2QGVA

Crystal structure of hydrogenase-1 operon protein hyae from shigella flexneri. northeast structural genomics consortium target sfr170
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
b'TPFDALWQRMLARGWTPVSESRLDDWLTQAPDGVVLLSSDPKRTPEVSDNPVMIGELLHEFPDYTWQVAIADLEQSEAIGDRFGAFRFPATLVFTGGNYRGVLNGIHPWAELINLMRGLVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 operon protein hyaE
publication title Crystal structure of hydrogenase-1 operon protein hyaE from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
total genus 23
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qgvA00
3QD9A 1O8XA 1Z6NA 1XFLA 3QCPA 3KM6A 4WF5A 4X1UA 1V58A 2HZEB 5HFKA 3IXRA 4POLA 3C1SA 3ZMKA 2HI7A 3IBHA 5ECQB 1KNGA 1YEPA 4JBBA 2LNTA 3F0IA 3KMOA 1G7EA 4AF2A 3ZMLA 1WWJA 5B8AA 3C7MA 5ECLB 4HJMA 4Q5NA 4LMVA 1RQMA 4YAVA 1GTAA 3RHCA 3LEFA 3G9BA 3F4RA 2XC2A 1ACVA 1DSBA 3Q6OA 4L0WA 1Z6MA 2FWFA 2H1DA 3HVVA 3WGXA 1X5CA 1USBA 3VK9A 4F03A 2DMLA 4POKA 5DBQA 2OE1A 3PGTA 5DALA 2GSRA 1SJIA 4MF5A 2XPDA 2MMZA 2GT5A 2YJHA 5H5QA 1AXDA 1EP8A 2C4JA 4G19A 1PMTA 20GSA 1AC1A 4RUVA 1GRXA 1FB0A 1C72A 2J23A 1JZRA 1XOAA 1FB6A 3GA4A 1W89A 3GIXA 2FWEA 4XIHA 3VFIA 2IFQB 4O32A 1ML6A 3VWWA 2FLSA 2K8VA 5H5SA 1SD8A 3ZTLA 2YNXA 5ELAA 3P90A 1MTCA 4TN8A 3QDNA 5D73A 2JZRA 4WR5A 2B6MA 1GUKA 4HU9A 5CP1A 5G5EA 1U3AA 2VAFA 1YKCA 3O3TA 1DE2A 1WP0A 2PUKC 2B7KA 3D4TA 4XTSA 2DLXA 2FD3A 3G7YA 5GZZB 4BWSA 2X8GA 5D9WA 2H1GA 3E3EA 4XHMA 1YF0A 1E6BA 3LFLA 2K6VA 2HSYA 4ZBDA 13GSA 4TR1B 5D93A 1OC9B 2VCVA 1OC3A 1T3BA 3QAVA 2V1MA 3KJYA 1YY7A 2K18A 3I69A 1GP1A 1B9XC 1LBKA 2YZUA 3UARA 3W8SA 1K3OA 2IIYA 3GURA 5JCWA 5D9TA 2VCTA 3CSJA 3TCOA 3FY7A 3DGQA 2B1LA 3KGKA 3DWVA 3APSA 3M9KA 1O73A 1PL1A 3HZ4A 1A2LA 4IBPA 19GSA 2QC7A 1AAZA 2HFDA 2YCDA 3LQ7A 5D8IA 1HNBA 3PINA 3UOMA 1VRSD 4L5OA 3GYKA 3HVXA 2LKUA 3A2WA 2V32A 2FHEA 4MH3A 2GDRA 2C3TA 1SYXA 2R3XA 2PERA 4PQIA 5IMCA 5KEJA 2XPEA 2BTOT 3UMAA 1X9MB 2I9HA 4QL7A 2P5QA 3M9JA 3MNGA 2LEGA 4KW6A 1SKSB 4MJCA 1I9DA 3KEBA 2CQ9A 4V1Ap 2ES7A 2GQLA 3GKKA 1IYHA 1W4VA 3ZFBA 2H66A 4V1Ag 2HNLA 5DAKB 5CAXA 1ST9A 1ZYQB 2AUVA 2K8SA 1XXUA 3MWHA 1A0RP 3HHVA 2R2JA 4IKHA 1GLPA 2N5BA 4HU7A 1YJ6A 3FZAA 4LMWA 1SL1B 5EVOA 4O5RA 5FT3A 1H4OA 6GSXA 1J0FA 2RUEA 4ACSA 3BD2A 1A2JA 2FA8A 1SKWB 5D9XA 2H75A 3N5OA 3A3TA 4KX4A 4TXVA 2I4AA 3J7Yb 3BCIA 2WFCA 1CQHA 3ZZXA 4DVCA 3W6GA 1AUCA 1ERTA 1Y6EA 5B6MA 1TI1A 2IMEA 5AISA 2C1YA 3CBUA 1PQNA 2G2QA 3GKXA 1EGRA 3D5JA 1XW9A 5KN0A 2GZZA 3D21A 2GVPA 3Q19A 4N11A 1PN9A 2YWIA 4FIWA 1M7TA 5IQYA 2OJLA 2LQOA 5C04A 4MF7A 2R4VA 3LG6A 1J9BA 3APQA 1O81A 4TXOB 1PKZA 4HS1A 4EDYA 4KNDA 1O8WA 3CRTA 1T1VA 5G1LA 5IPGA 1Z7RA 1X5DA 3ERFA 5DQSA 2V2GA 2C3NA 2MMNA 3CXGA 2O8VB 3GMFA 2HZFA 5DJMA 5F07A 1XZOA 4G9HA 2H0IA 2FA4A 4IP1A 4ECBA 1GWCA 3GH9A 3GRXA 2RM5A 1N2AA 2GSSA 3PR8A 3A2VA 2JADA 3ZITA 3LXTA 3HXSA 1A24A 3LXZA 4BA7A 5HR1A 3AY8A 4EE0A 2F9SA 3MAKA 2H71A 1M2BA 1K0AA 3UAPA 4MMMA 2KP2A 3L9UA 1SK1A 3KIJA 2WCIA 4MP4A 1BEDA 1ZL9A 3O6TA 4ZB6A 5IMZA 2DMMA 3U6VA 2B5YA 2AJQB 3GL3A 3FK8A 4ZILA 3L0HA 1EV9A 1OAZA 4GRFA 2IJYA 3RDWA 4YQVA 5GAPD 1AW9A 4KH7A 3HY2A 2AV4A 4XS6A 2PVQA 1VF2A 2H8LA 2RM6A 4JR4A 3FZ9A 3TJJA 4Q5RA 4CW9A 5L71A 4TW5A 3QAGA 4ZBAA 3F6DA 3KH9A 2VL2A 4NV5A 2E2GA 1XIYA 2XHFA 2X99A 2YZHA 2KUCA 3IA1A 3TKSE 5IOWA 1B4QA 1SENA 5F0GA 9GSSA 3GFKA 3GNJA 4HJ2A 3DYRA 3GKMA 3R2QA 1B4PA 2YPMA 3TOUA 4NXIA 3VPTA 2L4QA 2H6ZA 1GNEA 1VGLA 2VCZA 2PU9C 4MABA 3ERWA 6GSTA 5HQPA 2CA8A 2QSIA 1FVKA 1T00A 1TI3A 2L6DA 3EC3A 4NHZA 4WKWA 3FZ4A 3TJGA 4V2LA 3FW2A 1R4WA 1V98A 2VL9A 3ZRDA 2L57A 4YAPA 5F05A 1M2AA 4BVYA 4BWQA 1DUGA 4X0XA 4OFMA 3DKSA 1TK5B 5G30A 5DCHA 3ZFLA 5IO2A 4I8BA 1MDIA 3HYPA 5D96A 3ZL5A 2WULA 4LL4B 4BPYA 3RPPA 2DJ3A 3GV1A 1TU7A 3TKRA 1DE1A 4KDXA 3MSZA 1SJ6A 1TRVA 1E2YA 1SD9A 1M9AA 5J9BA 4I6XA 2VL2C 1K3YA 3ME7A 3G7IA 5AGYA 1GULA 4KCEA 1T4ZA 3UEMA 3ZLPA 1T4YA 1F6MC 5G31A 5ID2B 2C0DA 3EWLA 5IMAA 1K0NA 3FKFA 5CO3A 2OE3A 2O85A 2EIOA 4I97A 1GTIA 3F6FA 3LYPA 4J56E 3GKNA 3QMXA 4K7NA 5HR0A 3UBLA 1ON4A 1GSEA 4G2EA 4PNFA 1MD3A 4IVFA 1FAAA 1GLQA 3H8QA 4ZB8A 1CQGA 3U5RE 3P2AA 2B3SA 3ZVJA 4MPGA 3FR9A 5ABRA 1U87A 3TRQA 3DXBA 2GZPA 3IAM2 1THXA 2L59A 5FWGA 4ZL7A 3S9FA 1XBSA 4WXTA 1QK8A 4V2MA 4N10A 3GH6A 3NOFA 3IOSA 1MDKA 2WRTA 4AJ8A 1K3LA 2E2MA 4GF0A 1M9BA 2H0HA 1TKDB 3EE2A 4OCFA 2NDOA 4RI6A 1GSFA 2C0GA 2XBIA 3ED3A 4MCUA 4OFTA 1YZXA 2JSYA 5G2ZA 2FY6A 4KDYA 2O87A 2DJ2A 1XWGA 2HRFA 3GSSA 3SBCA 1A8LA 4EVMA 4MZWA 3F3QA 1MEKA 5CREA 5C00A 2VM2A 1BJXA 3DIEA 2E7PA 1Y25A 6GSVA 1SU9A 5KN3A 4NPBA 3ZREA 4IQAA 4KAEA 1BX9A 4RI7A 3H93A 4TOPA 5J3RA 1X5EA 2F3MA 2DJKA 2DIZA 1S3AA 3C71A 2F8AA 4HZ2A 2OBIA 2YP6A 1NHOA 3CSHA 4GCIA 3LSZA 1M99A 2L5OA 3IE3A 1FW1A 4BL7A 3IV4A 2H76A 1LJRA 6GSUA 2P31A 1B9YC 4GSNA 4K1FA 5CRWA 1XWAA 1URMA 2LRNA 4O7HA 4DSSA 3KP8A 1AQWA 1EWXA 1XCCA 4IELA 3QOUA 2MMAA 2DSAA 2KOKA 3RAZA 4F82A 3BBYA 2KHPA 1TDIA 4ILFA 3WT2A 2LS5A 2DBCA 4HDEA 2VO4A 3ERGA 3GTUA 1R7HA 3FRCA 2HZEA 4IHUA 2LJRA 1YEXA 4KUNA 5KN2A 1PL2A 1EP7A 3VWVA 3IDVA 3JCML 3UVTA 5J9CA 5D9VA 1G7OA 2TRXA 4K2DA 1PX7A 3E9JB 3G7JA 1R5AA 1YKAA 2X8CA 2LSTA 5A4WA 2ON7A 4AGSA 2GZYA 2WS2A 3EINA 1XW5A 4IW9A 3UL3A 1XPVA 3LORA 1JZDA 1KEBA 4K9ZA 3KD0A 1O7UA 3FYGA 1ERVA 1EZKA 2MZCA 2YJ7A 2M46A 3US3A 2HSHA 1ZGNA 4NAXA 5G1KA 3HJOA 2E0QA 5ECMB 2MBSA 5B8BA 1SKRB 1YDKA 2CAIA 1TRUA 1GSYA 1XOBA 1HNCA 1XVWA 2FWHA 5DVBA 4J57E 3WT1A 2CT6A 2VLVA 4KE3A 2HYXA 2IFQA 2H72A 1SL0B 3VWXA 3TJFA 2B7JA 4D73B 3RHBA 1Q4JA 3KXOA 5DDLA 4WBRD 3FEUA 5A5KA 3ME8A 1WE0A 5AIVA 2REMA 4LA1A 2EIQA 5ECOB 4XRAA 4XS4B 2R5GA 3F3RA 4TKYA 4J2FA 2AYTA 1ILOA 3GHAA 2A4VA 2PMTA 3M0FA 4JU5A 1GUMA 1G6WA 4ID0A 4HQZA 1O85A 1N8JA 1V9WA 2WDUA 3IRAA 4K0GA 1JHBA 2HLSA 5LNKe 4EDZA 4WF4A 4I5QA 4TR1A 5DCGA 2RUFA 4V2NA 1OC9A 1EGOA 4EO3A 4AJ6A 4TR0A 3EMXA 1F3AA 1H75A 3W8JA 4PURA 1BQ7A 2NPBA 4PUFC 1DBYA 4OCEA 1A23A 3KCMA 2HXKA 3CTGA 4ECCA 2VD1A 1V40A 2NVLA 4KCAA 3ZIJA 5H5RA 4MA9A 1X0RA 3LWAA 1R5PA 1ERWA 3HKRA 1PSQA 1KBNA 2JL4A 1ERUA 3UBKA 2IL3A 4X43A 2OBKA 1AQVA 2N5AA 2D2ZA 4FYBA 3CMIA 4PX1A 3IR4A 1PGTA 4POBA 4RQXA 5CRDA 2CV4A 1I5GA 5DALB 5E59A 1BYEA 1WOUA 4FYCA 4WR4A 1T7PB 1ABAA 11GSA 10GSA 1IYIA 2XBQA 4MH2A 2P5RA 2FUG2 1TK0B 5HR2A 2I1UA 4MDCA 3QFBC 3KTBA 3E0UA 4IP6A 2V6KA 2JU5A 3RBTA 4K0NA 2GLRA 3HA9A 4OO4A 3NZNA 2H0GA 3M1GA 1M0UA 4GTUA 5F06A 3ZVJD 22GSA 5IMFA 2YV7A 2VL3A 2OKAA 3OR5A 5COHA 2IMKA 4N0ZA 2KLXA 1F2EA 2VLTA 5EL8A 5DAKA 1R26A 1TTZA 3BOAA 5HFIA 1QGVA 1UN2A 12GSA 2LJAA 3WD6A 1YF1A 4I2UA 4Z7XA 5EPFA 4XRDA 4MJBA 1ZZYA 1GTUA 1YQ1A 5HFGA 3VLNA 3KTLA 3P8WA 1EEMA 1HD2A 1AIUA 2GTUA 3RPNA 4K8MA 4LLRA 1U6TA 2O7KA 3APOA 3DVWA 2WB9A 3K8NA 3QAWA 2AAWA 1PX6A 2VCQA 1RK4A 4GSSA 1OE7A 4PQHA 3HZ8A 3EVIA 1UA5A 1WRYA 2H1BA 1JZWA 1HYUA 1F9MA 1TW9A 2B5XA 2J9HA 2JZTA 2C80A 4XS1A 