FFAA 2H57A 1QHSA 2KSQA 2ZS7A 4LYJA 1XWIA 4PR0A 1BMFA 2YWHA 1D5CA 4M9QA 1CR2A 1P2UA 2ZETA 3QPWA 2CLSA 1LV7A 1JBKA 1DE0A 3EG5A 3SU8A 4TT3D 2QL6A 2ZEJA 5FBQB 1KMHB 4BECA 5G41A 3H4MA 4W5WA 5IHPA 4HB4A 2IC5A 3VR4A 1DAFA 1SVIA 4TLEA 1TTTA 2VLIA 2IYZA 3TUIC 221PA 5JJKA 5BN4A 2CHGA 3W90A 1G3MA 3BB4A 2QPAA 4HI0E 3EAQA 4S2EA 5HKKD 4PPQA 3SYKA 2D2EA 5KNCA 3CBQA 3X1WA 2REOA 4HAXA 2GXSA 5J40A 4EFMA 2CVHA 2BEJA 5K8TA 4LY6A 2BMEA 2RCNA 1P7CA 2SHKA 3VTKA 4HZUB 2FG5A 3C16C 2QM7A 4UJ3A 1OW3B 2OXRA 2GAAA 2Q21A 4P31A 3I5XA 2CJWB 1XMIA 4P4SB 5SZIA 1E99A 821PA 3CPHA 1IXZA 3GD7A 2FSIA 4MYTA 2R62A 3EPHA 5KDDA 1J8YF 4CVNA 2VHCA 1QG2A 4PHTA 1Z2AA 4PSKA 3KB2A 4IVQA 3RRMA 1T4GA 1C9KA 4K81B 3X1YA 4KJZA 3ZQJA 3D8BA 2YNMA 2YC4C 4TMZA 3SYLA 1D9ZA 4US0R 2OLKA 3AF2A 1OYYA 2JLXA 1Q1BA 4IDPA 2R9VA 4EQ6A 1QVAA 3GP8A 1N6LA 1KK1A 2FZLA 1IY2A 1NLFA 1VPLA 1XP8A 2QU8A 2ORVA 2RGNC 4E22A 1U9IC 5DN6D 1I2DA 2GXAA 2IBMA 2ORIA 5CIWA 1ZM7A 1OXTA 2P65A 3ASZA 3RC3A 2D3WA 5G53C 4AKEA 2GZAA 4LJ7A 5A4JA 1KO5A 2J0UA 3GEEA 3QXJA 1BIFA 2OZEA 3PITA 4QBIA 4DDWA 2ZS8A 4M4SA 3BE4A 3KX2A 1RRGA 1GP2A 4PO9A 3LBIA 1DELA 3SJCA 1KDRA 1F5NA 3UKDA 4B32A 3SNHA 1XD2B 1RPZA 4YMVA 1W48A 2WKQA 4A1FA 2WICA 4HLQB 3OE7D 3CLVA 1E2PA 1E9BA 3P4YA 4MRRA 1XRJA 1M2OB 5P21A 1LB1B 1L7VC 5JJIA 1AM4D 1KJZA 4TQ9A 4AWXA 1Z22A 4LV6A 3UG7A 1F6BA 1IN5A 4QJ5A 1E0AA 3NH9A 1G7RA 1ZM4A 2YVUA 4QG7A 3U2QA 2QBYA 4FMCB 3CX8A 4R7ZA 1KAOA 4KAXA 3K8YA 2R6CA 1EFHA 3RABA 3P32A 3ZIAD 3WNBA 1HYQA 1W5SA 2X2EA 4LDJA 4BFYA 3AF4A 4M9SA 4B3GA 3K0EA 3L0SA 3D7MA 4QGGA 2CCJA 2QT1A 5J4HA 2PT7A 4DHEA 1JXOA 2VTKA 1QHHB 2HV8A 1AA9A 2J9RA 3C14C 2IS4A 3AP2A 1KDTA 2EFGA 3R9XA 1B23P 2HF8A 3C8UA 2FFBA 5J4KA 4I1OA 4HLCA 3ICQB 4OKSA 1WXQA 2RHMA 4TT3A 2IYUA 3N2IA 5TVKA 4WVFA 4DCVA 2DHRA 1WA5A 4C0AC 2WSSD 5FPHA 1HT2E 4BQSA 4RFSA 1GOTA 1IN6A 4UNQA 1PLJA 4TTRA 5DH9A 4WA7A 2WM9B 2X19A 2H92A 2AHOA 1VTKA 1OFTA 1E2IA 1ZC4A 3K0AA 5TY0A 2QAGC 4MGZR 3WYAA 4N3NA 2UZ3A 1E1QA 3KJHA 1HURA 3LH5A 1NP6A 4JJZA 5KTYA 2ZRAA 4TWZA 4KFTA 4TYYA 5JWRA 3I32A 3OIYA 2XZLA 3UWOA 4CEIB 2QN6A 1LVGA 1YZTA 2GCNA 1LY1A 4Y0AA 1VKJA 2O8FB 6Q21A 4C2TA 3GJ6A 1DAHA 3W34A 5CLLA 1JNYA 4HUQB 3GMTA 3MD0A 5JCPA 4RCYA 4HSEA 2G0NA 3LO5A 1HUQA 5J4LA 2XITA 1PV4A 1U0HC 2QRZA 4HAVA 3OESA 2ONJA 2V7QD 2G6BA 1JJVA 5BN3A 4BE7B 4EPYA 2B8TA 3PFIA 5HCNA 1K8RA 2ZJZA 4QRHA 2FSGA 2HXSA 3VR2A 2WMOB 2Q3HA 4C0SA 2GF9A 2ZPTX 2WOJA 1NNEA 1FUUA 1XCPA 4JZKA 1YZUA 3LBNA 2H1LA 4LC1A 1IQPA 1IOZA 1K6MA 5JWHA 2R44A 4GSYA 3IHLA 2ZXUA 2O0JA 3QOFA 1SQ5A 5DN6A 2W6ID 4ZO4A 4V0OA 1XB2A 2GAOA 1ZM3A 5EUQB 1MO5A 5FUYA 3L0PA 5EP2A 1PVOA 5CLQA 2B7BA 1FP6A 4LJ9A 4XVUA 2OUKA 3GJ8A 1GNRA 2C03A 1N0UA 4JLMA 1ZYUA 3S1AB 3DKPA 4ITRC 1YR8A 2F1HA 4DUGA 2REXB 2FPKA 2JJ1A 3CB4A 3CIOA 4G5OA 3DMDA 4BLPA 2EFDB 3UPUA 1ZU5A 2ANBA 3THYA 2GJSA 3HU1A 4D0NA 3QKSB 5JEEA 4YDSA 1IXRC 4BLRA 2O8EB 4YQFA 1Z0DA 1E69A 5TARA 1I2MA 2CE7A 4CRWB 4DWJA 1ZNYA 1SHZA 4OK6A 3PENA 4NDZA 1KI8A 2DWOA 2I1VB 1T5IA 2AFIE 5FOSA 1G7TA 1SXJE 1P2VA 4L8GA 3B9QA 2ZE6A 4IFBA 1FQKA 4TYPA 2YHSA 3FMIA 1NY5A 2JJ2D 3ZJYA 4AK9A 5L3SB 1RW4A 2JLZA 4BFTA 4IDOA 2HDNB 3E70C 1M34E 2JLQA 4EJSB 2AKYA 1G4UR 2WKRA 2IWRA 1NY6A 3BS4A 1UADA 3EW9A 2B92A 2PJZA 3ZIAA 4DEXA 4D26A 1XPUA 2DB3A 1FW6A 4WZBE 3FKSA 1SULA 1E9CA 3LFUA 3WY9A 4AKGA 3ADBA 1JEEA 3SFZA 2LKDA 3OZXA 1S8FA 1G7CA 3CF6R 2NMVA 3BERA 2ZRPA 4KVAA 1KMHA 4Q4HA 5EE9A 5FTMA 4DZZA 2XAUA 5AUQA 3NIBA 4JVNA 4KHZA 3RS0A 4RZ2A 1ETUA 2W58A 3GJXC 4E07A 5CK4A 3RSOA 1II9A 5CM8B 3U4QB 3AV0B 1R5BA 2BIFA 2ZI6A 2JJ8A 2P6RA 2C04A 4G1UC 4MYCA 4C3ZA 3FB4A 3C7KA 2WSSA 5FBLB 2ZSEA 3AVOA 3CUEF 3TH5A 3K53A 2ZI9A 3X2SA 3K0CC 5KSZA 