2QGRA

Structure of the r178a mutant of delta pdz degs protease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
169
Chain Sequence
DETPASYNLAVRRAAPAVVNVYNRGGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNGQTITQGIISATGFLQTDASINHGNSGGALVNSLGELMGINTLGIGFAIPFQLATKIMDKLIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 40
structure length 169
sequence length 210
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qgrA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qgrA02
5LPRA 1GDUA 4AZ2B 1TMTH 3T27A 1UTJA 2ZIQH 2BTCE 2ODYB 3TIUA 2VWNA 2V3OH 5A0CA 1GBMA 1AFQB 2ZFQH 4BAQB 2Y5FA 2H5CA 1LHDH 4Y79A 1BTZA 2Z3CA 1EZQA 1MAXA 2XTTB 3K6YA 5EW2H 1T8OA 3KHVA 1OWEA 5K7RA 2ZPSA 1AD8H 1BTWA 2FI3E 3A7WA 1NC6A 3RXHA 1C1RA 4FVDA 1W3CA 4B76A 1N8OC 4OS7A 3RLWH 2C8ZB 2XC0A 2THFB 3L6PA 4OS2A 1YKTA 3E0NB 3EYDA 4OS1A 3KF2A 3RXDA 1BMNH 1CGJE 2BXTH 2B7DH 4YOJA 1SGFG 3PM3A 4WWYA 2A5KA 2J94A 3I77A 2AYWA 2EA3A 1PPZA 2FOGA 2GDEH 4GVUA 4WMFA 2ZDNA 2ZO3H 2BOHB 3SU2A 3EQ0H 1BQYA 2D8WA 3BG8A 3GDUA 5TCCA 5AFYH 3U1JB 1S5SA 1S84A 1OWIA 1GMCF 5LPFA 1DICA 2ZFTA 1QTFA 4CH2B 2WV5A 1Z8GA 2GTBA 3HKJB 2G52A 5JBTA 2XWAA 4ABBA 2BVSH 2ZTYA 1MCTA 1UVTH 2PTCE 1V2VT 3SU1A 1AUJA 2ZEBA 1ZHRA 1SBWA 3BTFE 2FOBA 4X2YA 4ABGA 1NRNH 4K8YA 4TPYA 1BTUA 1SGPE 3M5MA 1HXEH 3SU5A 4ZHMU 3TGKE 1TNLA 6CHAC 1FUJA 1EOLA 5A8XA 4D7GA 4WF8A 1ZYOA 4TPIZ 5C5OA 3A88A 3VGCC 1EJAA 1YGCH 1IQKA 4GCHF 2I6SA 4Y71A 5GCHG 2TGPZ 1ELGA 1FY8E 3U8OH 4Z0KA 3SOSA 3UIRA 2OCVB 1FNIA 3SI3H 2BD9A 3W95A 1P12E 2GZ8A 3RUOA 4ZUHA 2ZA5A 4UONA 2FYRA 3S0NA 1ORFA 1KLTA 3UOUA 3PROA 1C1MA 3BTME 3D49H 3M35A 1K1OA 1HBTH 2A4QA 2FEQH 3MI4A 4NGAH 2BLOA 3A7YA 4INLA 7KMEH 1GHBG 2ZFPH 2BD2A 1E35B 1XUJA 2FODA 2WPHS 5CHAC 3SNBA 1DSUA 2CHAB 1SQTA 1TBZH 1AIXH 1YPLH 2XBVA 1GBDA 5JPMH 3RU4D 3P8OA 1ACBE 2TGAA 3ZVBA 2XBYA 2XXLA 4MNVA 4OS4A 4FUFA 2ZU2A 3F68H 1G32B 3SNDA 1ZHPA 2BX4A 1VCPA 2VIOA 2JETB 1QA7A 4JK6A 1Y3XA 2AGEX 2FOAA 1C1PA 1Y3WA 5I46H 2CMYA 1IQIA 3NCLA 3SJIA 2QY0B 3A7ZA 3UFAA 1MZDA 2ANWA 1FI8A 2QC2A 1GHAF 3RP2A 3RXMA 1ZMLA 1BZXE 4ZHLU 3IG6B 3LGYA 1LDTT 3F9FA 2OLGA 1G2LA 1K21H 5DK1A 1XXDA 1XVMA 2AGIX 3SGQE 2F9PA 3ATMA 1O2KA 3E3TA 4YESB 4Q2KA 4JYTA 1C4U2 1ZR0A 1NU9A 1TNHA 4UDWH 2HWLB 1K2I1 1EQ9A 1TA6A 4KKDA 1OWHA 1ANEA 3MO3A 2C90B 1V2LT 1LHFH 3AASA 1BBRK 4HTCH 1AO5A 5DP3A 3GCTF 1PFXC 4XDEA 4NA8A 1D9IA 1HIAB 1ZSJA 2ESTE 1C2GA 1O5GH 2DE9A 4B74A 4NWLA 3SU4A 1BRCE 1P06A 2PUXB 1P02A 2VIWA 3TK9A 1O0DH 2AMPA 1TMBH 3SJOA 3ZZBA 1GBLA 1C2LA 2BOKA 5EW1H 5F8ZA 3MO6A 3EDXB 3BEIB 1EJNA 2AERH 3SJ8A 2VH0A 2LNCA 2Y82A 2CXVA 3MNXA 3MH7A 7LPRA 1O5EH 1Z8IB 1MBQA 4E7NA 3KCGH 5K0HA 4AG1A 1SFIA 3HPTB 3LONA 1UK3A 4Y6DA 1A0JA 1P09A 4F4OC 1J14A 3RXJA 3O8BA 3ZZ8A 4FUEA 2AH4X 1FXYA 4GHTA 4INHA 3TNTA 2FDAA 1FLEE 3PLPA 1ARBA 1VITF 2CHAC 1GBBA 1O3BA 3MOCA 5E2OA 3LC5A 4FUGA 5F03A 2ZHFH 1MZAA 4H6TA 1UHBB 2QXJA 2ZTZA 1GVLA 1GHAG 1YPHE 2ZCHP 4AFQA 1Q2WA 1DXPA 1V2NT 4ZROA 1NZQH 4A7IB 5LGOA 1UVUH 3ZVAA 2WPKS 1O35A 2BD3A 3T2NA 1LVOA 2KAIA 1CHGA 3FVFB 4ISNA 3L3TA 1C5WB 1BHXF 3O8DA 1ZMNA 4I8GA 3PTBA 3ENSB 1WUNH 3RMMH 3URDA 1NRPH 1ZTJA 3T62A 2GKVE 2IJOB 1UJ1A 1C9PA 1EX3A 1GJCB 1RTFB 1L0ZA 3KEEA 3RM0H 1SSXA 4BXWA 1WSSH 1O3OA 3V13A 2B5TB 2A32A 2Z9JA 1NESE 5TCAA 5EQQA 1Q31A 1RJXB 1T8NA 2JH6D 3UUZA 4FUJA 4AB8A 5FAHA 1O2NA 2C8XB 4CHAB 3HK3B 5DPAA 1L1NA 4AB9A 4MPVA 2ZU5A 3AW0A 5AHGH 1D6RA 1HAVB 4K3JA 1IQFA 1BCUH 1C1TA 4LK4A 4I8KA 2HVXA 3RXCA 1FN6A 1A2CH 1BTYA 3L33A 1P8VC 1GI0A 1F5RA 4ISHH 5C1XA 1UTNA 1C2DA 2OQ5A 1DOJA 4BAHB 3PMAB 2FO9A 1ZPBA 1AU8A 1C2MA 1AFQC 1SGCA 4BAOB 3A7VA 2IOTA 1FY4A 5F8XA 1S85A 1O34A 1S81A 1TNIA 3RXSA 4DY7B 3F9HA 3UREA 1C5OH 3M5NA 1O3JA 2NU0E 1H9LB 1UHBA 1DWDH 1C5XB 5FCKA 2P59A 1DXWA 3B23B 4Q7XA 2PWXA 1HAGE 3BTDE 2QV1A 1TNGA 2UUFB 1J17T 1GI5A 2BY6X 1SGFA 1S83A 2CV3A 3PO1C 2BHGA 1DUAA 3C27B 3BTEE 3GY7A 1HAXB 1O2HA 1PPEE 5LH8A 2O8UA 3SNAA 5L30H 1C2EA 1DLEA 1NY22 1XUKA 4A1VA 3QZRA 3UNRA 1ZTKA 2OC8A 2XBWA 1O3CA 1XUGA 1GJ8B 3EA8A 4K1TA 5J4SA 4DGJA 4NA7A 2RDLA 1TWXB 2ZFSA 1ELDE 4F49A 1PQ5A 1O2PA 2BZAA 3M3VA 3KQCA 1C5PA 2R0KA 2ZDLA 1O3LA 4MDSA 3U1IB 1EATA 4WMEA 1HV7A 1EZUC 3MNBA 5PTPA 2VGCB 3NZIA 5BPEA 1P9UA 1RIWB 1HXFH 2AFQB 1AUTC 1W0YH 1LKAA 4GLYA 4I32A 1AWHB 1H9IE 4CR5A 1BBRH 1W11U 2TIOA 1CE5A 1QBOA 5C5NA 1XKAC 5JB9S 4DVAU 1RTKA 2GVFA 3E0PB 1KYNA 4Q7ZA 3ZYEA 3K65B 3ZVFA 1BDAA 1IAUA 2B0FA 1MD8A 3GDVA 2W7SA 3SGBE 1GI6A 1HCGA 1ETRH 1YPGH 2ZFRH 2ANKH 1G3CA 3M7QA 2GV7A 4DIIH 3RXBA 1GI9B 1YLCA 2H2ZA 2UWOA 4WXIA 3QDZB 1C5SA 3ZZAA 4SGAE 3ZVCA 2W3IA 1AN1E 4MVNA 1N6YA 2Y7XA 3RU4T 2EEKA 3RXLA 1C2JA 2SNWA 3BG4B 1AKSA 2PW8H 3FP8E 1WU1A 4JZEH 2PKAB 2FI5E 4KTSA 1DX5M 1DFPA 1IQLA 1GBCA 4X2VA 2RA3A 2WYGA 1SFQB 1JIRA 1CA8B 4NZLA 4ISOA 1Y59T 1V2PT 6GCHF 3A83A 1MMJN 2C8WB 3S7HB 1EB1H 1MQ5A 2O8TA 1GHWH 3ZZ3A 1TX8A 2LPRA 2VWLA 5C67A 5L2ZH 4XOJA 4IN1A 2R2MB 4TYDA 1XUIA 3VB6A 2ODQA 1FIZA 1SHHB 3FP6E 5DP5A 3NWUA 1GDQA 1YLDA 2GMTB 3ZVGA 1C4V2 5EQSA 3BIUH 1KXCA 1CA0B 3PMJA 2FOMB 1QFKH 1O2VA 1IHSH 1QHRB 1L1GA 3UWIA 5JBCS 1BUIA 1CO7E 4GHQA 1P2IA 3N7OA 3VFEA 1NM6A 2R9PA 