2C0FA 5J4UA 3KMNA 3C1RA 5JCUA 3C73A 2IN3A 4EC0A 3DEXA 1AQXA 2AHEA 4HQSA 2F8FA 2IPAA 3TKSA 4P3YB 4L8EA 4IJIA 3LJRA 1JZOA 3L9SA 5GSTA 3WGEA 1HNAA 5GAND 2R6KA 2YV9A 4NWYA 1TRWA 4HZ4A 1GL8A 5F8BA 2PPTA 3I6AA 3GTUB 4TR4A 4KA0A 3J7Yk 3EU3A 4TXOA 2C3QA 2VOCA 3WYWA 1Z3EA 3F4SA 3UIWA 2L4CA 4O92A 3IK9A 6GSSA 3TOTA 2V41A 3H79A 1SK2A 1O6JA 1LU4A 2BJXA 2LQQA 4POMA 3H1NA 2VLUA 1S3DA 1PKWA 4F0CA 1B48A 8GSSA 3CRUA 2VCXA 2MBTA 4N0VA 1GSQA 1K0BA 2LJKA 4KDUA 4XCSA 4OMVA 3SWLA 5CYYA 4MZCA 1GSDA 2GSTA 2HRNA 1TK8B 3Q18A 3GX0A 4OD7A 3GX8A 2IMIA 4FO5A 4OO5A 5IMVA 4ZIJA 4TVEA 3WGDA 2H1AA 4F0BA 1ZOFA 3HD5A 4PQ1A 2L6CA 4PGTA 3TKSC 1EEJA 2K9FA 4TR3A 1ZCPA 2NTOA 3H4KA 3C8EA 2JZSA 2F51A 1FO5A 4Q5FA 3BJ5A 1FOVA 3VI5A 4PUAA 2PBJA 2H01A 2ON5A 4MLYA 4QL9A 1FHEA 2DC5A 3CYNA 1TOFA 2HE3A 4KB3A 3KP9A 4HEA2 2X64A 4ML1A 2R37A 1J08A 4GQCA 4QQ7A 4E8EA 3L4NA 2RIIA 5ECSA 1ZYEA 2ZUPA 3HJMA 3IAS2 4CDOA 4IS0A 3HJPA 2B5EA 1QXHA 2JSZA 1RW1A 2TRCP 2I81A 3I43A 4ZL8A 2ZCTA 3IK7A 5IPHA 4HOJA 4GLTA 5IIZA 2ZNMA 2H70A 4JZQA 4F2IA 3CSIA 1OKTA 1T8EB 1XWBA 5ELGA 1V2AA 4DSQA 1FG4A 3MDKA 4FH8A 2DIYA 1NHYA 2OE0A 1F37A 1HQOA 4MJEA 3DD3A 3DVXA 4L5LA 1SK0A 3ZIVA 1EV4A 4KSMA 2OA7A 2EC4A 3D4MA 4IGJA 4MZBA 5HR3A 2IMDA 2MMOA 2A2RA 18GSA 4I2TA 4JR6A 1QQ2A 5ECHB 2YN1A 1A8YA 5IOXA 2KP1A 17GSA 2M80A 2YWOA 3TKPA 2GQKA 1Z5YE 3FR3A 3P7XA 2LUSA 3F8UA 4MF6A 2I3YA 5JWRB 4JEDA 1K0MA 2QGVA 2WJUA 3EURA 1QMVA 5A4VA 3VI7A 4H86A 5ENUA 2VM1A 1OYJA 4IQ1A 1WPIA 2M72A 2CX3A 5G5FA 1GSUA 4GQFA 3ZYWA 5DQYA 2RLIA 3DMLA 3GUSA 2O89A 2ALBA 3HVSA 1NM3A 1U88A 4EUYA 1VF4A 2VUPA 4HUAA 4EL1A 5ID2A 16GSA 1GNWA 1TU8A 1WJKA 5AIXA 4ML6A 4NMUA 1EOGA 4YQMA 4CHSA 4PNGA 2H6XA 1UVZA 1PD21 4WEYA 3Q74A 3F9UA 4ZL9A 2V6OA 5EY6A 6GSYA 4Q5QA 1MD4A 3FR6A 3HDCA 14GSA 4EXJA 2CZ2A 2LNSA 3GSTA 2X8HA 1UC7A 2TIRA 1TP9A 2CVKA 1OKDA 4GWRA 1FVJA 4ZXGA 3VPQA 4ECJA 1QFNA 3M3MA 1G6YA 1VF1A 2PVOC 2MYGA 2IMFA 3I9V2 4G10A 5IMDA 3FHKA 5JWQB 1JLWA 5B7CA 3TRXA 3CTFA 4K7OA 3ISOA 4LL1B 5B6NA 5ECRB 4FYUA 1EOHA 3D6IA 3TB2A 4K7IA 3VURA 3EYTA 1BG5A 3FZ5A 3KH7A 2H19A 1S3CA 3EU4A 3GL5A 1TRSA 3F4TA 3TGZA 4K6XA 1TXXA 3IPZA 3VWUA 4ULXA 4DSRA 1X9SB 2NBSA 3D22A 1Z9HA 1M2DA 1MDJA 1WIKA 5E4WA 4YQUA 2H74A 2GS3A 3IC4A 1KTEA 3O76A 4EKZA 3EMPA 3TRPA 3BCKA 2LTKA 4TRXA 1SL2B 1A2MA 1XVQA 2H73A 2CVDA 3QFAC 2CVBA 4RQRA 3UVHA 5ECPB 4PXOA 5GSSA 2YOIA 2GGTA 1B8XA 5CRHA 2PGTA 4ISDA 4GXZA 1K0DA 2A2SA 2B1KA 1GUHA 1K0OA 5LCZA 4ECIA 1Q98A 5KN1A 3QPMA 2LV3A 3M8NA 1U3IA 3IHQA 3L78A 4OFNA 4ZB9A 1NSWA 1JLVA 2C8UA 5FHIA 2CZ3A 1GSSA 1QUWA 2EIRA 3A5WA 2PWJA 3L9VA 3QR6A 2HT9A 5J5NA 1TJDA 1ZMAA 7GSSA 3LGCA 2DJ0A 4WETA 4L0UA 2JACA 1G0TA 2LRTA 1Z7PA 4JRRA 2WGRA 5CRGA 3A2XA 2C0EA 1SYRA 2VCWA 2DJJA 5J41A 4F9ZA 2OADA 3UJ1A 5INYA 4WBJA 2GSQA 1OE8A 2YWMA 3F63A 2CAQA 4E8HA 2FGXA 1NW2A 6GSWA 5LD0A 4IJ3A 3N9JA 3PH9A 1F3BA 1THOA 2GQMA 1A0FA 2H30A 5IO0A 4AJ7A 1JFUA 3NIVA 4N30A 4ZBBA 2VIMA 3DRNA 5ECIB 1GTBA 2H6YA 2G0FA 2IWTA 4GSTA 2FCHA 4MJAA 4EF0A 1VF3A 1V57A 2FWGA 5JCGA 2DJ1A 5AN1A 2L5LA 2PN8A 1BAYA 1SJZA 4MK3A 2YANA 1PA3A 3TUEA 3TJKA 4KSOA 5A4UA 4YH2A 5ECKB 5DJLA 1GH2A 1XW6A 2VD0A 3TDGA 1OVNA 2CX4A 3KZQA 2YWNA 1XWKA 2P0GA 2QKEA 1X9WB 2LRCA 2N5FA 3D0ZA 4BVXA 4D73A 3HCZA 2AB6A 1XWCA 5IM9A 5JWOB 1PRXA 2WZ9A 2FNOA 1OC8A 4HI7A 3TJBA 4DSSB 3TKQA 3LYKA 5ECNB 4IN0A 4XS4A 3GN3A 4OWYA 4MPFA 4NV2A 1WMJA 2Z9SA 2BMXA 4JE1A 2OACA 4KGIA 5CNWA 4DEJA 1K0CA 2GT6A 3V1WA 4NHWA
chains in the Genus database with same CATH superfamily
3QD9A 1O8XA 1Z6NA 1XFLA 3QCPA 3KM6A 4WF5A 4X1UA 1V58A 2HZEB 5HFKA 3IXRA 3MYDA 4POLA 3C1SA 3ZMKA 1XG8A 2HI7A 3IBHA 5ECQB 1KNGA 1YEPA 4JBBA 2LNTA 3F0IA 3KMOA 1G7EA 4AF2A 4K2XA 3ZMLA 1WWJA 5B8AA 3C7MA 5ECLB 4HJMA 4Q5NA 4LMVA 1RQMA 4YAVA 1GTAA 3RHCA 3LEFA 3G9BA 3F4RA 2XC2A 1ACVA 1DSBA 3Q6OA 4L0WA 1Z6MA 2FWFA 2H1DA 3HVVA 3WGXA 1X5CA 1USBA 3VK9A 4F03A 2DMLA 4POKA 5DBQA 2OE1A 3PGTA 5DALA 2GSRA 1SJIA 4MF5A 2XPDA 2MMZA 2GT5A 2YJHA 5H5QA 2X49A 1AXDA 1EP8A 2C4JA 4G19A 1PMTA 20GSA 2A2PA 1AC1A 4RUVA 1GRXA 1FB0A 1C72A 2J23A 1JZRA 1XOAA 1FB6A 3GA4A 1W89A 3GIXA 2FWEA 4XIHA 3VFIA 2IFQB 4O32A 1ML6A 3VWWA 2FLSA 2K8VA 5H5SA 1SD8A 4K5SA 3ZTLA 2YNXA 5ELAA 3P90A 1MTCA 4TN8A 3QDNA 2JZRA 4WR5A 5D73A 2B6MA 1GUKA 4HU9A 5CP1A 5G5EA 1U3AA 2VAFA 1ZYNA 1YKCA 3O3TA 1DE2A 1WP0A 2PUKC 2B7KA 3D4TA 4XTSA 2DLXA 2FD3A 3G7YA 5GZZB 4BWSA 4ICYA 2X8GA 5D9WA 2H1GA 3E3EA 4XHMA 1YF0A 5BRTA 1E6BA 3LFLA 2K6VA 2HSYA 4ZBDA 13GSA 4TR1B 5D93A 1OC9B 2VCVA 1OC3A 1T3BA 3QAVA 2V1MA 3KJYA 1YY7A 2K18A 3I69A 1GP1A 1B9XC 1LBKA 2YZUA 3UARA 3W8SA 1K3OA 2IIYA 3GURA 5JCWA 5D9TA 2VCTA 3CSJA 3TCOA 3FY7A 3DGQA 2B1LA 3KGKA 3DWVA 3APSA 3M9KA 1O73A 1PL1A 4O5UA 3HZ4A 1A2LA 4IBPA 19GSA 2QC7A 1AAZA 2HFDA 2YCDA 3LQ7A 5D8IA 1HNBA 3PINA 3UOMA 1VRSD 4L5OA 3GYKA 3HVXA 2LKUA 3A2WA 2V32A 2FHEA 4MH3A 2GDRA 2C3TA 1SYXA 2R3XA 2PERA 4PQIA 5IMCA 5KEJA 2XPEA 2BTOT 3UMAA 1X9MB 2I9HA 4QL7A 2P5QA 3M9JA 3MNGA 2LEGA 4KW6A 1SKSB 4MJCA 1I9DA 3KEBA 2CQ9A 4V1Ap 2ES7A 2GQLA 3GKKA 1IYHA 1W4VA 3ZFBA 2H66A 4V1Ag 2HNLA 5DAKB 5CAXA 1ST9A 1ZYQB 2AUVA 2K8SA 1XXUA 3MWHA 1A0RP 3HHVA 2R2JA 4MNNA 4IKHA 1GLPA 2N5BA 4HU7A 4YKGA 1YJ6A 3FZAA 4LMWA 1SL1B 5KOXA 5EVOA 4O5RA 5FT3A 1H4OA 6GSXA 1J0FA 2RUEA 4ACSA 3BD2A 1A2JA 2FA8A 1SKWB 5D9XA 2H75A 3N5OA 3A3TA 4KX4A 4TXVA 2I4AA 3J7Yb 3BCIA 2WFCA 1CQHA 3ZZXA 4DVCA 3W6GA 1AUCA 1ERTA 1Y6EA 4G0LA 5B6MA 1TI1A 2IMEA 5AISA 2C1YA 3CBUA 1PQNA 2G2QA 3GKXA 1EGRA 3D5JA 1XW9A 5KN0A 2GZZA 3D21A 2GVPA 3Q19A 4N11A 1PN9A 2YWIA 4FIWA 1M7TA 5IQYA 2OJLA 2LQOA 2UZ8A 5C04A 4MF7A 4EIPA 2R4VA 3LG6A 1J9BA 3APQA 1O81A 4TXOB 1PKZA 4HS1A 4EDYA 4KNDA 1O8WA 3CRTA 1T1VA 5G1LA 5IPGA 1Z7RA 1X5DA 3ERFA 5DQSA 2V2GA 2C3NA 2MMNA 3CXGA 2O8VB 3GMFA 2HZFA 5DJMA 5F07A 1XZOA 4G9HA 2H0IA 2FA4A 4IP1A 4ECBA 1GWCA 3GH9A 3GRXA 2RM5A 1N2AA 2GSSA 3PR8A 3A2VA 2JADA 3ZITA 3LXTA 3HXSA 1A24A 3IHGA 3LXZA 4BA7A 5HR1A 3AY8A 4EE0A 2F9SA 3MAKA 2H71A 1M2BA 1K0AA 3UAPA 4MMMA 2KP2A 3L9UA 1SK1A 3KIJA 2WCIA 4MP4A 1BEDA 1ZL9A 3O6TA 4ZB6A 5IMZA 2DMMA 3U6VA 2B5YA 2AJQB 3GL3A 3FK8A 4ZILA 3L0HA 1EV9A 1OAZA 4GRFA 2IJYA 2R0GA 3RDWA 4YQVA 5GAPD 1AW9A 4KH7A 3HY2A 2AV4A 4XS6A 2PVQA 1VF2A 2H8LA 2RM6A 4JR4A 3FZ9A 4USSA 3TJJA 4Q5RA 4CW9A 5L71A 4TW5A 3QAGA 4ZBAA 3F6DA 3KH9A 2VL2A 4NV5A 2E2GA 1XIYA 2XHFA 2X99A 2YZHA 2KUCA 3IA1A 3TKSE 5IOWA 1B4QA 1SENA 5F0GA 9GSSA 3GFKA 3GNJA 4HJ2A 3DYRA 3GKMA 3R2QA 1B4PA 2YPMA 3TOUA 4NXIA 3VPTA 2L4QA 2H6ZA 1GNEA 1VGLA 2VCZA 4CY8A 2PU9C 4MABA 3ERWA 6GSTA 5HQPA 2CA8A 2QSIA 1FVKA 1T00A 1TI3A 2L6DA 3EC3A 4NHZA 4BIKA 4WKWA 3FZ4A 3TJGA 4V2LA 3FW2A 1R4WA 1V98A 2VL9A 3ZRDA 2L57A 4YAPA 5F05A 1M2AA 4BVYA 4BWQA 1DUGA 4X0XA 4OFMA 3DKSA 1TK5B 5G30A 5DCHA 3ZFLA 5IO2A 4I8BA 1MDIA 3HYPA 5D96A 3ZL5A 2WULA 4LL4B 4BPYA 3RPPA 2DJ3A 3GV1A 1TU7A 3TKRA 1DE1A 4KDXA 3MSZA 1SJ6A 1TRVA 1E2YA 1SD9A 