2VQSA 4BGDA 4BFUA 4MRVA 4JVLA 3AF0A 1S4QA 4LHYA 1BKDR 1JECA 3QXCA 4HZUA 2W00A 2CCGA 2OFOA 3P1JA 4NE2A 3SE0A 1VECA 1CJUC 721PA 1XD9A 4IOJA 1BO6A 3GQBA 2R6GA 2QENA 2G83A 5CDFE 2ZRMA 4Q9LA 4N0DA 3W6NA 1NSFA 4RD3A 4XJXA 2ZAMA 2WOOA 5FL7A 2WJGA 2ZJ2A 5CB6A 3OHMA 2JA1A 1TQ6A 3QVUA 4FMBB 3KQKA 2P5TB 2RMKA 4H9GA 2JLYA 3ECCA 1G6OA 4IOMA 4JL6A 1Q3TA 4CIDA 3N2EA 3T06B 1T3HA 3QEJA 2E1RA 3EZ6A 1S3GA 3QQ5A 3QKUA 4B73A 2KWIA 3H2YA 3Q7QA 5DI3B 3GLHE 3L8YA 3PCRB 1AQYA 3QXSA 1IJEA 2VP6A 1ZNWA 4HAWA 1KI9A 2GCOA 2HEIA 2RGGA 1OIVA 2UKDA 1MT0A 1DAKA 4OQNA 1NIPA 4PPNA 4E03A 3G82C 1EXMA 2GK7A 1SVLA 2VSOA 421PA 2YWGA 1OXSC 1E6CA 1VCIA 1ZIPA 4RD6A 2GK6A 1GL6A 1OF1A 3BWDD 4Z51A 3LLMA 1KOFA 4CDGA 4MKGA 2VH5R 1JXMA 3P4XA 2AWOA 1OH8A 3KL4A 4XD7A 2WVJA 2C98A 4ERNA 3BH0A 1E1RD 3A1UA 4TLAA 5E7IA 1S9DA 4C2UA 1TQ4A 4LJAA 5K8IA 3MGCA 1J2JA 1YE8A 1ZUIA 2PX3A 1G20E 4OJKA 3OIVA 1K5DA 1IONA 1E2NA 5JZVA 2HLDA 3GLFB 2JLVA 1HQCA 1Z3IX 5C18A 4I99A 2FF7A 4DLSA 3GEIA 4TMXA 4X8HA 4D0GA 2G3YA 4D4KA 3CRMA 3V4FA 2O0KA 1SKYB 1C4OA 1I4TD 2R6AA 3DZDA 4JVMA 4RFVA 3R9WA 1W4BA 3TR0A 3T1VA 1QHHA 1KI7A 1WBBA 4DIDA 1UKYA 3VKWA 4DDVA 5L3VA 2GA8A 4IHQA 4V0ME 2QZ4A 3U7GA 1SGWA 2P2LA 2WSMA 2XNDD 3H84A 3PEUA 4OQFA 2BDTA 3AQ4A 4PO1A 5E7JA 1YVDA 5FTJA 2W2XA 4WW0A 1T0HB 3KXIA 5CITA 1N5IA 2IYXA 1G3IA 3WP0A 2IF2A 2LKCA 4HAUA 4PANA 2OCAA 1UBGA 3T12A 1VCOA 1BS1A 2R6FA 5KNDA 4B48A 1OV4A 1R8QA 4MITA 1JPNA 3QBTA 4S35A 5CM9C 3VR3A 1TMKA 4QJ3A 1HA3A 5FL3A 4CT5A 3G0HA 3P27A 1D2NA 1JJ7A 1CF4A 4DXAA 3ND8A 3M1IA 2V6JA 4HB0A 5LB2A 3WBKA 4NHOA 3FHTA 5EP3A 3ZS9A 4AYWA 4QGAA 5FOXA 2WWGA 1XEWX 4YC7A 3TUJC 1Z63A 4CEIA 1E2MA 2QSZA 5IF9A 1TEVA 2RB4A 4DIEA 2O8FA 1CBUA 4HB3A 3DZ8A 4TMWA 1A1VA 1Z47A 3VMFA 4HUQA 1XEXB 5KDLA 4HAZA 1YKSA 1OFIA 3UATA 2B8WA 5F3WB 1UJ2A 2ZRHA 5ANRB 1WMSA 5HE8A 2GBLC 3QSYA 1R4AA 2IXGA 4M1OA 2VA8A 4LPKA 4LBYA 3MMPA 1NVVQ 2IEZA 4RVCA 1OLOA 4LWZA 4POAA 2GXUA 1KMQA 2EW1A 2JLUA 1W36B 2WWIA 2WMNB 3FWYA 2WIBA 3OAAD 5SZJA 1COWD 1YR9A 4M0LA 4TSFD 1TF2A 3NTUA 2VF7A 3OF5A 5EE0A 4A0RA 4NP6A 1EFUA 4NCIA 5AJXA 4ARZB 4Q1DA 1OIWA 4W9MC 4PAQA 1A82A 2OBMA 2CL6X 4QXAA 2MSDB 3KQLA 1XMJA 1IY0A 4D6PA 1F3OA 1UKEA 3KKOA 4Q9HA 4IXNA 4AG5A 1XNJA 4ZKEA 2QP3A 3S1AA 3SR0A 4CZ2A 4DLVA 1VDZA 4US2R 2RHDA 5FBVB 2PZGA 2GJ9A 4EDHA 5TDHA 3L82B 1JQJC 5G3ZA 4XSHA 2ZUDA 3SC3A 3NEYA 3R9IA 4F7WA 3WMFA 1UEIA 2EYQA 4TQAA 1R5OA 1E9SA 2A5YB 5JSZB 4BPBA 4ZDIA 2RGNA 1ZM2A 2UZIR 1U9IA 5L3SA 4DLYA 1U90A 1GNQA 4KBGA 2YWEA 2KBFA 3A37A 5IK2D 4XWKA 2FE4A 1MH1A 3EZFA 2GJAA 1TU3A 3PUVA 2G88A 3CPJB 4JYCA 2KE5A 2BEKA 3EX7C 1Z0KA 3KTAB 4D4JA 5F9FA 3NBXX 1AK2A 3VKHA 1VCNA 1WE2A 3VHLB 2G1KA 4DRZA 1S1MA 4N0EA 3NXSA 2IS1A 2HF9A 1PUIA 2C77A 2P6UA 2ERXA 4F38A 3KFXA 2AXPA 4BFVA 3B1WA 2V1XA 4JT2A 1XZQA 2IYRA 3NDBB 1FZQA 3U44A 1A7JA 2HT6A 3FMPB 3C4JA 5D3MB 2WAXA 3RRNA 3GLIB 2ZJBA 3LQQA 4Q7MB 4Z8YA 1LS6A 4FMDF 1RKBA 2PBRA 1E96A 3U4QA 2CNWD 4MYHA 2DYKA 5E95A 2J87A 4X8MA 2ZYVX 2XGJA 1II8B 3SJBA 3B2EA 2WIAA 3TVDA 1NVVR 2C8VA 1L8QA 2ANCA 3WP1B 4BLSA 2C9OA 3BXZA 4JL8A 4DSUA 2J7PD 2Q3FA 5KPJA 1G5RA 3CPEA 3B7GA 1ZVQA 4JT4A 4QBGB 4EUNA 3AKCA 2A5GA 1HV8A 2O8CB 2EQBA 3VNUA 2D4HA 1B0UA 1RYFA 2JEOA 2VO1A 1SVWA 3ZVMA 4PO8A 1KSFX 1UF9A 4XTRA 5SZHB 5DYGA 1E0KA 4ESVA 4QM6A 1CKEA 1HT1E 1P4SA 2Q0HA 3NC1C 4Q4JB 1GSIA 4QL3A 5AR1A 5EUMA 5C4GB 1DBSA 2QGNA 5B57C 1UBEA 2OHFA 2F55A 2OM2A 4LYFA 1X6VA 1V5WA 2IUSA 4A15A 2PMKA 3QG5A 4KO8A 2IUUA 1Z5ZA 5AUNB 1W36D 3SYNA 1UPTA 3C5CA 3RS7A 1OKKD 2C2HA 1IHUA 1GITA 4Q02A 2QAGA 1FOEB 3MG9A 2VHUA 1N3BA 3H1TA 3LV8A 4QKQA 4YDHB 4Q4AB 2GEVA 4RZXA 4UNSA 4B44A 3DM5A 4PC3A 2GF0A 4GRAA 1G8GA 1JQLB 1YJ5A 4WAUA 1P62B 