1BMAA 2XNIA 4K69A 2VJ1A 1A5GH 4D76A 1T31A 4KGAA 2WPJS 4ABHA 3TU7H 4X1SU 1BIOA 2RA0A 1C1VH 1QCPA 4A1TA 1K1MA 1ZZZA 1L2EA 3OY5U 2GP9B 1GJ7B 3NPSA 1QB6A 1YP9A 1DWBH 1MTVA 4Y8ZA 3TLOA 1WYKA 1QL9A 2F9UA 2J38A 2FYQA 2V6NA 3QTOH 5A0BA 4UFFH 2QF0A 3LGTA 2XYAA 5E8EH 1LCYA 1FV9A 3LH1A 3KQBA 5DP6A 3ZZ4A 2O8WA 2CF8H 4I8HA 3GCNA 3QZQA 4NCYA 1O3AA 1HAYB 2GZ9A 1SLUB 1SGEE 1YPHC 1C1NA 3PWBA 4TY6A 1DANH 2P8OB 1IQMA 4I7YH 3EA7A 2C3SA 1LTOA 4AORA 2NU1E 2OQUA 2A7CA 1P2MA 2GCHF 4NFFA 1THPB 3M7UA 1ABIH 1GBIA 1GJ4H 1K1PA 1EAWA 1FZZA 2FPZA 5FPTA 4E7RG 4X0WU 2TGDA 4B1TA 1O2GH 1RIWC 3H7TA 2OC7A 1HJ9A 1X7AC 2OTVA 2VVCA 3SUEA 1C5TA 1ELFA 3RXPA 1YCPK 4IS5A 3M5LA 1Z6EA 5GWZA 1EKBB 1C1QA 1QJ6B 4JK5A 1LO6A 1P3CA 1CGIE 2PV9B 4JYUH 2WPLS 3A8AA 2PTNA 4PROA 1RTLA 2H9EH 1O2RA 6CHAB 2FOEA 4WY3A 2G5NA 5T3HA 5TJXA 1O2XA 1SG8B 3R3GB 5BRRE 4BAKB 4YZUA 4Y7AA 2BYAX 3RXEA 4ASHA 1ANCA 3SQEE 4CBNA 3LGIA 3V12A 1TAWA 1MUEB 5A09A 1KLIH 2JH5D 3TJOA 1DPOA 1YPEH 8LPRA 1WAYB 2OC0A 1T8LA 3ATIA 1DY9A 1LPGB 3ELAH 1T8MA 1OP0A 1L4ZA 1AZ8A 1KXBA 4DW2U 3ATWA 1KIGH 3LJJA 2A4RA 3HGNA 1XUHA 4ISIH 3M3SA 5T6FA 1C1SA 4CH8B 1TPSA 4B2BA 4ZKNU 1ZGVA 4U30A 2SGPE 4X1QU 5EU8A 1UTKA 1OX1A 2WUCA 2GCTB 4FU8A 1XVOA 1THRH 1T7CA 2A7HA 2G00A 1HAOH 1ZPZA 2K1QA 3ZZ6A 5IDKA 2W3KA 2O9QA 3E6PH 1AKSB 2W7UA 1P03A 1HAPH 2ZGCA 7ESTE 1UK4A 4IC5A 3QX5H 1SOTA 3PMBB 3VXEH 3FP7E 2QGRA 4X1RU 3A80A 1NTPA 1TIOA 2ODPA 3A84A 1ESBA 2QXHA 2FS9A 1INCA 1XMNB 1BMMH 1WTGH 1IQHA 2FLRH 3KQDA 2D26C 3SNCA 3ESTA 3CS0A 5H4IB 3WY8A 1MKWH 3OU0A 3CENA 1HNEE 1K1LA 2BD4A 2Y6TA 1BOQA 3Q3YA 1O3NA 4Y7BA 4LXBH 1F7ZA 2EI8A 1BT7A 5EPYA 1H1BA 4HGCA 2G81E 2OUAA 1Y5BT 2OBQA 1GPZA 1SGDE 3W94A 1F0UA 2ZZUH 2BDHA 3F9EA 1C1UH 1KSNA 4X8TH 3SUGA 3BSQA 1KDQA 1TQ7B 1VGCB 2FOFA 1ZRKA 2ZHWH 2BX3A 1YM0A 2F9VA 3SO3A 1S82A 3PYHA 1EXFA 1SGQE 1D3QB 3OSYA 3VPKA 3GY2A 5EG4A 1FMGA 3AAVA 1HUTH 1C4Y2 1GI1A 1BJUA 4BXSA 3ITIA 2ZWLH 2ZU4A 1V2MT 3ZYDA 1KXFA 1JBUH 3LT3A 2R2WU 1TNKA 1ESTA 1WOFA 3SORA 1C2HA 1RRKA 1EUFA 1S6HA 1PPCE 1UTMA 2FXRA 1GI2A 1QJ7B 1WV7H 3TVJB 1O5FH 1EPTC 1C5QA 2VIQA 2PR3A 3F6UH 1FPCH 3A87A 1WQSA 1QRXA 1FDPA 5C20A 4A6LA 1JXPA 3MHWU 3I78A 1EOJA 2RCEA 1O38A 1O32A 2J95A 2ZDAH 3OY6U 1GBAA 3E16B 1O2OA 2YNAA 1TPPA 3GYMA 1QB1A 1O2LA 4FUBA 2H9HA 4DIHH 1O2ZA 1A4WH 1SQAA 3BTHE 5FBIA 3DA9B 2ZGJA 1G9IE 2WYJA 4BTTB 2OP9A 2SGQE 3NKKA 3P8GA 4VGCB 3RXTA 1UTLM 2DE8A 3QGNB 1BHXB 1YCPM 3AAUA 1P2KA 1VCWA 3SV2H 1OKXA 4CRDA 1MKWK 2SGFE 1MAYA 3SV6A 4RKJB 1ELVA 3RC6A 1TOCB 1CT0E 1JRSA 1AGJA 4AGJA 2FOCA 4FU7A 3A8DA 2ZGXH 2HNTC 2AS9A 4A92A 3RC5A 3FANA 1SMFE 1GBTA 3GDSA 2ZFFH 1Q3XA 2KAIB 4NIXA 4K60A 3ZZ9A 1SGNE 2ANMH 4ZKSU 1GMCG 4MNXA 2Y81A 4H4FA 4ISLA 4WJG2 1BRAA 2CN0H 1AY6H 2H1UA 3SJKA 3GYLB 2Z3DA 4CRAA 2BD8A 2HGTH 4K1SA 3FZDA 2VVVA 5GXPA 1GCTC 1NROH 1W13U 4X8SH 2ZC9H 1CSOE 3T26A 2TPIZ 3IITA 2GV6A 1GVKB 3KNXA 9LPRA 1GCTB 3NXPA 1ETSH 3RDZA 2ZPQA 1H4WA 3CP7A 1BTHH 1LKBA 1K1IA 1LHGH 5A8YA 1O2QA 1QBNA 2ANYA 3GY3A 3SHAH 3O8RA 1G3EA 4AFZA 1TGSZ 3QLPH 2Q1JA 2GZ7A 4RSPA 1O3GA 1TBQH 1A0HB 2P8OC 1IOEA 3M37A 4NIVA 1GJ6A 1HFDA 1MD7A 1BBRE 1BTPA 1G2MA 3O8CA 1QNJA 2A1DB 5EGMA 3DT0H 3LKWA 1ZSLA 2VWMA 1SQOA 1Y8TA 1O5BB 1EAIA 2ZTXA 1THSH 1TYNA 2Z9LA 1QQUA 5E2PA 1G36A 2XCNA 1C5YB 3VB7A 1IQNA 2ZCLP 2PHBA 4JMYA 1GHZA 4I33A 5F6MA 1O3DA 3TGIE 1SGIB 1GBJA 5FXLA 4U01A 2YOLA 3SNEA 4H6SB 3RXAA 1CU1A 2G5VA 1LPZB 3M36A 3A85A 4A5TS 1K22H 5T6DA 1O37A 4AYYB 2BMGB 1V6DA 1AWFH 1TRYA 1F92A 3MU5A 3QK1A 1F5LA 3SV7A 1LVMA 1UCYK 4B75A 1A61H 2BDYA 2PLXA 1GDNA 3TNSA 1MU8B 1OXGA 1WBGB 1QIXB 2R3UA 3A82A 5DP8A 2PGQB 2ZNKH 1AMHA 2ILNA 3BEUA 1ZGIA 2NU4E 1OP2A 2TGTA 3P8FA 1GHXH 1Z8RA 3P8NA 4CHAC 4J1YA 1FAKH 1GHBF 3D62A 2QIQA 1N8OB 4AYVB 5HMAA 1D4PB 3DUXH 1TX7A 2G8TA 1MTWA 1UCYE 1IHTH 2GCTC 1BJVA 1HPGA 3SUDA 1ZOMA 1GJDB 2XCFA 3A86A 3JZ1B 3P17H 1KTTB 2ZU3A 2ZHQH 5E0GA 3RLYH 1WQVH 8KME2 1U6QA 1TGNA 3ZZDA 1CBWC 1N6XA 2VINA 2NWNA 5A8ZA 2A5AA 4FVBA 1DE7H 1UK2A 1NU7B 4Q80A 1PJPA 1FY1A 4IGDA 1IQEA 1YCPH 4MQAA 2VIPA 1KXEA 3UWJH 1CQQA 1F5KU 4BTIB 2RG3A 3GCOA 2A2QH 5ESTE 5EXNA 2BM2A 1A3EH 1NPMA 2BY8X 4TWWA 1O2TA 1DS2E 2WPIS 4O03A 1DVAH 2GT7A 4IN2A 2PUQH 3GY5A 2OXSA 2XC4A 3A7TA 3TH4H 2Z9IA 2V0BA 1A5HA 1GBKA 1NFYA 4B73A 2ULLA 1WTHD 1LQEA 2ZDKA 1GBHA 3FZZA 3ZV9A 3MU1A 3BN9A 1PQ8A 3K2UA 2I6QA 2R3YA 2GCHG 2FLBH 1BRBE 1OPHB 2A5IA 1H8DH 3BEFB 1BB0B 1TPOA 4X6OA 1YPJH 1V2TT 1JOUB 4IW4E 3P95A 4MLFB 3RXKA 1TMUH 2P93A 4X6MA 1ELAA 1PPFE 1W8BH 4ZH8A 2J92A 2BY9X 4KELA 6GCHG 2FX6A 1F2SE 2XC5A 5HXFA 2P3FH 2ZU1A 1V2WT 2FTMA 2Z7FE 2BLQA 2BDCA 2QA9E 1BMLA 1Z6JH 2QAAA 1P9SA 2BDIA 3STJA 2FP7B 1ELBA 1HAHH 4ABJA 3ZZ7A 1QJ1B 1YC0A 2SNVA 1P01A 5SGAE 4YOGA 2UWLA 2FESH 4CRCA 4X2WA 5DP7A 3ODFA 1O3HA 1V2KT 2HALA 3VXFH 2WV4A 4D8NA 5FCRA 3Q3KA 2PGBB 2Y7ZA 1RS0A 2OBOA 1QL7A 1FN8A 3HK6B 2BQ7B 1NFXA 5ETXA 1DWCH 1MTNB 3SV8A 2BQWB 1MCVA 1CHOG 1O31A 4NFEA 1PPHE 2EC9H 3D65E 1QR3E 1SLXB 3M61U 1CVWH 3T29A 5I25A 5EPNA 2ASUB 4OS6A 3M3TA 2J34A 1FY3A 3HATH 2ZP0H 3QUMP 4MNYA 2W26A 4ESTE 1W12U 1PQAA 3BF6H 1GBEA 1O2IA 4MPWA 1TALA 3OTJE 3QWCH 4HZHA 1DDJA 1HLTH 1A0LA 2V35A 1EP5A 4XE4A 