1M9AA 5J9BA 4I6XA 2VL2C 1K3YA 3ME7A 3G7IA 5AGYA 1GULA 4KCEA 1T4ZA 3UEMA 3ZLPA 1T4YA 1F6MC 5G31A 5ID2B 2C0DA 3EWLA 5IMAA 1K0NA 3FKFA 5CO3A 2OE3A 4G0KA 2O85A 2EIOA 4I97A 1GTIA 3F6FA 3LYPA 4J56E 3GKNA 3QMXA 3MIXA 4K7NA 5HR0A 3UBLA 1ON4A 1GSEA 4G2EA 4PNFA 1MD3A 4IVFA 1FAAA 1GLQA 3H8QA 4ZB8A 1CQGA 3U5RE 3P2AA 2B3SA 3ZVJA 4MPGA 3FR9A 5ABRA 1U87A 4CY6A 3TRQA 2HRKA 3DXBA 2GZPA 3IAM2 2HSMA 1THXA 2L59A 5FWGA 4ZL7A 3S9FA 1XBSA 4WXTA 1QK8A 4V2MA 4N10A 3GH6A 3NOFA 3IOSA 1MDKA 2WRTA 4AJ8A 1K3LA 2E2MA 4GF0A 1M9BA 2H0HA 1TKDB 3EE2A 4OCFA 2NDOA 4RI6A 1GSFA 2C0GA 2XBIA 3ED3A 4MCUA 4OFTA 1YZXA 2JSYA 5G2ZA 2FY6A 4KDYA 2O87A 2DJ2A 1XWGA 2HRFA 3GSSA 3SBCA 1A8LA 4EVMA 4MZWA 3F3QA 1MEKA 5CREA 5C00A 2VM2A 1BJXA 3DIEA 2E7PA 2A4HA 1Y25A 6GSVA 1SU9A 5KN3A 4NPBA 3ZREA 4IQAA 4KAEA 1BX9A 4RI7A 3H93A 4TOPA 5J3RA 1X5EA 2F3MA 2DJKA 2DIZA 1S3AA 3C71A 2F8AA 4HZ2A 2OBIA 2YP6A 1M3IA 1NHOA 3CSHA 4GCIA 3LSZA 1M99A 2L5OA 3IE3A 1FW1A 4BL7A 3IV4A 2H76A 1LJRA 6GSUA 2P31A 1B9YC 4GSNA 4K1FA 5CRWA 1XWAA 1URMA 2LRNA 4O7HA 4X4JA 4DSSA 3KP8A 1AQWA 1EWXA 1XCCA 4IELA 3QOUA 2MMAA 2DSAA 2KOKA 3RAZA 4F82A 3BBYA 2KHPA 1TDIA 4ILFA 3WT2A 2LS5A 2DBCA 4HDEA 2VO4A 3ERGA 3GTUA 1R7HA 3FRCA 2HZEA 4IHUA 2LJRA 1YEXA 4KUNA 5KN2A 1PL2A 1EP7A 3VWVA 3IDVA 3JCML 3UVTA 5J9CA 5D9VA 1G7OA 3R3EA 2TRXA 4K2DA 1PX7A 5KOWA 3E9JB 3G7JA 1R5AA 1YKAA 2X8CA 2LSTA 4Z2UA 5A4WA 2ON7A 4AGSA 2R0CA 2GZYA 2WS2A 3EINA 1XW5A 4IW9A 3UL3A 1XPVA 3LORA 1JZDA 1KEBA 4K9ZA 3KD0A 1O7UA 1PN0A 3FYGA 1ERVA 1EZKA 2MZCA 2YJ7A 2M46A 4Z2RA 3US3A 2HSHA 1ZGNA 4NAXA 5G1KA 3HJOA 4HSCX 2E0QA 5ECMB 2MBSA 5B8BA 1SKRB 1YDKA 4K5RA 2CAIA 1TRUA 1GSYA 1XOBA 1HNCA 1XVWA 2FWHA 5DVBA 4J57E 3WT1A 2CT6A 2VLVA 4KE3A 2HYXA 2IFQA 2H72A 1SL0B 3VWXA 3TJFA 2B7JA 4D73B 4BVXB 3RHBA 1Q4JA 3KXOA 5DDLA 4WBRD 3FEUA 5A5KA 3ME8A 1WE0A 5AIVA 2REMA 4LA1A 2EIQA 5ECOB 4XRAA 4XS4B 2R5GA 3F3RA 4TKYA 4J2FA 2AYTA 1ILOA 3GHAA 2A4VA 2PMTA 3M0FA 4JU5A 1GUMA 1G6WA 4ID0A 4HQZA 1O85A 1N8JA 1V9WA 2WDUA 3IRAA 3FMWA 4K0GA 1JHBA 2HLSA 5LNKe 4EDZA 4WF4A 4I5QA 4TR1A 5DCGA 2RUFA 4V2NA 1OC9A 1EGOA 4EO3A 4AJ6A 4TR0A 3EMXA 1F3AA 1H75A 3W8JA 4PURA 1BQ7A 2NPBA 4PUFC 1DBYA 4OCEA 1A23A 3KCMA 2HXKA 3CTGA 4ECCA 2VD1A 1V40A 2NVLA 4KCAA 3ZIJA 5H5RA 4MA9A 1X0RA 3LWAA 1R5PA 1ERWA 3HKRA 4G0IA 1PSQA 1KBNA 2JL4A 1ERUA 3UBKA 2IL3A 4X43A 2OBKA 1AQVA 2N5AA 2D2ZA 3EPTA 4FYBA 3CMIA 4PX1A 3IR4A 1PGTA 4POBA 4RQXA 5CRDA 2CV4A 1I5GA 5DALB 5E59A 1BYEA 1WOUA 4FYCA 4WR4A 1T7PB 1ABAA 11GSA 10GSA 1IYIA 2XBQA 4MH2A 2P5RA 2FUG2 1TK0B 5HR2A 2I1UA 4MDCA 3QFBC 3KTBA 4PTSA 3E0UA 4IP6A 2V6KA 2JU5A 3RBTA 4K0NA 2GLRA 3HA9A 4OO4A 3NZNA 2H0GA 3M1GA 1M0UA 4GTUA 5F06A 3ZVJD 22GSA 5IMFA 2YV7A 2VL3A 2OKAA 3OR5A 5COHA 2IMKA 4N0ZA 1S3RA 2KLXA 1F2EA 2VLTA 5EL8A 5DAKA 1R26A 1TTZA 3BOAA 5HFIA 1QGVA 1UN2A 12GSA 2LJAA 3WD6A 1M3JA 1YF1A 4I2UA 4Z7XA 5EPFA 4XRDA 4MJBA 1ZZYA 3IC8A 1GTUA 1YQ1A 5HFGA 3VLNA 3KTLA 3P8WA 1EEMA 1HD2A 1AIUA 2GTUA 3RPNA 4K8MA 4LLRA 1U6TA 2O7KA 3APOA 3DVWA 2QA2A 2WB9A 3K8NA 3QAWA 2AAWA 1PX6A 2VCQA 1RK4A 4GSSA 1OE7A 4PQHA 3HZ8A 3EVIA 1UA5A 1WRYA 2H1BA 1JZWA 1HYUA 1F9MA 3HVNA 1TW9A 2B5XA 2J9HA 2JZTA 2C80A 4XS1A 2C0FA 4Z2TA 5J4UA 3KMNA 3C1RA 5JCUA 3C73A 2IN3A 4EC0A 3DEXA 1AQXA 1FOHA 2AHEA 4HQSA 2F8FA 2IPAA 3TKSA 2DKIA 4P3YB 4L8EA 4IJIA 3LJRA 1JZOA 3L9SA 5GSTA 3WGEA 1HNAA 5GAND 2R6KA 2YV9A 4NWYA 1TRWA 4HZ4A 1GL8A 5F8BA 2PPTA 3I6AA 3GTUB 4TR4A 4KA0A 3J7Yk 3EU3A 4TXOA 2C3QA 2DKHA 2VOCA 3WYWA 1Z3EA 3F4SA 3UIWA 2L4CA 4O92A 3IK9A 6GSSA 3TOTA 2V41A 3H79A 1SK2A 1O6JA 1LU4A 2BJXA 2LQQA 4POMA 3H1NA 2VLUA 1S3DA 1PKWA 4F0CA 1B48A 8GSSA 3CRUA 2VCXA 2MBTA 4N0VA 1GSQA 1K0BA 2LJKA 4KDUA 4XCSA 4OMVA 3SWLA 5CYYA 4MZCA 1GSDA 2GSTA 2HRNA 1TK8B 3Q18A 3GX0A 4OD7A 3GX8A 2IMIA 4FO5A 4OO5A 5IMVA 4ZIJA 4TVEA 1PFOA 3WGDA 2H1AA 4F0BA 1ZOFA 3HD5A 4PQ1A 2L6CA 4PGTA 3TKSC 1EEJA 2K9FA 4TR3A 1ZCPA 2NTOA 3H4KA 3C8EA 2JZSA 2F51A 1FO5A 4Q5FA 3BJ5A 1FOVA 3VI5A 4PUAA 2PBJA 2H01A 2ON5A 4MLYA 4QL9A 1FHEA 2DC5A 3CYNA 1TOFA 2HE3A 4KB3A 3KP9A 4HEA2 2X64A 4ML1A 2R37A 1J08A 4GQCA 4QQ7A 4E8EA 3L4NA 2RIIA 5ECSA 1ZYEA 3PPUA 2ZUPA 3HJMA 3IAS2 4CDOA 4IS0A 3HJPA 2B5EA 1QXHA 2JSZA 1RW1A 2TRCP 2I81A 3I43A 4ZL8A 2ZCTA 3IK7A 5IPHA 4HOJA 4GLTA 5IIZA 2ZNMA 2H70A 4JZQA 4F2IA 3CSIA 1OKTA 1T8EB 4KF9A 1XWBA 4O5QA 5ELGA 1V2AA 4DSQA 1FG4A 3MDKA 4FH8A 2DIYA 1NHYA 2OE0A 1F37A 1HQOA 4MJEA 3DD3A 3DVXA 4L5LA 1SK0A 3ZIVA 1EV4A 4KSMA 2OA7A 2EC4A 3D4MA 4IGJA 4MZBA 5HR3A 2IMDA 2MMOA 2A2RA 18GSA 4I2TA 4JR6A 1QQ2A 5ECHB 2YN1A 1A8YA 5IOXA 2KP1A 17GSA 2M80A 2YWOA 3TKPA 2GQKA 1Z5YE 3FR3A 3P7XA 2LUSA 3F8UA 4MF6A 2I3YA 2X4AA 5JWRB 4JEDA 1K0MA 2QGVA 2WJUA 3EURA 1QMVA 5A4VA 3VI7A 4H86A 2VM1A 5ENUA 1OYJA 4IQ1A 1WPIA 2M72A 2CX3A 5G5FA 1GSUA 4GQFA 3ZYWA 5DQYA 2RLIA 3DMLA 3GUSA 2O89A 2ALBA 3HVSA 1NM3A 1U88A 4EUYA 1VF4A 2VUPA 4HUAA 4EL1A 5ID2A 16GSA 1GNWA 1TU8A 1WJKA 3A5IA 5AIXA 4ML6A 4NMUA 1EOGA 4YQMA 4CHSA 4PNGA 2H6XA 1UVZA 1PD21 4WEYA 3CQFA 3Q74A 3F9UA 4ZL9A 2V6OA 5EY6A 6GSYA 4Q5QA 2R0PA 1MD4A 3FR6A 3HDCA 2HRAA 14GSA 4EXJA 2CZ2A 2LNSA 3GSTA 2X8HA 1UC7A 2TIRA 1TP9A 2CVKA 1OKDA 4GWRA 1FVJA 4ZXGA 3VPQA 4ECJA 1QFNA 3M3MA 1G6YA 1VF1A 2PVOC 2MYGA 2IMFA 3I9V2 4G10A 5IMDA 3FHKA 5JWQB 1JLWA 5B7CA 3TRXA 3CTFA 4K7OA 3ISOA 4LL1B 5B6NA 5ECRB 4FYUA 1EOHA 3D6IA 3TB2A 4K7IA 3VURA 3EYTA 1BG5A 3FZ5A 3KH7A 2H19A 1S3CA 3EU4A 3GL5A 1TRSA 3F4TA 3TGZA 4K6XA 1TXXA 3IPZA 3VWUA 4ULXA 4DSRA 1X9SB 4BVYB 2NBSA 3D22A 1Z9HA 1M2DA 1MDJA 1WIKA 5E4WA 4YQUA 2H74A 4A5PA 2GS3A 3IC4A 1KTEA 3O76A 4EKZA 3EMPA 3TRPA 3LW9A 3BCKA 2LTKA 4TRXA 1SL2B 1A2MA 1XVQA 2H73A 2CVDA 3QFAC 2CVBA 4RQRA 3UVHA 5ECPB 4PXOA 5GSSA 2YOIA 2GGTA 1B8XA 5CRHA 2PGTA 4ISDA 4GXZA 1K0DA 2A2SA 2B1KA 1GUHA 1K0OA 5LCZA 4ECIA 1Q98A 5KN1A 3QPMA 2LV3A 3M8NA 1U3IA 3IHQA 4YKFA 3L78A 4OFNA 4ZB9A 1NSWA 1JLVA 2C8UA 5FHIA 2CZ3A 1GSSA 1QUWA 2EIRA 3A5WA 2PWJA 3L9VA 3QR6A 2HT9A 5J5NA 1TJDA 1ZMAA 7GSSA 3LGCA 2DJ0A 4WETA 4L0UA 2JACA 1G0TA 2LRTA 1Z7PA 4JRRA 2WGRA 5CRGA 3A2XA 2C0EA 1SYRA 2VCWA 2DJJA 5J41A 4F9ZA 2OADA 3UJ1A 5INYA 4WBJA 2GSQA 1OE8A 2YWMA 3F63A 2CAQA 4E8HA 2FGXA 1NW2A 6GSWA 5LD0A 4IJ3A 3N9JA 3PH9A 1F3BA 1THOA 2GQMA 1A0FA 2H30A 5IO0A 4AJ7A 1JFUA 3NIVA 4N30A 4ZBBA 2VIMA 3DRNA 5ECIB 1GTBA 2H6YA 2G0FA 2IWTA 4GSTA 2FCHA 4MJAA 4EF0A 1VF3A 1V57A 2FWGA 5JCGA 2DJ1A 5AN1A 2L5LA 2PN8A 1BAYA 1SJZA 4MK3A 2YANA 1PA3A 3TUEA 3TJKA 2QA1A 4KSOA 5A4UA 4YH2A 5ECKB 5DJLA 1GH2A 4EIQA 1XW6A 2VD0A 3TDGA 1OVNA 2CX4A 3KZQA 5BMUA 2YWNA 1XWKA 2P0GA 4FQUA 4BL7B 2QKEA 1X9WB 2LRCA 2N5FA 3D0ZA 4BVXA 4D73A 3HCZA 2AB6A 1XWCA 5IM9A 5JWOB 1PRXA 2WZ9A 2FNOA 1OC8A 4HI7A 3TJBA 4DSSB 1ZYPA 3TKQA 3LYKA 5ECNB 4IN0A 4XS4A 3GN3A 4OWYA 4MPFA 4NV2A 1WMJA 2Z9SA 2BMXA 4JE1A 2OACA 4KGIA 5CNWA 4DEJA 1K0CA 2GT6A 3V1WA 4NHWA
chains in the Genus database with same CATH topology
