2QGNA

Crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
313
structure length
244
Chain Sequence
b'KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGETPSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans.
rcsb
source organism Bacillus halodurans c-125
molecule tags Transferase
total genus 79
structure length 244
sequence length 313
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 2qgnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qgnA01
2N1BA 2C9CA 2NO1A 2O0HA 3KUCA 1XCGB 5FBVB 4MRRA 4QBIA 4UNRA 2YZ2A 4LUCA 4TSFD 1MR3F 4A2WA 1XEXB 1OV4A 2A78A 3TVTA 3FMFA 2IYSA 3L82B 1XFAA 4Q21A 4ZCIA 1CR4A 1G6HA 2DR3A 2B6HA 2ZRBA 3KKPA 4NCKA 3RWOA 3EC2A 5KSOA 4YQFA 3LBHA 4TMVA 5H68A 5GJBA 2X8AA 5GADl 1NBME 4H9GA 1YJ5A 3OF5A 3AUXA 4HATA 4FMBB 1S3GA 2ZANA 1XTKA 1YZTA 3DOEA 4FMCF 3U3RA 4Q7JB 1H8HA 1E9CA 1XEFA 4LBWA 4PO9A 3CPJB 2JCSA 2QRZA 1Q12A 4GRAA 1K5GA 2FFQA 1GAJA 2GCNA 5JMTA 1BS1A 2GCOA 1UPTA 3RRZA 1CF4A 1E79A 2QMUA 1A4RA 4NCIA 1N5JA 2QRNA 2CCGA 2GNOA 3B6EA 3Q8XB 4A36A 4DDWA 2CVHA 4TQUS 5DYGA 4DC9A 3PIRA 1DOAA 1NN3A 1DO2A 1GL6A 3VHXA 4LZZA 1U99A 4OJKA 2DFLA 2ZRPA 1W0KA 3GFTA 4E07A 4JLOA 1IOZA 1N6PA 4C0HA 4FMDB 5FL3A 4M1OA 3FE2A 2O8CB 1E9RA 1TF5A 1ZVQA 2ZITA 4Q48A 3VKHA 2QSYA 2NO7A 2F55A 1PVOA 4WBSA 2CXXA 2IYTA 1KI4A 2IXEA 4US0R 4YLGA 5E95A 2OBNA 3SOPA 1IJFA 1KI9A 1SVSA 2QU8A 1MOZA 4WVFA 2IS4A 3EIHA 1FP6A 3BC1A 3FHCB 1JBKA 2IEZA 4NBSA 3O8BA 2FPLA 1SGWA 1N25A 1HQCA 1T3LA 1GDDA 1M74A 1N6KA 3A4NA 1GRRA 3QF7A 4LPSA 2VO1A 1NSTA 3DMDA 4YDSA 4DLVA 3D7MA 5IRCD 2QGZA 2CHQA 4Q00A 3IIMA 2GILA 1W2HA 3LV8A 1KKLA 4LPKA 2QORA 1XMJA 1YZNA 2IL1A 3RS2A 2GXSA 3AVPA 1G6OA 1A2KC 4RD0A 5CM9C 2NO0A 3GLFE 3SYLA 4WZAE 1XDBA 3EW9A 5BN5A 3PEYA 1VHLA 2PLFA 1W5TA 3B7GA 4NMMA 1WP9A 5FPHA 1Z28A 4C9BA 1ZU5A 5FOWA 1DO0A 3BGWA 4I81A 1EWRA 4KLZA 1JALA 4Q9IA 4B2IA 4EQ6A 1M7GA 3LX5A 2C2HA 2NIPA 2OAP1 4RJLA 3VMFA 1WF3A 2CE7A 4KU4A 3TE6A 2V7QA 4L5BA 3ZJYA 1GFIA 3IEVA 4QNMA 4MH0R 1XXHE 1M34E 3BFKA 3KXLA 1GM5A 3AKEA 3OESA 2O52A 1QDEA 2YWHA 4IDNA 1FPMA 5JS8A 4CEHA 1AZTA 4FCWA 4PC1A 2WHXA 4ITRC 3SYNA 1AS3A 3RS5A 1PV4A 1R0XA 2MSCB 2HYIC 5AUOB 4EIWA 2WWYA 4AKIA 3CM0A 3IIKA 4NCJA 1G1MA 1IBRA 1OYYA 3KQLA 1G18A 4V0OA 3Q7QA 4ZCMA 2DWQA 2OFXA 4HLQB 1E2QA 2EFHB 2RGGA 5E7IA 3TVDA 1I4LD 3JVVA 1RYHA 4OQNA 1PUJA 1Y63A 2P5TB 3G5UA 1RYFA 4Q4LA 2QN6A 2RGNA 2BMEA 5L3RA 2F1JA 3W9YA 4B2LA 4URXR 5DH9A 4JLJA 2W6JA 4I1SA 1KTVA 1KI3A 2G3YA 4C0AC 1XBTA 4YONB 2J59A 4BFXA 2HLDA 3OEED 3GJ4A 5H8WA 2VHQA 4ASUD 4NYJQ 1G5RA 4B3CA 3ICQB 2JAQA 1FMLA 3WXMA 4GZMA 5EE3A 2FA9A 2HXSA 4AURA 2K5UA 3H4MA 3GJ7A 1UEJA 4UNQA 5KU1A 5A5GA 2CLCX 2Q3FA 3E70C 5BYKA 2EYQA 3RYTC 1G8HA 1U0LA 2HF9A 4QJ3A 4US1R 2WIBA 1FFHA 3CF0A 3L8YA 4BFUA 2ZVQX 3AVYA 2BKUA 4MUAA 4TQAA 1GKUB 3ADBA 1P9WA 1S1CA 2F1IA 2WWXA 2KE5A 1L4YA 1QBKC 1NJGA 2VP0A 4CRWB 3ZD6A 3OEHA 2JDIA 4LV6A 2CNWA 3H86A 3MCAA 2QE7D 4LHZA 3WMGA 4YMTA 3MAAC 5HE8A 5DI3B 3TNFA 2OEPA 1KDOA 3Q5EA 2XB2A 4P4UA 2IYLD 4ZDIA 1US8A 3P27A 3VAAA 1XD2A 1XCMA 1NLFA 1XJCA 5LD2B 4Q5IA 4B3DA 1RC8A 3SYKA 5JCPA 3QY0A 4URUR 2HCJB 3BJIC 4EJSC 2B92A 1H8HD 4AD8A 2RHMA 1SXJB 4PSVA 2J9RA 3IHLA 1D2EA 2ZJBA 1JJVA 1TAGA 3SQWA 2CMKA 3Q3JB 4LBZA 1JEEA 1KJWA 3OIWA 2RH5A 4KAXA 1W0JA 4L16A 3ZQ6A 5KYKA 5JCZA 1QHNA 5GJCA 3U6BA 1RKBA 3UIEA 3RC3A 2WJJA 2HEIA 4DSUA 1AGRA 4LV8B 4DXAA 1SVWA 3UK6A 2OE2A 1N5KA 3GCGA 1F2UB 1LS1A 1DAKA 3BH7A 3B5JA 1JNYA 2PMKA 1OH6A 4CEIA 2FGKA 3A1SA 3OIVA 1J70A 1S1MA 1JQLB 1T8TA 1Z6GA 2GETA 2WJGA 2JEOA 1W5SA 4FCVA 2GESA 5GJVC 5CM8B 1HQYE 4BFZA 2V54A 1E4VA 2ZSAA 1KK2A 2C77A 2VHUA 3T1QA 2AD5A 4TYNA 3L43A 3TR0A 4LBVA 1J8YF 1CR1A 2QAGC 1P61B 1ZJ6A 4DLYA 4DSNA 2Z6VA 2WMOB 821PA 4Q1EA 3FOZA 3EA5A 1EFCA 1ZYUA 5FPTA 3GFPA 2QPTA 3B9PA 4DCNA 1E2JA 4L8GA 1RVDA 2BBWA 1NKTA 2QI9C 4TL6A 4EPYA 2WZQA 4W5WA 3PCRB 1DAMA 3VFDA 2G83A 3T35A 3CRRA 2F43A 3EC1A 4JZKA 1IY1A 2AD1A 1AQYA 1P2UA 4A0GA 4V0LA 4D4JA 3K0AA 1AKEA 3B82A 2NOAA 1G17A 5CLQA 1U0HC 4NHOA 4V0ME 1OB2A 3KKMA 3KZ1E 5K8UA 3FKSA 1Z06A 4JVNA 4JVLA 3N2IA 2F6RA 3D8BA 4TMWA 4BLQA 3GLGE 2CJWB 3V4FA 4NONA 3B1WA 3AGQA 4Q7MB 5JBQA 4D0LB 1E98A 1JAHA 1B23P 2ZAOA 4BFYA 1N6RA 2A5GA 1GTVA 3MJHA 2XAUA 1P9RA 1QHSA 3GLHA 1IXRC 4I99A 4YMVA 4LHWA 2ODNA 3UWKA 3CIOA 2LKCA 2REOA 1FX0A 2BMDA 2R6AA 3BE4A 3NEJA 4JL5A 2FFBA 4C7OB 3DM5A 2NMVA 2ZXUA 1CRQA 2ZQ5A 2O0JA 4QNRA 1Z22A 4B3XA 2ZRJA 2RGDA 3SJZA 1E1RD 3LXRA 4TL7A 1JR3E 2ZRHA 2FOLA 4MYHA 4XTRA 1GOTA 3E2IA 1P9NA 4M1TA 2QZ4A 2YKGA 2XNDA 3EA0A 1EFRD 3EG5A 3UMSA 5FBQB 2R62A 3K0FB 4CF7A 5EJEA 1NBMA 4HAXA 3W3ZB 1OFTA 4Q4AA 5EZ5A 4LRWA 5KUTA 2DFTA 2W6JD 3THXA 5B57C 4P4TA 5DNYB 4UNNA 3NH6A 4PXAA 3MD0A 3SBEA 3CH5A 2DFNA 4BRWA 1VKJA 4C4PA 3CR8A 3SQXA 4MKFA 1F48A 1WA5A 3QKSB 2R9VA 2G1KA 3HPQA 4RVCA 2EWVA 3NEYA 3CF6R 3QQ5A 3TK1A 1RPZA 4HB0A 5UKDA 4MGYR 3THYA 1IXSB 1TX4B 5AJZA 3U7GA 2FV8A 4BRUA 3OAAA 3Q9LA 1YKSA 3M4YA 3UG7A 4I1OA 4DLUA 4HUTA 3AF4A 3BD9A 5G41A 1RJ9A 3FMIA 3SU8A 3DEFA 5C1BA 3ZZTA 4NH0A 4QHTA 4OL0A 4QHYA 3AEZA 4LHVA 1D8TA 2B7BA 3BS4A 3REGA 2RGAA 2JDID 3QXXA 1VDZA 1XPRA 1E9SA 4E5UA 4RZUA 