3UNQA 1E36B 1SOZA 4WMDA 5AFZH 2BZ6H 1EPTB 1GHVH 4YT7H 1QL8A 1AE8H 1N1LA 3S9AA 4KTUA 2ZPRA 4DT7B 4UFEH 2FMJA 1GCDA 9ESTA 3RC4A 3TH3H 3G01A 3M7TA 4H42U 1KDQB 4QT8C 4ZXYH 1OOKB 3ATLA 3RU4E 5HM2A 1SGRE 1EZXC 2ALVA 4MTBA 4O97A 2XWBI 2J9NA 2Z3EA 1P0SH 3K6ZA 1Z8JB 2HPPH 4DG4A 2Z9GA 4RKOB 1EASA 3DFLA 1FJSA 1SLVB 1TA2A 4GUXA 1HAIH 4CRFA 1QBVH 5IYTA 1C5MD 1O5DH 4Y11E 3Q00A 4X1PU 1VGCC 2EI7A 4NIYA 1ESAA 2AEIH 2F9OA 1UTPA 3QO6A 2GGVB 3P70B 1GHYH 1W10U 2VNTA 3E90B 4X2XA 4FU9A 4TY7A 1C5NH 1ZJKA 4FUDA 4K1EA 3UY9A 1J16A 1NRSH 2A31A 1UO6A 1FAXA 3A8CA 2PSXA 3LDXH 2HLCA 4B71A 3VEQB 2P3UB 2WINI 4Y10E 3S69A 1AI8H 1O33A 1HJAC 1E37B 2SGEE 5EOKA 4OGYA 2QCYA 2HNTF 3ODDA 3VB4A 1O36A 3PLBA 1UTQA 4Y0ZE 1K9OE 3JZ2B 1D3PB 3SJ9A 2V3HH 4FUCA 1TGTA 3RXUA 4GCHG 1P2QA 1P2NA 4ZHAA 2VGCC 4WH6A 1V2QT 3SGAE 1XKBC 1ETTH 2ALPA 1O3MA 4ZKOU 2AIQA 5EODA 1ABJH 1DITH 4BAMB 2A7JA 1SVPA 1TRNA 1HAZB 1C5RA 4R8TB 2G51A 4KP0A 4X8UH 3ZZCA 1V3XA 1JIMA 4AOQA 2GDDA 5JDUB 1D3DB 5C1UA 1O3EA 1G30B 3SU3A 2BXUH 3MWIU 2VVUA 1GI3A 2FTLE 3E1XB 2GMTC 1V2JT 1C2KA 4FXGH 1AVWA 3UR6A 1GMDF 4MPUA 5DO4H 4KTCA 1C9TA 2QN5T 2PKSC 2SGAA 3S7KB 1TOMH 3GY8A 1GGDB 4GPGA 5FBEA 3GISB 4NSVA 1W7GH 4O9VA 2J2UA 3Q76A 3ATKA 4WH8A 8GCHF 3LGUA 2STBE 4K2YA 3EGKH 1MQ6A 2Z94A 3KQEA 3DHKH 2AMQA 2BLWA 1RGQA 5AVDA 2A0QB 3TPIZ 3BG4C 3TK6A 2F9BH 2OC1A 1WCZA 1NRQH 4I8LA 4WVPE 2BVXH 1QURH 1S0QA 2NU3E 2Q6DA 1ANBA 2IPHA 2UUKB 3U98H 1V2OT 3P6ZB 4JZDH 4D9RA 1ZJDA 2BY5X 1UVSH 2BB4A 4X1NU 4YLUA 5CHAB 1BRUP 3RXVA 4AN7A 1SB1H 1K28D 1ID5H 4MPXA 4DJZB 1PPGE 4YT6H 4Q7YA 1NRRH 1ZHMA 8ESTE 5G4BA 1S6FA 1O3PB 3RMOH 1QB9A 5DG6A 1P10A 1J15A 4O3TA 3OX7U 3A7XA 3E91A 2EI6A 6ESTA 3KIDU 2GD4B 4JZIA 1OSSA 4D9QA 1V2UT 4CBOA 1C5UA 1MTSA 1TLDA 1QY6A 2Z6BD 3TK5A 3RXIA 2BLVA 1SR5C 4AGKA 1PYTC 3LC3A 4RN6A 3S9BA 2STAE 3VB3A 3HGPA 3PMHB 5C2ZA 4E06H 3TJVA 4MNWA 3SV9A 1T4VH 1VR1H 3BTGE 2ZDVH 2ZHEH 2JKHA 1XM1A 4ZAEA 3NK8A 2ZCKP 4B2AA 5DJ7A 2BDGA 3U69H 1L4DA 2C4FH 5DKMA 3PO1B 4CREA 1TPAE 1Y5UT 2O8MA 3E8LA 5FX6A 5E0JA 1EPTA 1KXAA 1Z71A 1P2JA 3F9GA 1Y3YA 2SFAA 4ABEA 3UOPA 3SHCH 3T5FH 3SI4H 4Y8YA 7GCHG 3GICB 3A81A 4VGCC 3U9AH 3OYPA 2PSYA 1J8AA 1O2MA 3AVZA 1FPHH 2F91A 2WUBA 1ZMJA 1EZSC 1Y3VA 1DT2A 1PPBH 1GWAA 4NA9H 3TH2H 4IMQA 3TGJE 3C1KA 8GCHG 4Y76A 2PKSB 1C5ZB 1B5GH 1O3IA 2C8YB 1CA0C 5GCHF 3BIVH 4BOHA 3SU0A 1TONA 1QA0A 1FIWA 2SGDE 2XW9A 4K5ZA 1SL3A 3P92A 1O2WA 1YF4A 2D2DA 1OWJA 5FPSA 1C2FA 1C1OA 4AFUA 1YYY1 1F0RA 3SQHE 3MO9A 1VCQA 3PTNA 1KXDA 4X6PA 1MKXK 4BNRA 1O2JA 2F3CE 3MU4A 4ZXXH 1ZSKA 1B7XB 5DGJA 1GJAB 1DWEH 3S9CA 1RXPA 1SC8U 2C93B 3LGVA 3SN8A 1YPKH 2Z9KA 4XFQA 1PYTD 4GAWA 1O39A 5F8TA 2XBXA 4DOQA 3LOXA 5LPEA 1AQ7A 4Z6AH 2VWOA 4I8JA 3DD2H 2ZG0H 3Q3XA 3B9FH 4YO9A 2G4TA 5FX5A 2JETC 1Z1IA 2AGGX 1P11E 1BA8B 3SZNA 1IQJA 1TABE 1GL1A 1O3KA 1GI8B 1RFNA 3RXRA 3SW2B 5L6NH 5GJ4B 3LIWA 1SPJA 4LOYH 3SU6A 1E0FD 3DFJA 1A7SA 2A4OA 1AB9C 2HPQH 1CT2E 2ZI2H 5JBAS 3PWCA 4NZQA 4R0IA 1HYLA 2BVRH 3ZZ5A 5GIBA 1UCYH 2ZQ2A 1KTSB 1E38B 3GY6A 1OWKA 3U8TH 2A4GA 3UQOA 1Z7KA 4WXVA 3H5CB 1DUEA 4A1XA 1YPMH 4M7GA 2W5EA 3GCHB 1GG6C 1DLKB 1GMHF 2ZGHA 3MH4A 3PV4A 2Q6FA 3BTQE 1HDTH 1K1NA 3URCA 4ABFA 3F1SB 1MBMA 3BTKE 1TQ0B 2B9LA 3I29A 3UR9A 5A2MH 3TJNA 3MU8A 3RXQA 1H8IH 3RM2H 1GG6B 3GCHC 4LZ1H 1MH0A 1G3BA 1ELCA 4ABAA 2PKAA 1GI7B 3EAJA 1A46H 1ZTLA 4CR9A 1LQDB 2QXGA 4DCDA 5EXMA 4D7FA 3MTYA 4B2CA 2UUJB 4XBBA 5E0HA 4UD9H 2M5TA 1QRWA 2DUCA 1NO9H 2HNTE 5CMXH 2ZDMA 5HGGA 1AHTH 2CJIA 1AFEH 4O3UA 5HM9A 4IMZA 1KLJH 3T28A 2BQ6B 3UPEA 1MTNC 1O2YA 1MU6B 3RXOA 1ZLRA 1LHEH 1J9CH 3MFJA 3LPRA 4ZKRU 4NG9H 3A89A 1W2KH 7GCHF 2A2XH 1O2SA 1DM4B 2OD3B 1CHOF 1B0EA 1QQ4A 1TGCA 5L2YH 1NS3A 1JRTA 3PLKA 1PQ7A 1YBWA 1UMAH 5JYIA 1A3BH 5ABWA 5A0AE 2D1JA 2AIPA 2ZHDA 4I31A 2VB0A 2G4UA 2J4IA 1V2ST 2BDAA 1P05A 1SGTA 3H7OA 4NSYA 3U8RH 1C5VA 2VU8E 4X8VH 1QRZA 1O2UA 2ZECA 3LH3A 4CRBA 3GY4A 1L1JA 4JCNA 2NU2E 5CE1A 2ZF0H 4AFSA 5EQRA 4HI3A 3AW1A 1UVPA 1LVYA 3R0FA 5HYOA 2QXIA 3MNSA 3D23A 4INKA 2P94A 1H9HE 3BTTE 4UFGH 4ABIA 2FWWA 2JH0D 2FZZA 1HIAA 4XBDA 4U2WA 1C1WH 3FFGA 1MKXH 1EAXA 1OYQA 1FY5A 1IQGA 3BV9B 3BTWE 2P3TB 5ESBA 1VITG 1HJAB 2YNBA 4YM9A 2QYIA 1HGTH 1FONA 1QGFA 2HOBA 2F9NA 2Q6GA 3ZVEA 1GJ9B 1AB9B 3MYWA 4TWYA 4YLQH 2B8OH 2TRMA 2ZQ1A 1W14U 4JZFH 1ARCA 3V7TA 2CF9H 2XRCA 3EE0B 2UUYA 1SI5H 1XXFA 1Z1JA 1AVGH 2GX4A 1V2RT 1VZQH 2HRVA 1A5IA 1TBRH 1KY9A 5T6GA 4UE7H 2H6MA 2FM2A 1NFUA 1VITH 2PFEA 1P2OA 1W0ZU 1HAVA 1Y3UA 3IWMA 1E34B 3NUMA 3M5OA 4HFPB 4IBLH 2FX4A 3T25A 1EAUA 1AVXA 3RXGA 1GMHG 4MG3A 1CBWB 1ELEE 2IN2A 4SGBE 1TFXA 1GJ5H 3ZVDA 4OGXA 3KL6A 1F0SA 1TE0A 1O30A 2O8LA 5B6OA 3RMLH 2AMDA 2BDBA 2P16A 1O5AB 1GJBB 1MTUA 1T4UH 1LHCH 3SBKA 1AE5A 1D3TB 3VB5A 1F0TA 1DSTA 2A45B 4U32A 3STIA 4Y8XA 3UQVA 1GMDG 3TITA 1HRTH 4ABDA 1Y5AT 2QF3A 2WPMS 1BTXA 4AG2A 1HB0B 1P3EA 3LJOA 3KN2A 4X6NA 1OYTH 2Y5HA 2TBSA 1EB2A 2G55A 1GBFA 5C3NA 1LPKB 6LPRA 1XX9A 5J4QA 1VJAU 1O5CB 1UVOA 4OS5A 2FS8A 1HJ8A 2FOHA 3MH6A 1P57B 3MMGA 4GSOA 4FUHA 2CGAA 2BY7X 4YOIA 2H5DA 2R0LA 4DURA 5EXLA 1TX6A 4LZ4B 1A1RA 1W7XH 1XUFA 3V3MA 2VH6A 1EP6A 3UTUH 1GL0E 2FI4E 4THNH 5DP9A 1NFWA 1ANDA 1RD3B 2FIRH 4FUIA 4BANB 2VIVA 1CT4E 1LVBA 5AF9H 3QN7A 1GGDC 4UFDH 3V0XA 5FHTA 2ZGBH 3QTVH 1K1JA 4NWKA 5JB8S 3TJUA 3LGWA 4J2YB 1GI4A 1SHYA 3GOVB 2ZKSA 3A8BA 3CS7A 1SGYE 1JWTA 1FQ3A 4XBCA 1B0FA 1ZPCA 3FAOA 5FPYA 1TRMA 3SUFA 2H9TH 1EJMA 1G37A 4UEHH 2BD7A 2OINA 1S0RA 1NN6A 3K9XB 4IC6A 4YTAA 3RXFA 2BD5A 3B8JA 4BTUB 2P95A 2Y5GA 1P04A 2VIDA 4XSKU 1ELTA 4K8BA 1OS8A 1SLWB 3HKIB 2GT8A 1CGHA 5JBBS 3QGJA 3PB1E 1M9UA 3VGCB 1D6WA 1DY8A 1VJ9U 3GCTG 4JZ1A 1C2IA 1OWDA 1TNJA 3KGPA 1GVZA 1G3DA 1TB6H 5GDSH 4E05H 3EA9A 5DP4A 1NT1A 1AZZA 1BITA 1UTOA 1LMWB 1O3FA 1T32A 5GPIB 4AX9H 3MH5A 4CRGA 3RMNH 2F83A 2Y80A 2UWPA 4Y0YE 1JMOH 4JYVH 3LU9B 1C5LH 3MU0A 3Q77A 3ZV8A 4ZMAH 5C1YA 1TGBA 1OP8A 3MNCA 4NIWA 3UNSA 1ZRBA