3QD9A 1O8XA 1Z6NA 1XFLA 3QCPA 3KM6A 4WF5A 4X1UA 1V58A 2HZEB 5HFKA 3IXRA 3MYDA 4POLA 3C1SA 3ZMKA 2HI7A 3IBHA 5ECQB 1KNGA 1YEPA 4JBBA 2LNTA 3F0IA 3KMOA 1G7EA 4AF2A 4K2XA 3ZMLA 1WWJA 5B8AA 3C7MA 5ECLB 4HJMA 4Q5NA 4LMVA 1RQMA 4YAVA 1GTAA 3RHCA 3LEFA 3G9BA 3F4RA 2XC2A 1ACVA 1DSBA 3Q6OA 4L0WA 1Z6MA 2FWFA 2H1DA 3HVVA 3WGXA 1X5CA 1USBA 3VK9A 4F03A 2DMLA 4POKA 5DBQA 2OE1A 3PGTA 5DALA 2GSRA 1SJIA 4MF5A 2XPDA 2MMZA 2GT5A 2YJHA 5H5QA 2X49A 1AXDA 1EP8A 2C4JA 4G19A 1PMTA 20GSA 2A2PA 1AC1A 4RUVA 1GRXA 1FB0A 1C72A 2J23A 1JZRA 1XOAA 1FB6A 3GA4A 1W89A 3GIXA 2FWEA 4XIHA 3VFIA 2IFQB 4O32A 1ML6A 3VWWA 2FLSA 2K8VA 5H5SA 1SD8A 4K5SA 3ZTLA 2YNXA 5ELAA 3P90A 1MTCA 4TN8A 3QDNA 5D73A 2JZRA 4WR5A 2B6MA 1GUKA 4HU9A 5CP1A 5G5EA 1U3AA 2VAFA 1ZYNA 1YKCA 3O3TA 1DE2A 1WP0A 2PUKC 2B7KA 3D4TA 4XTSA 2DLXA 2FD3A 3G7YA 5GZZB 4BWSA 4ICYA 2X8GA 5D9WA 2H1GA 3E3EA 4XHMA 1YF0A 5BRTA 1E6BA 3LFLA 2K6VA 2HSYA 4ZBDA 13GSA 4TR1B 5D93A 1OC9B 2VCVA 1OC3A 1T3BA 3QAVA 2V1MA 3KJYA 1YY7A 2K18A 3I69A 1GP1A 1B9XC 1LBKA 2YZUA 3UARA 3W8SA 1K3OA 2IIYA 3GURA 5JCWA 5D9TA 2VCTA 3CSJA 3TCOA 3FY7A 3DGQA 2B1LA 3KGKA 3DWVA 3APSA 3M9KA 1O73A 1PL1A 4O5UA 3HZ4A 1A2LA 4IBPA 19GSA 2QC7A 1AAZA 2HFDA 2YCDA 3LQ7A 5D8IA 1HNBA 3PINA 3UOMA 1VRSD 4L5OA 3GYKA 3HVXA 2LKUA 3A2WA 2V32A 2FHEA 4MH3A 2GDRA 2C3TA 1SYXA 2R3XA 2PERA 4PQIA 5IMCA 5KEJA 2XPEA 2BTOT 3UMAA 1X9MB 2I9HA 4QL7A 2P5QA 3M9JA 3MNGA 2LEGA 4KW6A 1SKSB 4MJCA 1I9DA 3KEBA 2CQ9A 4V1Ap 2ES7A 2GQLA 3GKKA 1IYHA 1W4VA 3ZFBA 2H66A 4V1Ag 2HNLA 5DAKB 5CAXA 1ST9A 1ZYQB 2AUVA 2K8SA 1XXUA 3MWHA 1A0RP 3HHVA 2R2JA 4MNNA 4IKHA 1GLPA 2N5BA 4HU7A 4YKGA 1YJ6A 3FZAA 4LMWA 1SL1B 5KOXA 5EVOA 4O5RA 5FT3A 1H4OA 6GSXA 1J0FA 2RUEA 4ACSA 3BD2A 1A2JA 2FA8A 1SKWB 5D9XA 2H75A 3N5OA 3A3TA 4KX4A 4TXVA 2I4AA 3J7Yb 3BCIA 2WFCA 1CQHA 3ZZXA 4DVCA 3W6GA 1AUCA 1ERTA 1Y6EA 4G0LA 5B6MA 1TI1A 2IMEA 5AISA 2C1YA 3CBUA 1PQNA 2G2QA 3GKXA 1EGRA 3D5JA 1XW9A 5KN0A 2GZZA 3D21A 2GVPA 3Q19A 4N11A 1PN9A 2YWIA 4FIWA 1M7TA 5IQYA 2OJLA 2LQOA 2UZ8A 5C04A 4MF7A 4EIPA 2R4VA 3LG6A 1J9BA 3APQA 1O81A 4TXOB 1PKZA 4HS1A 4EDYA 4KNDA 1O8WA 3CRTA 1T1VA 5G1LA 5IPGA 1Z7RA 1X5DA 3ERFA 5DQSA 2V2GA 2C3NA 2MMNA 3CXGA 2O8VB 3GMFA 2HZFA 5DJMA 5F07A 1XZOA 4G9HA 2H0IA 2FA4A 4IP1A 4ECBA 1GWCA 3GH9A 3GRXA 2RM5A 1N2AA 2GSSA 3PR8A 3A2VA 2JADA 3ZITA 3LXTA 3HXSA 1A24A 3IHGA 3LXZA 4BA7A 5HR1A 3AY8A 4EE0A 2F9SA 3MAKA 2H71A 1M2BA 1K0AA 3UAPA 4MMMA 2KP2A 3L9UA 1SK1A 3KIJA 2WCIA 4MP4A 1BEDA 1ZL9A 3O6TA 4ZB6A 5IMZA 2DMMA 3U6VA 2B5YA 2AJQB 3GL3A 3FK8A 4ZILA 3L0HA 1EV9A 1OAZA 4GRFA 2IJYA 2R0GA 3RDWA 4YQVA 5GAPD 1AW9A 4KH7A 3HY2A 2AV4A 4XS6A 2PVQA 1VF2A 2H8LA 2RM6A 4JR4A 3FZ9A 4USSA 3TJJA 4Q5RA 4CW9A 5L71A 4TW5A 3QAGA 4ZBAA 3F6DA 3KH9A 2VL2A 4NV5A 2E2GA 1XIYA 2XHFA 2X99A 2YZHA 2KUCA 3IA1A 3TKSE 5IOWA 1B4QA 1SENA 5F0GA 9GSSA 3GFKA 3GNJA 4HJ2A 3DYRA 3GKMA 3R2QA 1B4PA 2YPMA 3TOUA 4NXIA 3VPTA 2L4QA 2H6ZA 1GNEA 1VGLA 2VCZA 4CY8A 2PU9C 4MABA 3ERWA 6GSTA 5HQPA 2CA8A 2QSIA 1FVKA 1T00A 1TI3A 2L6DA 3EC3A 4NHZA 4WKWA 3FZ4A 3TJGA 4V2LA 3FW2A 1R4WA 1V98A 2VL9A 3ZRDA 2L57A 4YAPA 5F05A 1M2AA 4BVYA 4BWQA 1DUGA 4X0XA 4OFMA 3DKSA 1TK5B 5G30A 5DCHA 3ZFLA 5IO2A 4I8BA 1MDIA 3HYPA 5D96A 3ZL5A 2WULA 4LL4B 4BPYA 3RPPA 2DJ3A 3GV1A 1TU7A 3TKRA 1DE1A 4KDXA 3MSZA 1SJ6A 1TRVA 1E2YA 1SD9A 1M9AA 5J9BA 4I6XA 2VL2C 1K3YA 3ME7A 3G7IA 5AGYA 1GULA 4KCEA 1T4ZA 3UEMA 3ZLPA 1T4YA 1F6MC 5G31A 5ID2B 2C0DA 3EWLA 5IMAA 1K0NA 3FKFA 5CO3A 2OE3A 4G0KA 2O85A 2EIOA 4I97A 1GTIA 3F6FA 3LYPA 4J56E 3GKNA 3QMXA 3MIXA 4K7NA 5HR0A 3UBLA 1ON4A 1GSEA 4G2EA 4PNFA 1MD3A 4IVFA 1FAAA 1GLQA 3H8QA 4ZB8A 1CQGA 3U5RE 3P2AA 2B3SA 3ZVJA 4MPGA 3FR9A 5ABRA 1U87A 4CY6A 3TRQA 2HRKA 3DXBA 2GZPA 3IAM2 2HSMA 1THXA 2L59A 5FWGA 4ZL7A 3S9FA 1XBSA 4WXTA 1QK8A 4V2MA 4N10A 3GH6A 3NOFA 3IOSA 1MDKA 2WRTA 4AJ8A 1K3LA 2E2MA 4GF0A 1M9BA 2H0HA 1TKDB 3EE2A 4OCFA 2NDOA 4RI6A 1GSFA 2C0GA 2XBIA 3ED3A 4MCUA 4OFTA 1YZXA 2JSYA 5G2ZA 2FY6A 4KDYA 2O87A 2DJ2A 1XWGA 2HRFA 3GSSA 3SBCA 1A8LA 4EVMA 4MZWA 3F3QA 1MEKA 5CREA 5C00A 2VM2A 1BJXA 3DIEA 2E7PA 2A4HA 1Y25A 6GSVA 1SU9A 5KN3A 4NPBA 3ZREA 4IQAA 4KAEA 1BX9A 4RI7A 3H93A 4TOPA 5J3RA 1X5EA 2F3MA 2DJKA 2DIZA 1S3AA 3C71A 2F8AA 4HZ2A 2OBIA 2YP6A 1NHOA 3CSHA 4GCIA 3LSZA 1M99A 2L5OA 3IE3A 1FW1A 4BL7A 3IV4A 2H76A 1LJRA 6GSUA 2P31A 1B9YC 4GSNA 4K1FA 5CRWA 1XWAA 1URMA 2LRNA 4O7HA 4X4JA 4DSSA 3KP8A 1AQWA 1EWXA 1XCCA 4IELA 3QOUA 2MMAA 2DSAA 2KOKA 3RAZA 4F82A 3BBYA 2KHPA 1TDIA 4ILFA 3WT2A 2LS5A 2DBCA 4HDEA 2VO4A 3ERGA 3GTUA 1R7HA 3FRCA 2HZEA 4IHUA 2LJRA 1YEXA 4KUNA 5KN2A 1PL2A 1EP7A 3VWVA 3IDVA 3JCML 3UVTA 5J9CA 5D9VA 1G7OA 3R3EA 2TRXA 4K2DA 1PX7A 5KOWA 3E9JB 3G7JA 1R5AA 1YKAA 2X8CA 2LSTA 4Z2UA 5A4WA 2ON7A 4AGSA 2R0CA 2GZYA 2WS2A 3EINA 1XW5A 4IW9A 3UL3A 1XPVA 3LORA 1JZDA 1KEBA 4K9ZA 3KD0A 1O7UA 1PN0A 3FYGA 1ERVA 1EZKA 2MZCA 2YJ7A 2M46A 4Z2RA 3US3A 2HSHA 1ZGNA 4NAXA 5G1KA 3HJOA 2E0QA 5ECMB 2MBSA 5B8BA 1SKRB 1YDKA 4K5RA 2CAIA 1TRUA 1GSYA 1XOBA 1HNCA 1XVWA 2FWHA 5DVBA 4J57E 3WT1A 2CT6A 2VLVA 4KE3A 2HYXA 2IFQA 2H72A 1SL0B 3VWXA 3TJFA 2B7JA 4D73B 4BVXB 3RHBA 1Q4JA 3KXOA 5DDLA 4WBRD 3FEUA 5A5KA 3ME8A 1WE0A 5AIVA 2REMA 4LA1A 2EIQA 5ECOB 4XRAA 4XS4B 2R5GA 3F3RA 4TKYA 4J2FA 2AYTA 1ILOA 3GHAA 2A4VA 2PMTA 3M0FA 4JU5A 1GUMA 1G6WA 4ID0A 4HQZA 1O85A 1N8JA 1V9WA 2WDUA 3IRAA 3FMWA 4K0GA 1JHBA 2HLSA 5LNKe 4EDZA 4WF4A 4I5QA 4TR1A 5DCGA 2RUFA 4V2NA 1OC9A 1EGOA 4EO3A 4AJ6A 4TR0A 3EMXA 1F3AA 1H75A 3W8JA 4PURA 1BQ7A 2NPBA 4PUFC 1DBYA 4OCEA 1A23A 3KCMA 2HXKA 3CTGA 4ECCA 2VD1A 1V40A 2NVLA 4KCAA 3ZIJA 5H5RA 4MA9A 1X0RA 3LWAA 1R5PA 1ERWA 3HKRA 4G0IA 1PSQA 1KBNA 2JL4A 1ERUA 3UBKA 2IL3A 4X43A 2OBKA 1AQVA 2N5AA 2D2ZA 3EPTA 4FYBA 3CMIA 4PX1A 3IR4A 1PGTA 4POBA 4RQXA 5CRDA 2CV4A 1I5GA 5DALB 5E59A 1BYEA 1WOUA 4FYCA 4WR4A 1T7PB 1ABAA 11GSA 10GSA 1IYIA 2XBQA 4MH2A 2P5RA 2FUG2 1TK0B 5HR2A 2I1UA 4MDCA 3QFBC 3KTBA 4PTSA 3E0UA 4IP6A 2V6KA 2JU5A 3RBTA 4K0NA 2GLRA 3HA9A 4OO4A 3NZNA 2H0GA 3M1GA 1M0UA 4GTUA 5F06A 3ZVJD 22GSA 5IMFA 2YV7A 2VL3A 2OKAA 3OR5A 5COHA 2IMKA 4N0ZA 2KLXA 1F2EA 2VLTA 5EL8A 5DAKA 1R26A 1TTZA 3BOAA 5HFIA 1QGVA 1UN2A 12GSA 2LJAA 3WD6A 1YF1A 4I2UA 4Z7XA 5EPFA 4XRDA 4MJBA 1ZZYA 3IC8A 1GTUA 1YQ1A 5HFGA 3VLNA 3KTLA 3P8WA 1EEMA 1HD2A 1AIUA 2GTUA 3RPNA 4K8MA 4LLRA 1U6TA 2O7KA 3APOA 3DVWA 2QA2A 2WB9A 3K8NA 3QAWA 2AAWA 1PX6A 2VCQA 1RK4A 4GSSA 1OE7A 4PQHA 3HZ8A 3EVIA 1UA5A 1WRYA 2H1BA 1JZWA 1HYUA 1F9MA 1TW9A 2B5XA 2J9HA 2JZTA 2C80A 4XS1A 2C0FA 4Z2TA 5J4UA 3KMNA 3C1RA 5JCUA 3C73A 2IN3A 4EC0A 3DEXA 1AQXA 1FOHA 2AHEA 4HQSA 2F8FA 2IPAA 3TKSA 2DKIA 4P3YB 4L8EA 4IJIA 3LJRA 1JZOA 3L9SA 5GSTA 3WGEA 1HNAA 5GAND 2R6KA 2YV9A 4NWYA 1TRWA 4HZ4A 1GL8A 5F8BA 2PPTA 3I6AA 3GTUB 4TR4A 4KA0A 3J7Yk 3EU3A 4TXOA 2C3QA 2DKHA 2VOCA 3WYWA 1Z3EA 3F4SA 3UIWA 2L4CA 4O92A 3IK9A 6GSSA 3TOTA 2V41A 3H79A 1SK2A 1O6JA 1LU4A 2BJXA 2LQQA 