2Q9BA 2Z4RA 3F5FA 5L3RA 4KFUA 3CF2A 4UXJA 2P3SA 2GVDC 3B82A 2OV2A 2IEYA 2QP4A 4P3YA 1JR3E 2X1VA 2XNSA 2V1UA 2ZUBA 3VKGA 3GPLA 3PV0A 2GNOA 4OK3A 2QE7D 2WWXA 3Q7PA 1OXXK 3U3RA 3R7WB 4G01B 4QOSA 3FE2A 3GJ4A 1UKVY 5FUWA 4C7OA 5DSZA 4JSYA 2W6JA 5D3QA 1SVKA 2JCSA 2F43B 1EX6A 1NG1A 3PEYA 1E2JA 3KUDA 4LYAA 3AVTA 2PZEA 3GLFA 1NLYA 4NMMA 3AUYA 1GTVA 1XU4A 1P2TA 3AVYA 3Q3JB 3O8BA 4NYIR 4JBXA 1Q1QA 2NG1A 1DTSA 2IYYA 4XOIA 1P9RA 4B33A 4JLVA 1H8ED 4BFXA 4A8JB 2H8KA 4IVRA 2ZE7A 5A0FA 1OIXA 2ZSAA 3DPUA 1GM5A 1O3YA 1JEDA 2QMHA 2IS6A 5AJVB 5KO2A 3ZZ0A 4U02A 3QKTA 2X77A 1JR6A 1QG4A 2BC9A 4U00A 4Q47A 3SBEA 3B1XA 1X8KA 4OI4A 3HR7A 3JZMA 2EFHB 3QPUA 1DARA 3ZYCA 3BRWD 1PZNA 4KYIB 2A78A 3CNLA 1SVMA 3VAAA 2GJ8A 4BFSA 5DGXA 3UXMA 2CNWA 4YXWA 1W2GA 4DLXA 3DHWC 2DWQA 4GP6A 2WTUA 1ZU4A 4DJTA 1E3MA 1XXHB 4Z54A 1ZMXA 1NJFA 2NO6A 1IXSB 1AKYA 2K5UA 2QT0A 4LBWA 4QM7A 2XTNA 2DWPA 4CYMA 4Q9KA 5TMPA 4PFSA 3I8SA 4EJSC 1E9EA 2L0XA 2GEUA 5EXSA 1KSHA 1XEXA 4TYQA 3ZZUA 1ODFA 4I1SA 2O8BB 3PG5A 1T8UA 2IX3A 3I61A 3WNDA 2LWIA 5K8UA 3QG1A 4O0MA 2F9MA 3CW2A 1KY3A 3UMFA 2DFLA 4IEIA 2B6HA 1GUAA 1VG1A 2WBLC 2A9KA 3IUYA 3U3JA 3T15A 3K0CA 1F2UB 3NBZC 3NC0C 4K46A 4RD0A 5FUXA 3H86A 2WWFA 4MGKR 3LA6A 3IIKA 5FUVA 4PC2A 3W8RA 2FDCA 3AM1A 2C96A 1ZCBA 5KU1A 2J46A 2XX3A 4P0TA 4ARZA 1PJRA 2CDNA 2NOAA 5JMTA 1N5KA 1TL7C 5JCZA 3MCAA 3IEVA 1KJWA 1SHKA 2F6RA 3A4NA 3IO5A 2X8AA 2X2FA 4ZCLA 3DOEA 2FJUA 1G1MA 1QHXA 2XJ9A 4ZI3A 2Z43A 4IVPA 2XSZD 4ACBA 2C5LA 5BYJA 4HUTA 3QKRB 1E79D 2ZTSA 5A5GA 3NHAA 4BEJA 2FPMA 1P60A 4IRUB 1VG9B 2C9YA 4Q7KA 4FWIB 4TMTA 3AGQA 4LHVA 1Z0IA 5FPSA 2F1RA 2QE7A 2HJGA 2FWRA 2QPTA 3Q5DA 3THXB 2ODNA 4FMDB 4QNRA 1G19A 1R7RA 4OQLA 2I1QA 2IXEA 2FGJA 2IW3A 3A1VA 5F2EA 3Q5EA 1ZD8A 3TIFA 4Z8XA 3TSZA 1HTWA 3IILA 1KI4A 1Q1ZA 1T5LA 1Z07A 3K0FB 3ONWA 5AJZA 3FTQA 1N6RA 4PAOA 4URXR 4URZR 4M9XA 5GJWC 4XIGS 4LHZA 1QZXA 5AWFC 4HLDA 3U3KA 1DO0A 4NKRA 4KYUA 3FGNA 5HKKA 1FMJA 1S0UA 1KI1A 2AXNA 1TU4A 3LXXA 3RWMB 1TUIA 4ZKDA 4YMUA 3HR8A 3NWJA 3C41J 5B30A 5ELXA 4UNPA 5AJWA 2P6NA 3ZGXA 1P73A 5AK0A 2ZSDA 4HDCA 5GJCA 3GLIA 4LK2A 5L3QB 4MQBA 4UNNA 3GJ0A 4MKIA 1U8YA 4LUCA 1JI0A 3LNCA 2AN9A 2QROA 2QTFA 3THWB 1VYVA 3DM9B 1II8A 2RGCA 4KITB 2OG2A 1N6IA 3CO5A 4Q4LA 5BXQC 3GLGB 5GJBA 3ICEA 4GBMA 4LV5B 1E2EA 1KHTA 2OE2A 1KNQA 5CJ2A 2O8CA 5LBIA 1P61B 1ZUNB 2N1BA 3B13B 4V03A 1VG0B 2JATA 4LBVA 2BBSA 2IYWA 1UAAA 3TKLA 4O3MA 2WJHA 3IGFA 3IO3A 2AWNA 3PR1A 3BJIC 2J45A 1W49A 5BWMA 2AD1A 3PUXA 2MMCA 1AJEA 4Q18A 2HUPA 5BYKA 1OFHA 1MRNA 4Q4JA 3SEAA 2IA5A 4GFDA 4JL5A 3UANA 5JRJA 3IQXA 2FU5C 3AKYA 1G6HA 1QF9A 1OXVA 3I72A 4JBYA 1E9AA 3AF1A 2ZI4A 4ZDWA 4M1WA 4URVR 1FPMA 4US1R 2WHXA 1GFIA 5CIQA 1IY1A 1TQ2A 3K70B 1ZM9A 1H8HD 2O52A 1DVRA 2FEOA 2FZ4A 3RS2A 5J4VA 4A36A 4ON9A 3TAHA 3CH5A 3OE7A 4Q4AA 1TADA 1X8LA 4A82A 1E94E 4P4UA 1EWRA 1NBMD 2KBEA 1F2TB 2CHVA 2C78A 3NDPA 1WCV1 3R20A 4DEYA 5IRCD 1RVDA 121PA 4B43A 3ND9A 1XMSA 4IEEA 3IQWA 3KKPA 1U0LA 1P2SA 3F8TA 1RJ9B 1M6NA 1NRJB 4PX9A 1Z8FA 5IT5A 2QQEA 4NYMQ 3IIMA 1U81A 2LCFA 1T0JB 2FFHA 1EWQA 1CJTC 1P3JA 1LS1A 3K9HA 1KAGA 2GDJA 3UIEA 2GBLA 1MO3A 4L16A 3E5HA 4EPVA 3AVXA 1ESNA 2JLWA 1XTSA 3X1DA 3FYHA 2IYLD 1AGPA 1DAIA 1G7SA 1AS0A 3EC2A 4BFZA 1ZRHA 2NIPA 5FOWA 1G21E 1G8FA 4JIMA 3MRSA 3TJZA 1II0A 4QGFA 3EARA 1F60A 4NTZA 4RD1A 2A2ZA 2GKSA 3NEJA 2WAYA 5FOTA 3IEUA 1R0YA 3LRPA 4OQMA 5C46F 3MJRA 5KNBA 3T34A 4GZLA 2FSFA 3SI7A 4D80A 4G5RA 2V54A 4B3DA 4A2QA 1IN4A 2WJIA 2A3RA 1XFAA 4IDQA 4TLBA 1YU9A 1OT3A 2GVZC 5EXTA 4D4LA 1GVNB 1W36C 1TUEA 3NVAA 2ZANA 1E0SA 1W4RA 4PQYA 3L2OB 1N5JA 3W3AA 3I4LA 2Q9CA 1NL3A 4RZUA 2RGDA 2P67A 2MMGA 3TE6A 5C4MA 1NVWQ 4M21A 4Z1MD 2CXXA 5HR5A 3AB3A 3VR1A 4DLUA 1N25A 4QFMA 2CJWA 4FD2A 1CJVC 4P4SA 3I8XA 3CZPA 4UQOA 1E4VA 2ZUCA 1NN1A 1TNDA 2ZS9A 4HEJA 2BMDA 1OH7A 2FN4A 3NBFA 1BYIA 1AZSC 4RD2A 1G3UA 4V0LA 3CX6A 4Y0VA 2IUTA 2AD5A 4H1UA 3ZQ6A 3PQCA 1KDOA 2NPFA 2PX0A 1W4CA 3QF4B 3SOPA 4HDOB 4A2WA 1KI2A 2ZRNA 1KTVA 1Q44A 2OT3B 1SZPA 5FBRB 2ZR9A 3U6KA 2V7QA 1FTNA 1XXHA 1NLZA 2ZRDA 4RZ3A 3KKMA 3RLFA 4ILEA 4M1TA 4DDUA