chains in the Genus database with same CATH superfamily
5LPRA 3OTPA 1GDUA 4AZ2B 1WDIA 1TMTH 3T27A 1UTJA 3FOAA 2ZIQH 2BTCE 2ODYB 3TIUA 2VWNA 2V3OH 5A0CA 3WWBA 1GBMA 1AFQB 2ZFQH 4BAQB 2Y5FA 2H5CA 1LHDH 4Y79A 1BTZA 4ACBA 2Z3CA 1EZQA 1MAXA 2XTTB 3K6YA 5EW2H 1T8OA 3KHVA 1OWEA 5K7RA 2ZPSA 1AD8H 2J98B 1BTWA 2FI3E 3A7WA 1NC6A 3RXHA 1C1RA 4FVDA 1W3CA 4B76A 1N8OC 4OS7A 3RLWH 3KQ5A 2C8ZB 2XC0A 2THFB 3L6PA 4OS2A 1YKTA 3E0NB 3EYDA 4OS1A 3KF2A 3RXDA 1BMNH 1CGJE 2BXTH 2B7DH 4YOJA 1SGFG 3PM3A 4WWYA 2A5KA 2J94A 3I77A 2AYWA 2EA3A 1PPZA 2FOGA 2GDEH 4GVUA 4WMFA 2ZDNA 2ZO3H 2BOHB 2OK5A 3SU2A 3EQ0H 1BQYA 2D8WA 3BG8A 3GDUA 5TCCA 5AFYH 3U1JB 1S5SA 2WV9A 1S84A 1OWIA 1GMCF 5LPFA 1DICA 2ZFTA 1QTFA 4CH2B 2WV5A 1Z8GA 2GTBA 3HKJB 2G52A 5JBTA 2XWAA 4ABBA 2BVSH 2ZTYA 1MCTA 1UVTH 2PTCE 1V2VT 3SU1A 1AUJA 2ZEBA 1ZHRA 1SBWA 3BTFE 2FOBA 4X2YA 3OEED 4ABGA 4RI0A 1NRNH 4K8YA 4TPYA 1BTUA 1SGPE 3M5MA 1EFRD 1HXEH 4ZHMU 3SU5A 3TGKE 1TNLA 6CHAC 1FUJA 1EOLA 2KCPA 3KYGA 5A8XA 4D7GA 4WF8A 3EE7A 1ZYOA 4TPIZ 5C5OA 3A88A 3VGCC 1EJAA 1YGCH 1IQKA 4GCHF 2I6SA 4Y71A 5GCHG 2TGPZ 1ELGA 1FY8E 3U8OH 4Z0KA 3SOSA 1YY3A 2XNDD 3UIRA 2OCVB 1FNIA 3SI3H 3FO8D 2BD9A 3W95A 1P12E 2GZ8A 3RUOA 4ZUHA 2ZA5A 4UONA 2FYRA 3S0NA 1ORFA 1KLTA 3UOUA 3PROA 1C1MA 3BTME 3D49H 3M35A 1K1OA 1HBTH 2A4QA 2FEQH 3MI4A 4NGAH 2BLOA 3A7YA 4INLA 7KMEH 1GHBG 2ZFPH 2BD2A 1E35B 1XUJA 2FODA 2WPHS 5CHAC 2KZ4A 3SNBA 1DSUA 2CHAB 1SQTA 1TBZH 1AIXH 1YPLH 2XBVA 1GBDA 5JPMH 3RU4D 3NRLA 3P8OA 1ACBE 2TGAA 3ZVBA 2XBYA 2XXLA 4MNVA 4OS4A 4FUFA 2ZU2A 3F68H 1G32B 3SNDA 1ZHPA 2BX4A 1VCPA 2VIOA 2JETB 1QA7A 4JK6A 1Y3XA 2AGEX 2FOAA 1C1PA 1Y3WA 5I46H 2CMYA 1IQIA 3NCLA 3SJIA 2QY0B 3A7ZA 3UFAA 1MZDA 2ANWA 1FI8A 2QC2A 1GHAF 2WSSD 3RP2A 3RXMA 1ZMLA 1BZXE 4ZHLU 3IG6B 3LGYA 1LDTT 3F9FA 2OLGA 1G2LA 1K21H 3DCLA 5DK1A 1XXDA 1XVMA 2AGIX 3SGQE 2F9PA 3ATMA 1O2KA 3E3TA 4YESB 4Q2KA 4JYTA 1C4U2 1ZR0A 2KCOA 1NU9A 1TNHA 4UDWH 2HWLB 1K2I1 1EQ9A 1TA6A 4KKDA 1OWHA 1ANEA 3MO3A 2C90B 1V2LT 1LHFH 3AASA 1BBRK 4HTCH 1AO5A 5DP3A 3GCTF 1PFXC 4XDEA 5C17A 4NA8A 1D9IA 1HIAB 1ZSJA 2ESTE 1C2GA 1O5GH 2DE9A 4B74A 4NWLA 3SU4A 1BRCE 1P06A 2PUXB 1P02A 2VIWA 3TK9A 1O0DH 2AMPA 1TMBH 3SJOA 3ZZBA 1GBLA 1C2LA 2BOKA 5EW1H 5F8ZA 3MO6A 3EDXB 3BEIB 1EJNA 2AERH 3SJ8A 2VH0A 2LNCA 2Y82A 2CXVA 3MNXA 3MH7A 7LPRA 1O5EH 1Z8IB 1MBQA 4E7NA 3KCGH 5K0HA 4AG1A 1SFIA 3HPTB 3LONA 1UK3A 4Y6DA 1A0JA 1P09A 2YMSD 3F0OA 4F4OC 1J14A 3RXJA 3O8BA 3ZZ8A 4FUEA 2AH4X 1FXYA 4GHTA 4INHA 3TNTA 2FDAA 1FLEE 3PLPA 1ARBA 1VITF 2CHAC 1GBBA 1O3BA 3MOCA 5E2OA 3LC5A 4FUGA 5F03A 2ZHFH 1MZAA 4H6TA 1UHBB 2QXJA 2ZTZA 3DSPA 1GVLA 1GHAG 1YPHE 2ZCHP 4AFQA 1Q2WA 1DXPA 1V2NT 4ZROA 1NZQH 4A7IB 5LGOA 1UVUH 4XD7D 3ZVAA 2WPKS 1O35A 2BD3A 3T2NA 1LVOA 2KAIA 1CHGA 3FVFB 4ISNA 3L3TA 1C5WB 1BHXF 3O8DA 1ZMNA 4I8GA 3PTBA 3ENSB 1WUNH 3RMMH 3URDA 1NRPH 1ZTJA 3T62A 2GKVE 2IJOB 1UJ1A 1C9PA 1EX3A 1GJCB 1RTFB 1L0ZA 3KEEA 3RM0H 1SSXA 4BXWA 1WSSH 1O3OA 3V13A 2B5TB 2A32A 2Z9JA 1NESE 5TCAA 5EQQA 1Q31A 1RJXB 3F2FA 1T8NA 2JH6D 3UUZA 4FUJA 4AB8A 5FAHA 1O2NA 2C8XB 4CHAB 3FN8A 3CNRA 3HK3B 1L1NA 5DPAA 4AB9A 4MPVA 2ZU5A 3AW0A 5AHGH 1D6RA 1HAVB 4K3JA 1IQFA 1BCUH 1C1TA 4LK4A 4I8KA 2HVXA 3RXCA 5IK2D 3AK5A 1FN6A 1A2CH 1BTYA 2RFKC 3L33A 1P8VC 1GI0A 1F5RA 4ISHH 5C1XA 1UTNA 1C2DA 2OQ5A 1DOJA 4BAHB 3PMAB 2FO9A 1ZPBA 1AU8A 1C2MA 1AFQC 1SGCA 4BAOB 3A7VA 2IOTA 1S6LA 1FY4A 2L6OA 2PP6A 5F8XA 1S85A 1O34A 1S81A 1TNIA 3RXSA 3VG8A 4DY7B 3F9HA 1WXRA 3UREA 1C5OH 3M5NA 1O3JA 2NU0E 1H9LB 1UHBA 1DWDH 1C5XB 5FCKA 2P59A 1DXWA 3B23B 4Q7XA 2PWXA 1HAGE 3BTDE 2QV1A 1TNGA 2UUFB 1J17T 1GI5A 2BY6X 4RT0A 1SGFA 1S83A 2CV3A 3PO1C 2BHGA 1DUAA 3C27B 3BTEE 1VKYA 3GY7A 1HAXB 1O2HA 1PPEE 5LH8A 2O8UA 3SNAA 5L30H 1C2EA 1DLEA 1NY22 5KEDA 1XUKA 2F43B 4A1VA 3QZRA 3UNRA 1ZTKA 2OC8A 2XBWA 1O3CA 1XUGA 1GJ8B 3EA8A 4K1TA 5J4SA 4DGJA 4NA7A 2RDLA 1TWXB 2ZFSA 1ELDE 4F49A 1PQ5A 1O2PA 2BZAA 3M3VA 5EJ1A 3KQCA 1C5PA 2R0KA 2ZDLA 1O3LA 4MDSA 3U1IB 1EATA 4WMEA 1HV7A 1EZUC 3MNBA 5PTPA 2VGCB 3NZIA 5BPEA 3PRDA 1P9UA 1RIWB 1HXFH 2AFQB 1AUTC 1W0YH 1LKAA 4GLYA 4I32A 1AWHB 1H9IE 2EY4C 4CR5A 1BBRH 1W11U 2TIOA 1CE5A 1QBOA 2YMSB 5C5NA 1XKAC 5JB9S 4DVAU 1RTKA 2GVFA 3E0PB 1KYNA 4Q7ZA 3ZYEA 3K65B 3ZVFA 1BDAA 1IAUA 2B0FA 1MD8A 3GDVA 2W7SA 3SGBE 1GI6A 1HCGA 1ETRH 1YPGH 2ZFRH 2ANKH 1G3CA 3M7QA 2GV7A 4I86A 4DIIH 3RXBA 1GI9B 1YLCA 2H2ZA 5DSFA 