4POMA 3H1NA 2VLUA 1S3DA 1PKWA 4F0CA 1B48A 8GSSA 3CRUA 2VCXA 2MBTA 4N0VA 1GSQA 1K0BA 2LJKA 4KDUA 4XCSA 4OMVA 3SWLA 5CYYA 4MZCA 1GSDA 2GSTA 2HRNA 1TK8B 3Q18A 3GX0A 4OD7A 3GX8A 2IMIA 4FO5A 4OO5A 5IMVA 4ZIJA 4TVEA 3WGDA 2H1AA 4F0BA 1ZOFA 3HD5A 4PQ1A 2L6CA 4PGTA 3TKSC 1EEJA 2K9FA 4TR3A 1ZCPA 2NTOA 3H4KA 3C8EA 2JZSA 2F51A 1FO5A 4Q5FA 3BJ5A 1FOVA 3VI5A 4PUAA 2PBJA 2H01A 2ON5A 4MLYA 4QL9A 1FHEA 2DC5A 3CYNA 1TOFA 2HE3A 4KB3A 3KP9A 4HEA2 2X64A 4ML1A 2R37A 1J08A 4GQCA 4QQ7A 4E8EA 3L4NA 2RIIA 5ECSA 1ZYEA 3PPUA 2ZUPA 3HJMA 3IAS2 4CDOA 4IS0A 3HJPA 2B5EA 1QXHA 2JSZA 1RW1A 2TRCP 2I81A 3I43A 4ZL8A 2ZCTA 3IK7A 5IPHA 4HOJA 4GLTA 5IIZA 2ZNMA 2H70A 4JZQA 4F2IA 3CSIA 1OKTA 1T8EB 4KF9A 1XWBA 4O5QA 5ELGA 1V2AA 4DSQA 1FG4A 3MDKA 4FH8A 2DIYA 1NHYA 2OE0A 1F37A 1HQOA 4MJEA 3DD3A 3DVXA 4L5LA 1SK0A 3ZIVA 1EV4A 4KSMA 2OA7A 2EC4A 3D4MA 4IGJA 4MZBA 5HR3A 2IMDA 2MMOA 2A2RA 18GSA 4I2TA 4JR6A 1QQ2A 5ECHB 2YN1A 1A8YA 5IOXA 2KP1A 17GSA 2M80A 2YWOA 3TKPA 2GQKA 1Z5YE 3FR3A 3P7XA 2LUSA 3F8UA 4MF6A 2I3YA 2X4AA 5JWRB 4JEDA 1K0MA 2QGVA 2WJUA 3EURA 1QMVA 5A4VA 3VI7A 4H86A 2VM1A 5ENUA 1OYJA 4IQ1A 1WPIA 2M72A 2CX3A 5G5FA 1GSUA 4GQFA 3ZYWA 5DQYA 2RLIA 3DMLA 3GUSA 2O89A 2ALBA 3HVSA 1NM3A 1U88A 4EUYA 1VF4A 2VUPA 4HUAA 4EL1A 5ID2A 16GSA 1GNWA 1TU8A 1WJKA 3A5IA 5AIXA 4ML6A 4NMUA 1EOGA 4YQMA 4CHSA 4PNGA 2H6XA 1UVZA 1PD21 4WEYA 3Q74A 3F9UA 4ZL9A 2V6OA 5EY6A 6GSYA 4Q5QA 2R0PA 1MD4A 3FR6A 3HDCA 2HRAA 14GSA 4EXJA 2CZ2A 2LNSA 3GSTA 2X8HA 1UC7A 2TIRA 1TP9A 2CVKA 1OKDA 4GWRA 1FVJA 4ZXGA 3VPQA 4ECJA 1QFNA 3M3MA 1G6YA 1VF1A 2PVOC 2MYGA 2IMFA 3I9V2 4G10A 5IMDA 3FHKA 5JWQB 1JLWA 5B7CA 3TRXA 3CTFA 4K7OA 3ISOA 4LL1B 5B6NA 5ECRB 4FYUA 1EOHA 3D6IA 3TB2A 4K7IA 3VURA 3EYTA 1BG5A 3FZ5A 3KH7A 2H19A 1S3CA 3EU4A 3GL5A 1TRSA 3F4TA 3TGZA 4K6XA 1TXXA 3IPZA 3VWUA 4ULXA 4DSRA 1X9SB 4BVYB 2NBSA 3D22A 1Z9HA 1M2DA 1MDJA 1WIKA 5E4WA 4YQUA 2H74A 4A5PA 2GS3A 3IC4A 1KTEA 3O76A 4EKZA 3EMPA 3TRPA 3LW9A 3BCKA 2LTKA 4TRXA 1SL2B 1A2MA 1XVQA 2H73A 2CVDA 3QFAC 2CVBA 4RQRA 3UVHA 5ECPB 4PXOA 5GSSA 2YOIA 2GGTA 1B8XA 5CRHA 2PGTA 4ISDA 4GXZA 1K0DA 2A2SA 2B1KA 1GUHA 1K0OA 5LCZA 4ECIA 1Q98A 5KN1A 3QPMA 2LV3A 3M8NA 1U3IA 3IHQA 4YKFA 3L78A 4OFNA 4ZB9A 1NSWA 1JLVA 2C8UA 5FHIA 2CZ3A 1GSSA 1QUWA 2EIRA 3A5WA 2PWJA 3L9VA 3QR6A 2HT9A 5J5NA 1TJDA 1ZMAA 7GSSA 3LGCA 2DJ0A 4WETA 4L0UA 2JACA 1G0TA 2LRTA 1Z7PA 4JRRA 2WGRA 5CRGA 3A2XA 2C0EA 1SYRA 2VCWA 2DJJA 5J41A 4F9ZA 2OADA 3UJ1A 5INYA 4WBJA 2GSQA 1OE8A 2YWMA 3F63A 2CAQA 4E8HA 2FGXA 1NW2A 6GSWA 5LD0A 4IJ3A 3N9JA 3PH9A 1F3BA 1THOA 2GQMA 1A0FA 2H30A 5IO0A 4AJ7A 1JFUA 3NIVA 4N30A 4ZBBA 2VIMA 3DRNA 5ECIB 1GTBA 2H6YA 2G0FA 2IWTA 4GSTA 2FCHA 4MJAA 4EF0A 1VF3A 1V57A 2FWGA 5JCGA 2DJ1A 5AN1A 2L5LA 2PN8A 1BAYA 1SJZA 4MK3A 2YANA 1PA3A 3TUEA 3TJKA 2QA1A 4KSOA 5A4UA 4YH2A 5ECKB 5DJLA 1GH2A 4EIQA 1XW6A 2VD0A 3TDGA 1OVNA 2CX4A 3KZQA 5BMUA 2YWNA 1XWKA 2P0GA 4FQUA 4BL7B 2QKEA 1X9WB 2LRCA 2N5FA 3D0ZA 4BVXA 4D73A 3HCZA 2AB6A 1XWCA 5IM9A 5JWOB 1PRXA 2WZ9A 2FNOA 1OC8A 4HI7A 3TJBA 4DSSB 1ZYPA 3TKQA 3LYKA 5ECNB 4IN0A 4XS4A 3GN3A 4OWYA 4MPFA 4NV2A 1WMJA 2Z9SA 2BMXA 4JE1A 2OACA 4KGIA 5CNWA 4DEJA 1K0CA 2GT6A 3V1WA 4NHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QD9 A;  1O8X A;  1Z6N A;  1XFL A;  3QCP A;  3KM6 A;  4WF5 A;  4X1U A;  1V58 A;  2HZE B;  5HFK A;  3IXR A;  4POL A;  3C1S A;  3ZMK A;  2HI7 A;  3IBH A;  5ECQ B;  1KNG A;  1YEP A;  4JBB A;  2LNT A;  3F0I A;  3KMO A;  1G7E A;  4AF2 A;  3ZML A;  1WWJ A;  5B8A A;  3C7M A;  5ECL B;  4HJM A;  4Q5N A;  4LMV A;  1RQM A;  4YAV A;  1GTA A;  3RHC A;  3LEF A;  3G9B A;  3F4R A;  2XC2 A;  1ACV A;  1DSB A;  3Q6O A;  4L0W A;  1Z6M A;  2FWF A;  2H1D A;  3HVV A;  3WGX A;  1X5C A;  1USB A;  3VK9 A;  4F03 A;  2DML A;  4POK A;  5DBQ A;  2OE1 A;  3PGT A;  5DAL A;  2GSR A;  1SJI A;  4MF5 A;  2XPD A;  2MMZ A;  2GT5 A;  2YJH A;  5H5Q A;  1AXD A;  1EP8 A;  2C4J A;  4G19 A;  1PMT A;  20GS A;  1AC1 A;  4RUV A;  1GRX A;  1FB0 A;  1C72 A;  2J23 A;  1JZR A;  1XOA A;  1FB6 A;  3GA4 A;  1W89 A;  3GIX A;  2FWE A;  4XIH A;  3VFI A;  2IFQ B;  4O32 A;  1ML6 A;  3VWW A;  2FLS A;  2K8V A;  5H5S A;  1SD8 A;  3ZTL A;  2YNX A;  5ELA A;  3P90 A;  1MTC A;  4TN8 A;  3QDN A;  5D73 A;  2JZR A;  4WR5 A;  2B6M A;  1GUK A;  4HU9 A;  5CP1 A;  5G5E A;  1U3A A;  2VAF A;  1YKC A;  3O3T A;  1DE2 A;  1WP0 A;  2PUK C;  2B7K A;  3D4T A;  4XTS A;  2DLX A;  2FD3 A;  3G7Y A;  5GZZ B;  4BWS A;  2X8G A;  5D9W A;  2H1G A;  3E3E A;  4XHM A;  1YF0 A;  1E6B A;  3LFL A;  2K6V A;  2HSY A;  4ZBD A;  13GS A;  4TR1 B;  5D93 A;  1OC9 B;  2VCV A;  1OC3 A;  1T3B A;  3QAV A;  2V1M A;  3KJY A;  1YY7 A;  2K18 A;  3I69 A;  1GP1 A;  1B9X C;  1LBK A;  2YZU A;  3UAR A;  3W8S A;  1K3O A;  2IIY A;  3GUR A;  5JCW A;  5D9T A;  2VCT A;  3CSJ A;  3TCO A;  3FY7 A;  3DGQ A;  2B1L A;  3KGK A;  3DWV A;  3APS A;  3M9K A;  1O73 A;  1PL1 A;  3HZ4 A;  1A2L A;  4IBP A;  19GS A;  2QC7 A;  1AAZ A;  2HFD A;  2YCD A;  3LQ7 A;  5D8I A;  1HNB A;  3PIN A;  3UOM A;  1VRS D;  4L5O A;  3GYK A;  3HVX A;  2LKU A;  3A2W A;  2V32 A;  2FHE A;  4MH3 A;  2GDR A;  2C3T A;  1SYX A;  2R3X A;  2PER A;  4PQI A;  5IMC A;  5KEJ A;  2XPE A;  2BTO T;  3UMA A;  1X9M B;  2I9H A;  4QL7 A;  2P5Q A;  3M9J A;  3MNG A;  2LEG A;  4KW6 A;  1SKS B;  4MJC A;  1I9D A;  3KEB A;  2CQ9 A;  4V1A p;  2ES7 A;  2GQL A;  3GKK A;  1IYH A;  1W4V A;  3ZFB A;  2H66 A;  4V1A g;  2HNL A;  5DAK B;  5CAX A;  1ST9 A;  1ZYQ B;  2AUV A;  2K8S A;  1XXU A;  3MWH A;  1A0R P;  3HHV A;  2R2J A;  4IKH A;  1GLP A;  2N5B A;  4HU7 A;  1YJ6 A;  3FZA A;  4LMW A;  1SL1 B;  5EVO A;  4O5R A;  5FT3 A;  1H4O A;  6GSX A;  1J0F A;  2RUE A;  4ACS A;  3BD2 A;  1A2J A;  2FA8 A;  1SKW B;  5D9X A;  2H75 A;  3N5O A;  3A3T A;  4KX4 A;  4TXV A;  2I4A A;  3J7Y b;  3BCI A;  2WFC A;  1CQH A;  3ZZX A;  4DVC A;  3W6G A;  1AUC A;  1ERT A;  1Y6E A;  5B6M A;  1TI1 A;  2IME A;  5AIS A;  2C1Y A;  3CBU A;  1PQN A;  2G2Q A;  3GKX A;  1EGR A;  3D5J A;  1XW9 A;  5KN0 A;  2GZZ A;  3D21 A;  2GVP A;  3Q19 A;  4N11 A;  1PN9 A;  2YWI A;  4FIW A;  1M7T A;  5IQY A;  2OJL A;  2LQO A;  5C04 A;  4MF7 A;  2R4V A;  3LG6 A;  1J9B A;  3APQ A;  1O81 A;  4TXO B;  1PKZ A;  4HS1 A;  4EDY A;  4KND A;  1O8W A;  3CRT A;  1T1V A;  5G1L A;  5IPG A;  1Z7R A;  1X5D A;  3ERF A;  5DQS A;  2V2G A;  2C3N A;  2MMN A;  3CXG A;  2O8V B;  3GMF A;  2HZF A;  5DJM A;  5F07 A;  1XZO A;  4G9H A;  2H0I A;  2FA4 A;  4IP1 A;  4ECB A;  1GWC A;  3GH9 A;  3GRX A;  2RM5 A;  1N2A A;  2GSS A;  3PR8 A;  3A2V A;  2JAD A;  3ZIT A;  3LXT A;  3HXS A;  1A24 A;  3LXZ A;  4BA7 A;  5HR1 A;  3AY8 A;  4EE0 A;  2F9S A;  3MAK A;  2H71 A;  1M2B A;  1K0A A;  3UAP A;  4MMM A;  2KP2 A;  3L9U A;  1SK1 A;  3KIJ A;  2WCI A;  4MP4 A;  1BED A;  1ZL9 A;  3O6T A;  4ZB6 