chains in the Genus database with same CATH superfamily
4UEOA 1QOQB 3UJ3X 4NYJR 3FYTA 1TB4A 2GR9A 3OZGA 4YLEA 4YPOA 2RKBA 1H2BA 2VLBA 2WHRA 1FY2A 3RUEA 4OAQA 3I5DA 2VP4A 1UBJS 1DLJA 1GRRA 4G0OA 1L9KA 1K7DA 2BEVA 2B5UA 3F2VA 3E86A 3WK9A 4HXYA 2FWNA 3VU9B 1GCAA 1W47A 4WECA 3A9RA 4FWTA 4Q9AA 3B40A 1UEJA 2HPVA 1J90A 3U60B 3F3MA 1PGQA 3VR6A 1XTKA 4OQZA 5E9JA 2H4YA 5E3IA 4W4TA 3IR5A 2H1WA 2IJJA 3PTZA 3U11A 2CFTA 1JHPA 4JGGA 1NONA 1Z28A 2V6IA 3VNSA 3GVMA 2YVQA 3ETCA 1DIOB 2JVKA 2ECFA 3EDRA 3ZGOA 1FFDA 4LXXA 2OQVA 5FB3A 2EFEB 2GEBA 2SCUA 4J0GA 4NJMA 1QBGA 1A72A 1Q7EA 3KZIZ 2N42A 2B4QA 4FIDA 3I3SR 4DIMA 1I30A 3WV5A 3BMNA 1OT5A 3F96A 1LUAA 3JYOA 2VP0A 1PE0A 5L51A 1MW9X 3JQBA 1KO4A 3DKVA 4B8ZA 1U8AA 3G3EA 4ZQGA 3RIEA 4W7HA 5GM2A 3GJ5A 3AUKA 4O2BB 1I4DD 1DCKA 2CSUA 2UYQA 2C5SA 4PLFA 3OE4A 4XRRA 5ELLA 2HAEA 3R5SA 3RVDA 3R9XB 4OAOA 4P38A 4BP3A 3QBVA 1C3LA 1RIFA 4JMPA 1F4NA 4RFSB 1T5BA 4KGVA 3AR8A 4EABA 5H16A 4EMBA 4UOQA 5FFMA 3DMRA 4NYIQ 5ALFA 2A5LA 5LDDC 1KO1A 2XYPA 5EZSA 4XX0B 3FZNA 1IPFA 4DR1B 4W6QA 2PL3A 3K0HA 1NF2A 2VBGA 1M6VA 3FZGA 3R3JA 3JASA 1TO2E 3HDTA 1H2KA 4MULA 3FPAA 1B3QA 1A9SA 2OBFA 1JMKC 3K9FC 2SBTA 3DVAB 5E7MA 5A3JA 1VHLA 3P9RA 2E4VA 1VL1A 5H70A 2Q5EA 1ZDMA 1OCRB 4KE9A 5LBTA 2IODA 4XLTA 1D6JA 4IJ5A 5KA6A 3F5TA 5A5FA 4K86A 3VNQA 4GPZA 4PWZA 3TK1A 3DQPA 4Y2HA 4MLPA 1UDRA 3TQCA 4CDRA 1BE8A 3SIWA 3DO8A 1XZJA 3UUWA 3OWXA 2ILMA 2C99A 1MQ9A 3LGXA 5A4AA 2PCJA 1PLKA 4ABTA 5FHRA 3B8HA 4D9EA 1OYOA 4NQZA 4B84A 4LOAA 4OHWA 4BLOA 4MRSA 3K70C 3IOEA 2QN7A 4K8OA 1T0UA 4CQMD 3KWMA 5ALWA 3JWIA 2FPXA 2BGJA 3JQAA 3K5LA 3SR3A 4XKJA 3SPGA 3VR2D 2G4LA 2YOFA 2QE6A 1Y66A 1TQDA 2ZJ5A 1YUMA 1PS0A 3DOCA 5CJJA 4PX2A 5FPRA 5JCXA 4IP0A 4JODA 2FPGA 3M4XA 4EB8A 1LX6A 2D1TA 1NMYA 4DUGD 5BSHA 3FFBA 1R0ZA 5IDWA 2ZQMA 1LJ8A 4BTVA 1ECFA 4Q21A 5DGHA 1O0SA 2VJDA 1GZSA 4KGXA 3WWOA 1QFJA 3I09A 2BZGA 5IYZF 1ZAKA 5BMVF 2ORWA 3AP1A 2D1FA 5LU8A 3UJ6A 4BQNA 2H11A 1NATA 4XPZA 2PYZA 4XR4A 3KELA 1ZMTA 3RT1A 3MAJA 1QVVA 1YQEA 4B4WA 1QMPA 2VZ8A 1HI9A 1NBHA 4U63A 2J59A 7ADHA 4H1VA 5JSHA 5LOVF 5IY5C 1FXKB 3ZV3A 5HYVA 3I01A 4KJXA 2EWWA 2EG9A 1HZZC 1J56A 5CBHA 5FL7D 1WB5A 4NCXA 4Q9DA 4BVJA 5JZBA 3K0SA 2ADQB 1I5OA 4F3YA 1NU8A 1ICIA 4QXQA 1NYRA 4ZVPA 5GVSA 4YAUA 3N3AC 5T3UA 2GWHA 1EVLA 3VNVA 1P9OA 3T7EA 1HSZA 2GRAA 5THXA 3UK2A 4L9SA 3E9DA 4I5EA 3ADOA 3NR2A 3FFTA 2QKSA 3DAOA 4U9IS 3WZMA 1DINA 3VPFA 1I1OA 1REQA 1XF9A 3JRWA 3OT1A 4JLDA 3A2NA 2Z3YA 1YOVA 2XYVA 4I9QA 1XZPA 2P91A 1DPFA 1G8MA 2Z56A 3FD8A 4JYMA 1ONOA 1NN3A 1XZLA 3EBOA 3RQSA 1VB3A 1YR7A 4LF6B 1TCUA 4ME6A 1M1YE 2YOGA 2A0XA 4OU4A 1JDVA 4YRZA 2YJTD 2YWCA 1A2OA 3AFNA 1KVQA 1VLZA 5IH7A 3SZRA 3HJAA 4B6PA 1QQAA 1HR0O 1EUZA 3L6EA 2WDPA 1OUMA 1VB5A 1ECLA 1QHYA 2XZDA 4LWQA 5DLYA 4J1TC 9ATCA 2XUFA 3T95A 5ADHA 1VKHA 4GLBA 3B1FA 3FPSA 1SOWA 3HZHA 1RMTA 1CUIA 4BV9A 1TCAA 1K8QA 4MMZB 4FDVA 3T3GA 3OY7A 1BXRA 2QM0A 2AR7A 4LH7A 3GRCA 1P1CA 2AJ8A 1Q0TA 4GX1A 4L5YA 2XUMA 4LF8O 5BORA 4BV2A 1UFQA 5EN4A 4KPYA 4BVKA 4ZYZA 4GR5A 3K9GA 4BP9A 1F38A 4MV1A 1XK7A 4F6EA 3I62A 3X0DA 3L41A 5CH3A 4J6FA 2X15A 1T3LA 1FLNA 1VF6C 1GGMA 1U1DA 3A14A 3ORYA 3N0RA 1FP7A 2YHIB 1UMDB 1XJCA 3JQ9C 4EGAA 3UHPA 3H0CA 2X6BA 4MWBA 5I51A 1OBFO 5DYNA 2OEPA 4RKRA 