2UWOA 4WXIA 2J97A 3QDZB 1C5SA 2W6JD 3PV5A 3ZZAA 4SGAE 3ZVCA 2W3IA 1AN1E 4MVNA 1N6YA 2Y7XA 3RU4T 2EEKA 2CK3D 3FKSD 3RXLA 1C2JA 2SNWA 3BG4B 1AKSA 2PW8H 3FP8E 1WU1A 4JZEH 2PKAB 2FI5E 4KTSA 1DX5M 2IPQX 1DFPA 1IQLA 1GBCA 4X2VA 2RA3A 2WYGA 1SFQB 1JIRA 1CA8B 4NZLA 4ISOA 1Y59T 1V2PT 6GCHF 3A83A 1MMJN 2C8WB 3S7HB 5KGOA 1EB1H 1MQ5A 2O8TA 1GHWH 3ZZ3A 5HIYA 1TX8A 1NBMD 2LPRA 2VWLA 5C67A 5L2ZH 4XOJA 4IN1A 2R2MB 4TYDA 1XUIA 3VB6A 2ODQA 1FIZA 1SHHB 3FP6E 5DP5A 3NWUA 1GDQA 1YLDA 2GMTB 3ZVGA 1C4V2 5EQSA 3BIUH 1KXCA 1CA0B 3PMJA 2FOMB 1QFKH 1O2VA 1IHSH 2J5UA 1QHRB 2KX4A 1L1GA 3UWIA 5JBCS 1BUIA 1CO7E 2F4LA 4GHQA 1P2IA 3N7OA 3VFEA 1NM6A 2R9PA 2KM0A 1BMAA 2XNIA 4K69A 2VJ1A 2QF4A 1A5GH 4D76A 1T31A 5EIYA 4KGAA 2WPJS 4ABHA 3TU7H 4X1SU 1BIOA 4HG6A 2RA0A 1C1VH 1QCPA 3PRBA 4A1TA 1K1MA 1ZZZA 1L2EA 3OY5U 2GP9B 1GJ7B 3NPSA 2JJ2D 1QB6A 1YP9A 1DWBH 1MTVA 4Y8ZA 3TLOA 1WYKA 1QL9A 2F9UA 5FL7D 2V7QD 2J38A 2FYQA 2V6NA 5CDFE 3QTOH 5A0BA 4UFFH 2QF0A 3LGTA 2XYAA 5E8EH 1LCYA 1FV9A 2XOKD 3LH1A 3KQBA 5DP6A 3ZZ4A 2O8WA 2CF8H 4I8HA 3GCNA 3QZQA 4NCYA 1O3AA 1HAYB 2GZ9A 1SLUB 1SGEE 1YPHC 1C1NA 3PWBA 4TY6A 1DANH 2P8OB 1IQMA 4I7YH 3EA7A 2C3SA 1LTOA 1H8ED 4AORA 2NU1E 2OQUA 2A7CA 1P2MA 2GCHF 4NFFA 1THPB 3M7UA 1ABIH 1GBIA 1GJ4H 1K1PA 1EAWA 1FZZA 2FPZA 5FPTA 4E7RG 4X0WU 2TGDA 4B1TA 1O2GH 1RIWC 3H7TA 2OC7A 1HJ9A 1X7AC 2OTVA 2VVCA 3SUEA 1SQRA 1C5TA 1ELFA 3RXPA 1YCPK 4IS5A 3M5LA 1Z6EA 5GWZA 1EKBB 1C1QA 1QJ6B 4JK5A 1LO6A 1P3CA 1CGIE 2PV9B 4TSFD 4JYUH 2WPLS 3A8AA 2PTNA 2W6ID 4PROA 1RTLA 2H9EH 1O2RA 4FETA 6CHAB 2FOEA 4WY3A 2G5NA 5T3HA 5TJXA 1O2XA 1SG8B 3R3GB 5BRRE 4BAKB 4YZUA 4Y7AA 2BYAX 3RXEA 4ASHA 1ANCA 3SQEE 4CBNA 3LGIA 2WPDD 3V12A 1TAWA 1MUEB 5A09A 1KLIH 2JH5D 3TJOA 1DPOA 1YPEH 8LPRA 1WAYB 2OC0A 1T8LA 3ATIA 1DY9A 1LPGB 2JJ1D 1T8MA 1OP0A 3ELAH 1L4ZA 1AZ8A 1KXBA 2M2AA 4DW2U 3ATWA 1KIGH 3LJJA 2A4RA 3HGNA 1XUHA 4ISIH 3M3SA 5T6FA 1C1SA 4CH8B 1TPSA 4B2BA 4ZKNU 1OHHD 1ZGVA 4U30A 2SGPE 4X1QU 5EU8A 1UTKA 1OX1A 2WUCA 4XRNA 2GCTB 4FU8A 1XVOA 1THRH 1T7CA 2A7HA 2G00A 1HAOH 1ZPZA 2K1QA 3ZZ6A 5IDKA 2W3KA 2O9QA 3E6PH 1AKSB 2W7UA 1P03A 1HAPH 2ZGCA 4YXWD 7ESTE 1UK4A 4IC5A 3QX5H 1SOTA 3PMBB 3VXEH 5F53A 3FP7E 2QGRA 4X1RU 3A80A 1NTPA 1TIOA 2ODPA 3A84A 1ESBA 3OE7D 2QXHA 2FS9A 1INCA 1XMNB 1BMMH 1WTGH 1IQHA 2FLRH 3KQDA 2D26C 3SNCA 3ESTA 4F48B 3CS0A 5H4IB 3WY8A 1MKWH 3OU0A 2IJD1 3CENA 1HNEE 1K1LA 2BD4A 2Y6TA 1BOQA 3Q3YA 1O3NA 4Y7BA 4LXBH 1F7ZA 2EI8A 1BT7A 5EPYA 1H1BA 4HGCA 2G81E 2OUAA 1Y5BT 5T1VA 2OBQA 1GPZA 1SGDE 3W94A 1F0UA 2ZZUH 2BDHA 3F9EA 1C1UH 1KSNA 4P00A 4X8TH 3SUGA 3BSQA 1KDQA 1TQ7B 1VGCB 2FOFA 1ZRKA 2ZHWH 2BX3A 1E1RD 1YM0A 2F9VA 3SO3A 1S82A 3PYHA 1EXFA 1SGQE 1D3QB 3OSYA 3VPKA 3GY2A 5EG4A 1FMGA 3AAVA 1HUTH 1C4Y2 1GI1A 1BJUA 4BXSA 3ITIA 2ZWLH 2ZU4A 1V2MT 3ZYDA 1KXFA 2LP6A 1JBUH 3LT3A 2R2WU 1TNKA 1ESTA 1WOFA 3SORA 1C2HA 1RRKA 1EUFA 1S6HA 1PPCE 1UTMA 2FXRA 1GI2A 1QJ7B 1WV7H 3TVJB 1O5FH 1EPTC 1C5QA 2VIQA 2PR3A 3F6UH 1FPCH 3A87A 1WQSA 1QRXA 1FDPA 5C20A 4A6LA 1JXPA 3MHWU 3I78A 1EOJA 2RCEA 1O38A 1O32A 2J95A 2ZDAH 3OY6U 1GBAA 3E16B 1O2OA 2YNAA 1TPPA 3GYMA 1QB1A 4FOUC 1O2LA 4FUBA 1YLNA 2H9HA 4DIHH 1YWUA 2L74A 1O2ZA 1A4WH 1SQAA 3BTHE 5FBIA 3DA9B 2ZGJA 1G9IE 2WYJA 4BTTB 2OP9A 2SGQE 3W1EA 3NKKA 3P8GA 4VGCB 3RXTA 1UTLM 2DE8A 3QGNB 1BHXB 1YCPM 3AAUA 3F0PA 1P2KA 1VCWA 3SV2H 1OKXA 4CRDA 1MKWK 2SGFE 1MAYA 3SV6A 4RKJB 1ELVA 3RC6A 1TOCB 5HIZA 1CT0E 1JRSA 1AGJA 3OAAD 4AGJA 2FOCA 4FU7A 3A8DA 2ZGXH 2HNTC 2AS9A 4A92A 3RC5A 4F55A 3FANA 1SMFE 1GBTA 3GDSA 2ZFFH 2KR7A 1Q3XA 2KAIB 4NIXA 4K60A 3ZZ9A 1SGNE 2ANMH 4ZKSU 1GMCG 4MNXA 2Y81A 4H4FA 4ISLA 4WJG2 1BRAA 2CN0H 1AY6H 2H1UA 3SJKA 3GYLB 2Z3DA 4CRAA 2BD8A 2HGTH 4ACAA 4K1SA 3FZDA 2VVVA 5GXPA 1GCTC 1NROH 1W13U 4X8SH 2ZC9H 1CSOE 3T26A 2TPIZ 3IITA 2GV6A 1GVKB 3KNXA 9LPRA 1GCTB 3NXPA 1ETSH 3RDZA 2ZPQA 1H4WA 3CP7A 1BTHH 1LKBA 1K1IA 1LHGH 5A8YA 1O2QA 1QBNA 2ANYA 3GY3A 3SHAH 3O8RA 1G3EA 4AFZA 1TGSZ 3QLPH 2Q1JA 4M9FA 2GZ7A 4RSPA 1O3GA 1TBQH 1A0HB 2P8OC 1IOEA 3M37A 4NIVA 1GJ6A 1HFDA 1MD7A 1BBRE 1BTPA 1G2MA 3O8CA 1QNJA 2A1DB 5EGMA 3DT0H 3LKWA 1ZSLA 2VWMA 1SQOA 1Y8TA 1O5BB 1EAIA 2ZTXA 1THSH 1TYNA 2Z9LA 1QQUA 5E2PA 1G36A 2XCNA 1W0KD 1C5YB 3VB7A 1IQNA 2ZCLP 2PHBA 4JMYA 1GHZA 4I33A 5F6MA 1O3DA 3TGIE 1SGIB 1GBJA 5FXLA 4U01A 2YOLA 3SNEA 4H6SB 3RXAA 1CU1A 2G5VA 1LPZB 3M36A 3A85A 4A5TS 1K22H 5T6DA 1O37A 4AYYB 2BMGB 1V6DA 1AWFH 1TRYA 1F92A 3MU5A 3QK1A 1F5LA 3SV7A 5C0TA 1LVMA 1UCYK 4B75A 1A61H 2BDYA 2PLXA 1GDNA 3TNSA 1MU8B 1OXGA 1WBGB 1QIXB 2R3UA 3A82A 5DP8A 2PGQB 2ZNKH 1AMHA 2ILNA 3BEUA 1ZGIA 2NU4E 5B6LA 1OP2A 2TGTA 3P8FA 1GHXH 1Z8RA 3P8NA 4CHAC 4J1YA 1FAKH 1GHBF 3D62A 2QIQA 1N8OB 4AYVB 5HMAA 1D4PB 3DUXH 1TX7A 2G8TA 2KCAA 1MTWA 1UCYE 1IHTH 2GCTC 1BJVA 1K0HA 1HPGA 3SUDA 1ZOMA 1GJDB 2XCFA 3A86A 3JZ1B 3P17H 1KTTB 2ZU3A 2ZHQH 5E0GA 3RLYH 1WQVH 8KME2 1U6QA 1TGNA 3ZZDA 1CBWC 1N6XA 2VINA 2NWNA 5A8ZA 2A5AA 4FVBA 1DE7H 1UK2A 1NU7B 4Q80A 1PJPA 1FY1A 4IGDA 1IQEA 1E1QD 1YCPH 4MQAA 2VIPA 1KXEA 3UWJH 1CQQA 1F5KU 4BTIB 2RG3A 3GCOA 2A2QH 5ESTE 5EXNA 2BM2A 1A3EH 1NPMA 2BY8X 4TWWA 1O2TA 2WZQA 1DS2E 2WPIS 4O03A 1DVAH 