4GP7A 1S4QA 1VYVA 4Q4HA 2ZRNA 4RZXA 3GEHA 1OF1A 2GTPA 4G0NA 2XXAB 3K0CC 3NH9A 4W5JA 4IXNA 4A8JB 2O8FA 2W0MA 2C03A 1DG3A 3ADCA 1Z8FA 3EZ6A 4AI6A 4PO8A 3DMNA 2JLVA 2ZS9A 4UXIA 3SC3A 1GSIA 4TLBA 1D6JA 1E96A 1T9HA 5HPYB 5DHFA 1KHTA 1SKYE 1RRPA 1IY0A 2EFDB 5KNDA 2ZAMA 1S2MA 3IDQA 4GT1A 2UZIR 2QTHA 1P2VA 1XCPA 2ORWA 2LWIA 4Z51A 4PANA 2DCUA 1WQ1R 1VCNA 4P0TA 1R5BA 5FOSA 2VL7A 3PUWA 2FWRA 4B76A 721PA 3GLFA 2D74A 3FPAA 5TMPA 3GMTA 3NG1A 5TY0A 1GVNB 3K0EA 1KDTA 1DAFA 1T91A 4TSFA 5HCIA 1J90A 3S1AB 1CBUA 3SBDA 1E9FA 1TQ2A 2WTUA 4V0NA 2Z5FA 4IFBA 2Z43A 1D2MA 3RRYA 2J41A 4BFTA 4CEJA 2F3RA 5D3QA 3EX7C 3Q72A 4MRVA 5JEDA 1ZRHA 3U4QB 1D5CA 3K9GA 3QXJA 4R2IA 1CKEA 1XXHA 1G8PA 4FD2A 4CVNA 2J0SA 1K6MA 3MLEA 2VIIA 1M7BA 1YR8A 3LH5A 1T0JB 3R9WA 4WAUA 2P65A 4FMDF 4ZO4A 3GJXC 4EPRA 4ZI3A 2IS6A 1ZC3A 1E2IA 2KB0A 1H65A 1XZQA 2ZI3A 2XSZA 5JRZA 3I8XA 5CYOA 2J0QA 4PSAA 5KDOA 3V4RA 4BGDA 4CT4B 4TTRA 4AWXA 3U3KA 3D31A 1QG2A 1X8LA 1AN0A 4EFLA 4HAWA 1NKSA 4AIIA 1P75A 2ZI4A 4Q19A 2QAGB 1E0SA 3X1ZA 3CF2A 3WHKA 1XTSA 4BPBA 2O8EB 4LJ9A 1E2KA 4TQ9A 1W36C 4M9XA 1ZNZA 3FKSD 4M22A 3EASA 4G5OA 4ZDJA 4N0DA 2KJQA 5FI0B 4N0EA 2QROA 3KJEA 4BECA 2EYUA 2YYZA 4JYCA 3DKPA 4US2R 1II0A 4W7SA 1YU9A 3PENA 3P1JA 4KI0A 2BMFA 4JBYA 3GLIB 4G5RA 1AM4D 1WDTA 2PZFA 1VIYA 1FOEB 1MO5A 1X86B 2OBLA 4NU0A 4N3NA 1JXOA 1E4YA 1E2NA 1YVDA 4ZDKA 5IK2D 3AUYA 3A8TA 2VHCA 3THOA 4OI0A 4DZZA 4F7WA 1KOFA 1ZU4A 3CO5A 4PTLA 1NN1A 4HAVA 4EDHA 4KYUA 4UJ3A 3H84A 2GBLA 3FB4A 1BOFA 5KO2A 4Q1DA 5FTNA 3QSYA 1II8A 2H92A 4OQMA 3QOFA 2HUPA 3VNUA 2FPMA 4QG7A 2XNDD 1UF9A 3RSOA 1OKKD 1LF0A 1XD8A 2IYQA 2QT1A 4M9SA 4DT1A 1OXUA 3ZQJA 4BZPA 4IHQA 4RFSA 2IYZA 2BM1A 4JVSB 3EZ7A 4JBWA 1NBMD 2ZU0C 4LOAA 2JLWA 4DB2A 5P21A 3HR8A 2VSXA 5FFMA 2ZEJA 4C2UA 1E94E 2FPKA 4QGHA 4RD4A 4DBLC 5L3VA 2ZRMA 1SVIA 3AM1A 2O8CA 4QM7A 3H0KA 1R0WA 2WM9B 3HP1A 2IXGA 5E7MA 3X1DA 5DGXA 2OZEA 1G3RA 5EP4A 1P3JA 4KJZA 1P4SA 3WRXC 5KHOC 1Q21A 1ZD8A 3W5IA 1NLZA 1OXSC 3PVSA 2KBFA 1NG1A 3KXKA 4GFDA 2RB4A 3QENA 4D25A 2C78A 3REFA 2FSHA 3OAAD 1FP7A 2D62A 2WMNB 2QG6A 1R5OA 2RGEA 4M1SA 4Q02A 4ZCLA 1FNMA 4DIEA 5EUMA 4CW7A 4Q7LA 1SKQA 5FTLA 1G3UA 2D7CA 2PJRA 2F7SA 2FNAA 4KV9A 2O8BB 1L8QA 1KAGA 1OT3A 3TUJC 1Z6TA 2JJ8A 1TNDA 1W47A 5GJWC 2J0VA 3QJYA 1HY3A 4GP6A 4KCGA 1ZM3A 2ZR0A 3QF4B 3WYFA 3IPYA 1KDPA 2G1JA 2ASEA 4B3GA 4B74A 4Q7KA 1G19A 1I4TD 1G8YA 1PLKA 4AYTA 2HJGA 2WJIA 2IHBA 2WJHA 4M2LA 3B1VA 2AX4A 1N0WA 4QGFA 4BFVA 4DCSA 4QHSA 2GJ9A 5EQTA 4AC9A 4BFWA 2WWGA 2J0UB 3TUZC 4DJTA 3LW7A 4R7ZA 3QKRB 2C04A 3L0IB 4TT3D 1D9XA 3AVQA 1Q57A 3PFIA 3AH8A 3CPEA 1OFHA 2W6ID 1KO1A 4NYIR 2VBCA 3FDIA 4UXJA 4WW0A 5FPYA 3ZD7A 3EAQA 1XP8A 4BEBA 1CS4C 4GSYA 1NI3A 3I72A 2D2EA 3G82C 3QEJA 3I4LA 2FSGA 4OHXA 5K8IA 4QFMA 4DSTA 1E2GA 1DPFA 4NKRA 1SXJC 2RAPA 3CZPA 3R20A 1KI7A 5L3QA 4MRSA 2RCNA 4V0MA 4JSTA 4NYMR 3CNLA 2JA1A 4DLXA 1VG1A 2VHJA 2QE7A 5L3SA 1LS6A 2FZ4A 3HYTA 4X8OA 3W6PA 1E2HA 1GKYA 1ZIOA 1A82A 3CR7A 3I3SR 4L9WA 3VR3A 5F2EA 3GLGA 2CVFA 3IBGA 3Q7PA 2ORIA 3SFZA 3LX8A 3BK7A 1Q3HA 3DO6A 5FUXA 4Q01A 4A0HA 4DLZA 1XRJA 5EE1A 2VEDA 1SVOA 2ZRAA 1UFQA 2X19A 1G7SA 1Z3IX 4YMWA 3MMPA 1Z07A 2P6UA 4P4SA 2I4IA 2ZYVX 2ORVA 3ZZUA 1X1SA 4GOJA 4IXMA 5B64A 4C0LA 1EFHA 3CZQA 1UBCA 5KSZA 3W6NA 2H17A 5LPNA 4DLTA 2XSZD 1UBFA 4PPFA 4YMSA 3JVUA 3L0PA 2VSOA 4B75A 4HYYA 3J81k 3QBVA 4JKYA 1NP6A 1U90A 1V5WA 1G21E 1OB5A 1ZM9A 2JLXA 3A37A 3KTAA 1E0JA 2HYDA 2WJVA 5C4GB 4TYYA 4CIDA 5FTMA 2NPFA 3F0TA 2ANBA 1KZ7B 2FE4A 3MWYW 4A4DA 5FPKA 1BKDR 3CX7A 2ZRFA 3BRWD 3CLVA 2PBRA 1XB2A 3IQXA 5EE5B 3GQBA 4PZLA 1GRNA 2O8DB 5BWMA 4M53A 3O8CA 3RDPA 2ONJA 3FHOA 3EIQA 1Z0AA 2L0XA 5CB6A 2JIZA 3AQ4A 4P3YA 2J3EA 1U8ZA 3B60A 4URVR 1CRPA 4RKFA 4B73A 1YZKA 3WYAA 4OK6A 4OK3A 1OXXK 1W2GA 3KUDA 4QJ4A 4D6PA 2X2EA 1QVAA 5C4MA 2XJ9A 3IGFA 2GA8A 1W36B 4DDUA 3QIAA 2JLYA 3GD7A 2JLRA 3BWDD 5CJPA 2RGNC 2MSEB 1RW4A 2F1RA 1E9EA 1IQPA 2EFGA 1VMAA 3LA6A 3A4LA 4Q4JB 4UJ5A 2V4ZA 2CE2X 2FN4A 2ZYUX 3D3QA 1IN8A 1LTQA 4B71A 1GP2A 2R44A 1YQTA 2ZS7A 2WKQA 1G5PA 3BH6A 2ZE6A 3ZVLA 4F4CA 2ANCA 1GL9B 1OFUX 3PITA 3WNDA 4DIDA 1SVMA 2OT3B 4AKEA 1XTJA 3BFVA 3RRMA 2A2ZA 1VCIA 1E99A 4MYUA 4TL9A 1ZM4A 1FMJA 2F9LA 3NBYC 3PR1A 4NZYA 4POAA 4D0NA 3AF3A 1CJTC 1TU3A 1EX7A 2BEJA 1JB1A 2GDJA 2IEYA 4M1WA 1XU4A 3ZDQA 4PAQA 2ZSBA 1ZNXA 3U3MA 3EXAA 3V9PA 3VNVA 1QF9A 4MQBA 4F91B 4QGGA 2UKDA 2HT6A 1YHNA 1NVVQ 4QKQA 4I1VA 1RRCA 2ODWA 1XEWY 4GBMA 4M1MA 3U44B 4RD2A 1N6IA 4LC0A 2GVZC 2C9YA 2DFKB 3TLXA 4DWJA 1E1RA 1CLUA 1NN0A 4MGZR 3DPUA 1TPZA 1AKYA 5DISB 1EFRA 2WAYA 1ZM7A 1Z0FA 4OHYA 1GNQA 3K0AB 4ARZA 4BWYA 5EE9A 2XTMA 2AWNA 4TYQA 1QHYA 1XTIA 1Z0JA 5TB5A 3CH4B 4UNSA 2QBYA 1G4AE 1OXTA 5EP2A 2FJUA 1EGAA 3ADDA 2IYXA 3UG6A 1E9DA 1MRSA 3QVUA 4M8NE 4PC3A 1P72A 3FWYA 1Q1ZA 1U8YA 3CNNA 4LBYA 3VR6A 4TTPA 4MGIR 3X1WA 3BERA 4A8JC 3M1IA 1ZW6A 2RKOA 2XX3A 1KMHB 2PCLA 4RFVA 3LDAA 5DYIA 1ZINA 2W0SA 3L0SA 5K8TA 3CW2A 3K70C 4HAUA 1DAIA 4A9AA 2GCOB 3C5HA 5AWFC 1TQ6A 4DLWA 121PA 1QHHA 4M0LA 5HCNA 4ABYA 2IYYA 3RS4A 4WXRA 2AXNA 3HR7A 2C8VA 1U98A 4DEXA 4QOSA 5F9FA 3A58B 2LKDA 1C9KA 4HZUA 5IT5A 2OCYC 