1GIAA 3RC8A 2HR3A 5TB5A 3TQOA 5IARA 1IBMB 3OX3A 3TI7A 3REFA 1J2EA 2HUNA 4EEKA 2X5JO 3P9YA 2IDMA 2A0WA 5FA5A 4PZZA 3MXTA 2AZ0A 4LW8A 1B8PA 1BHBA 1R2QA 3NM5A 2YXPX 3GV0A 1TI7A 2XCUA 2UVPB 2W11A 2FQ1A 3TEJA 4W5OA 2IGTA 1KARA 1DXOA 2VBCA 1AA6A 1AN0A 1YR1A 3RW9A 3HUEA 4QBFA 3ILYA 2OGWA 5JH7A 1CY0A 4BBAA 5JCJA 1G5TA 2QMQA 1NKDA 4H6VA 2ZI3A 1W2BU 3U7QA 3K58A 2QAJA 3ACDA 4R7CA 3K0AB 4WESB 1F8FA 1T3ZA 4U1RA 3C7TA 4TX1A 3H1JH 1DT5A 2IEBA 1XDGA 2YRFA 1NVUQ 4C30A 4ZA2A 4BUJA 3HCCA 3L8GA 4M99A 4RPIA 3ZVLA 1YJXA 2EX4A 4HVAA 3ZXXA 1U0JA 2ZRIA 3X2QB 2GRJA 4FSDA 1WIWA 3WXBA 4JUIA 1P4RA 3U39A 3EPLA 4D5EA 3KYCB 4LJYA 2OYRA 5J2TB 2JK0A 3M5CA 4OY3A 3CRVA 1OX4B 4RLHA 3RVRA 1RPTA 5AH0A 3KQHA 1IN7A 1DUVG 1B7GO 2C3YA 1NTRA 1ZJZA 3SQLA 2WWWA 4Z3DA 5LKAA 2WWRA 4TYMA 4V0SA 4HTFB 4AZTA 1KZ9A 1EI9A 2XWPA 3DKRA 4BNUA 4EBFA 4WXEA 2EOAA 2C20A 2NSDA 1RM1C 1EBBA 4BVAA 2I78A 3EAQA 4TTIA 4FTWA 4I3GA 5J40A 2HCRA 5G1NA 2BEJA 4DMCA 1UINA 3NT2A 4UJ3A 4MYSA 2EKDA 3C3BA 1ONNA 5ERYA 1C0LA 4CVNA 3O1IC 4C7VA 2RMKB 4I8XA 2JFVA 2WLLA 4PS1A 3ZQJA 3D8BA 2D3OW 5IZ4A 1MSWD 2EZ8A 3B4SA 2LIPA 4ZGGA 1VPLA 4R2KA 1I2DA 4EHFA 3ABMB 1KECA 1BJKA 3OMIB 3WO1A 4DKJA 2QN2A 5KWVA 1Q0QA 2WICA 3OA2A 3J7TA 1H5UA 3K8OE 3PSAA 1ZX1A 2JHGA 1IVNA 2GLXA 3FDZA 2QM4A 4LV6A 1RM5A 1YUBA 3RABA 4CQLA 5DYWA 2HJWA 4LECA 3RYCA 1DLIA 5C8YA 4J2HA 3AEXA 4TT3G 3OFSA 3UWSA 1FZTA 5GTHZ 1QCCA 4NCAA 4TT3A 4EW2A 2IYUA 3LDDA 1B8OA 4C0AC 1D2AA 3N8KA 5FPHA 4QECA 1X7ZB 1E1QG 2H92A 1DBPA 3GVCA 1RWNA 1ZEMA 1IYZA 2FX5A 2QHXA 1E1QA 1PDOA 1HURA 1E8DA 2XW6A 4LNAA 4EI9A 5CFPA 4UBJA 3OT4A 4XLZA 4MEJA 1LVGA 2GCNA 4Y0AA 1JNYA 3FB5C 4HUQB 3FCXA 3HNPA 1XEQA 2FPUA 4B4KA 3EB9A 3ZWAA 1U1CA 5K1XA 2RH9B 2G6BA 4G0VA 4EB6A 4IV8A 5AOBA 2FSGA 2WOJA 1IOZA 4V1CA 4ALKA 2YX1A 4K9PA 2ODTX 2LCQA 2O7RA 2B7BA 4LJ9A 3VYSB 4XVUA 1JQDA 1GNRA 4EKEA 3LYLA 1DAPA 3PQ2A 2AG8A 2F1HA 4DWWA 2OK8A 5AW2A 2IIVA 1KH2A 2HJRA 4Z4CA 6NULA 4PF1A 2DWOA 3OKCA 4BB9A 2EIKC 2LBPA 3L6CA 4DJJA 4YAKA 1RLIA 5A6SA 4HYOA 2V7GA 3D4BA 3LXUX 4D7TA 1QLEB 1N57A 2PJZA 4DEXA 2FFRA 1SMKA 1K68A 5FTMA 1KMHA 4DZZA 3EISA 3RS0A 3LT4A 1U5BA 4ARVA 3UF0A 4C76A 3F9RA 2ZI6A 4G1UC 4XVCA 4FJ1A 3ZXSA 3CUEF 5D1NA 4WI1A 2OXTA 4KMOA 4MRVA 3ILSA 1S4QA 1A27A 3T6KA 4RH0A 3LUAA 3L1KA 3GP5A 1JJFA 1FYVA 2F90A 3FSRA 2YUAA 1SZDA 5CEFA 1QU3A 4WOBA 1ZJ4A 3L1UA 3W6NA 1GNVA 4KK4A 2BI4A 2DJIA 3DHVA 3ZW7A 3OX2A 4EY3A 3ECCA 1EFRG 5C3MA 1QIHA 1J07A 2ZB3A 5ADUS 2GBFA 1SHJA 1DQNA 3PRKE 5JJCA 5BR8O 4RQEA 2WF6A 1CVRA 4KN9S 1QX4A 1NIPA 1NRXA 3G82C 4R2WA 2X0JA 2VSOA 5ECGC 1ZIPA 5KWIA 4FHFA 2MOKA 4LZOA 2G1AA 1JXMA 1OH8A 2AWOA 2VAPA 4ZO8A 2ZPAA 3NBKA 2H2IA 1QIEA 3PD7A 1HQCA 1UODA 3PC2A 4N47A 2PSEA 1HX7A 4X8HA 1NH2B 3L8HA 4BO7A 4CCAA 3CMEV 1W4ZA 1JYFA 1UIRA 5CT8A 3G02A 5FYQA 4Z0PA 1RD4A 5HKOA 1EHIA 1GZHB 3ND8A 5JPCA 1N8RW 4BAZA 3FAVB 4TMWA 4H44B 4EYEA 3E9YA 4LGVA 3S29A 1P33A 3UATA 4OB8A 5A3QA 1PTJA 2P79A 4OA5A 4ZVMA 1HDJA 1D2RA 5HF8A 1HDCA 1FRFS 1OLOA 2JHCA 4MVCA 2WD8A 2ZB8A 1XK6A 1R0CA 4FLXA 1NZJA 3QX3A 4HEA6 4Q1DA 4BNZA 5KU7A 3IXMA 4JI8O 4MI6A 4BKMA 4IUBS 1L7PA 1ZBQA 2ZDHA 3IP6A 2ZZMA 1VL6A 3MDSA 3SFTA 3LX4A 1K0UA 1FLDA 4U2CA 3LLVA 3HCEA 2NXCA 3HM2A 2F17A 3REQA 1L5HB 5F9FA 1VCNA 2YXYA 1IHDA 1QGDA 4JOQA 2FQXA 1T4BA 2IS1A 4QOIA 2C77A 3KQMA 3I05A 2FWBA 4F38A 4UB8Z 1SU6A 1XLWA 2JW5A 4TVKA 1S7CA 3UAWA 3NS7A 2ZYVX 5E6SB 4NZOA 4JL8A 3KDPA 2ICAA 1ZVQA 3PNSA 5L3GA 3DOHA 4O4LF 2JFWA 4IJUA 1JFVA 3AESA 5K0SA 3TD2A 2Q6IA 3W7SA 4YT4A 4QL3A 2O2CA 4PZEA 3MOSA 3USES 5DDIP 1OTHA 3C5CA 3B8NA 1DQRA 1Z37A 3FWNA 4Q02A 3NGMA 3EXEA 5L7TA 2O6LA 2YV2A 4U3FH 1J97A 2GF0A 1KBHA 2Q9BA 3RRJA 3HSSA 3I12A 2X6QA 3B3QA 2Q4TA 