2GT7A 4IN2A 2PUQH 2JIZD 3GY5A 2OXSA 2XC4A 3A7TA 3TH4H 2Z9IA 2EQNA 2V0BA 1A5HA 1GBKA 1NFYA 4B73A 2ULLA 1WTHD 1LQEA 2ZDKA 1GBHA 3FZZA 3ZV9A 3MU1A 3BN9A 1PQ8A 3K2UA 2I6QA 2R3YA 2GCHG 2FLBH 1BRBE 1OPHB 2A5IA 5EJLA 1H8DH 3WWFA 3BEFB 1BB0B 1TPOA 4X6OA 1YPJH 1V2TT 1JOUB 4IW4E 3P95A 4MLFB 3RXKA 1FX0B 2V3MA 1TMUH 2P93A 4X6MA 1ELAA 1PPFE 1W8BH 4ZH8A 2J92A 4TT3D 2BY9X 4KELA 2JDID 6GCHG 2FX6A 3KYFA 1F2SE 2XC5A 1MABB 5HXFA 2P3FH 2ZU1A 1V2WT 2FTMA 2Z7FE 2BLQA 2BDCA 2QA9E 1BMLA 1Z6JH 2QAAA 1P9SA 1BMFD 2BDIA 3STJA 2FP7B 4P02A 1ELBA 1HAHH 4ABJA 3ZZ7A 1QJ1B 1YC0A 2SNVA 1P01A 5SGAE 4YOGA 2UWLA 2FESH 4CRCA 4X2WA 5DP7A 3ODFA 1O3HA 1V2KT 2HALA 3VXFH 2WV4A 3PV2A 4D8NA 3MQKC 5FCRA 3Q3KA 2PGBB 2Y7ZA 1RS0A 2OBOA 1QL7A 1FN8A 3HK6B 2BQ7B 1NFXA 5ETXA 1DWCH 1MTNB 3SV8A 2BQWB 1MCVA 1CHOG 1O31A 4NFEA 1COWD 1PPHE 2K0QA 2EC9H 3D65E 1QR3E 1SLXB 3M61U 1CVWH 3T29A 5I25A 5EPNA 2ASUB 4OS6A 3M3TA 2J34A 1FY3A 3HATH 2ZP0H 3QUMP 4MNYA 2W26A 4ESTE 1W12U 1PQAA 3BF6H 1GBEA 1O2IA 4MPWA 1TALA 3OTJE 3QWCH 4HZHA 1DDJA 1HLTH 1A0LA 2V35A 1EP5A 4XE4A 2HVYB 3UNQA 1E36B 1SOZA 4WMDA 5AFZH 2BZ6H 1EPTB 1GHVH 4YT7H 1QL8A 1AE8H 1N1LA 3S9AA 4KTUA 2ZPRA 4DT7B 4UFEH 2FMJA 1GCDA 9ESTA 3RC4A 3TH3H 3G01A 3M7TA 4H42U 1KDQB 1KMHB 4QT8C 4ZXYH 1OOKB 3ATLA 3RU4E 5HM2A 1SGRE 1EZXC 2ALVA 4MTBA 4O97A 2XWBI 2J9NA 2LELA 1P0SH 2Z3EA 1Z8JB 3K6ZA 2HPPH 4DG4A 2Z9GA 4RKOB 1EASA 3DFLA 5C0UA 1FJSA 1SLVB 1TA2A 4GUXA 1HAIH 4Q63A 4CRFA 1QBVH 5IYTA 1C5MD 1O5DH 4Y11E 3Q00A 4X1PU 1VGCC 2EI7A 4NIYA 1ESAA 2AEIH 2F9OA 1UTPA 3QO6A 2GGVB 3P70B 1GHYH 1W10U 2VNTA 3E90B 4X2XA 4FU9A 4TY7A 1C5NH 1ZJKA 4FUDA 4K1EA 3UY9A 1J16A 1NRSH 2A31A 1UO6A 1FAXA 3A8CA 2PSXA 3LDXH 2HLCA 4B71A 3VEQB 2P3UB 2WINI 4Y10E 3S69A 1AI8H 1O33A 1HJAC 1E37B 2SGEE 5EOKA 4OGYA 2QCYA 2HNTF 3ODDA 3VB4A 1O36A 3PLBA 1UTQA 4Y0ZE 1K9OE 3JZ2B 1D3PB 3SJ9A 2V3HH 4FUCA 1TGTA 3RXUA 3N7EA 1P2QA 1P2NA 4GCHG 2VGCC 4ZHAA 4WH6A 1V2QT 3SGAE 1XKBC 1ETTH 2ALPA 1O3MA 4ZKOU 2AIQA 5EODA 1ABJH 1DITH 4BAMB 2A7JA 1SVPA 1TRNA 1HAZB 1C5RA 4R8TB 2G51A 3F3BA 4KP0A 4X8UH 3ZZCA 1V3XA 1JIMA 4AOQA 2GDDA 3UAIC 5JDUB 1D3DB 5C1UA 1O3EA 1G30B 3SU3A 2BXUH 3MWIU 2VVUA 1GI3A 2FTLE 3E1XB 2GMTC 1V2JT 1C2KA 4FXGH 1AVWA 3UR6A 1GMDF 4MPUA 5DO4H 4KTCA 1C9TA 2QN5T 2PKSC 2SGAA 3S7KB 1TOMH 3GY8A 1H8HD 1GGDB 4GPGA 5FBEA 1NBME 3GISB 4NSVA 1W7GH 4O9VA 2J2UA 3Q76A 3ATKA 4WH8A 8GCHF 3GS9A 2STBE 3LGUA 4K2YA 3EGKH 1MQ6A 2Z94A 3KQEA 3DHKH 2AMQA 5CHBA 2BLWA 1RGQA 5AVDA 2A0QB 3TPIZ 3BG4C 3TK6A 2F9BH 2OC1A 1WCZA 1NRQH 4I8LA 4WVPE 2BVXH 1QURH 1S0QA 2NU3E 2Q6DA 1ANBA 2IPHA 2UUKB 3U98H 1V2OT 3P6ZB 4JZDH 4D9RA 1ZJDA 2BY5X 1UVSH 2BB4A 4X1NU 4YLUA 5CHAB 1BRUP 3RXVA 4AN7A 1SB1H 1K28D 1ID5H 4MPXA 4DJZB 1PPGE 3N7DA 4YT6H 4Q7YA 1NRRH 1ZHMA 8ESTE 5G4BA 5HKKD 1S6FA 1O3PB 3RMOH 4RT1A 1QB9A 5DG6A 1P10A 1J15A 4O3TA 3OX7U 3A7XA 3E91A 2EI6A 6ESTA 3KIDU 2GD4B 4JZIA 1OSSA 4D9QA 1V2UT 4CBOA 1C5UA 1MTSA 1TLDA 1QY6A 2Z6BD 3TK5A 3RXIA 2BLVA 1SR5C 4AGKA 1PYTC 3LC3A 3SYJA 4RN6A 3S9BA 2STAE 3VB3A 3HGPA 3PMHB 5C2ZA 4E06H 3TJVA 4MNWA 3SV9A 1T4VH 1VR1H 3BTGE 2ZDVH 2ZHEH 2JKHA 1XM1A 4ZAEA 3NK8A 2ZCKP 2KFWA 4B2AA 5DJ7A 2BDGA 3U69H 1L4DA 2C4FH 5DKMA 3PO1B 4CREA 1TPAE 1Y5UT 2O8MA 3E8LA 5FX6A 5E0JA 1EPTA 2QF5A 1KXAA 1Z71A 1P2JA 3F9GA 1Y3YA 2SFAA 4ABEA 3UOPA 3SHCH 3T5FH 3SI4H 4Y8YA 7GCHG 3GICB 3A81A 4VGCC 3U9AH 3OYPA 2PSYA 1J8AA 1O2MA 3AVZA 1FPHH 2F91A 2WUBA 3U28C 1ZMJA 1EZSC 1Y3VA 1DT2A 1PPBH 1GWAA 4NA9H 3TH2H 4IMQA 3TGJE 3C1KA 8GCHG 4Y76A 2PKSB 1C5ZB 1B5GH 1O3IA 2C8YB 1CA0C 5GCHF 3BIVH 4BOHA 3SU0A 1TONA 1QA0A 1FIWA 2SGDE 2XW9A 4K5ZA 3SZEA 1SL3A 3P92A 1O2WA 1YF4A 2D2DA 1OWJA 5FPSA 1C2FA 1C1OA 4AFUA 1YYY1 1F0RA 3SQHE 3MO9A 1VCQA 3PTNA 1KXDA 4X6PA 1MKXK 4BNRA 3OEHD 4Q4LA 1O2JA 2F3CE 3MU4A 4ZXXH 1ZSKA 1B7XB 1UW7A 5DGJA 1GJAB 1DWEH 3S9CA 1RXPA 1SC8U 2C93B 3LGVA 3SN8A 1YPKH 2Z9KA 4XFQA 1PYTD 4GAWA 1O39A 5F8TA 2XBXA 4DOQA 3LOXA 3F2GA 1QZ8A 5LPEA 1AQ7A 4Z6AH 2VWOA 4I8JA 3DD2H 3WW7A 2ZG0H 3Q3XA 3B9FH 4YO9A 2G4TA 5FX5A 4Z1MD 2JETC 1Z1IA 2AGGX 1P11E 1BA8B 3SZNA 1IQJA 2WHXA 1TABE 1GL1A 1O3KA 1GI8B 1RFNA 3RXRA 3SW2B 5L6NH 5GJ4B 3LIWA 1SPJA 4LOYH 3SU6A 1E0FD 3DFJA 1A7SA 2A4OA 1AB9C 2HPQH 1CT2E 2ZI2H 5JBAS 3PWCA 4NZQA 4R0IA 1HYLA 2BVRH 2HLDD 3ZZ5A 5GIBA 1UCYH 2ZQ2A 1KTSB 1E38B 3GY6A 1OWKA 3U8TH 2A4GA 3UQOA 1Z7KA 4WXVA 3H5CB 1DUEA 4A1XA 1YPMH 4M7GA 2W5EA 3GCHB 1GG6C 1DLKB 1GMHF 2ZGHA 3MH4A 3PV4A 2J98A 2Q6FA 3BTQE 1HDTH 1K1NA 3URCA 4ABFA 3F1SB 1MBMA 3BTKE 1TQ0B 2B9LA 3I29A 3UR9A 5A2MH 3TJNA 3MU8A 3RXQA 1H8IH 3RM2H 1GG6B 3GCHC 4LZ1H 1MH0A 1G3BA 1ELCA 4ABAA 2PKAA 1GI7B 3EAJA 4DT4A 1A46H 1ZTLA 4CR9A 1LQDB 2QXGA 4B6FA 4DCDA 5EXMA 4D7FA 3MTYA 4B2CA 2UUJB 4XBBA 5E0HA 4UD9H 2M5TA 1QRWA 2DUCA 1NO9H 2HNTE 5CMXH 2ZDMA 5HGGA 3UB0A 1AHTH 2CJIA 1AFEH 4O3UA 5HM9A 2AHME 4IMZA 1KLJH 3T28A 2BQ6B 3UPEA 1MTNC 1O2YA 1MU6B 2QE7D 3RXOA 3N99A 1ZLRA 1LHEH 5C94A 3H09A 1J9CH 3MFJA 3LPRA 4ZKRU 4NG9H 3A89A 1W2KH 7GCHF 2A2XH 1O2SA 1DM4B 2OD3B 1CHOF 1B0EA 1QQ4A 1TGCA 5L2YH 1NS3A 1JRTA 3PLKA 1PQ7A 1YBWA 1UMAH 5JYIA 1A3BH 5ABWA 5A0AE 2D1JA 2AIPA 2ZHDA 4I31A 2VB0A 2G4UA 2J4IA 1V2ST 2BDAA 