3PV0A 1BIFA 2IC5A 2Z4SA 3QBTA 3ZVMA 4C2TA 1U9IA 1DAGA 2JLQA 2BC9A 3A1TA 1XD9A 3CRQA 1E6CA 3PUVA 2CL0X 2C95A 3MG9A 2UZ3A 2YOHA 2WKRA 1VECA 1XX6A 1E0AA 1ZUNB 5CDFE 4GOKA 2HF8A 2DHRA 3SJAA 3O47A 4WIAA 2GK7A 4Q47A 1O3YA 4R71A 2ZTSA 4L4UA 1R0YA 4B6FA 1KK0A 1UDXA 2ZRKA 1GNPA 2P2LA 3CRMA 2IA5A 1U0JA 2CL6X 4D4MA 4LYAA 2CLDX 1JR3D 3H2YA 4Q1FA 3SHFA 4GMXA 5CIWA 3QKTA 3KFVA 3NC1C 3RVBA 3TIFA 2H18A 1S8FA 1S3SA 1RZ3A 4JMPA 4ZI2A 3EIEA 1RIFA 5AUPB 2PZGA 2GF0A 3NVAA 4TYWA 3IHWA 4PFSA 3IO5A 3EARA 3ICEA 5J47A 4G5GA 2WIAA 2OILA 3DDCA 5EUQB 1PZNA 5HKKD 2XTNA 1Q1EA 3K09A 2X2FA 1KSGA 3AVUA 2QGNA 1TQDA 1YRAA 2JIZD 3LO5A 4DUGD 1EG7A 4GL2A 3KB2A 2BOVA 2DPXA 4BUJA 1PLLA 2IHYA 2NQ2C 4JJZA 1KNXA 3KJHA 3E5HA 5D3MB 4YDHB 3P20A 5SZJA 3ZGXA 4EQ6B 3SN6A 5B58C 1J99A 3RRNA 1AQUA 2VP5A 2WWFA 1J2JA 1KMQA 4RZ3A 4KBGA 4B47A 4YMUA 4ZPXA 3EPKA 2H57A 1G7TA 1XEWX 1E2FA 4CEHB 3UXMA 1Z0IA 1S96A 1DTSA 4ZV4A 1KO7A 3EPHA 3GJ8A 4GZLA 4XWAA 1ZCBA 1KI6A 2OV2A 1EWQA 4KVAA 3UWOA 4CZ2A 2XZLA 5J4HA 3PXGA 3NIBA 4WZBE 3KX2A 2ZYTX 4LJ6A 4EJSA 3HPRA 4HLDA 2Z4RA 1NVWQ 2BMJA 3HDTA 2QMHA 3QKUA 4JLBA 3RANA 4B3BA 3AGPA 3R9IA 3OHMA 3LQRA 4DHEA 5M04A 2ZJ5A 3FTQA 1MT0A 4O2LA 4BLTA 4IVPA 4KO8A 4OKSA 3GPLA 4LJ8A 4MDEA 1U81A 3TSOA 4II7A 4NL4H 2H7VA 1V43A 3DVLA 4RCYA 5IK2A 4F38A 2FFHA 3SNHA 1VCMA 3H1TA 1R0ZA 3SZRA 3ZH9B 4LV5B 2ZE7A 2CLSA 5A0FA 4A0RA 4JL6A 1M7HA 1NG9A 1G291 2ZRIA 1W49A 2YC2C 4KSBA 2VP6A 3KQNA 2Q3HA 1HE8B 4TL8A 1FZQA 1VYUA 4HDCA 4J0QA 2D06A 4AKHA 3HYRA 1AS2A 2J7PD 4HI0E 4ZIRA 1OKKA 1VPLA 5IHPA 2NO9A 5JWOA 1R7RA 3ASYA 1U2RA 1P2SA 1ZNYA 4K46A 2YWGA 5J4YA 3ECCA 1O87A 4G5SA 1WRBA 1Q1QA 4D26A 4IDOA 2XNSA 4JIMA 1W1WA 1A1VA 1DELA 2AL7A 1E0KA 2ATVA 3ETLA 4M1YA 4HLUC 4HLCA 4RD6A 4B3FX 3VR5A 3P32A 2PT5A 2E87A 4PSKA 4EPTA 2OESA 5CK4A 3QI2A 4IW3B 4A1FA 4PC6A 2AKYA 3PQCA 2ZRDA 1II9A 1XD2B 4V02A 1KJZA 3ZS9A 1LF5A 4EKDA 2QPOA 1A7JA 1JI0A 3QEOA 1OYWA 2TMKA 2ZUCA 2AR7A 3PG5A 3LW8A 1N0UA 5TVKA 2R6GA 2PEYA 3HU3A 5DLQC 5DSZA 2GEVA 4HB2A 1SXJE 2IUUA 3T61A 2XTZA 5FL7D 3AVTA 3A1VA 4B48A 4D80A 1OPXA 5CK5A 1KZGB 3NBFA 2VTKA 4HUQA 1Z83A 5KSPA 3B9QA 1L7VC 4NE2A 4AY2A 2A5JA 1C1YA 3NHBA 5L8VA 2GXUA 3ND8A 2RGBA 3TW4A 3AF1A 4G5QA 1N5LA 5GVSA 2C9OA 4CEIB 2QM8A 1X8KA 1P7CA 1UDWA 3OE7A 5DIFA 3IILA 3WBJA 4CYMA 3ADKA 4FINA 3PEUA 3K70B 4BZXA 1NLYA 1F2TA 3VR4A 3R7WA 2VA8A 3TRFA 4B43A 4Q18A 3AVWA 3CX8A 4TT3A 3MUFA 4FIDA 2ZI6A 3C7KA 3FMPB 1T3HA 1AA9A 4I4LA 2W6IA 3AP1A 1CULC 2FMXA 3NC0C 3KL4A 3LBIA 1KO5A 5LB4A 1GKIA 2ZSDA 4LYFA 1T6NA 3T15A 1NVUQ 3RS3A 2ZJOA 1KY2A 4JLDA 4YXWD 4XWOA 2Q0HA 2D2FA 2XEXA 3C41J 2PT7A 3LXXA 1E1QD 1TQ4A 2GJ8A 2ZI7A 5LBIA 3TAUA 1OH7A 1AIPA 1NMYA 1UEIA 2OM2A 1K8RA 1WBBA 3X2SA 2ZSEA 1AGPA 1R2QA 4A92A 4BFSA 1XJQA 2PMDA 3L2OB 3LWNA 4Q1BA 1HTWA 4UXHA 2F43B 3FVQA 3AV0B 3VU9A 3C4JA 5KPJA 5F3WB 3VKWA 5EXXA 1KJYA 4EPXA 1Z0DA 1NY5A 2QP9X 2XITA 2IYRA 2V6JA 3BOSA 1NJFA 1YRBA 2EQBA 2JJ2A 3PEVA 2CHVA 2FFAA 4LYJA 3LQQA 1N0VC 2BWJA 4U02A 4UKDA 3ZYCA 2GBLC 4OJQA 3RHFA 3M0EA 4PPQA 4S35A 4NDZA 4PR0A 4XTCS 4LDJA 2P6NA 1G8GA 1Q22A 2ZJ2A 4XVQA 3RS0A 2YWFA 4AK9A 3QXSA 3TH5A 3ONWA 2MMGA 4GI7A 1CJVC 3DOFA 4TYPA 5G53C 5JECA 1F3OA 2HJVA 2VF7A 2OHFA 1IHUA 4TLAA 2R6DA 4DSOA 1W4AA 5DI9A 3P26A 3K0CA 1UKYA 1FX0B 1HT1E 1P73A 4TWZA 4OBEA 5G3ZA 3PUZA 3D6TB 3I73A 3IUYA 4KODA 3RLFA 1CIPA 1SQ5A 3TUIC 5CITA 2V1XA 4D0GA 4PQRA 4OHWA 4OHZA 4EPVA 3F8TA 2J46A 2Q9CA 3LLMA 1XEXA 3W8RA 2XZPA 5B2ZA 1R6BX 3TAHA 1DG1G 1Q20A 1P5ZB 2F3TA 2OCBA 3QNUA 4MITA 4JLAA 2ZRGA 1SHKA 2AKAB 1F5NA 4Q4AB 3M6AA 3SS8A 3THXB 4OI2A 3GP8A 1IN6A 1CJKC 1VG0B 1P2TA 2ODBA 5AUQA 2BIFA 4O2RA 4NCHA 4OQXA 1AJEA 1JQJC 3IPXA 3T06B 2ZE8A 3QG1A 2QY9A 5C46F 1ODFA 3OFNA 1IY2A 3LFUA 2R2AA 2FSIA 4FN5A 4NPHA 4EUNA 2HT1A 3AVXA 4KHZA 2W2XA 2WICA 3W5JA 3W34A 2H5EA 3MWLA 2V9PA 2KI5A 3THYB 5KPDA 1ZP6A 1FNNA 4DLSA 3GEIA 2PL3A 4A0FA 5DHAA 2OBMA 2Z83A 2FDCA 3K9HA 1RJ9B 3U3JA 3U5ZB 1NY6A 1Z63A 4EPWA 3K8YA 4TLDA 1IONA 4M9QA 2BCGY 5FH9A 4A2QA 1F60A 5CDFA 5BN4A 3TBKA 4HDOB 4QBHA 4Q4HB 5GVRA 3I5XA 1T0HB 2F9MA 3B13B 4DVGA 3ZLJA 1UKZA 4TMXA 2GZDA 3ZVRA 2O8FB 1FQKA 1KKMA 2FF7A 1WCV1 1WE2A 1N6HA 2R65A 1W4CA 2JLZA 4PAMA 221PA 4FCTA 3C15C 3K53A 2ZI5A 4IVQA 2GWHA 2QA5A 1E2EA 1NN5A 2OXRA 1DVRA 2J45A 1MRNA 2QL6A 3QVVA 4LHXA 2J5XA 1BO6A 5HR5A 5JLJA 2HCBA 4V0KA 1IN7A 1NIPA 2VF8A 1UBGA 4KXFB 8OHMA 1W4BA 3SE0A 5JHHB 4TN1A 3TJZA 4TMZA 3F3YA 3NKVA 3QPUA 1UBEA 3CPHA 3WP0A 1W48A 2IYWA 2UVQA 3CKLA 3CNOA 4X8MA 1BMFA 1ETUA 2KWIA 3GJ3A 2GAAA 2IX3A 4DKXA 1VYTA 3AVVA 3PEWA 2I1QA 2ZJZA 5LDDC 4A15A 5CIQA 2ONKA 2KSQA 4OHVA 1EFTA 4O25A 4HEJA 3GLFB 5FTKA 4ZKDA 2C96A 2ERXA 1ZM2A 3SFVA 5A4JA 2QM7A 2WAXA 5KOYA 1KSFX 1CEEA 1FUUA 2ZROA 4XJXA 4M4SA 5EP1A 3TGPA 3KQHA 2X1VA 3OE7D 4JKIA 4MA4A 2AK3A 4OYHA 4Q9KA 1GILA 3TW8B 1RRFA 2JLUA 2D3WA 2QP3A 2VP9A 3MJRA 1MABB 1UKVY 3IBYA 2GZAA 4MRPA 4E09A 2P6RA 4CEJB 1TF2A 1XZPA 3SJBA 4TLCA 3PJRA 4X8HA 2GXQA 4HSEA 5FUVA 2AWOA 2FH5B 5J4VA 1GWNA 1H8EA 2ZREA 2ECKA 3GEEA 2YWEA 2EFCB 4LI0A 5CYPA 2ZR7A 2BBOA 2QMEA 4FI3C 3R8FA 4NP6A 1X6VA 2B21A 5JJKA 5BYJA 2IUSA 2ZE5A 4KFUA 4Y0VA 2WKPA 2FGJA 2QUZA 