1EH5A 2HI0A 1QO0A 4QOSA 5DM70 1QE5A 1KXZA 3C74A 5ALKA 3B09A 4JSYA 1QRRA 3PEYA 1NNSA 3LC0A 4DBVO 1A8QA 3K5MA 1WKBA 1XU4A 3RYFA 3QTCA 5BSWA 1O5TA 2WP0A 4JGIA 4EKNB 1LBSA 3AG4C 4NHEA 1DARA 5JU6A 4FM0A 1UC9A 1S2LA 3G1UA 2BTQA 3BICA 3DHWC 3JQGB 3HRHA 4CMHA 1MLDA 4N82A 1QNLA 1L5VA 2QKCA 4NESA 3BCUA 1ENPA 1MUUA 1E6WA 4ARUA 4DILA 3CW2A 1GQRA 4DDMA 1VG1A 1UPUA 3W5UA 3T15A 1SCIA 5HSGA 4M36A 3TDMA 1ZWIC 4BGUA 3PQFA 3DSQA 2PBFA 4P0TA 4XQEA 3MCAA 1XCLA 2DULA 1ZLXA 1SH7A 4LHSA 5LVAA 2XSZD 5BYJA 1SCKA 4CODB 4Q37A 4BMCA 1GZ5A 4F6CA 1EXNA 1Z0IA 1Y98A 1UC5B 1MA1A 1EUCB 1ZD8A 1CERA 3K0FB 4KPEC 3AK4A 3TJMA 2EZPA 3CLSD 5AWFC 4YT5A 1EUYA 5CB0A 2AUMA 1VJDA 2QLFA 4X54A 5ALSA 2Y77A 3MT7A 1VI6A 5GJCA 3QE3A 4U39A 4X90A 5BXQC 5IBQA 2XXBA 3I6MA 2O8CA 3DC2A 1QVFU 1DV1A 1EZZA 1T34A 3PR1A 1YV9A 3S7ZA 2BZ0A 2ZR8A 3C8ZA 2A3QA 4EGSA 3IV9A 2IY8A 5E2AA 3LPNA 4YLYA 3VH3A 4BAUA 1DKLA 5I8WA 4R7TA 1XAIA 4US1R 2KX7A 1NXOA 2C82A 4J3FA 2QA4V 1DVRA 3CCQV 3AY6A 5JDIA 2CHVA 4B43A 1OCCB 1M6NA 4HS9A 1GN4A 2GDJA 3G7UA 1ESNA 4HT3B 3D2BA 2Q6KA 2DM6A 2PGIA 2WAYA 2R751 4FKZA 1ZH0A 1R6VA 3WLEA 4MA5A 4IDQA 1W4RA 4IMPA 2XAQA 2DYRC 2Z0AA 3A06A 2P30A 4JT8A 3WWEA 4OVKA 3OMXA 2JGUA 1E4VA 1RWKA 2ZS9A 3W7BA 4ZALA 4BDTA 3OU6A 5DF1A 3QJGA 4OHOA 5BYAA 5F2VO 4FGUA 1LDBA 1KI2A 4RHTA 4Z4HA 1VJ5A 4N6NA 3NEPX 4NY1A 1NLZA 1V1MA 3K94A 3ZQUA 4UM9B 3D6FA 2AN3A 2AFHA 2JAQA 4FYKA 1YB2A 5JHHB 4HYYA 4HMOA 4MMYB 2AI2A 2R8EA 2BMVA 3N07A 4PLTA 2XMBA 3U40A 2G07A 4EECA 2ZRFA 4JB2A 3U3XA 3GUHA 4HN9A 1JX9A 1JHVA 4URWR 2GPJA 2Z6QA 2ATIA 2VYFA 3TLGB 4E14A 2JAHA 1Y4MA 1B2RA 4HNGA 3VHXA 4B0PA 3QX7A 4F5YA 1V6SA 3VZRA 3W6OA 3I2IA 5DKFA 5FPKA 3THXA 1V95A 4Q9IA 4TLLB 5TPWB 4K6FA 2NVBA 2W98A 3N05A 1E5QA 2F1IA 3UG6A 2PLAA 2N1MA 5JJEB 1R10A 1TZCA 2EV9A 5BZBA 3AR3A 2GUGA 4NXNO 2WIGA 2FY8A 2CJFA 2FPWA 1FMTA 4IYJA 2CB0A 1LI5A 3H8WA 3B3JA 2YMQA 3DDCA 3KXLA 2ZTLA 4GUDA 4WZZA 2Q1UA 1XHXA 3PWKA 2JLBA 5ABPA 4FKBA 1RS0A 2GZMA 2F3SA 2A9PA 2QRPA 2G9QA 2GXQA 3QE4A 2DFKB 4N01A 2ZIXB 5IJXA 4OJYA 4IKOA 3USCS 2WF9A 2BJHA 5DBEX 1JOYA 3IX7A 1ACMA 4XGRA 1V3UA 2ZYIA 3KVYA 2IVFA 4F1WA 2A6PA 2DRIA 2Z4SA 3FMGA 4DYVA 2UXBB 4WX2B 3LKZA 4M53A 4JYPA 1QVZA 3WNQA 4HX9A 3I9KA 1JIUA 4PZPA 2C57A 1GPKA 1BAPA 1WCXA 4FFMA 4JZ2A 2QY9A 3EASA 2YCLA 5KHLB 4FEYA 3WMEA 5AJYA 1M7BA 3NHZA 3A11A 3CSXA 1ETHA 4XASA 3OUFA 4CKXA 2UXDO 2FP4A 4ZXPA 3CXCU 4N3GA 3TQFA 2W2LA 1RAIA 3AHFA 3PIIA 4KXNA 4ZAYA 1L4LA 2E75B 5TQJA 4ZEVA 2H54A 2AQ8A 2YNMD 2V8OA 1EFPB 4BRWA 5H59A 1P44A 5FLEX 2XTJA 2EIJC 4OXRA 4BVEA 4KQFA 2XKBA 4IMRA 2Z98A 1IZ0A 4PQFA 3MJVA 1ARZA 1COWG 1JG1A 1COWA 4A9AA 4BFCA 3P0HA 4BASA 3PLNA 2ID9A 4G5HA 1JG2A 4QNHB 1M5RA 3UMJA 4PHCA 5BW8A 3SXPA 2BHLA 3RYIB 1MABG 2QUAA 3BAAA 2YQ5A 2FRDA 1TJ4A 5FEUA 3KJZA 1PUJA 5E1AC 1BYUA 5JHGB 1MABA 3ES9A 3D59A 3QO5A 1XLUA 4TQFA 2V9CA 3WRYC 4HGPA 1V35A 2OCYC 3OOJA 3H5RA 2RGXA 2R00A 4KQGA 3CNNA 3RCBA 3NEAA 1CDEA 4Q3OA 1XRMA 2RBEA 1L5SA 2RGAA 4BNFA 4DR3O 1EGHA 4FGSA 5I4CA 4FM9A 4LFBB 3PTAA 4PGFA 2F93B 4I4NA 3AF6A 1Y1KE 4X8AA 2ADPA 2NAFA 3P20A 4BB6A 1S2IA 4G1EB 4Y7CA 3L7MA 3ONEA 5B3SC 3WYGA 3ZEDA 3VHRA 5LPNA 1Y3BE 1MU0A 4AX8A 3RO7A 3HJGA 1AZLA 1YIAA 2WM3A 2CBZA 3DA8A 4HLNA 1DMRA 3S2YA 3RIGA 1S7GA 4MVRA 1K6XA 2QZPA 2JD1A 4QUHA 5CEEA 3ZH9B 4J9ZB 1HTTA 5KHOC 4ZOLA 3E3MA 1HK7A 5EGSA 4KX3A 4S05A 2BY4A 1EJ2A 1J7KA 1SOUA 4B3RO 1BSMA 4YIOA 2CTWA 4TYWA 1ORDA 1PJ4A 3PX3A 3D6TB 3BABA 1RYNA 2BVNA 3I9V6 1WY5A 5EBMC 2FLKA 4WBSA 5HF5A 4DJAA 4Y2TA 4AN0A 2Y05A 1CFJA 3AK3A 2H18A 3AEKA 1N6KA 4E2WA 1BX3A 2VRWA 5LXTA 1H6AA 3MCVA 3FETA 3G85A 3NYQA 4NMHA 1YS1X 3SS9X 5BVHA 2GHIA 2OBBA 2XVXA 3J80N 2ZROA 3B1YA 4B87A 4KIJA 2DHEA 