A;  5IMZ A;  2DMM A;  3U6V A;  2B5Y A;  2AJQ B;  3GL3 A;  3FK8 A;  4ZIL A;  3L0H A;  1EV9 A;  1OAZ A;  4GRF A;  2IJY A;  3RDW A;  4YQV A;  5GAP D;  1AW9 A;  4KH7 A;  3HY2 A;  2AV4 A;  4XS6 A;  2PVQ A;  1VF2 A;  2H8L A;  2RM6 A;  4JR4 A;  3FZ9 A;  3TJJ A;  4Q5R A;  4CW9 A;  5L71 A;  4TW5 A;  3QAG A;  4ZBA A;  3F6D A;  3KH9 A;  2VL2 A;  4NV5 A;  2E2G A;  1XIY A;  2XHF A;  2X99 A;  2YZH A;  2KUC A;  3IA1 A;  3TKS E;  5IOW A;  1B4Q A;  1SEN A;  5F0G A;  9GSS A;  3GFK A;  3GNJ A;  4HJ2 A;  3DYR A;  3GKM A;  3R2Q A;  1B4P A;  2YPM A;  3TOU A;  4NXI A;  3VPT A;  2L4Q A;  2H6Z A;  1GNE A;  1VGL A;  2VCZ A;  2PU9 C;  4MAB A;  3ERW A;  6GST A;  5HQP A;  2CA8 A;  2QSI A;  1FVK A;  1T00 A;  1TI3 A;  2L6D A;  3EC3 A;  4NHZ A;  4WKW A;  3FZ4 A;  3TJG A;  4V2L A;  3FW2 A;  1R4W A;  1V98 A;  2VL9 A;  3ZRD A;  2L57 A;  4YAP A;  5F05 A;  1M2A A;  4BVY A;  4BWQ A;  1DUG A;  4X0X A;  4OFM A;  3DKS A;  1TK5 B;  5G30 A;  5DCH A;  3ZFL A;  5IO2 A;  4I8B A;  1MDI A;  3HYP A;  5D96 A;  3ZL5 A;  2WUL A;  4LL4 B;  4BPY A;  3RPP A;  2DJ3 A;  3GV1 A;  1TU7 A;  3TKR A;  1DE1 A;  4KDX A;  3MSZ A;  1SJ6 A;  1TRV A;  1E2Y A;  1SD9 A;  1M9A A;  5J9B A;  4I6X A;  2VL2 C;  1K3Y A;  3ME7 A;  3G7I A;  5AGY A;  1GUL A;  4KCE A;  1T4Z A;  3UEM A;  3ZLP A;  1T4Y A;  1F6M C;  5G31 A;  5ID2 B;  2C0D A;  3EWL A;  5IMA A;  1K0N A;  3FKF A;  5CO3 A;  2OE3 A;  2O85 A;  2EIO A;  4I97 A;  1GTI A;  3F6F A;  3LYP A;  4J56 E;  3GKN A;  3QMX A;  4K7N A;  5HR0 A;  3UBL A;  1ON4 A;  1GSE A;  4G2E A;  4PNF A;  1MD3 A;  4IVF A;  1FAA A;  1GLQ A;  3H8Q A;  4ZB8 A;  1CQG A;  3U5R E;  3P2A A;  2B3S A;  3ZVJ A;  4MPG A;  3FR9 A;  5ABR A;  1U87 A;  3TRQ A;  3DXB A;  2GZP A;  3IAM 2;  1THX A;  2L59 A;  5FWG A;  4ZL7 A;  3S9F A;  1XBS A;  4WXT A;  1QK8 A;  4V2M A;  4N10 A;  3GH6 A;  3NOF A;  3IOS A;  1MDK A;  2WRT A;  4AJ8 A;  1K3L A;  2E2M A;  4GF0 A;  1M9B A;  2H0H A;  1TKD B;  3EE2 A;  4OCF A;  2NDO A;  4RI6 A;  1GSF A;  2C0G A;  2XBI A;  3ED3 A;  4MCU A;  4OFT A;  1YZX A;  2JSY A;  5G2Z A;  2FY6 A;  4KDY A;  2O87 A;  2DJ2 A;  1XWG A;  2HRF A;  3GSS A;  3SBC A;  1A8L A;  4EVM A;  4MZW A;  3F3Q A;  1MEK A;  5CRE A;  5C00 A;  2VM2 A;  1BJX A;  3DIE A;  2E7P A;  1Y25 A;  6GSV A;  1SU9 A;  5KN3 A;  4NPB A;  3ZRE A;  4IQA A;  4KAE A;  1BX9 A;  4RI7 A;  3H93 A;  4TOP A;  5J3R A;  1X5E A;  2F3M A;  2DJK A;  2DIZ A;  1S3A A;  3C71 A;  2F8A A;  4HZ2 A;  2OBI A;  2YP6 A;  1NHO A;  3CSH A;  4GCI A;  3LSZ A;  1M99 A;  2L5O A;  3IE3 A;  1FW1 A;  4BL7 A;  3IV4 A;  2H76 A;  1LJR A;  6GSU A;  2P31 A;  1B9Y C;  4GSN A;  4K1F A;  5CRW A;  1XWA A;  1URM A;  2LRN A;  4O7H A;  4DSS A;  3KP8 A;  1AQW A;  1EWX A;  1XCC A;  4IEL A;  3QOU A;  2MMA A;  2DSA A;  2KOK A;  3RAZ A;  4F82 A;  3BBY A;  2KHP A;  1TDI A;  4ILF A;  3WT2 A;  2LS5 A;  2DBC A;  4HDE A;  2VO4 A;  3ERG A;  3GTU A;  1R7H A;  3FRC A;  2HZE A;  4IHU A;  2LJR A;  1YEX A;  4KUN A;  5KN2 A;  1PL2 A;  1EP7 A;  3VWV A;  3IDV A;  3JCM L;  3UVT A;  5J9C A;  5D9V A;  1G7O A;  2TRX A;  4K2D A;  1PX7 A;  3E9J B;  3G7J A;  1R5A A;  1YKA A;  2X8C A;  2LST A;  5A4W A;  2ON7 A;  4AGS A;  2GZY A;  2WS2 A;  3EIN A;  1XW5 A;  4IW9 A;  3UL3 A;  1XPV A;  3LOR A;  1JZD A;  1KEB A;  4K9Z A;  3KD0 A;  1O7U A;  3FYG A;  1ERV A;  1EZK A;  2MZC A;  2YJ7 A;  2M46 A;  3US3 A;  2HSH A;  1ZGN A;  4NAX A;  5G1K A;  3HJO A;  2E0Q A;  5ECM B;  2MBS A;  5B8B A;  1SKR B;  1YDK A;  2CAI A;  1TRU A;  1GSY A;  1XOB A;  1HNC A;  1XVW A;  2FWH A;  5DVB A;  4J57 E;  3WT1 A;  2CT6 A;  2VLV A;  4KE3 A;  2HYX A;  2IFQ A;  2H72 A;  1SL0 B;  3VWX A;  3TJF A;  2B7J A;  4D73 B;  3RHB A;  1Q4J A;  3KXO A;  5DDL A;  4WBR D;  3FEU A;  5A5K A;  3ME8 A;  1WE0 A;  5AIV A;  2REM A;  4LA1 A;  2EIQ A;  5ECO B;  4XRA A;  4XS4 B;  2R5G A;  3F3R A;  4TKY A;  4J2F A;  2AYT A;  1ILO A;  3GHA A;  2A4V A;  2PMT A;  3M0F A;  4JU5 A;  1GUM A;  1G6W A;  4ID0 A;  4HQZ A;  1O85 A;  1N8J A;  1V9W A;  2WDU A;  3IRA A;  4K0G A;  1JHB A;  2HLS A;  5LNK e;  4EDZ A;  4WF4 A;  4I5Q A;  4TR1 A;  5DCG A;  2RUF A;  4V2N A;  1OC9 A;  1EGO A;  4EO3 A;  4AJ6 A;  4TR0 A;  3EMX A;  1F3A A;  1H75 A;  3W8J A;  4PUR A;  1BQ7 A;  2NPB A;  4PUF C;  1DBY A;  4OCE A;  1A23 A;  3KCM A;  2HXK A;  3CTG A;  4ECC A;  2VD1 A;  1V40 A;  2NVL A;  4KCA A;  3ZIJ A;  5H5R A;  4MA9 A;  1X0R A;  3LWA A;  1R5P A;  1ERW A;  3HKR A;  1PSQ A;  1KBN A;  2JL4 A;  1ERU A;  3UBK A;  2IL3 A;  4X43 A;  2OBK A;  1AQV A;  2N5A A;  2D2Z A;  4FYB A;  3CMI A;  4PX1 A;  3IR4 A;  1PGT A;  4POB A;  4RQX A;  5CRD A;  2CV4 A;  1I5G A;  5DAL B;  5E59 A;  1BYE A;  1WOU A;  4FYC A;  4WR4 A;  1T7P B;  1ABA A;  11GS A;  10GS A;  1IYI A;  2XBQ A;  4MH2 A;  2P5R A;  2FUG 2;  1TK0 B;  5HR2 A;  2I1U A;  4MDC A;  3QFB C;  3KTB A;  3E0U A;  4IP6 A;  2V6K A;  2JU5 A;  3RBT A;  4K0N A;  2GLR A;  3HA9 A;  4OO4 A;  3NZN A;  2H0G A;  3M1G A;  1M0U A;  4GTU A;  5F06 A;  3ZVJ D;  22GS A;  5IMF A;  2YV7 A;  2VL3 A;  2OKA A;  3OR5 A;  5COH A;  2IMK A;  4N0Z A;  2KLX A;  1F2E A;  2VLT A;  5EL8 A;  5DAK A;  1R26 A;  1TTZ A;  3BOA A;  5HFI A;  1QGV A;  1UN2 A;  12GS A;  2LJA A;  3WD6 A;  1YF1 A;  4I2U A;  4Z7X A;  5EPF A;  4XRD A;  4MJB A;  1ZZY A;  1GTU A;  1YQ1 A;  5HFG A;  3VLN A;  3KTL A;  3P8W A;  1EEM A;  1HD2 A;  1AIU A;  2GTU A;  3RPN A;  4K8M A;  4LLR A;  1U6T A;  2O7K A;  3APO A;  3DVW A;  2WB9 A;  3K8N A;  3QAW A;  2AAW A;  1PX6 A;  2VCQ A;  1RK4 A;  4GSS A;  1OE7 A;  4PQH A;  3HZ8 A;  3EVI A;  1UA5 A;  1WRY A;  2H1B A;  1JZW A;  1HYU A;  1F9M A;  1TW9 A;  2B5X A;  2J9H A;  2JZT A;  2C80 A;  4XS1 A;  2C0F A;  5J4U A;  3KMN A;  3C1R A;  5JCU A;  3C73 A;  2IN3 A;  4EC0 A;  3DEX A;  1AQX A;  2AHE A;  4HQS A;  2F8F A;  2IPA A;  3TKS A;  4P3Y B;  4L8E A;  4IJI A;  3LJR A;  1JZO A;  3L9S A;  5GST A;  3WGE A;  1HNA A;  5GAN D;  2R6K A;  2YV9 A;  4NWY A;  1TRW A;  4HZ4 A;  1GL8 A;  5F8B A;  2PPT A;  3I6A A;  3GTU B;  4TR4 A;  4KA0 A;  3J7Y k;  3EU3 A;  4TXO A;  2C3Q A;  2VOC A;  3WYW A;  1Z3E A;  3F4S A;  3UIW A;  2L4C A;  4O92 A;  3IK9 A;  6GSS A;  3TOT A;  2V41 A;  3H79 A;  1SK2 A;  1O6J A;  1LU4 A;  2BJX A;  2LQQ A;  4POM A;  3H1N A;  2VLU A;  1S3D A;  1PKW A;  4F0C A;  1B48 A;  8GSS A;  3CRU A;  2VCX A;  2MBT A;  4N0V A;  1GSQ A;  1K0B A;  2LJK A;  4KDU A;  4XCS A;  4OMV A;  3SWL A;  5CYY A;  4MZC A;  1GSD A;  2GST A;  2HRN A;  1TK8 B;  3Q18 A;  3GX0 A;  4OD7 A;  3GX8 A;  2IMI A;  4FO5 A;  4OO5 A;  5IMV A;  4ZIJ A;  4TVE A;  3WGD A;  2H1A A;  4F0B A;  1ZOF A;  3HD5 A;  4PQ1 A;  2L6C A;  4PGT A;  3TKS C;  1EEJ A;  2K9F A;  4TR3 A;  1ZCP A;  2NTO A;  3H4K A;  3C8E A;  2JZS A;  2F51 A;  1FO5 A;  4Q5F A;  3BJ5 A;  1FOV A;  3VI5 A;  4PUA A;  2PBJ A;  