1P05A 1SGTA 4AC9A 3H7OA 4NSYA 3U8RH 1C5VA 2VU8E 4X8VH 4ASUD 1QRZA 1O2UA 2ZECA 3LH3A 4CRBA 3GY4A 1L1JA 4JCNA 2NU2E 5CE1A 2ZF0H 4AFSA 5EQRA 4HI3A 3AW1A 1UVPA 1LVYA 3R0FA 5HYOA 2QXIA 3MNSA 3D23A 4INKA 2P94A 3DSGA 1H9HE 3BTTE 4UFGH 4ABIA 2FWWA 2JH0D 2FZZA 1HIAA 4XBDA 4U2WA 1C1WH 3FFGA 1MKXH 1EAXA 1OYQA 1FY5A 1IQGA 3BV9B 3BTWE 2P3TB 5ESBA 1VITG 1HJAB 2YNBA 4YM9A 2QYIA 1HGTH 1FONA 1QGFA 2HOBA 2F9NA 2Q6GA 3ZVEA 1GJ9B 1AB9B 3MYWA 4TWYA 4YLQH 2B8OH 2TRMA 2ZQ1A 1W14U 4JZFH 1ARCA 3V7TA 2CF9H 2XRCA 3EE0B 2UUYA 1SI5H 1XXFA 1Z1JA 1AVGH 2GX4A 1V2RT 1VZQH 2HRVA 1A5IA 1TBRH 1KY9A 5T6GA 4UE7H 2H6MA 2FM2A 1NFUA 1VITH 2PFEA 2VBCA 1P2OA 1W0ZU 1HAVA 1Y3UA 3IWMA 2K8IA 1E34B 3NUMA 3M5OA 4HFPB 4IBLH 5KECA 2FX4A 3T25A 1EAUA 1AVXA 3RXGA 1GMHG 4MG3A 2YMSC 1CBWB 1ELEE 2IN2A 4SGBE 1TFXA 5EJZA 1GJ5H 3ZVDA 3OFND 4OGXA 3KL6A 1F0SA 1TE0A 1O30A 2O8LA 5B6OA 3RMLH 2AMDA 2BDBA 2P16A 1O5AB 1GJBB 1MTUA 1T4UH 1LHCH 3SBKA 1SKYE 1AE5A 1D3TB 3VB5A 1F0TA 1DSTA 2A45B 4U32A 3STIA 4Y8XA 3UQVA 1GMDG 3TITA 1HRTH 4ABDA 1Y5AT 2QF3A 2WPMS 1BTXA 4AG2A 1HB0B 1P3EA 3LJOA 3KN2A 4X6NA 1OYTH 2Y5HA 5DN6D 2TBSA 1EB2A 2G55A 1GBFA 5C3NA 1LPKB 6LPRA 1XX9A 5J4QA 1VJAU 1O5CB 1UVOA 4OS5A 2FS8A 1HJ8A 2GJGA 2FOHA 3MH6A 1P57B 3MMGA 4GSOA 4FUHA 2CGAA 2BY7X 4YOIA 2H5DA 2R0LA 4DURA 2RDEA 5EXLA 1TX6A 4LZ4B 1A1RA 1W7XH 4OM9A 1XUFA 5GNDA 3V3MA 1EP6A 2VH6A 3UTUH 1GL0E 2FI4E 4THNH 5DP9A 1NFWA 1ANDA 1RD3B 2FIRH 4FUIA 4BANB 2VIVA 1CT4E 1LVBA 5AF9H 3QN7A 1GGDC 4UFDH 3V0XA 5FHTA 2KCYA 2ZGBH 3QTVH 1K1JA 4NWKA 5JB8S 3TJUA 3F2HA 3LGWA 4J2YB 1GI4A 1SHYA 3GOVB 2ZKSA 3A8BA 3CS7A 1SGYE 1JWTA 1FQ3A 4XBCA 1B0FA 1ZPCA 4B6EA 3FAOA 5FPYA 1TRMA 3SUFA 2H9TH 1EJMA 1G37A 4UEHH 2BD7A 2OINA 1S0RA 1NN6A 4ZCNA 3K9XB 4IC6A 4YTAA 3RXFA 2BD5A 3B8JA 4BTUB 2P95A 2Y5GA 1P04A 2VIDA 4XSKU 1ELTA 4K8BA 1OS8A 3ZIAD 1SLWB 1W0JD 3HKIB 2GT8A 1CGHA 5JBBS 3QGJA 3PB1E 1M9UA 3VGCB 1D6WA 1DY8A 1E79D 1VJ9U 3GCTG 4JZ1A 1C2IA 1OWDA 1TNJA 3KGPA 1GVZA 1G3DA 1TB6H 5GDSH 4E05H 3DSOA 3EA9A 5DP4A 1NT1A 1AZZA 1BITA 1UTOA 1LMWB 1O3FA 1T32A 5GPIB 4AX9H 3MH5A 4CRGA 3RMNH 2F83A 2Y80A 2UWPA 4Y0YE 1JMOH 4JYVH 3LU9B 1C5LH 3MU0A 3Q77A 3ZV8A 4ZMAH 5C1YA 1TGBA 1OP8A 3MNCA 4NIWA 3UNSA 1ZRBA
chains in the Genus database with same CATH topology
5LPRA 1GDUA 4AZ2B 1TMTH 3T27A 1UTJA 2ZIQH 2BTCE 2ODYB 3TIUA 2VWNA 2V3OH 5A0CA 1GBMA 1AFQB 2ZFQH 4BAQB 2Y5FA 2H5CA 1LHDH 4Y79A 1BTZA 2Z3CA 1EZQA 1MAXA 2XTTB 3K6YA 5EW2H 1T8OA 3KHVA 1OWEA 5K7RA 2ZPSA 1AD8H 1BTWA 2FI3E 3A7WA 1NC6A 3RXHA 1C1RA 4FVDA 1W3CA 4B76A 1N8OC 4OS7A 3RLWH 2C8ZB 2XC0A 2THFB 3L6PA 4OS2A 1YKTA 3E0NB 3EYDA 4OS1A 3KF2A 3RXDA 1BMNH 1CGJE 2BXTH 2B7DH 4YOJA 1SGFG 3PM3A 4WWYA 2A5KA 2J94A 3I77A 2AYWA 2EA3A 1PPZA 2FOGA 2GDEH 4GVUA 4WMFA 2ZDNA 2ZO3H 2BOHB 3SU2A 3EQ0H 1BQYA 2D8WA 3BG8A 3GDUA 5TCCA 5AFYH 3U1JB 1S5SA 1S84A 1OWIA 1GMCF 5LPFA 1DICA 2ZFTA 1QTFA 4CH2B 2WV5A 1Z8GA 2GTBA 3HKJB 2G52A 5JBTA 2XWAA 4ABBA 2BVSH 2ZTYA 1MCTA 1UVTH 2PTCE 1V2VT 3SU1A 1AUJA 2ZEBA 1ZHRA 1SBWA 3BTFE 2FOBA 4X2YA 4ABGA 1NRNH 4K8YA 4TPYA 1BTUA 1SGPE 3M5MA 1HXEH 3SU5A 4ZHMU 3TGKE 1TNLA 6CHAC 1FUJA 1EOLA 5A8XA 4D7GA 4WF8A 1ZYOA 4TPIZ 5C5OA 3A88A 3VGCC 1EJAA 1YGCH 1IQKA 4GCHF 2I6SA 4Y71A 5GCHG 2TGPZ 1ELGA 1FY8E 3U8OH 4Z0KA 3SOSA 3UIRA 2OCVB 1FNIA 3SI3H 2BD9A 3W95A 1P12E 2GZ8A 3RUOA 4ZUHA 2ZA5A 4UONA 2FYRA 3S0NA 1ORFA 1KLTA 3UOUA 3PROA 1C1MA 3BTME 3D49H 3M35A 1K1OA 1HBTH 2A4QA 2FEQH 3MI4A 4NGAH 2BLOA 3A7YA 4INLA 7KMEH 1GHBG 2ZFPH 2BD2A 1E35B 1XUJA 2FODA 2WPHS 5CHAC 3SNBA 1DSUA 2CHAB 1SQTA 1TBZH 1AIXH 1YPLH 2XBVA 1GBDA 5JPMH 3RU4D 3P8OA 1ACBE 2TGAA 3ZVBA 2XBYA 2XXLA 4MNVA 4OS4A 4FUFA 2ZU2A 3F68H 1G32B 3SNDA 1ZHPA 2BX4A 1VCPA 2VIOA 2JETB 1QA7A 4JK6A 1Y3XA 2AGEX 2FOAA 1C1PA 1Y3WA 5I46H 2CMYA 1IQIA 3NCLA 3SJIA 2QY0B 3A7ZA 3UFAA 1MZDA 2ANWA 1FI8A 2QC2A 1GHAF 3RP2A 3RXMA 1ZMLA 1BZXE 4ZHLU 3IG6B 3LGYA 1LDTT 3F9FA 2OLGA 1G2LA 1K21H 5DK1A 1XXDA 1XVMA 2AGIX 3SGQE 2F9PA 3ATMA 1O2KA 3E3TA 4YESB 4Q2KA 4JYTA 1C4U2 1ZR0A 1NU9A 1TNHA 4UDWH 2HWLB 1K2I1 1EQ9A 1TA6A 4KKDA 1OWHA 1ANEA 3MO3A 2C90B 1V2LT 1LHFH 3AASA 1BBRK 4HTCH 1AO5A 5DP3A 3GCTF 1PFXC 4XDEA 4NA8A 1D9IA 1HIAB 1ZSJA 2ESTE 1C2GA 1O5GH 2DE9A 4B74A 4NWLA 3SU4A 1BRCE 1P06A 2PUXB 1P02A 2VIWA 3TK9A 1O0DH 2AMPA 1TMBH 3SJOA 3ZZBA 1GBLA 1C2LA 2BOKA 5EW1H 5F8ZA 3MO6A 3EDXB 3BEIB 1EJNA 2AERH 3SJ8A 2VH0A 2LNCA 2Y82A 2CXVA 3MNXA 3MH7A 7LPRA 1O5EH 1Z8IB 1MBQA 4E7NA 3KCGH 5K0HA 4AG1A 1SFIA 3HPTB 3LONA 1UK3A 4Y6DA 1A0JA 1P09A 4F4OC 1J14A 3RXJA 3O8BA 3ZZ8A 4FUEA 2AH4X 1FXYA 4GHTA 4INHA 3TNTA 2FDAA 1FLEE 3PLPA 1ARBA 1VITF 2CHAC 1GBBA 1O3BA 3MOCA 5E2OA 3LC5A 4FUGA 5F03A 2ZHFH 1MZAA 4H6TA 1UHBB 2QXJA 2ZTZA 1GVLA 1GHAG 1YPHE 2ZCHP 4AFQA 1Q2WA 1DXPA 1V2NT 4ZROA 1NZQH 4A7IB 5LGOA 1UVUH 3ZVAA 2WPKS 1O35A 2BD3A 3T2NA 1LVOA 2KAIA 1CHGA 3FVFB 4ISNA 3L3TA 1C5WB 1BHXF 3O8DA 1ZMNA 4I8GA 3PTBA 3ENSB 1WUNH 3RMMH 3URDA 1NRPH 1ZTJA 3T62A 2GKVE 2IJOB 1UJ1A 1C9PA 1EX3A 1GJCB 1RTFB 1L0ZA 3KEEA 3RM0H 1SSXA 4BXWA 1WSSH 1O3OA 3V13A 2B5TB 2A32A 2Z9JA 1NESE 5TCAA 5EQQA 1Q31A 1RJXB 1T8NA 2JH6D 3UUZA 4FUJA 4AB8A 5FAHA 1O2NA 2C8XB 4CHAB 3HK3B 5DPAA 