3DC6A 2ZUVA 3TCUA 3B6IA 4WXRA 3BK7A 3QXHA 3TVYA 2CXTA 4WXPA 4D0SA 1GXSA 2UXCB 4P3OA 3K3PA 4HH3C 3KQQA 2HPHA 3GT3A 3V7UA 4EIWA 3LDUA 1ZN2A 2ISQA 4URYR 4BCBA 4E1VA 3R5TA 3IDFA 5E0KB 4JYZA 1NXTA 4RAOA 1W87A 2HKIA 1I10A 1UZLA 3SBXA 5H3LA 4JI6O 4FFDA 1XZEA 3JQDA 3LJKA 2ZRCA 1Z4QA 1C3EA 1R9MA 1N6OA 3S68A 1H66A 3PI6A 1FIUA 4IBOA 2V6MA 3ZDEA 2YC0A 4N9QA 3TIGA 1HT3A 1J2RA 4LAFA 4JJFA 3RJZA 3HKEB 3IR7A 1V3TA 2EJVA 2VWGA 1KK2A 4MQ6A 4A8JA 1IC6A 1Q19A 2JG3A 1D6MA 4LQDA 3TXQA 3IA7A 2BKLA 3RU7A 4MVQA 4XQCA 3B6KA 1VIBA 3QFSA 2I2XB 1R8XA 3P9NA 1UM9A 4KXQA 4Z0HO 3UA3A 4M1EA 3HVIA 3P8ZA 4J75A 3H9VA 4JJAA 4BEBA 1JJAA 1XNRB 4RF4A 4J9UE 3GZ4A 3LGSA 1OBOA 2OCBA 1XYYA 3OPYB 4OSOA 4M6WB 1M5IA 5CN0A 2ZOSA 4OLJA 3VJKA 2KI5A 5I7FA 2VDKB 3WC4A 1GG5A 3Q15C 1GGVA 3FYUA 2PO7A 4IOKA 4YREA 1U3WA 3E22B 5FO0A 1E1CA 1BGXT 1CEQA 1Q3KA 3VZQA 5CH8A 1LXCA 4DREA 1CQJA 3QYFA 4BUZA 4PC7A 1QAOA 3U37A 1T9AA 3ELUA 3BIXA 1RM0A 1U9JA 2I33A 3E8GA 1TRHA 4P3XA 1R16A 4IIUA 3NP7A 4RJIA 2ZIEA 3ZNQA 5F9MA 2J30A 3PJDA 1WMFA 2Z9BA 3ET4A 3ZNPA 1DRWA 4O4HF 3LCJA 1JX6A 3PUHA 2WILA 3NT4A 3QPVA 4CGZA 1M4UA 4H0FA 2GNAA 2IF0A 2NW6A 3DDUA 2FUG6 4X66B 5K20A 2ZFUA 2JARA 4RHEA 4UU1A 2QUIA 1S9HA 3QI2A 5AP9A 1BHQ1 1XV5A 2WA4A 3M4ZA 4QQ8A 4WOPA 3V9PA 4N6GA 1XREA 4IV0A 1SPBS 4ZOEA 1UBCA 4B34A 4P82A 4MVJF 4YROA 2CVFA 2VJYA 4Q6BA 1C5KA 3OZ7A 3TTVA 1OH5A 2OCHA 1XEFA 1W1WA 1GM7A 1V47A 3W4KA 5AICA 4LIPD 3LUTB 4F6RB 3NWPA 3TRKA 2YJ6A 1LW6E 3LBYA 1I0IA 1CLUA 4L72A 4B6FA 4K0KB 1YI2V 3AEQA 4QHTA 1E18A 1T36B 3B6EA 1I2AA 3HP1A 3UWPA 1VKRA 1C2TA 4X62O 1GCIA 1FP2A 4J9VA 3U19A 1PS8A 5FDFA 1ZVJA 4YXWD 3LHIA 2CLCX 3O8LA 2O1SA 4ZHQF 1TYAE 1KP3A 2MDTA 3LDEA 4DCPA 4P30A 3U7IA 4MUEA 4FE3A 1CJSA 1SO8A 1NTKH 1QZTA 1VHWA 1WVGA 5TMDA 2GA9A 1MJFA 4CH3A 3AC0A 1RJEA 1N9GA 4N3AA 2F9LA 3RJTA 1JFFA 1J2YA 4P81A 2WJYA 1LPAB 1XYGA 1H94A 3L01A 3A28A 1G8PA 3HB4X 2GVNA 1Y6XA 5CGQB 5F1OA 2QPOA 4C0HA 2EJCA 5CB4A 4FNAA 4PG6A 1PNRA 1DWOA 3KJEA 1NFQA 1OHHG 4V1CI 1K86A 4LYJA 4PR0A 3ELWA 2YWHA 1D5CA 3NGXA 3FLAA 1VSVA 2EINB 4ESOA 4BO3A 3R66A 1USGA 1BCRA 4EVQA 2FWPA 2QPAA 4CV3A 2FTKE 3SYKA 2FMKA 1QU2A 2WEKA 2CVHA 4LY6A 2SHKA 4WKNA 2FZ5A 3H1LH 2HA3A 3IKVA 4UAJA 3GQBB 3I5XA 5SZIA 2DYSC 4W5QA 3F6RA 4R1OA 3LNTA 4HX5A 5A4IS 4J0DA 1KORA 3FFWA 2QU7A 3BE6A 3KCYA 4U5QA 2HOQA 5DHSA 4RLFA 3NHSA 4IDPA 4J11A 2DUMA 3PXCX 1QVAA 5GIOE 3DF7A 1SOVA 4DV3B 1P4AA 5DNUA 1VFNA 3C87A 1DJNA 5M7EA 4RHXA 2VG8A 4FM2A 1VP3A 2IH5A 4UVDA 3TQTA 1R3KC 1KOJA 3P4YA 2EQAA 2JFGA 4TWBA 5BN1A 1Q6UA 1A7KA 5JFOA 2BELA 2FEKA 4DHEA 1JNXX 1KDTA 5JWPA 1A0OA 3FOAA 4LWSA 4OKSA 2RHMA 5JARA 2EFYA 2PQ0A 1XMQO 1Z5VA 1HYGA 1RTTA 3G2QA 1RAAA 2NUTA 4X9XA 2P9CA 5B1IA 1YBHA 3NC4A 1P6UA 2VDQB 3F78A 3I3OA 3GMTA 1Y89A 3QA3E 4XM2A 1ZL8B 3HA2A 1KFEB 2V7QD 2Q3HA 4ECEA 5EC1C 3QEMB 2Q5CA 4YCAA 4LC1A 3RVQA 3AR4A 3QOFA 4WJKB 1EWVA 4LGCA 2JS5A 5DRTA 4MWGA 4YMIA 3HYCA 2QTMA 3S1AB 2ARHA 1YR8A 1R6TA 1V2HE 4OK6A 2V59A 1RHQA 3T41A 1MRZA 2F4NA 2V6FA 2BFDA 4JA2A 3BZUA 2BZ1A 2NUPA 1RXUA 3E70C 2AKYA 4XJVA 4FW8A 3K57A 1YQDA 3MCTA 3VTFA 1SULA 1ATZA 1ILEA 1PL6A 2CNOA 5LMNB 1F6DA 4JVNA 3GJXC 1II9A 4JYAO 2BUBA 3EXHB 3A0BZ 4MYCA 1V4VA 3V2IA 2ZSEA 4GKJO 3AETA 3HUUA 3E7XA 4BAYA 3UXYA 2Q99A 3NTOA 1QZ3A 1HDRA 1CRLA 3SE0A 3K3WA 4B82A 2PL5A 4RD3A 3C97A 4YYEA 3IVCA 4BU1A 4E15A 1IZZA 4EA7A 4BJ1A 1EQAA 5EZYA 4IOMA 4V0QA 2WUEA 3F5SA 1B2LA 2Y4NA 5JXGA 2D5BA 3RJ9A 4IDDA 4F9TA 3ZZMA 3Q7QA 3TZQA 1VP9A 1EBOA 3E83A 2GPYA 2RB5A 3IJ5A 1YIJV 2B98A 421PA 4RD6A 5ESDA 1PG5A 2G7MC 4GZ5A 4FBLA 5GONA 3C3TA 5KQRA 3KL4A 4W82A 5L3DA 3BH0A 3A1UA 2GMWA 4ZEWA 4NV0A 3LLCA 4PCUA 3STUA 1YBVA 2B1QA 2GAJA 3WLHA 1KRWA 4G4GA 