2H01 A;  2ON5 A;  4MLY A;  4QL9 A;  1FHE A;  2DC5 A;  3CYN A;  1TOF A;  2HE3 A;  4KB3 A;  3KP9 A;  4HEA 2;  2X64 A;  4ML1 A;  2R37 A;  1J08 A;  4GQC A;  4QQ7 A;  4E8E A;  3L4N A;  2RII A;  5ECS A;  1ZYE A;  2ZUP A;  3HJM A;  3IAS 2;  4CDO A;  4IS0 A;  3HJP A;  2B5E A;  1QXH A;  2JSZ A;  1RW1 A;  2TRC P;  2I81 A;  3I43 A;  4ZL8 A;  2ZCT A;  3IK7 A;  5IPH A;  4HOJ A;  4GLT A;  5IIZ A;  2ZNM A;  2H70 A;  4JZQ A;  4F2I A;  3CSI A;  1OKT A;  1T8E B;  1XWB A;  5ELG A;  1V2A A;  4DSQ A;  1FG4 A;  3MDK A;  4FH8 A;  2DIY A;  1NHY A;  2OE0 A;  1F37 A;  1HQO A;  4MJE A;  3DD3 A;  3DVX A;  4L5L A;  1SK0 A;  3ZIV A;  1EV4 A;  4KSM A;  2OA7 A;  2EC4 A;  3D4M A;  4IGJ A;  4MZB A;  5HR3 A;  2IMD A;  2MMO A;  2A2R A;  18GS A;  4I2T A;  4JR6 A;  1QQ2 A;  5ECH B;  2YN1 A;  1A8Y A;  5IOX A;  2KP1 A;  17GS A;  2M80 A;  2YWO A;  3TKP A;  2GQK A;  1Z5Y E;  3FR3 A;  3P7X A;  2LUS A;  3F8U A;  4MF6 A;  2I3Y A;  5JWR B;  4JED A;  1K0M A;  2QGV A;  2WJU A;  3EUR A;  1QMV A;  5A4V A;  3VI7 A;  4H86 A;  5ENU A;  2VM1 A;  1OYJ A;  4IQ1 A;  1WPI A;  2M72 A;  2CX3 A;  5G5F A;  1GSU A;  4GQF A;  3ZYW A;  5DQY A;  2RLI A;  3DML A;  3GUS A;  2O89 A;  2ALB A;  3HVS A;  1NM3 A;  1U88 A;  4EUY A;  1VF4 A;  2VUP A;  4HUA A;  4EL1 A;  5ID2 A;  16GS A;  1GNW A;  1TU8 A;  1WJK A;  5AIX A;  4ML6 A;  4NMU A;  1EOG A;  4YQM A;  4CHS A;  4PNG A;  2H6X A;  1UVZ A;  1PD2 1;  4WEY A;  3Q74 A;  3F9U A;  4ZL9 A;  2V6O A;  5EY6 A;  6GSY A;  4Q5Q A;  1MD4 A;  3FR6 A;  3HDC A;  14GS A;  4EXJ A;  2CZ2 A;  2LNS A;  3GST A;  2X8H A;  1UC7 A;  2TIR A;  1TP9 A;  2CVK A;  1OKD A;  4GWR A;  1FVJ A;  4ZXG A;  3VPQ A;  4ECJ A;  1QFN A;  3M3M A;  1G6Y A;  1VF1 A;  2PVO C;  2MYG A;  2IMF A;  3I9V 2;  4G10 A;  5IMD A;  3FHK A;  5JWQ B;  1JLW A;  5B7C A;  3TRX A;  3CTF A;  4K7O A;  3ISO A;  4LL1 B;  5B6N A;  5ECR B;  4FYU A;  1EOH A;  3D6I A;  3TB2 A;  4K7I A;  3VUR A;  3EYT A;  1BG5 A;  3FZ5 A;  3KH7 A;  2H19 A;  1S3C A;  3EU4 A;  3GL5 A;  1TRS A;  3F4T A;  3TGZ A;  4K6X A;  1TXX A;  3IPZ A;  3VWU A;  4ULX A;  4DSR A;  1X9S B;  2NBS A;  3D22 A;  1Z9H A;  1M2D A;  1MDJ A;  1WIK A;  5E4W A;  4YQU A;  2H74 A;  2GS3 A;  3IC4 A;  1KTE A;  3O76 A;  4EKZ A;  3EMP A;  3TRP A;  3BCK A;  2LTK A;  4TRX A;  1SL2 B;  1A2M A;  1XVQ A;  2H73 A;  2CVD A;  3QFA C;  2CVB A;  4RQR A;  3UVH A;  5ECP B;  4PXO A;  5GSS A;  2YOI A;  2GGT A;  1B8X A;  5CRH A;  2PGT A;  4ISD A;  4GXZ A;  1K0D A;  2A2S A;  2B1K A;  1GUH A;  1K0O A;  5LCZ A;  4ECI A;  1Q98 A;  5KN1 A;  3QPM A;  2LV3 A;  3M8N A;  1U3I A;  3IHQ A;  3L78 A;  4OFN A;  4ZB9 A;  1NSW A;  1JLV A;  2C8U A;  5FHI A;  2CZ3 A;  1GSS A;  1QUW A;  2EIR A;  3A5W A;  2PWJ A;  3L9V A;  3QR6 A;  2HT9 A;  5J5N A;  1TJD A;  1ZMA A;  7GSS A;  3LGC A;  2DJ0 A;  4WET A;  4L0U A;  2JAC A;  1G0T A;  2LRT A;  1Z7P A;  4JRR A;  2WGR A;  5CRG A;  3A2X A;  2C0E A;  1SYR A;  2VCW A;  2DJJ A;  5J41 A;  4F9Z A;  2OAD A;  3UJ1 A;  5INY A;  4WBJ A;  2GSQ A;  1OE8 A;  2YWM A;  3F63 A;  2CAQ A;  4E8H A;  2FGX A;  1NW2 A;  6GSW A;  5LD0 A;  4IJ3 A;  3N9J A;  3PH9 A;  1F3B A;  1THO A;  2GQM A;  1A0F A;  2H30 A;  5IO0 A;  4AJ7 A;  1JFU A;  3NIV A;  4N30 A;  4ZBB A;  2VIM A;  3DRN A;  5ECI B;  1GTB A;  2H6Y A;  2G0F A;  2IWT A;  4GST A;  2FCH A;  4MJA A;  4EF0 A;  1VF3 A;  1V57 A;  2FWG A;  5JCG A;  2DJ1 A;  5AN1 A;  2L5L A;  2PN8 A;  1BAY A;  1SJZ A;  4MK3 A;  2YAN A;  1PA3 A;  3TUE A;  3TJK A;  4KSO A;  5A4U A;  4YH2 A;  5ECK B;  5DJL A;  1GH2 A;  1XW6 A;  2VD0 A;  3TDG A;  1OVN A;  2CX4 A;  3KZQ A;  2YWN A;  1XWK A;  2P0G A;  2QKE A;  1X9W B;  2LRC A;  2N5F A;  3D0Z A;  4BVX A;  4D73 A;  3HCZ A;  2AB6 A;  1XWC A;  5IM9 A;  5JWO B;  1PRX A;  2WZ9 A;  2FNO A;  1OC8 A;  4HI7 A;  3TJB A;  4DSS B;  3TKQ A;  3LYK A;  5ECN B;  4IN0 A;  4XS4 A;  3GN3 A;  4OWY A;  4MPF A;  4NV2 A;  1WMJ A;  2Z9S A;  2BMX A;  4JE1 A;  2OAC A;  4KGI A;  5CNW A;  4DEJ A;  1K0C A;  2GT6 A;  3V1W A;  4NHW A; 
#chains in the Genus database with same CATH topology
 3QD9 A;  1O8X A;  1Z6N A;  1XFL A;  3QCP A;  3KM6 A;  4WF5 A;  4X1U A;  1V58 A;  2HZE B;  5HFK A;  3IXR A;  3MYD A;  4POL A;  3C1S A;  3ZMK A;  1XG8 A;  2HI7 A;  3IBH A;  5ECQ B;  1KNG A;  1YEP A;  4JBB A;  2LNT A;  3F0I A;  3KMO A;  1G7E A;  4AF2 A;  4K2X A;  3ZML A;  1WWJ A;  5B8A A;  3C7M A;  5ECL B;  4HJM A;  4Q5N A;  4LMV A;  1RQM A;  4YAV A;  1GTA A;  3RHC A;  3LEF A;  3G9B A;  3F4R A;  2XC2 A;  1ACV A;  1DSB A;  3Q6O A;  4L0W A;  1Z6M A;  2FWF A;  2H1D A;  3HVV A;  3WGX A;  1X5C A;  1USB A;  3VK9 A;  4F03 A;  2DML A;  4POK A;  5DBQ A;  2OE1 A;  3PGT A;  5DAL A;  2GSR A;  1SJI A;  4MF5 A;  2XPD A;  2MMZ A;  2GT5 A;  2YJH A;  5H5Q A;  2X49 A;  1AXD A;  1EP8 A;  2C4J A;  4G19 A;  1PMT A;  20GS A;  2A2P A;  1AC1 A;  4RUV A;  1GRX A;  1FB0 A;  1C72 A;  2J23 A;  1JZR A;  1XOA A;  1FB6 A;  3GA4 A;  1W89 A;  3GIX A;  2FWE A;  4XIH A;  3VFI A;  2IFQ B;  4O32 A;  1ML6 A;  3VWW A;  2FLS A;  2K8V A;  5H5S A;  1SD8 A;  4K5S A;  3ZTL A;  2YNX A;  5ELA A;  3P90 A;  1MTC A;  4TN8 A;  3QDN A;  2JZR A;  4WR5 A;  5D73 A;  2B6M A;  1GUK A;  4HU9 A;  5CP1 A;  5G5E A;  1U3A A;  2VAF A;  1ZYN A;  1YKC A;  3O3T A;  1DE2 A;  1WP0 A;  2PUK C;  2B7K A;  3D4T A;  4XTS A;  2DLX A;  2FD3 A;  3G7Y A;  5GZZ B;  4BWS A;  4ICY A;  2X8G A;  5D9W A;  2H1G A;  3E3E A;  4XHM A;  1YF0 A;  5BRT A;  1E6B A;  3LFL A;  2K6V A;  2HSY A;  4ZBD A;  13GS A;  4TR1 B;  5D93 A;  1OC9 B;  2VCV A;  1OC3 A;  1T3B A;  3QAV A;  2V1M A;  3KJY A;  1YY7 A;  2K18 A;  3I69 A;  1GP1 A;  1B9X C;  1LBK A;  2YZU A;  3UAR A;  3W8S A;  1K3O A;  2IIY A;  3GUR A;  5JCW A;  5D9T A;  2VCT A;  3CSJ A;  3TCO A;  3FY7 A;  3DGQ A;  2B1L A;  3KGK A;  3DWV A;  3APS A;  3M9K A;  1O73 A;  1PL1 A;  4O5U A;  3HZ4 A;  1A2L A;  4IBP A;  19GS A;  2QC7 A;  1AAZ A;  2HFD A;  2YCD A;  3LQ7 A;  5D8I A;  1HNB A;  3PIN A;  3UOM A;  1VRS D;  4L5O A;  3GYK A;  3HVX A;  2LKU A;  3A2W A;  2V32 A;  2FHE A;  4MH3 A;  2GDR A;  2C3T A;  1SYX A;  2R3X A;  2PER A;  4PQI A;  5IMC A;  5KEJ A;  2XPE A;  2BTO T;  3UMA A;  1X9M B;  2I9H A;  4QL7 A;  2P5Q A;  3M9J A;  3MNG A;  2LEG A;  4KW6 A;  1SKS B;  4MJC A;  1I9D A;  3KEB A;  2CQ9 A;  4V1A p;  2ES7 A;  2GQL A;  3GKK A;  1IYH A;  1W4V A;  3ZFB A;  2H66 A;  4V1A g;  2HNL A;  5DAK B;  5CAX A;  1ST9 A;  1ZYQ B;  2AUV A;  2K8S A;  1XXU A;  3MWH A;  1A0R P;  3HHV A;  2R2J A;  4MNN A;  4IKH A;  1GLP A;  2N5B A;  4HU7 A;  4YKG A;  1YJ6 A;  3FZA A;  4LMW A;  1SL1 B;  5KOX A;  5EVO A;  4O5R A;  5FT3 A;  1H4O A;  6GSX A;  1J0F A;  2RUE A;  4ACS A;  3BD2 A;  1A2J A;  2FA8 A;  1SKW B;  5D9X A;  2H75 A;  3N5O A;  3A3T A;  4KX4 A;  4TXV A;  2I4A A;  3J7Y b;  3BCI A;  2WFC A;  1CQH