1L1NA 4AB9A 4MPVA 2ZU5A 3AW0A 5AHGH 1D6RA 1HAVB 4K3JA 1IQFA 1BCUH 1C1TA 4LK4A 4I8KA 2HVXA 3RXCA 1FN6A 1A2CH 1BTYA 3L33A 1P8VC 1GI0A 1F5RA 4ISHH 5C1XA 1UTNA 1C2DA 2OQ5A 1DOJA 4BAHB 3PMAB 2FO9A 1ZPBA 1AU8A 1C2MA 1AFQC 1SGCA 4BAOB 3A7VA 2IOTA 1FY4A 5F8XA 1S85A 1O34A 1S81A 1TNIA 3RXSA 4DY7B 3F9HA 3UREA 1C5OH 3M5NA 1O3JA 2NU0E 1H9LB 1UHBA 1DWDH 1C5XB 5FCKA 2P59A 1DXWA 3B23B 4Q7XA 2PWXA 1HAGE 3BTDE 2QV1A 1TNGA 2UUFB 1J17T 1GI5A 2BY6X 1SGFA 1S83A 2CV3A 3PO1C 2BHGA 1DUAA 3C27B 3BTEE 3GY7A 1HAXB 1O2HA 1PPEE 5LH8A 2O8UA 3SNAA 5L30H 1C2EA 1DLEA 1NY22 1XUKA 4A1VA 3QZRA 3UNRA 1ZTKA 2OC8A 2XBWA 1O3CA 1XUGA 1GJ8B 3EA8A 4K1TA 5J4SA 4DGJA 4NA7A 2RDLA 1TWXB 2ZFSA 1ELDE 4F49A 1PQ5A 1O2PA 2BZAA 3M3VA 3KQCA 1C5PA 2R0KA 2ZDLA 1O3LA 4MDSA 3U1IB 1EATA 4WMEA 1HV7A 1EZUC 3MNBA 5PTPA 2VGCB 3NZIA 5BPEA 1P9UA 1RIWB 1HXFH 2AFQB 1AUTC 1W0YH 1LKAA 4GLYA 4I32A 1AWHB 1H9IE 4CR5A 1BBRH 1W11U 2TIOA 1CE5A 1QBOA 5C5NA 1XKAC 5JB9S 4DVAU 1RTKA 2GVFA 3E0PB 1KYNA 4Q7ZA 3ZYEA 3K65B 3ZVFA 1BDAA 1IAUA 2B0FA 1MD8A 3GDVA 2W7SA 3SGBE 1GI6A 1HCGA 1ETRH 1YPGH 2ZFRH 2ANKH 1G3CA 3M7QA 2GV7A 4DIIH 3RXBA 1GI9B 1YLCA 2H2ZA 2UWOA 4WXIA 3QDZB 1C5SA 3ZZAA 4SGAE 3ZVCA 2W3IA 1AN1E 4MVNA 1N6YA 2Y7XA 3RU4T 2EEKA 3RXLA 1C2JA 2SNWA 3BG4B 1AKSA 2PW8H 3FP8E 1WU1A 4JZEH 2PKAB 2FI5E 4KTSA 1DX5M 1DFPA 1IQLA 1GBCA 4X2VA 2RA3A 2WYGA 1SFQB 1JIRA 1CA8B 4NZLA 4ISOA 1Y59T 1V2PT 6GCHF 3A83A 1MMJN 2C8WB 3S7HB 1EB1H 1MQ5A 2O8TA 1GHWH 3ZZ3A 1TX8A 2LPRA 2VWLA 5C67A 5L2ZH 4XOJA 4IN1A 2R2MB 4TYDA 1XUIA 3VB6A 2ODQA 1FIZA 1SHHB 3FP6E 5DP5A 3NWUA 1GDQA 1YLDA 2GMTB 3ZVGA 1C4V2 5EQSA 3BIUH 1KXCA 1CA0B 3PMJA 2FOMB 1QFKH 1O2VA 1IHSH 1QHRB 1L1GA 3UWIA 5JBCS 1BUIA 1CO7E 4GHQA 1P2IA 3N7OA 3VFEA 1NM6A 2R9PA 1BMAA 2XNIA 4K69A 2VJ1A 1A5GH 4D76A 1T31A 4KGAA 2WPJS 4ABHA 3TU7H 4X1SU 1BIOA 2RA0A 1C1VH 1QCPA 4A1TA 1K1MA 1ZZZA 1L2EA 3OY5U 2GP9B 1GJ7B 3NPSA 1QB6A 1YP9A 1DWBH 1MTVA 4Y8ZA 3TLOA 1WYKA 1QL9A 2F9UA 2J38A 2FYQA 2V6NA 3QTOH 5A0BA 4UFFH 2QF0A 3LGTA 2XYAA 5E8EH 1LCYA 1FV9A 3LH1A 3KQBA 5DP6A 3ZZ4A 2O8WA 2CF8H 4I8HA 3GCNA 3QZQA 4NCYA 1O3AA 1HAYB 2GZ9A 1SLUB 1SGEE 1YPHC 1C1NA 3PWBA 4TY6A 1DANH 2P8OB 1IQMA 4I7YH 3EA7A 2C3SA 1LTOA 4AORA 2NU1E 2OQUA 2A7CA 1P2MA 2GCHF 4NFFA 1THPB 3M7UA 1ABIH 1GBIA 1GJ4H 1K1PA 1EAWA 1FZZA 2FPZA 5FPTA 4E7RG 4X0WU 2TGDA 4B1TA 1O2GH 1RIWC 3H7TA 2OC7A 1HJ9A 1X7AC 2OTVA 2VVCA 3SUEA 1C5TA 1ELFA 3RXPA 1YCPK 4IS5A 3M5LA 1Z6EA 5GWZA 1EKBB 1C1QA 1QJ6B 4JK5A 1LO6A 1P3CA 1CGIE 2PV9B 4JYUH 2WPLS 3A8AA 2PTNA 4PROA 1RTLA 2H9EH 1O2RA 6CHAB 2FOEA 4WY3A 2G5NA 5T3HA 5TJXA 1O2XA 1SG8B 3R3GB 5BRRE 4BAKB 4YZUA 4Y7AA 2BYAX 3RXEA 4ASHA 1ANCA 3SQEE 4CBNA 3LGIA 3V12A 1TAWA 1MUEB 5A09A 1KLIH 2JH5D 3TJOA 1DPOA 1YPEH 8LPRA 1WAYB 2OC0A 1T8LA 3ATIA 1DY9A 1LPGB 3ELAH 1T8MA 1OP0A 1L4ZA 1AZ8A 1KXBA 4DW2U 3ATWA 1KIGH 3LJJA 2A4RA 3HGNA 1XUHA 4ISIH 3M3SA 5T6FA 1C1SA 4CH8B 1TPSA 4B2BA 4ZKNU 1ZGVA 4U30A 2SGPE 4X1QU 5EU8A 1UTKA 1OX1A 2WUCA 2GCTB 4FU8A 1XVOA 1THRH 1T7CA 2A7HA 2G00A 1HAOH 1ZPZA 2K1QA 3ZZ6A 5IDKA 2W3KA 2O9QA 3E6PH 1AKSB 2W7UA 1P03A 1HAPH 2ZGCA 7ESTE 1UK4A 4IC5A 3QX5H 1SOTA 3PMBB 3VXEH 3FP7E 2QGRA 4X1RU 3A80A 1NTPA 1TIOA 2ODPA 3A84A 1ESBA 2QXHA 2FS9A 1INCA 1XMNB 1BMMH 1WTGH 1IQHA 2FLRH 3KQDA 2D26C 3SNCA 3ESTA 3CS0A 5H4IB 3WY8A 1MKWH 3OU0A 3CENA 1HNEE 1K1LA 2BD4A 2Y6TA 1BOQA 3Q3YA 1O3NA 4Y7BA 4LXBH 1F7ZA 2EI8A 1BT7A 5EPYA 1H1BA 4HGCA 2G81E 2OUAA 1Y5BT 2OBQA 1GPZA 1SGDE 3W94A 1F0UA 2ZZUH 2BDHA 3F9EA 1C1UH 1KSNA 4X8TH 3SUGA 3BSQA 1KDQA 1TQ7B 1VGCB 2FOFA 1ZRKA 2ZHWH 2BX3A 1YM0A 2F9VA 3SO3A 1S82A 3PYHA 1EXFA 1SGQE 1D3QB 3OSYA 3VPKA 3GY2A 5EG4A 1FMGA 3AAVA 1HUTH 1C4Y2 1GI1A 1BJUA 4BXSA 3ITIA 2ZWLH 2ZU4A 1V2MT 3ZYDA 1KXFA 1JBUH 3LT3A 2R2WU 1TNKA 1ESTA 1WOFA 3SORA 1C2HA 1RRKA 1EUFA 1S6HA 1PPCE 1UTMA 2FXRA 1GI2A 1QJ7B 1WV7H 3TVJB 1O5FH 1EPTC 1C5QA 2VIQA 2PR3A 3F6UH 1FPCH 3A87A 1WQSA 1QRXA 1FDPA 5C20A 4A6LA 1JXPA 3MHWU 3I78A 1EOJA 2RCEA 1O38A 1O32A 2J95A 2ZDAH 3OY6U 1GBAA 3E16B 1O2OA 2YNAA 1TPPA 3GYMA 1QB1A 1O2LA 4FUBA 2H9HA 4DIHH 1O2ZA 1A4WH 1SQAA 3BTHE 5FBIA 3DA9B 2ZGJA 1G9IE 2WYJA 4BTTB 2OP9A 2SGQE 3NKKA 3P8GA 4VGCB 3RXTA 1UTLM 2DE8A 3QGNB 1BHXB 1YCPM 3AAUA 1P2KA 1VCWA 3SV2H 1OKXA 4CRDA 1MKWK 2SGFE 1MAYA 3SV6A 4RKJB 1ELVA 3RC6A 1TOCB 1CT0E 1JRSA 1AGJA 4AGJA 2FOCA 4FU7A 3A8DA 2ZGXH 2HNTC 2AS9A 4A92A 3RC5A 3FANA 1SMFE 1GBTA 3GDSA 2ZFFH 1Q3XA 2KAIB 4NIXA 4K60A 3ZZ9A 1SGNE 2ANMH 4ZKSU 1GMCG 4MNXA 2Y81A 4H4FA 4ISLA 4WJG2 1BRAA 2CN0H 1AY6H 2H1UA 3SJKA 3GYLB 2Z3DA 4CRAA 2BD8A 2HGTH 4K1SA 3FZDA 2VVVA 5GXPA 1GCTC 1NROH 1W13U 4X8SH 2ZC9H 1CSOE 3T26A 2TPIZ 3IITA 2GV6A 1GVKB 3KNXA 9LPRA 1GCTB 3NXPA 1ETSH 3RDZA 2ZPQA 1H4WA 3CP7A 1BTHH 1LKBA 1K1IA 1LHGH 5A8YA 1O2QA 1QBNA 2ANYA 3GY3A 3SHAH 3O8RA 1G3EA 4AFZA 1TGSZ 3QLPH 2Q1JA 2GZ7A 4RSPA 1O3GA 1TBQH 1A0HB 2P8OC 1IOEA 3M37A 4NIVA 1GJ6A 1HFDA 1MD7A 1BBRE 1BTPA 1G2MA 3O8CA 1QNJA 2A1DB 5EGMA 3DT0H 3LKWA 1ZSLA 2VWMA 1SQOA 1Y8TA 1O5BB 1EAIA 2ZTXA 1THSH 1TYNA 2Z9LA 1QQUA 5E2PA 1G36A 2XCNA 1C5YB 3VB7A 1IQNA 2ZCLP 2PHBA 4JMYA 1GHZA 4I33A 5F6MA 1O3DA 3TGIE 1SGIB 1GBJA 5FXLA 4U01A 2YOLA 3SNEA 4H6SB 3RXAA