3I1FA 4KBFA 4CGZA 1HEIA 1N3BA 3B8HA 1KNQA 1X8JA 3W90A 4PPGA 3RNLA 2XOKA 4NYJR 4UNPA 4GOXA 2WSSA 1OW3B 3WYGA 1G3MA 2ZRLA 1SHZA 4GNKA 2IT1A 1CR0A 4Q9JA 4CT5A 4D4KA 1FTSA 1Z6XA 3VQTA 2H8KA 4C30A 3CBQA 3A6PC 2PJZA 2ZUDA 2GJSA 1OE0A 1Z2AA 3VR1A 4H1VA 1NMZA 5CJ2A 5ANRB 1G64A 4LCBA 1G3IA 2JJ2D 2Q9BA 2JGNA 2AHOA 2X77A 2B7CA 1KI2A 4URZR 2W58A 2MMCA 1F6BA 3T1OA 4MRNA 1E2LA 1KI8A 1GL7A 4PC2A 1QHGA 4C3ZA 1T3SA 3I5YA 2GEUA 3DM9B 2YNMA 3UKDA 1WXQA 2ZIAA 1JR3A 3GLIE 5JSZB 2OLKA 4P31A 1Z08A 2C98A 2C99A 3U3OA 4C0KA 1YR6A 4QXAA 3IQWA 4IOKA 5B30A 1KMHA 3KDSE 4Q9HA 4BZQA 2A9KA 1BYUA 1ESNA 3N70A 3AKDA 2FZLA 5FUYA 4F92B 2IS1A 4BQSA 4RD3A 3QXHA 4X8LA 1VG8A 1II8B 5JZVA 3R9XA 1T4GA 2YC4C 4KFTA 3AKYA 3I61A 3OIYA 4JYBA 4DT1B 5HKKA 2IXFA 5DI3A 2FG5A 2OG2A 3SJCA 3NTUA 4Q66C 1SVKA 4RFSB 4DEYA 5C2JB 4GDFA 1Z29A 3CX6A 5EE0A 4F4IA 1G3QA 1N5IA 1KGDA 4HB3A 4DUGA 3ZIAA 1NNEA 3FHTA 2GJAA 3WMEA 3T12A 2SHKA 5J40A 1TTTA 1X1RA 3U61B 1E9AA 1P62B 4RCZA 1GIAA 4A82A 2RGXA 3RC8A 3KKNA 3B78A 3OFND 2GXAA 1SXJA 2I3BA 3L0OA 4HZIA 5KDLA 3AB3A 1UJ2A 3B2EA 3I8SA 1KIMA 1OH8A 3OZXA 3BB3A 1DADA 4QBGB 3G0HA 2IWHA 4F93B 3HJNA 1LVGA 3RAPR 3VKGA 1MH1A 1HA3A 5HE9A 4BASA 5JRJA 2XGJA 4B6EA 3AF2A 5EXPA 2I1VB 1YZLA 5JJIA 1TADA 2Y8EA 4KFSA 1F2UA 2ZJYA 2GJKA 3UMRA 5AJWA 1Z47A 4M9ZA 4C0BA 2ZJAA 4Z8XA 4IDHA 4RSGA 1QVRA 3DHWC 1KI1A 1NF3A 3A1UA 3ZZ0A 3BAFA 4D82A 2OAQ1 4YC7A 4AG5A 3GJ6A 5FTJA 4BLOA 4XD7A 4DCTA 3THWB 1CJMA 5G3YA 2W83A 3U60B 5AK0A 1IN5A 2DBYA 3MRSA 4IVRA 2WPDD 1CR2A 3BBPA 3FMOB 1EX6A 4O3MA 4TLEA 3BFXA 2PCJA 3VHLB 1UKEA 4OQFA 1MO3A 2YINC 4AYXA 4K81B 2O5VA 1PLJA 1IAQA 2ZJ8A 3LRPA 4QC2A 2CDNA 5D3MA 5EXTA 1G20E 3BORA 4PHTA 4Q03A 1W36D 1BMFD 4PHGA 1U9IC 1IXZA 2BKEA 3WY9A 3I92A 2ATXA 1TL7C 2J7PA 2ZR9A 1FUKA 5SZIA 2IF0A 2Q6TA 2NZJA 1JPJA 3RS7A 1HT2E 2ZETA 4IKEA 4D4LA 1G16A 2P67A 5EP3A 2CL7X 2LCFA 5L3QB 4ON9A 2V1UA 3IIJA 5L3SB 4DLRA 3WMFA 3HU2A 3AP2A 4R98A 4LJAA 4Q1AA 3EWAA 5JS7A 3GLGB 4NYIQ 3I32A 5HZHA 5JWHA 1LNZA 1SZPA 1H8ED 1TUEA 2BBSA 2CJWA 2IUTA 3B1YA 1YR7A 2HV8A 2GVDC 3IKJA 4Q9LA 2D7DA 3B1XA 1E32A 1HV8A 1X3SA 3O8DA 4KYIB 3IEUA 5KSYA 1LFDB 4D81A 2P5SA 4JLPA 2QSZA 2FX3A 2WOOA 3JZAA 4LY6A 4P4SB 5DN6D 1JJ7A 2WJYA 2PZEA 4NYMQ 4BLSA 5FL7A 2G0NA 2GKSA 3KFXA 5BN3A 4C7OA 2XOKD 1DARA 2XZOA 4JBXA 2WSSD 4URWR 4BLRA 4DDVA 3K09C 5SZHB 4A6XA 1T5LA 2ZU6A 2DB3A 2QENA 3WHLA 1WBDA 5FBRB 1CP2A 2N42A 4KFRA 1U94A 2FSFA 3KTAB 2FEMA 1Y3AA 3BB4A 2YV5A 3VX4A 2AK2A 2D4HA 3TSWA 2NTYC 3K0FA 1J7KA 5ELXA 3NHAA 1KSJA 2C5LA 2E1RA 5J4LA 1I4DD 1XTQA 4PHFA 1N6OA 4JLVA 3QUSA 3NBZC 1NRJB 2AXPA 2E9SA 5EXSA 5EZ6B 1XTRA 5JFGA 1ZAKA 2DWPA 2PLRA 2FEOA 3NXSA 1TEXA 1Z6YA 3EWSA 4P33A 2Q3MA 3QKSA 3IO3A 1ELOA 4RZ2A 1YZGA 3T5GA 3TMKA 5JWRA 3TR5A 1YE8A 1N6NA 1T8UA 1GITA 1LV7A 4B35A 4YXWA 3EZFA 3C16C 1NMXA 4MUBA 3SDZA 1E1QA 3QG5A 4Y0AA 3KQUA 1T5IA 5FOXA 5JEEA 4RD1A 2GCPA 4LJ7A 1XPUA 2EVWX 1EXMA 3GFOA 1COWA 2ZSFA 5BQ5A 3CWQA 5AJYA 4Z1MA 4WA7A 1JXMA 4W9MC 1E79D 4HAYA 1J8MF 1HUQA 2XJ4A 5BW8A 2IYVA 1DE0A 4TZ6A 1E3MA 4XSGA 2BV3A 1BH2A 3C5CA 3U7FB 2XXAA 4FMCB 4ERNA 5J4KA 1ZD9A 4A8JA 1W0KD 3CB4A 3ZIAD 3Q85A 1VCOA 1ZNWA 1EK0A 1PUIA 4RY2A 4LX0A 3BB1A 4MDFA 5KNCA 4HDQB 4QBFA 3LLUA 2BDTA 2WWWA 3BH0A 1A5TA 1SKYB 1OFIA 3W6OA 2QTVB 1SXJD 4BEJA 1QHXA 1HYQA 1G41A 3T1TA 3A4MA 1XJ0A 1YZQA 4WXPA 2P0EA 2GEDA 4B32A 5AJXA 1NL3A 2ODEA 4IDQA 4DDTA 1KK3A 3KB1A 2IWRA 1UM8A 3WRYC 2H1LA 2QTFA 3V00A 4IEEA 4B2PA 2ZS8A 2BHRA 2OSBA 4QJ5A 5AR1A 4OK5A 4MKIA 5BXQC 1ESMA 621PA 2O0KA 5CB8A 1BYIA 4GPTA 3MWJA 1E2PA 3ASZA 4CDGA 2AFHE 1R5NA 4XVRA 1ZCAA 4G3XA 1KDRA 4IOLA 4MKGA 2B8WA 3S1AA 2JASA 2WV9A 1B0UA 4R9UC 1JECA 2BCJQ 5JI2E 3JZMA 3TQFA 4ARZB 2VSFA 4LC1A 1D9ZA 1L2TA 1G7RA 4XD7D 3KKQA 1ZIPA 2G0TA 3CRVA 1LY1A 3U4QA 3Q5DA 4LGMA 1FW6A 4IFEA 2QBYB 4FWIB 1CXZA 4KVGA 3LAWA 4D2IA 4A2PA 4LJ5A 1KO4A 1MKYA 1SULA 2QAJA 4B34A 1ZBDA 3U7EB 4R2HA 1Z6AA 4IEIA 4U7DA 1ZUHA 4KITB 2JJ1A 4XIGS 4MGKR 2QMOA 3LD9A 3VTKA 4IOJA 2V8OA 2W2TA 2V7QD 4JS0A 3AKCA 4FXPA 5HZKA 4WOPA 3CWZA 3AVOA 4QM6A 1R8QA 2G6BA 5J5CA 2YJTD 4AKGA 1KO8A 1Q3TA 3SEAA 1D2NA 2XB4A 3BIFA 4GMDA 4MYCA 1QHHB 2QAGA 2REXB 3KXIA 2O8EA 2IYUA 2J87A 4AYWA 3RWMB 2OXCA 4HZUB 2VPPA 2OCAA 2A5DA 4PAOA 1US8B 1S9DA 2GZHA 1JEDA 3PUYA 1NSFA 1HURA 3X1YA 3GLIA 3LNCA 4JL8A 1Q1BA 2DWOA 4LHYA 4XSHA 1TEVA 2R6CA 521PA 1E69A 3EPJA 1YR9A 4BLPA 4HAZA 1OXVA 2CCKA 2HLDD 3DZ8A 4PZZA 4NTZA 3UANA 4QGAA 4DB4A 1OH5A 4Z8YA 4JLNA 5C18A 2REBA 3KQKA 2IW3A 5JJLA 5H1YA 1AS0A 2R6FA 1XPOA 2WVJA 3UATA 1OSNA 1IM2A 1CU1A 3QE0A 1LB1B 4QL3A 5TDHA 1DS6A 1OHHA 1XF9A 1GRQA 1M6NA 2PX3A 4KSCA 2QNRA 1N2CE 1RRGA 5FR1A 2EWWA 2KBEA 2PH1A 3QPVA 1E2DA 4BE7B 3UPUA 3ZVNA 2V6IA 1I2DA 3QXCA 1QG4A 4PQYA 3K9NA 4RKEA 2CK3A 3OEHD 2CNWD 3AF0A 5CLLA 4B44A 2QPAA 5JI3E 4QRHA 1SVLA 1S9HA 1GUAA 2CHGA 4P32A 4TMTA 2ZYWX 3O8RA 2V55B 1NVXQ 4PO1A 2QT0A 1MV5A 2NGRA 2DYKA 2A7QA 2ZUBA 4TMKA 4LYHA 4ACBA 4A6PA 4N1AA 3UMFA 2BBTA 1HE1C 2VP4A 1YZUA 4PX9A 3SI7A 2A3RA 4G01B 1G9XA 5LB2A 1DAHA 1P60A 3MFYA 1AK2A 5F98A 1VTKA 4W5HA 3LY5A 3MSXA 4LK2A 3NDPA 1Z2CA 1COWD 1GZSA 1Z5ZA 4Z1MD 1WMSA 1W0JD 4HLUA 3T1VA 