1C50A 4DLSA 3GEIA 5HM6A 4CLRA 4LJLA 3I9OA 5FV7A 4UHCA 1SHUX 4PVCA 2DETA 1PTKA 3PPWA 1CUVA 2HEGA 4DDVA 3FSEA 3O4JA 4LDPA 1SGWA 2J6CA 3AQ4A 2W2XA 3GEBA 2V7PA 4NDAA 1XA3A 2QJ1A 3IE0A 3MF4A 3O6VA 3OEEG 1XYVA 1NNUA 4JFRA 4CEIA 3TD6A 1Y1RA 4FS8A 1A1VA 2FR8C 2EGHA 5KDLA 3O9VA 2V74B 2B4TO 4HGYA 3TQSA 1W5BA 3ZHTA 1WTAA 2YN4A 2I34A 4FMPA 4POAA 1BVUA 1N8TA 4PHZA 2BFNA 1KFCB 3UB4A 1A82A 3LPAA 4QXAA 4F04A 3L4EA 4OMCA 5EHXA 2QRVA 5ICMA 2HN9A 3GVPA 3F6SA 2H5JA 4TQAA 1R5OA 1M6YA 4LFAO 1O6CA 1HMYA 5JC8A 3E4DA 3FOEC 1EK1A 3TQIA 3PSHA 3VKHA 1S5PA 2QB5A 1TJ5A 2C2XA 5FJJA 3WLMA 3VV3A 1PQWA 1M34B 4TN5A 1BVHA 3BWBA 1A1SA 4FYHA 2CNWD 2H5LA 2XGJA 1C8BA 3I83A 1MZEA 1QMGA 3NW9A 2Y3IA 4BBZA 5ECDA 1SVWA 4J8PA 1JQ5A 5IXYA 5KAIZ 1PNTA 1RYEA 4RTSA 3ODGA 1NQAO 4YGYA 3TRJA 3FBTA 1UBEA 4QU9A 1X6VA 4G2NA 1Z5ZA 4QXRA 3SYNA 4COOA 4Y2VA 3KR2A 4C29A 2GEVA 2H63A 4UNSA 3OQMA 2OVBA 5K01A 3WG9A 2GPAA 2XVZA 1HTBA 4BNLA 3NOXA 3NHFA 2AEJA 1R6DA 2QP4A 3LY8A 1E7QA 2GNOA 2VPWA 4X64O 2FJ0A 4BWGA 4L8FA 4ROSA 1EX6A 1NG1A 1WHTB 2QTTA 4YUXA 5EQDA 3RUAA 3OQNA 3G8CA 5FBKA 4PX3A 2I4RA 2X77A 4R2XA 3C3MA 5JAPA 3JQBC 3JWEA 4I9UA 4U9HS 2HXGA 4TT8A 5DGXA 3GPCA 1E1DA 2EJUA 2Y1GA 3D3WB 2AF3C 4TTAA 4R0NA 3PT5A 1XEXA 1RYYA 4TYQA 3I61A 1LD3A 4O0MA 4AJ1A 3BL6A 3K6SB 1M5UA 3TZKA 2EF1A 4MGKR 3IIKA 3VZDA 1V4NA 3NALA 1PJRA 5K3BA 4OXYA 3IO5A 1LDNA 3OC0A 1IXYA 1ZVKA 2C5LA 4HQFA 5TJHA 3L5KA 2FPMA 2P8SA 3ZY5A 1RI1A 3G1TA 2CE4A 2RK6A 3H9UA 2JJMA 4WADA 2QJOA 3PKIA 1RXWA 2QLTA 5F2EA 2F64A 2BFBA 1U97A 3L05A 4PAOA 2XUGA 1BEEA 5GJWC 3KB8A 3MW8A 1JG7A 3W3AD 3SX0A 1KI1A 4QFCA 4Y6LA 5AKYA 4YMUA 1X2BA 3VXKA 1VJRA 5AJWA 3IYLW 4R2JA 1H4TA 5IMBA 1BXKA 3U4HA 4OSEA 3BA8A 1II8A 4GGOA 4B7ZA 1M1YA 1EJBA 4Q4LA 3JX9A 5CJ2A 2IPOA 3G1WA 5GMOA 1VLJA 4EO9A 4I1PA 4D41A 1E63A 1MRNA 1H2WA 5B3JA 4JL5A 5JRJA 2FU5C 3S99A 4KO1S 4URVR 1GSAA 3AEUB 1H8HD 2NXNA 2J9GA 3ECAA 3WB9A 2GN8A 1F2TB 4QLAA 1CVIA 2CMFA 3O3OB 3KEOA 4UCOA 1DFHA 5DX0A 3DEKA 1NRJB 1Z8FA 3TSCA 2CAZC 4K9QA 2JLWA 4EZIA 5IH3A 2ZB4A 3JD3A 3CW9A 4YAEA 2O59A 4OKNA 2Q6AA 1VYHA 3W3AH 4RZHA 2G1UA 2OC9A 2AJTA 3EGOA 3MYRA 3X1KA 4QFMA 1P1HA 2ZUCA 1OH7A 1O5OA 2ZSHA 3CX6A 2OY0A 4H1UA 1W4CA 4DIBA 2XUJA 1X87A 4F5EA 4WE3A 2ZRDA 4K9LA 2O0LA 3KKMA 1PJQA 1I5EA 1Q21A 3E35A 4EY7A 4FW9A 3F1LA 4PCVA 2D74A 2PGNA 2O8DB 2PCLA 2ROQA 4EDFA 2PYLA 4ND5A 1ISSA 2VHZA 1T13A 3RFCA 2NXEA 3ET5A 3GO4A 2VQEB 3QMPA 2BFCA 1GAQA 2C07A 2YZMA 4PAMA 1IUPA 1QO9A 4RTMA 4OUDB 1IATA 1E9RA 1H9CA 5CCEA 2ZSBA 3IA2A 1T5EA 1W76A 1AV6A 2QLJA 3V1UA 4Q19A 5FI0B 4QPPA 3IAS1 4RMNA 2Y9PB 1N32B 2DCMA 2J32A 5HOQA 5ALHA 2PD4A 3HCAA 3P9PA 4PHFA 3WFZA 4ALJA 4MB6A 3FSGD 3DTVA 3ZHBA 3THWA 4CL0A 4MGYR 5FV4A 5G1PA 3ZS8A 1NVPD 1IHOA 3LC2O 2XUHA 4YHHO 3P2EA 3HKCB 1PIWA 1SIOA 3T3EA 2J33A 1RQ2A 2H4JA 2OZLB 4MVZA 1DG3A 2IUFA 4PVDA 2WHPB 3Q98A 4U7HA 3UMVA 4R31A 2HA0A 3QKSA 2BOVA 5I9MA 2CN1A 1GEGA 3CQ9A 2BFOA 2AW5A 4I6EA 1STOA 2ZQYA 2FDXA 3E8SA 1Z6TA 3QOYA 1HG0A 1XNGA 4G9GA 3P19A 4PHHA 3GAZA 1Z0JA 2VNSA 5DFAA 4C7BA 3UA4A 4NK4A 2CV0A 3H9GA 3PGMA 4LF4B 4OHXA 4CUZA 5E4FA 3BT7A 3UK7A 4DIKA 2L6LA 4WQMA 3F7NA 3ZV7A 4X7RA 1RHJA 3EUAA 5DCLA 3FGPA 2PG3A 2Q7XA 1X14A 2CC2A 1TGVA 3HADA 4Q7LA 3OBBA 3G9XA 4AB1A 4RH3A 1TVKA 2YYZA 3CV3A 2G06A 4DO2A 2RGWA 2TMKA 4BXOB 4IIEA 3DOOA 3CVXA 1CNMA 2IYTA 2EL9A 2JVIA 3SBDA 2REQA 4UVBA 5LUAA 5LA6A 3AJDA 3A58B 1F6WA 1R27A 4BW9A 4JS0A 2Z6UA 2WLIA 2PNFA 5JEDA 2I2AA 3PD0A 1TGYA 2OD9A 4JV5B 1SU4A 4BUCA 2F48A 1Z4JA 5FQNA 3A04A 5IK2A 1FUKA 2C97A 3ZS8C 2OCPA 3KOOA 1H2XA 1KY2A 5DW3A 3BRQA 4B3BA 2XWQA 1YZLA 3OFJA 2JIBA 3DD1A 4ZFNA 2BV3A 1O96B 2J6HA 2QL7A 4CEHA 1V6AA 2RH5A 2YEVA 2XYHA 1ZH8A 5IC5A