4EFNA 2JATA 2O8BA 5G40A 2CBZA 3HWSA 3NWJA 3C14C 2WBLC 2WSMA 1ANKA 4JT2A 5FOVA 1DAEA 4FW9A 1Z0KA 5FOTA 3P4YA 4K8OA 1CJUC 1KI6B 1QZXA 2OCPA 2YOFA 2BEKA 5AJVB 1VIAA 2CEAA 4ILEA 3QF4A 4PPNA 1ZMXA 3HU1A 4PC7A 1HH4A 1CTQA 3B1ZA 2YVUA 4EAQA 2Z0MA 4DCVA 2PEZA 4EJSB 2AFIE 3K9LA 5FR2A 4PZYA 2VHTA 4IOMA 4URYR 2GRJA 5FUWA 4IJMA 3K70D 2G9NA 1I2MA 2J0UA 1MABA 1UAAA 3KJIA 1Q44A 3TQCA 4XH9B 1XMVA 3QKRA 3EZ9A 3MGCA 1JR6A 2ZRCA 1MO6A 5DE3A 1W4RA 1RE0A 5IF9A 3FYHA 3B85A 2IF2A 5AUNB 1E9BA 1P6XA 3GLHB 3X1XA 4JSYA 5TV2A 1ZC4A 4PHHA 4ZKEA 2RHDA 2G88A 1ZUIA 1L4UA 4AG6A 2A30A 4C0SA 2N46A 4EFMA 5DO9A 2DY1A 3WP1B 1XWIA 3DZDA 5KTYA 1FL9A 4ZIRB 2IK8A 2QQEA 5FI1B 2IS2A 4M1KA 1JAIA 2ZI9A 3R8CA 4OQLA 4IDPA 4JLMA 5IDVA 4TTQA 4MYTA 3PUXA 1R10A 4ACAA 1OIWA 4IRUB 2F1HA 1NIJA 2ZVPX 5SZKB 3FFBA 2J1LA 2VH5R 1TU4A 2ZM5A 5F9HA 2IBMA 1LW7A 4JJKA 4M21A 3A1WA 2OO7A 2R8RA 5FBWB 1KSHA 2QP4A 2VQSA 1A2BA 3EZ2A 5K8LA 2JJ1D 1IN4A 1W44A 4U00A 3ZS8A 3ND9A 421PA 3W8NA 1Q0UA 3U7HB 3U2QA 5JHGB 3NBXX 5JSZA 4ESVA 2NZ8A 4C0JA 3NDBB 1M8PA 2BVNA 3WNBA 3EPLA 1XMIA 4UQOA 1EESA 1M2OB 4LJ4A 1QRAA 4ESHA 2GAOA 4F4JA 2OFWA 2HDNB 4U5XA 2VLIA 5FOUA 3L8ZA 4HUQB 4WZ6A 3F5FA 2WOJA 4E22A 3C8UA 5FBLB 1KAOA 3QPWA 1GG2A 2OUKA 4FWTA 2O8DA 6Q21A 1KY3A 5E7JA 2RGCA 1IJEA 2BJVA 1TF7A 2QEQA 2WPDA 3LVRE 2AN9A 2W2VA 3OIUA 2BJWA 2QQ0A 1EFUA 1OIVA 1F2TB 1RFLA 1OIXA 1R4AA 4JLKA 5HTKA 3R7WB 1KK1A 1ONBA 5FPSA 4DRZA 3K1JA 3RSLA 2FU5C 1G5TA 2YOGA 1W7AA 3TKLA 2EW1A 1N6LA 3WBKA 2ERYA 3E1SA 4Z54A 2VP2A 3T5DA 1VG9B 3AP3A 3I62A 1VHTA 3N5CA 3CONA 4XVUA 1FQJA 2J7KA 2PX0A 4L15A 2W00A 2RMKA 1DBSA 2WWHA 2HXYA 4H1UA 1G7CA 3T34A 2NPIA 1OHHD 4B33A 1WB9A 4Q4JA 2OFOA 3GJ5A 3A36A 4LJYA 4XOIA 2YHSA 5E3HA 1G4UR 4G1UC 2A5FA 3RABA 3KKOA 4KLNA 2EFEB 4LWZA 2Q9AA 3P4XA 1OLOA 1NVVR 1R8SA 1UADA 4L9SA 1TUIA 2P3SA 1M1YE 1FTNA 1ZD1A 3GJ0A 4PQFA 1OJLA 4JVMA 2CK3D 1W46A 3N2EA 3SR0A 2GF9A 3VU9B 4V03A 4C0QC 1XNJA 2OLJA 3DKVA 1XMSA 3SHWA 1XXHB 3LVQE 4LSGA 3MWKA 4S2EA 2CCJA 1U8AA 2Q21A 3FGNA 1K5DA 4I1UA 4Q1CA 5TARA 1E2MA 3W3AA 4HB4A 3THWA 3KJGA 1MO4A 4ZDWA 4E03A 1PJRA 1C4OA 3OEEA 1QHIA 2H16A 4OI4A 3DL0A 5DN6A 4ASUA 3CUEF 1KYIA 5E4FA 4TZ0A 3WNCA 5KDDA 2NG1A 2VRWA 4JT4A 3FFAA 2ZPTX 3U44A 3CRW1 2EU8A 3VR2A 1AZSC 2WWIA 1S0UA 2BM0A 3LBNA 2VYFA 4O0MA 2G77B 4OI1A 3VX3A 3TSZA 4XWKA 3U6KA 1JPNA 1DEKA 1G8FA 3BXZA 2MSDB 4DCUA 3FKQA 5KNBA 2B8TA 3GLHE 2NO6A 5LD2C 2A5YB 2GHIA 5TXGA 1GNRA 2JLSA 5H70A 4MKHA 4NCNA 3K0SA 2V3CC 2GK6A 1TMKA
chains in the Genus database with same CATH superfamily
4WRRA 3M4JA 1S0VA 5I7UA 3CVXA 1MR3F 1XQ8A 3Q0TA 1BXKA 3TXAA 4Q21A 1AO3A 3U0ZA 3DUFA 3AUXA 5A0VA 3CUVA 3STLC 3K7EA 3U3RA 4ITVA 1H8HA 1DTWB 4DK1A 2C3YA 2DWDC 4GRAA 1M2GA 1W581 2RJNA 3GDGA 2B20A 4K9NA 4W9NC 3B6EA 4LF7O 5J9FA 4WCEV 4LFCB 4TN5A 2O8CB 1T1GA 2IE8A 3SLGA 2WUWE 4Q48A 4KSYA 3QSGA 3BAZA 4WVFA 2I3AA 3KVYA 2IJGX 2IZ5A 4F60A 1YBFA 3EIWA 1QAMA 2FW8A 1BCSB 1A2KC 2JVKA 3F8SA 1I1NA 1FU4A 4RM2A 2FMFA 3SPGA 3A7DA 5A5DA 4FSXA 1JALA 4DJJA 4B2IA 1M7GA 2X2PA 3ND7A 4OD0A 1H93A 3S2IA 2IH1C 3ZJYA 1GM5A 1MUUA 1Z4MA 4CEHA 4U7FA 1AZTA 3OI7A 4MUNA 1PFVA 1FFXB 3BQ9A 1O7JA 1G18A 3BMCB 3CRNA 4RPHA 4OFBA 1TK3A 2EAUA 5KTSA 3F8WA 1ECPA 4U2CA 3FAVA 3ZMZA 3H4MA 3ZWBA 1UEJA 1FMFA 3EMKA 1Q7CA 4K6CA 4NMHA 3G2PA 4QJ3A 4NI5A 3O4VA 3L41A 1GKUB 4R4JA 3C3WA 1NULA 2F1IA 4HGZA 5ARDA 5CURA 4B3IA 1JKJB 3E8XA 4CTKA 1TU0A 1KMIY 5BMVF 1K7FB 2I6XA 1D7OA 3VH1A 2IEGA 3FNHA 3Q88A 4LF8B 2VNHA 1YONA 4IQFA 4AD8A 2VJDA 2ZJBA 4DIUA 1TAGA 4CM6A 4KQXA 3UIEA 5A04A 2XOKG 1DAKA 4EW1A 4AQYO 1X1BA 5A7GA 2VS1A 2EHDA 2VZ0A 1YB1A 3ZDRA 3IAS1 3P0JA 1OA0A 4LSZA 4L74A 3UM7A 2CMDA 4BE4A 4EYKA 4RXTA 1LPMA 3FVVA 3HQ4O 1P1RA 1IFXA 1BQZA 1AQYA 4B82A 1CUZA 1Z38A 2QKAA 3MB8A 4MW4A 2CJWB 2YFYA 3RAGA 4LJLA 3R4VA 1AT1A 1Z6QA 1XZFA 3D8UA 4PA3A 5COAA 3CT4A 1Z22A 1N3LA 3ZY3A 4HNGA 5FBQB 3DF7A 2CZGA 1NBMA 5B57C 4URFA 4JLSA 4PXAA 3NRCA 1FFBA 4NXNO 1UPUA 1F4MA 5G1PA 2PLWA 3TK1A 1L5HA 1QV9A 3ZCCA 1Y3HA 1YKSA 2AJLI 4HUTA 4KZPA 3DEFA 2KSDA 3UA4A 4IIEA 3D1JA 2AOWA 1XYGA 2G5PA 4K9DA 1E3EA 4E33A 2PMWB 4DR2B 5CVTA 2EX3A 4LDZA 2O8FA 4YWJA 4LXGA 2ZS9A 3CPSA 1RRPA 4GT1A 2QQ5A 8MHTA 1DJQA 2XYPA 3GLFA 2D74A 2F8MA 3SF8B 4E5PA 3TW8A 2EG5A 3VYVA 4BX0A 4HDNA 1E64A 4NAHA 1ISRA 1ADFA 2E7ZA 5LUAA 1Q7YW 4ZCTA 3MOIA 1K6MA 2JJMA 4CKBA 3C7DB 1MTZA 3I39X 5CYOA 5BO5A 4BGDA 1W0JG 5KJ6A 1X8LA 2ONZA 2ZI4A 4QDKA 5EJMA 1E2BA 2QROA 3OU2A 4EGCB 2XRZA 2YYZA 4TM7A 2AG1A 2F23A 1JH8A 2JHPA 2BFAA 3OZAA 5MN6A 4MVWA 1SUDA 2WLMA 3UKMA 3ZWPA 1UMDA 1BOFA 2GM5A 4LXQA 4JPRA 2H92A 4XDJA 1KEWA 1H5QA 4N5NA 1CE8B 3OZGA 2IYQA 1EZZA 3TZCA 1UPXA 1F7YA 3DHYA 2JLWA 3KV1A 2QN8A 3TQOA 1NC3A 3O3OB 2BR3A 1G3RA 2G76A 2J5BA 3TZLA 4X89A 4OKIA 5K4HA 2VOEA 2OFPA 5AW4A 3A14A 3UWMA 3E9NA 1S2IA 2JIBA 4FFMA 3TOVA 3VR6H 2PJRA 4V1CA 3TLMA 1XELA 2VYND 4ZT3A 2WJHA 1NQWA 1RIIA 3KG2A 2Q3LA 4QHSA 4AC9A 4C05A 3STVA 3LW7A 4BCBA 1A72A 3FDIA 2PD3A 1URFA 2FYTA 4OHXA 2R7LA 4R83A 2IQ5A 1PGQA 5CFRA 1H0KA 4R0MA 1FXKA 5LHGA 1WPQA 1G8JA 5AVTA 1GU7A 4Q01A 1V9SA 2VEDA 3I2YX 2AJDA 2QRPA 3C5VA 1FJ2A 2DMXA 5D84A 4GYKA 1A76A 3BWBA 4Y6PA 3CX5F 1VQ8V 3FXAA 3HVUA 2H17A 3TQRA 4I4TA 3L0PA 2H6EA 2GRUA 3B77A 3CX4A 3KSZO 2NUAA 3CLUC 1AC5A 1JTEA 3U40A 5K0CA 3NYRA 2RCYA 5B1SA 2O8DB 4GYWA 1M6EX 3RJTA 3WSTA 3CEJA 5H2FZ 4WBNF 4LGVA 2P2YA 3B60A 5JXIA 2X9VA 3N0RA 4RSHA 1N8KA 4IR7A 1QVAA 2GA8A 4Z6KA 3ZCVA 4NESA 1S8NA 4Y2PA 3ZXXA 1UC9A 5E0KB 4LTMA 2HI0A 2ZKIA 4OA5A 4AN0A 1OFUX 1U5CA 1WSBA 3PFHA 3LZCA 2OXIA 4DYVA 1QYDA 3T7RA 2X8BA 3EDCA 1ZNXA 2MYTA 3FZNA 1GYPA 4XIFA 3ZHCA 3DPUA 4K7JA 1TPZA 3KYDB 4QOGA 4CQLA 2PZSA 4BWYA 4LOKA 3FNQA 4P34A 3WQRA 4RQAA 2VYVD 1Z0JA 4B3JA 1BJRE 4BP3A 2DPMA 2C2BA 2X3YA 3UHPA 2IP2A 5A2GA 3LPMA 2I29A 2IBSA 1SCIA 1K73W 1Q7BA 4RHYA 3VR4H 2X0DA 1ODJA 3CW2A 2A3NA 4A9AA 2LKDA 2R9IA 5KA6A 3KQQA 2CJPA 3VHXB 1GGNA 3J81N 3K8OE 1VECA 1BS3A 1U3VA 2GK7A 2LNDA 4EVSA 1VE3A 2IJHA 3CRMA 4UCOA 1R6XA 2Q6OA 2A86A 3RQSA 3FDXA 3BJMA 4GXTA 4YR7A 2JFYA 3NVAA 1NF8A 3JYOA 1ICIA 1TIKA 1GEGA 1IXBA 4X65O 3GDOA 3G79A 4QDJA 4CI9A 2QGNA 3ILVA 4GL2A 2Z6AA 4KE8A 3MDSA 2R60A 4EQ6B 5TVGA 3OF3A 4P0QB 3CY6A 4PGFA 3QYFA 1YWGO 2HQRA 4K3AA 2H8PC 4D9BA 1OWMA 2YEVB 3M2TA 4KDEA 4HLDA 4JLBA 2QMHA 2OZLA 4DR6O 5M04A 2ZJ5A 4O2LA 1GY8A 1BC5A 1XYYA 4RYDA 1MP0A 2H7VA 3HDQA 1I7NA 2Z3VA 1O0SA 1G291 5ALFA 3ZCTA 2NTNA 2XQVA 4CS3A 1UXKA 3ILHA 3SMVA 4DG9A 3PX3A 1JIKA 4PNPA 2GAFA 1WRBA 2CDBA 3PQCA 3VR6D 1TIBA 4J3JA 4OSOA 2QPOA 4MCAA 1ID8A 5K6AC 3HU3A 4HB2A 2OPHA 3IQHX 5A1TA 3NBFA 3S3XA 3C3MA 1QRDA 4AY2A 2JGFA 1PTKA 1Z25A 3K35A 2QM8A 1JEOA 5DLYA 1UDWA 2BZ0A 3HLYA 3ANXA 1MLDA 3TRFA 1ZN7A 2NTJA 2Z9CA 4O33A 3IMFA 4NR1A 5K5EA 2ZSDA 3DBRB 2WTBA 4NDNE 3EMVA 1KY2A 2XEXA 5HUJA 3M83A 5DBIA 2MWMA 2O57A 1Z5GA 4L6CA 2YFQA 3FWKA 3UUFA 4JUCA 1N36O 2PS3A 4DR5O 1YA8A 3TB6A 4HD8A 3F6PA 4LYJA 3QNMA 2CYBA 3C1AA 3RS0A 4MW6A 3W7BA 5GTHZ 4TYPA 3COZA 4TLAA 4AZ0A 2W70A 1R66A 1P1JA 2GN1A 3PUZA 2D6FA 3D6TB 3DHVA 4KODA 5AK5A 3PGJA 3FA2A 3IR6A 5IYZA 2H4ZA 3M6AA 3THXB 4DGSA 5JZBA 1JQJC 3BMOB 5K3FA 3O83A 2PO7A 1R4MA 4UTNA 1ODFA 3SLRA 2R2AA 1JIVA 2EL9A 4M0UA 3MWLA 4BO0A 3C74A 3EGEA 2DWCA 2Z83A 1RJ9B 1NY6A 4DM4A 4EPWA 1NT2A 1MO2A 5TX7A 4X1KB 1YV9A 2WJWA 4YRGA 2GZDA 3ZVRA 5JVDF 1WE2A 4XASA 1W4CA 4ZOCA 1UZMA 4FYJA 5J5AA 3FPEA 3QVVA 4MI6A 1RP3B 4V0KA 2VFAA 1UBGA 1PCXA 3K71B 2IYWA 3SD7A 3N7TA 4I5GA 5ETJA 1JDPA 1BHQ1 5JSFA 3HN2A 5HGXA 5JUWA 2AK3A 2EEPA 3PJRA 5H82A 3OKCA 5FUVA 4BVFA 4UTPA 4BMSA 4KEAA 3VZRA 1ZGBA 3TQIA 2FGJA 3N8DA 1KE1A 1J2UA 1RSZA 3DGEA 4NENA 1T15A 1P0IA 4IL6Z 4M54A 4D4KA 3M5CA 1UPCA 4N7JA 2GJSA 3G85A 4DC0A 4QBTA 1SZJG 2VXCA 4CKWB 4DV7B 3FY4A 1PTJA 1KI2A 3V42A 3ZGOA 3P9ZA 1T3SA 3MTAA 1U2ZA 4XJVA 5AJHA 1JR3A 3F3SA 1YQDA 3PQ3A 2W6NA 2C99A 3NOOA 2J6IA 3R09A 1ESNA 2X0LA 1JRLA 1XMPA 4N3GA 2IU3A 2IS1A 1MJGA 4Z2YA 3UKJA 2QTWB 1X80B 1VL2A 1BA2A 2WQ6A 3NVDA 4HBZA 3WRWA 3CX6A 4F4IA 1OWPA 2GJAA 1K63A 1ADYA 1OLUB 4N9WA 1DSSG 4PLVA 3UXYA 1VIMA 1YXMA 3B78A 3E61A 2JJ2G 5DYYA 3AB3A 1UOQA 3RUHA 4C78A 5I7EA 1T36B 3AF2A 2PKCA 2VAVA 1TADA 1FFYA 1U3GA 3OWOA 3UMRA 4TXLA 5AJWA 4KK3A 4C0BA 2UZ4A 1ILEA 5FTJA 4XD7A 3HNPA 3L02A 4HH4A 3ET4A 1SBNE 4OQFA 3HUFA 3FTFA 5B1IA 2VRCD 1QLJA 2IF0A 2D1RA 3FJYA 1JPJA 4PG4A 4CM5A 1QF6A 2ZSHA 4BNGA 2V1UA 2DPGA 3GRPA 2X13A 4AN4A 4QX6A 1V54C 5JS7A 4MWCA 3I32A 1FMCA 1GSOA 3EXHB 1SZPA 3HJTA 1WULS 1ZISA 2IUTA 2VT6A 5CGZA 3B1XA 1RXWA 3JW8A 3O8DA 2H1RA 1FBTA 3FUVA 2Q99A 1NOJA 2WSSD 2I7XA 5SZHB 5HJ2A 5F9MA 1SRYA 3BWVA 4YUXA 3IERA 1U94A 4HQ0A 4X00A 1U0SY 5EXSA 1NRJB 1HE2A 2FEOA 3KVVA 4RZ2A 4D9IA 2EX4A 2HWYA 1YOBA 3C16C 1CUXA 4UPEA 1KY5A 3TJMA 1BU5A 1MN6A 3JASB 1EN6A 4BMDA 3QELA 2E4YA 2EGUA 1CVLA 5BV2P 4XSGA 4JAVA 4LX0A 3G2NA 4RDXA 1N1GA 2HMUA 3W6OA 3PNMA 5T41A 2RGYA 5DM4A 3STXA 4QTZA 1HQKA 1GQOA 4PDMA 1GPLA 2ODEA 4UBLA 2B5OA 2BHRA 2XDYA 1H42A 2EW2A 2PGGA 2O0KA 4LNAA 1ORVA 1DX4A 3ZQKA 3F7OA 3N2NA 5JSYA 2BCJQ 5CBPA 4LGMA 4L8JA 3LAWA 1C4KA 1QGYA 4OXRA 1SK9A 4B2YA 4XIGS 2D5BA 2GZRA 4L1KA 3DE7X 1SELA 1BX3A 1QHHB 3KKYA 1UFRA 1Z2DA 1P7ZA 1JLLA 3N86A 3RK4A 2DOKA 1US8B 1XRNA 2LTAA 3VO8A 2XGSA 3W2TA 4RSRA 2ID4A 1Z5WA 4UOZA 3LKZA 1YR9A 1RYEA 4NNOA 1XALA 4XUGB 4I36A 2REBA 3DDOA 4XX0B 2Q67A 4M87A 1I10A 4EJ0A 3UAWA 2E4ZA 2ZPAA 3RVKA 2ZWPA 2XGOA 1IK6A 1N7GA 4QQ8A 2OIEA 1NASA 1Y6ZA 1U1FA 4KDRA 1JTVA 1Y6JA 1P80A 3MTGA 5HW0A 3GFQA 4PX9A 3SI7A 3G5AA 3P2JA 1F8XA 3RUFA 3SY8A 1FXWF 2HKIA 4JJ7A 4YCAA 2YY6A 5FYQA 1NP3A 4K8OA 4IFIA 1OCEA 2EATA 3DEHA 1CNMA 4PPNA 1V7QA 5FR2A 3G59A 4LTNA 5LGTA 2X5NA 4PA6A 2FLKA 1K08A 1G20A 1XMVA 3ZHSA 3QKRA 2Q7EA 2AUTA 4JSYA 4PZPA 3ZMVA 3M3DA 3WGVA 2JBAA 1BWRA 1W4LA 5BUSA 2N46A 1PT9A 3DLIA 3WP1B 2IS2A 2XWSA 2ZI9A 3O9ZA 3LCJA 4TTQA 4CBCA 3K30A 3NI2A 2PWYA 2E74B 1Q74A 2IP4A 4EEXA 3A1WA 1H2AS 3OZIA 5FBWB 2PIAA 3TIIA 5D86A 3E27A 4E5SA 5I48A 1QYCA 1Q0UA 2X0RA 3U2QA 4KH0A 2JEXA 4H17A 4CDMA 3D3EA 4FZ5A 5DNDA 1X7ZB 4QPKA 4MJ3A 4HUQB 3F5FA 5BW6B 2MYNA 4I2NA 3RU9A 3E48A 3P52A 2A1TS 4Z1VA 2VCEA 3S7ZA 5JAPA 3V6MA 3FOEC 4B6GA 2WW8A 2PSJA 4DK0A 2BJWA 1LBSA 3OMIB 2XODA 2WD7B 1WIWA 3NBUA 3PPYA 1ONBA 3O2JA 3H87A 4JOBA 3I45A 1W7AA 4KQ2A 1TW2A 3A26A 1HOTA 1W29A 4OXXA 3QUBA 4A7PA 2CB9A 1FQOA 3IKMB 2MT9A 4H1UA 5KZMB 2YIVX 3RABA 1JA8A 1AMNA 4GPBA 3AI3A 3P4XA 1Y4SA 5FJIA 4UDXX 3NAGA 1NZJA 2Z5VA 2ATCA 3IMGA 1U8AA 4BMCA 5FHRA 3BVOA 3GG9A 3HBAA 3V3TA 1ZONA 4N4AA 3N8NA 2HHHB 2IIQA 2CTWA 2HSGA 3AG4B 2H1SA 1JPNA 5KNBA 3TQQA 4MKHA 5LDHA 1XTZA 4CG2A 3A1CA 4UBIA 2N1BA 2C9CA 4MRRA 4D43A 5DOVA 1XEXB 3ASOB 2A78A 3TVTA 1F7UA 1XFAA 1M1KW 4J0HA 4NCKA 4QYWA 4YQFA 5DPMA 2JIQA 4DNFA 1CY4A 4H9GA 4I8XA 4WLVA 5AHKA 1O5TA 4G8DA 5KHIA 2BISA 4YCDA 1WL8A 4C7JA 2GCNA 3IA2A 4ZXFA 2WUDA 3O3MB 1SXGA 2DYSC 2DFLA 1O97D 4BO6A 1MX5A 3D8HA 1PD0A 1IJFA 1SVSA 3VTAA 2JGRA 3O8BA 3B3QA 4UU0A 2PVPA 3C8ZA 4I5EA 3D2AA 4IRMA 4RXUA 2ZUEA 2YWDA 1CPYA 1N2CA 1OZAA 4BMNA 5LNK6 4QICA 3SZ3A 1W2HA 3LV8A 1QPGA 4B7KA 4YAIA 2IL1A 2LGJA 2X9QA 2RBKA 3ZJVA 5ICSA 3MUEA 1FXVA 1GXSA 3HL4A 4C9BA 4XQCA 2C2HA 4TXNA 2CE7A 2UYGA 1BG6A 2PMFA 1M34E 2VNSA 2ZB4A 3EG9A 4PC1A 5FRDA 4NCJA 1P7YA 4AT1A 3JVVA 2MCFA 3UICA 4I14A 5KOJA 2F1JA 3RJ9A 3QIVA 3GZNA 2I71A 3ZV3A 2XMPA 4ASUD 2HBRA 4AJOA 1LUWA 1OILA 2JVDA 3B48A 4RE6A 2CNDA 2OC4A 4DV5O 5AKXA 1WSWA 4WFGA 1NJGA 1T4MA 3ZX5A 1RLJA 3GK3A 2L69A 2IYLD 4IGKA 4ZDIA 3VAAA 4R3WA 3R75A 3HZHA 3FBGA 2O5EA 1V2GA 4D57A 1RKXA 2GMWA 4PBTA 1ZHOA 4WESB 4QUGA 4HFMA 4E1VA 4NBVA 5E6RA 4MUYA 4R8CA 5CW2A 2PBLA 4WFIA 5EPEA 5HJEA 4NBRA 1J8YF 1P61B 1PV2A 3RVPA 2I6SA 5FPTA 1FDOA 1OVMA 1N7JA 3GARA 1QKKA 5K3EA 3T35A 1P2UA 1BDHA 4CR6A 1JF8A 1E79G 3GO4A 3EN0A 4NHOA 2Q69A 2BM9A 1BZKA 1IPEA 3HVRA 4LJKA 1I2ZA 2GPWA 5AXBA 3JQ8B 4EHAA 2FP4B 3MUOA 4O4JA 3BQMB 1N5RA 2JFQA 1NX9A 3RK0A 3K5WA 1XQWA 3AHDA 1BE3H 5KMGA 1AK9A 1JEQB 1V16A 4C4XA 2LKCA 2QRGA 3A9VA 4QNRA 5LXTB 1Z6ZA 3PC7A 2VQDA 3E2IA 3V1LA 4E5NA 1ZO8A 3RUIA 1GPYA 3VPFA 4R8RA 2RIPA 4FLFA 5IAEA 5DNYB 5ALUA 4Y9SA 1DRVA 1YVRA 4MKFA 2GI4A 4TKVA 5DHUA 1D0IA 4ZVUA 1PD1A 2EWVA 2QV0A 2ZAIA 3ZDXB 3UG7A 4I1OA 2JARA 5G41A 2WIJA 4F06A 1M2OA 3GUCA 3S44A 2JD0A 2ZSKA 3C4VA 2EWMA 4OL0A 1VPWA 1VDZA 5K0NA 4Z4FA 3GRZA 4G0NA 2C03A 4JUDX 4KQKA 4KUGA 4DWWA 3ANMA 1RCTE 2ZR3A 5JCJA 1E96A 1ZN9A 5DHFA 1KHTA 2IOHA 3KT8A 1A98A 5CVEA 5AI0A 4KN9S 4MUGA 1VCNA 3E8SA 3FPAA 4B9AA 1BU8A 4KQMA 4ZQHA 2ZR2A 3RYHA 4JODA 2O2DA 1T91A 4HNRA 1GUDA 3ZWVA 4BVLA 4LKOA 2AZ4A 4V0NA 3EGWA 3Q72A 3A9TA 3K9GA 4RTQA 3ILSA 1T4DA 4R2IA 2AN4A 2GPBA 1LX6A 3NJ8A 4LE0A 1S5PA 4I9QA 5CBFA 1KUQA 1YMVA 2V7BA 4C6SA 1KVQA 3NHPA 1S89A 4FKBA 1COWG 4TTRA 3SX2A 2Z8ZA 1FDUA 1P75A 1G9SA 2D00A 1NW9B 1S7CA 1K6JA 3FZQA 4OU4A 4NU6A 2BUCA 1J8QA 2NU7A 1N75A 3KJEA 4BECA 3SR2C 4EYGA 2EBWA 4RH1A 1JU4A 3P1JA 4BBZA 1N4DA 4HNTA 1L1FA 1JXOA 4HC4A 5FLEX 1ZU4A 1P6QA 1RJFA 4PTLA 1J5PA 1M33A 2QUKA 1Y8QB 1XTVA 3BE6A 2F43G 4GMHA 4RD4A 1SVIA 2O3TA 2HUNA 2X7HA 4HEHA 1XZMA 4YAJA 3GJSA 1SEPA 4NOLA 1EYZA 5L7WA 1U96A 2AJ8A 4FFWA 1KAGA 1HLFA 1OT3A 3EVZA 3TUJC 5AICA 5CEEA 3X2QB 1ZESA 4GP6A 4KCGA 2POCA 4HMOA 1G19A 2AX3A 1EVZA 3PKIA 1W73A 2WWGA 1WB7A 4QAJA 4EBFA 5A3RA 5JYBA 1KXJA 2ZYSA 5FQOA 4QRIA 1K9MW 2QLFA 3NFRA 3JALB 5FPYA 1VQ9V 1V8OA 5JROA 1WTAA 4FCCA 2OCDA 3GLKA 5K8IA 1E2GA 2I67A 3ZHUA 4NYMR 5EJ5A 5L3SA 5JFOA 4L9WA 3I3SR 3GLGA 4IUYA 1QG6A 4R3NA 4S1VA 3V80A 1BXZA 1L7BA 1X1SA 5CNMA 1JT2A 3EGCA 1L1QA 1EDEA 4GI2A 3JVUA 1I3MA 4G65A 2PUEA 1E0JA 2ANBA 4A4DA 3CLVA 2Y6UA 5LOVA 5PNTA 2O19A 5DX0A 4IQGA 3VA7A 4ZTZB 2ZT5A 5BSVA 3D2BA 2L0XA 2JIZA 1CRPA 5BOVA 1QGZA 1W2GA 4X71A 4QJ4A 2XJ9A 4INJA 2H29A 5HFNA 1WQ4A 4X6UA 4FT2A 4IXWA 4UJ5A 4D5EA 1RHKA 1IN8A 1N0NA 1LTQA 4UV8A 2PMEA 4B71A 2NXNA 3QEMA 3MPOA 4KC0A 2C58A 3F3MA 3HABA 5BSGA 1U2GA 3LT1A 3AF3A 1OY1A 1LTKA 4M3NA 2IEYA 2CC2A 4LCJA 3QVOA 1S5JA 3UGKA 3U80A 3DEIA 1E1RA 4GM0A 1CLUA 4C4YA 3MJ4A 2JFNA 1Z0FA 4L5JA 3CH4B 4DG5A 4UNSA 1HDIA 1E8MA 2FPIB 1JQEA 3U4AA 3T3OA 1DQNA 4MYRA 1Y6GA 5FPQA 4RANA 3WGHA 2C83A 5LZ9A 3SIPA 5AW8A 1OX6A 2IYYA 1QAQA 3RS4A 4FJ2A 3HR7A 1YDEA 1A9TA 4DLKA 3ZVMA 3BA1A 2DKNA 4U7OA 1PS8A 1XD9A 3MA0A 4OQZA 4ZVNA 5JADA 4EVRA 1ZUNB 3OR6C 2ISQA 4IIGA 1AXEA 4D4MA 1TLFA 2CLDX 4N5LA 2QTGA 1ZL2A 4HQNA 3VPCA 1BXGA 1K8XB 1NVEA 1M2FA 1RZRD 5DHRA 1KSGA 4BLVA 4EJMA 3ZXYA 1TQDA 2OKGA 3PCTA 4BUJA 2DPXA 2Q4PA 2NQ2C 3KJHA 5SZJA 1GTOA 4XLLA 4XYLA 1M1YA 1LQTA 3EVAA 5M7EA 3FYSA 2H57A 5LM3A 1XEWX 5JC1A 1IC6A 1KI6A 4BXOA 2XZDA 4L4ZA 3TEJA 1QUEA 1U0NA 4XDYA 3OTOO 3ULKA 1YJCA 1WKBA 1E6WA 2UUPA 4LV5B 4O4IA 1DXQA 1X7HA 2ZRIA 2I7TA 2A1IA 1QLWA 4H3VA 2IGBA 4TL8A 5FHQA 3H9QA 1NUUA 3HYRA 2HU8A 5J2TF 2VVTA 1ODSA 2R4TA 1KYQA 2VJNA 2P6OA 3VR5A 1N5OX 1UZNA 5SY6A 1XD2B 4G27B 3SPXA 3WLJA 4BL5A 2HREA 5CFQA 2DULA 3URMA 3KJNA 1UT5A 5AVOA 3TIVA 2QMQA 5GW7A 4HDSA 4UEJA 5BN1A 2DTXA 3TW4A 4OMCA 1EFRG 1A2QA 3WBJA 2B2NA 1NYQA 4A3SA 1ESEA 1GARA 1VLLA 1K75A 4MV3A 3MMSA 2HW8A 4KGXA 4YXWD 1PPJH 2YI9A 2PT7A 3O4GA 1WBBA 2FPGA 5EWJB 1NI8A 2J5QA 1M9NA 3LWNA 3C6BA 1J22A 3AV0B 3VU9A 2MSLA 5AW3A 5CFMA 2B82A 3H97A 2RFLA 2GBLC 3ZYCA 1TT5B 4S35A 4NDZA 3ZNNA 1IZ9A 5JECA 4CLXA 1BN7A 2ATKC 2PZJA 4PV7A 1DQZA 4JJIA 3GP5A 3RLFA 1T5BA 4MVYA 1MIHA 4DUYO 3V1NA 4M9CA 3NALA 2OCBA 1V45E 1U6KA 2ZDGA 1F5NA 2FE1A 2DETA 3L8DA 1T0IA 2NYVA 1V35A 2QYTA 4EUNA 2HT1A 2H5EA 2V9PA 2OHGA 3GWKC 5FLXN 3THYB 4MDHA 3WR5A 4DLSA 2QW8A 4ZCSA 2FDCA 2WJPA 3G0IA 3FHLA 5DM70 2BCGY 3EK2A 1K3EA 2GKGA 2EJ7A 1U1IA 1QIIA 1NKVA 4UVIA 2Q9UA 2GUZA 3KIPA 4OO3A 2Y93A 1U7OA 1P18A 221PA 4J2HA 4UAJA 3PGA1 2OXRA 2PTGA 4ARUA 2QL6A 3HMKA 2WTEA 1Q84A 1W4BA 1CYDA 1P84F 5KWSA 2HQBA 2NZYA 1EFTA 4BKMA 1CERA 4ANFA 2ZROA 1JHAA 5JNVA 2DBZA 1YHYA 3LYHA 3N8HA 3MJRA 3CXHF 3S2SA 2OV6A 1ZXBA 2VQFO 2ZYAA 4HSEA 1PDVA 4CLRB 4NZNA 1MIOB 3N39C 2IUSA 2ZE5A 4Y0VA 2WKPA 4RY8A 4WY2A 2WZCA 4BKOA 1XJWA 1CD5A 2LFSA 3B1KA 3PQDA 1PJCA 4RTRA 1CR0A 3MMXA 1G64A 2JJ2D 1K9SA 3T7AA 3FWHA 1EVYA 4GWLA 4PG6A 4WEOA 5LMUB 4YRTA 4JV5B 3AT1A 3DM9B 2EJUA 3HBNA 4ZVOA 1FSGA 4X90A 2KQUA 5LU8A 4NZMA 3ODPA 4C5BA 4EZEA 2IOYA 3COYA 4KFTA 3U4DA 2EFYA 3VPBA 2AXQA 3TTVA 3WWOA 3MWGA 4GDFA 4NVRA 1EWYA 4UOQA 1Q0LA 3IMEA 2VJQA 3VYTB 3GX1A 5TGZA 1A7KA 1U1DA 3IOEA 1SXJA 1WA8B 3MVEA 3LUAA 4NZPA 3N0VA 2Q62A 3C6KA 1QIMA 3KYBA 4BASA 5AMXA 1NLMA 2V6GA 3K6RA 5KQLA 3JQAA 4Y1RB 2W2KA 3IXQA 4Y6RA 3OMWA 2HADA 1EN5A 2R6ZA 2HRZA 3GJ6A 2K9PA 2PZMA 4F56A 4A0SA 4BMVA 5EHZA 2B94A 4X3CA 3ZDZB 3BFXA 2DN9A 2O5VA 1HDXA 4BV8A 3DVAA 2LDBA 3WWDA 4BIMA 1DJPA 1Y3BE 1Q0HA 1RQLA 1ODKA 4D4LA 2H3OA 4GX5A 5ELLA 3WGJA 4J90A 1Y4DE 3ZWDA 4O8CA 3B1YA 4EHLA 2GVDC 4II2A 2I2DA 4UZSA 3E7WA 5CPFA 5DN6D 2W4IA 3VNBA 2HJWA 2EJTA 4OP2A 5A4IS 1NWCA 2G0NA 4C7OA 5B3JA 2P3OA 1Y37A 5E79Z 2JCXA 1T9GS 5KAFZ 2AK2A 2HPAA 4OQPA 1KSJA 1I4DD 3OUSA 2AN1A 2G07A 2R6R1 4GH5A 5IKOA 3UK7A 1CS0A 3EWSA 1NNSA 3VMMA 2HK7A 2Q3MA 2C00A 1E1YA 2V7VA 1YZGA 3TR5A 1YE8A 3A0HZ 3T9BA 1T5TA 3HU5A 4L9RA 1TUGA 3QG5A 3KQUA 2WJZB 3BGOS 1R1BA 5I45A 2Q5FA 3OE5A 3PFBA 1T8WA 1RQ7A 2DQ0A 1CR6A 4DABA 4E2YA 5I7SA 3AHIA 4ZARA 2IU6A 4X7BA 3L9WA 4BEJA 4PZ0A 2DZDA 2P0EA 4HDKB 3IVXA 4GI5A 1EUCB 3GRUA 2YJ6A 2C42A 3L4JA 1MC4A 4MPJA 2JEUA 2R25B 5IDQA 4R81A 1QGUA 2BFCB 5ILOA 5FWXB 2JASA 1XFDA 3QVKA 3L0CA 4TUYB 2GBPA 3U4QA 3ZI7A 1OC2A 1RE1A 1WXGA 4U39A 4LG1A 3DW1X 4D2IA 4PLTA 3CLUD 4TXMA 1P29A 1CQXA 5G4KB 1KFEB 3AFGA 2JJ1A 5DCYA 2V8OA 3UKOA 3HCPA 3ZR4B 1ULAA 1L5RA 2ZIFA 3VSAA 2HDHA 1H2KA 2CHFA 2EIHA 1GR0A 3Q10A 4YDQA 4EW3A 2VHYA 3GLIA 4JL8A 2BKAA 2Q8PA 3LOQA 1E3SA 1LPSA 2HLDD 4V24A 4XCVA 1HC7A 5BW4A 3U1TA 2CW5A 1VJRA 3UAYA 1SCUA 4GF5A 3RC1A 2BPOA 5L53A 1TEZA 2MR6A 5HIKA 4LF4B 3ABKB 3AEQA 1E2DA 4WGGA 3EEYA 2VQEO 4PQYA 2QPAA 1S9HA 1AJNA 2GPJA 2QT0A 1Z39A 1QCCA 3G7SA 4R2WA 5L40A 4ZCRA 3U17A 4QYMA 4KK4A 4F3YA 1YGPA 3IURA 5K0ZA 4Q24A 3VPDA 2HNBA 5TR9A 4Q7QA 1KYVA 4Z1MD 1WMSA 4KR0A 4FW9A 5FOTA 4C0WA 1CJUC 2YOFA 4LDAA 2CEAA 2OD7A 3A4IA 1VQLV 3OX1A 4EUSA 3LS2A 4QYTA 2YY7A 3E3NA 4URYR 2XIQA 1I80A 5EN4A 3ND5A 2ZRCA 4EVQA 3X1XA 1VI2A 5TV2A 2GN6A 4EK9A 2RHDA 4FYWA 5DULA 5BNIA 2QN7A 4QFBA 3QYJA 4BIOA 1UL1X 3OMNB 2GN9A 1VIBA 5G1NA 3BTSA 1VXRA 4FOTA 2XKAA 3B4SA 4JCOA 1OIWA 1CZRA 4UC0A 2E55A 3FFBA 2J1LA 5F9HA 2IBMA 4X62B 1GO2A 2OO7A 2QP4A 4CMEA 1VPEA 3AJAA 1B8UA 2XGMA 4OFWA 5HDQA 4B8YA 2H51A 3EPLA 1C7QA 4IP0A 5DTRA 3OCJA 1GG2A 1RAFA 2XAHA 3ZI4A 1JFFA 2GJ4A 4UHCA 4YY3B 1JFLA 3BFRA 2QEQA 3QPBA 1R1DA 1RYYA 1KVSA 1ROPA 1EFUA 4DGQA 1R4AA 1Z15A 3BEOA 5FPSA 3DZGA 7YASA 5CT5A 3WBKA 3DLHA 1O95A 10MHA 2OFOA 3WWPA 1PR5A 4XOIA 3TR6A 4BB5A 5LQUA 3K32A 1PZXA 4EFBA 3QFTA 3N2EA 3ICXA 5A3QA 1GAQA 4L85A 2JL1A 4E5YA 3MHPA 3SHWA 1E18A 3LVQE 1XHLA 5JAHA 1EIZA 5DECA 1K5DA 2GO7A 3THWA 1K5PA 4QPNA 1V37A 4U7JA 4F6EA 2EF1A 3DL0A 3IQZA 3GFBA 3AW9A 4IMJB 3I2JA 4J10A 5JAQA 1A4IA 1ZJ5A 2QRMA 2EX0A 5LD2C 4CNBA 1ZH4A 3LUPA 1M2KA 2GK6A 5DHQA 1FRQA 1VSBA 1PD3A 1OV4A 1VQ6V 2IYSA 3HN7A 2GASA 5H68A 4YJFA 5GADl 1WY7A 2XY4A 2O3JA 3FNBA 2QRZA 4H13B 4DR1B 3RRZA 1N77A 3HM9A 2ZJ7A 4DMRA 2Y4TA 3OGIB 1RRVA 5JNUA 2PPLA 1ORHA 4Y3UA 2JCVA 2ZBGA 5EQFA 3FE2A 2ZITA 4PNEA 3OU6A 1HK7A 3DDSA 1CP9A 4GGOA 1UR5A 2VXBA 1JV2B 1JBKA 1PNLA 3SF0A 5EC2C 2VF2A 5SICE 5CNJA 4PGAA 3A4NA 4C89A 1Y3DE 1NSTA 3DMDA 3HBMA 1OZFA 5B3AA 1DX9A 1IHPA 1M1NB 4CH6A 3VHQA 1Y76A 4C22A 3IAAA 1P81A 2W2PA 2AGAA 2G6TA 5J23A 4R1NA 3LVFO 1H2FA 1DO0A 2M9MA 5F1KA 4W5QA 4KU4A 1SCJA 1QP4A 2V7QA 4MH0R 3QFHA 1UFVA 1B15A 2R5NA 4FCWA 1P2GA 1AS3A 2MSCB 3QE4A 2OC9A 1DDIA 2AFIA 1G66A 1YH3A 5BOSA 1E1LA 4S05A 2P5TB 2QN6A 3P9QA 2Q8VA 2J48A 2TMYA 3IT3A 1JA9A 4XDGA 4RGYA 1ZJYA 2VHQA 4BATA 3AM5A 1TZJA 4E6PA 3ICQB 4W6ZA 1Z62A 3RLIA 2B35A 4DV0B 4AURA 2K5UA 5BNTA 4O4HB 3MAQA 1HT0A 5F7OA 1X2EA 4YROA 2BKUA 2FG6C 3KEMA 5LMCA 2KE5A 1QBKC 4PX2A 2ZCJA 4AJIA 1Q17A 5INTA 4XIYA 2XB2A 1ZEJA 1NLFA 3KB8A 4J16C 4DADA 3H1IH 4LY9A 5HJ7A 5JCZA 1PFGA 1UBUS 1SUAA 3HEMA 3NDIA 3NM4A 1PYOA 4P53A 2R1VB 4F2GA 3ZW8A 3GCGA 1CUCA 3URKA 4ICIA 5FAKA 4R9NA 4FK8A 2JEOA 5IUNC 4FCVA 1Q6HA 5GJVC 2V54A 1LCIA 2V03A 3ZJ5A 4TWIA 2GX6A 2A9VA 4UMEA 3VDNB 1LTHR 2WNIA 1CUUA 1FP1D 2XUOA 1KBHA 3NHMA 3OOJA 2A5LA 1YJXA 2HRBA 4U3FH 2XVZA 3ELYA 4MUHA 4ECAA 5ARBA 1AKEA 5A3VA 3B82A 4PVCA 2PGJA 1N2OA 3PA6A 5FI3A 3ZRXA 2WLJA 1Y3IA 4ZYLA 3K6SA 2RN9A 3ETGA 3KEQA 4G1CA 3D8BA 4Q7MB 5JBQA 2D2CB 4N0QA 3HKCA 2QOEA 2ZAOA 4Q93A 2Y1GA 3C5WP 4I99A 3H11A 3EEBA 4BBAA 2IXBA 2ZXUA 1L9XA 2O0JA 2C3PA 4TL7A 4XTRA 4ND8A 5LHHA 2F17A 2MINB 1X0VA 3I2FA 3SXPA 5AVQA 4B4VA 4QTYA 4E46A 2QM0A 3LI2A 4Y2JA 2ZAYA 3L0DA 5EHIA 1P17A 4G2TA 3GWZA 1Y8ZA 1WPBA 2MOKA 1YKGA