A;  3ZZX A;  4DVC A;  3W6G A;  1AUC A;  1ERT A;  1Y6E A;  4G0L A;  5B6M A;  1TI1 A;  2IME A;  5AIS A;  2C1Y A;  3CBU A;  1PQN A;  2G2Q A;  3GKX A;  1EGR A;  3D5J A;  1XW9 A;  5KN0 A;  2GZZ A;  3D21 A;  2GVP A;  3Q19 A;  4N11 A;  1PN9 A;  2YWI A;  4FIW A;  1M7T A;  5IQY A;  2OJL A;  2LQO A;  2UZ8 A;  5C04 A;  4MF7 A;  4EIP A;  2R4V A;  3LG6 A;  1J9B A;  3APQ A;  1O81 A;  4TXO B;  1PKZ A;  4HS1 A;  4EDY A;  4KND A;  1O8W A;  3CRT A;  1T1V A;  5G1L A;  5IPG A;  1Z7R A;  1X5D A;  3ERF A;  5DQS A;  2V2G A;  2C3N A;  2MMN A;  3CXG A;  2O8V B;  3GMF A;  2HZF A;  5DJM A;  5F07 A;  1XZO A;  4G9H A;  2H0I A;  2FA4 A;  4IP1 A;  4ECB A;  1GWC A;  3GH9 A;  3GRX A;  2RM5 A;  1N2A A;  2GSS A;  3PR8 A;  3A2V A;  2JAD A;  3ZIT A;  3LXT A;  3HXS A;  1A24 A;  3IHG A;  3LXZ A;  4BA7 A;  5HR1 A;  3AY8 A;  4EE0 A;  2F9S A;  3MAK A;  2H71 A;  1M2B A;  1K0A A;  3UAP A;  4MMM A;  2KP2 A;  3L9U A;  1SK1 A;  3KIJ A;  2WCI A;  4MP4 A;  1BED A;  1ZL9 A;  3O6T A;  4ZB6 A;  5IMZ A;  2DMM A;  3U6V A;  2B5Y A;  2AJQ B;  3GL3 A;  3FK8 A;  4ZIL A;  3L0H A;  1EV9 A;  1OAZ A;  4GRF A;  2IJY A;  2R0G A;  3RDW A;  4YQV A;  5GAP D;  1AW9 A;  4KH7 A;  3HY2 A;  2AV4 A;  4XS6 A;  2PVQ A;  1VF2 A;  2H8L A;  2RM6 A;  4JR4 A;  3FZ9 A;  4USS A;  3TJJ A;  4Q5R A;  4CW9 A;  5L71 A;  4TW5 A;  3QAG A;  4ZBA A;  3F6D A;  3KH9 A;  2VL2 A;  4NV5 A;  2E2G A;  1XIY A;  2XHF A;  2X99 A;  2YZH A;  2KUC A;  3IA1 A;  3TKS E;  5IOW A;  1B4Q A;  1SEN A;  5F0G A;  9GSS A;  3GFK A;  3GNJ A;  4HJ2 A;  3DYR A;  3GKM A;  3R2Q A;  1B4P A;  2YPM A;  3TOU A;  4NXI A;  3VPT A;  2L4Q A;  2H6Z A;  1GNE A;  1VGL A;  2VCZ A;  4CY8 A;  2PU9 C;  4MAB A;  3ERW A;  6GST A;  5HQP A;  2CA8 A;  2QSI A;  1FVK A;  1T00 A;  1TI3 A;  2L6D A;  3EC3 A;  4NHZ A;  4BIK A;  4WKW A;  3FZ4 A;  3TJG A;  4V2L A;  3FW2 A;  1R4W A;  1V98 A;  2VL9 A;  3ZRD A;  2L57 A;  4YAP A;  5F05 A;  1M2A A;  4BVY A;  4BWQ A;  1DUG A;  4X0X A;  4OFM A;  3DKS A;  1TK5 B;  5G30 A;  5DCH A;  3ZFL A;  5IO2 A;  4I8B A;  1MDI A;  3HYP A;  5D96 A;  3ZL5 A;  2WUL A;  4LL4 B;  4BPY A;  3RPP A;  2DJ3 A;  3GV1 A;  1TU7 A;  3TKR A;  1DE1 A;  4KDX A;  3MSZ A;  1SJ6 A;  1TRV A;  1E2Y A;  1SD9 A;  1M9A A;  5J9B A;  4I6X A;  2VL2 C;  1K3Y A;  3ME7 A;  3G7I A;  5AGY A;  1GUL A;  4KCE A;  1T4Z A;  3UEM A;  3ZLP A;  1T4Y A;  1F6M C;  5G31 A;  5ID2 B;  2C0D A;  3EWL A;  5IMA A;  1K0N A;  3FKF A;  5CO3 A;  2OE3 A;  4G0K A;  2O85 A;  2EIO A;  4I97 A;  1GTI A;  3F6F A;  3LYP A;  4J56 E;  3GKN A;  3QMX A;  3MIX A;  4K7N A;  5HR0 A;  3UBL A;  1ON4 A;  1GSE A;  4G2E A;  4PNF A;  1MD3 A;  4IVF A;  1FAA A;  1GLQ A;  3H8Q A;  4ZB8 A;  1CQG A;  3U5R E;  3P2A A;  2B3S A;  3ZVJ A;  4MPG A;  3FR9 A;  5ABR A;  1U87 A;  4CY6 A;  3TRQ A;  2HRK A;  3DXB A;  2GZP A;  3IAM 2;  2HSM A;  1THX A;  2L59 A;  5FWG A;  4ZL7 A;  3S9F A;  1XBS A;  4WXT A;  1QK8 A;  4V2M A;  4N10 A;  3GH6 A;  3NOF A;  3IOS A;  1MDK A;  2WRT A;  4AJ8 A;  1K3L A;  2E2M A;  4GF0 A;  1M9B A;  2H0H A;  1TKD B;  3EE2 A;  4OCF A;  2NDO A;  4RI6 A;  1GSF A;  2C0G A;  2XBI A;  3ED3 A;  4MCU A;  4OFT A;  1YZX A;  2JSY A;  5G2Z A;  2FY6 A;  4KDY A;  2O87 A;  2DJ2 A;  1XWG A;  2HRF A;  3GSS A;  3SBC A;  1A8L A;  4EVM A;  4MZW A;  3F3Q A;  1MEK A;  5CRE A;  5C00 A;  2VM2 A;  1BJX A;  3DIE A;  2E7P A;  2A4H A;  1Y25 A;  6GSV A;  1SU9 A;  5KN3 A;  4NPB A;  3ZRE A;  4IQA A;  4KAE A;  1BX9 A;  4RI7 A;  3H93 A;  4TOP A;  5J3R A;  1X5E A;  2F3M A;  2DJK A;  2DIZ A;  1S3A A;  3C71 A;  2F8A A;  4HZ2 A;  2OBI A;  2YP6 A;  1M3I A;  1NHO A;  3CSH A;  4GCI A;  3LSZ A;  1M99 A;  2L5O A;  3IE3 A;  1FW1 A;  4BL7 A;  3IV4 A;  2H76 A;  1LJR A;  6GSU A;  2P31 A;  1B9Y C;  4GSN A;  4K1F A;  5CRW A;  1XWA A;  1URM A;  2LRN A;  4O7H A;  4X4J A;  4DSS A;  3KP8 A;  1AQW A;  1EWX A;  1XCC A;  4IEL A;  3QOU A;  2MMA A;  2DSA A;  2KOK A;  3RAZ A;  4F82 A;  3BBY A;  2KHP A;  1TDI A;  4ILF A;  3WT2 A;  2LS5 A;  2DBC A;  4HDE A;  2VO4 A;  3ERG A;  3GTU A;  1R7H A;  3FRC A;  2HZE A;  4IHU A;  2LJR A;  1YEX A;  4KUN A;  5KN2 A;  1PL2 A;  1EP7 A;  3VWV A;  3IDV A;  3JCM L;  3UVT A;  5J9C A;  5D9V A;  1G7O A;  3R3E A;  2TRX A;  4K2D A;  1PX7 A;  5KOW A;  3E9J B;  3G7J A;  1R5A A;  1YKA A;  2X8C A;  2LST A;  4Z2U A;  5A4W A;  2ON7 A;  4AGS A;  2R0C A;  2GZY A;  2WS2 A;  3EIN A;  1XW5 A;  4IW9 A;  3UL3 A;  1XPV A;  3LOR A;  1JZD A;  1KEB A;  4K9Z A;  3KD0 A;  1O7U A;  1PN0 A;  3FYG A;  1ERV A;  1EZK A;  2MZC A;  2YJ7 A;  2M46 A;  4Z2R A;  3US3 A;  2HSH A;  1ZGN A;  4NAX A;  5G1K A;  3HJO A;  4HSC X;  2E0Q A;  5ECM B;  2MBS A;  5B8B A;  1SKR B;  1YDK A;  4K5R A;  2CAI A;  1TRU A;  1GSY A;  1XOB A;  1HNC A;  1XVW A;  2FWH A;  5DVB A;  4J57 E;  3WT1 A;  2CT6 A;  2VLV A;  4KE3 A;  2HYX A;  2IFQ A;  2H72 A;  1SL0 B;  3VWX A;  3TJF A;  2B7J A;  4D73 B;  4BVX B;  3RHB A;  1Q4J A;  3KXO A;  5DDL A;  4WBR D;  3FEU A;  5A5K A;  3ME8 A;  1WE0 A;  5AIV A;  2REM A;  4LA1 A;  2EIQ A;  5ECO B;  4XRA A;  4XS4 B;  2R5G A;  3F3R A;  4TKY A;  4J2F A;  2AYT A;  1ILO A;  3GHA A;  2A4V A;  2PMT A;  3M0F A;  4JU5 A;  1GUM A;  1G6W A;  4ID0 A;  4HQZ A;  1O85 A;  1N8J A;  1V9W A;  2WDU A;  3IRA A;  3FMW A;  4K0G A;  1JHB A;  2HLS A;  5LNK e;  4EDZ A;  4WF4 A;  4I5Q A;  4TR1 A;  5DCG A;  2RUF A;  4V2N A;  1OC9 A;  1EGO A;  4EO3 A;  4AJ6 A;  4TR0 A;  3EMX A;  1F3A A;  1H75 A;  3W8J A;  4PUR A;  1BQ7 A;  2NPB A;  4PUF C;  1DBY A;  4OCE A;  1A23 A;  3KCM A;  2HXK A;  3CTG A;  4ECC A;  2VD1 A;  1V40 A;  2NVL A;  4KCA A;  3ZIJ A;  5H5R A;  4MA9 A;  1X0R A;  3LWA A;  1R5P A;  1ERW A;  3HKR A;  4G0I A;  1PSQ A;  1KBN A;  2JL4 A;  1ERU A;  3UBK A;  2IL3 A;  4X43 A;  2OBK A;  1AQV A;  2N5A A;  2D2Z A;  3EPT A;  4FYB A;  3CMI A;  4PX1 A;  3IR4 A;  1PGT A;  4POB A;  4RQX A;  5CRD A;  2CV4 A;  1I5G A;  5DAL B;  5E59 A;  1BYE A;  1WOU A;  4FYC A;  4WR4 A;  1T7P B;  1ABA A;  11GS A;  10GS A;  1IYI A;  2XBQ A;  4MH2 A;  2P5R A;  2FUG 2;  1TK0 B;  5HR2 A;  2I1U A;  4MDC A;  3QFB C;  3KTB A;  4PTS A;  3E0U A;  4IP6 A;  2V6K A;  2JU5 A;  3RBT A;  4K0N A;  2GLR A;  3HA9 A;  4OO4 A;  3NZN A;  2H0G A;  3M1G A;  1M0U A;  4GTU A;  5F06 A;  3ZVJ D;  22GS A;  5IMF A;  2YV7 A;  2VL3 A;  2OKA A;  3OR5 A;  5COH A;  2IMK A;  4N0Z A;  1S3R A;  2KLX A;  1F2E A;  2VLT A;  5EL8 A;  5DAK A;  1R26 A;  1TTZ A;  3BOA A;  5HFI A;  1QGV A;  1UN2 A;  12GS A;  2LJA A;  3WD6 A;  1M3J A;  1YF1 A;  4I2U A;  4Z7X A;  5EPF A;  4XRD A;  4MJB A;  1ZZY A;  3IC8 A;  1GTU A;  1YQ1 A;  5HFG A;  3VLN A;  3KTL A;  3P8W A;  1EEM A;  1HD2 A;  1AIU A;  2GTU A;  3RPN A;  4K8M A;  4LLR A;  1U6T A;  2O7K A;  3APO A;  3DVW A;  2QA2 A;  2WB9 A;  3K8N A;  3QAW A;  2AAW A;  1PX6 A;  2VCQ A;  1RK4 A;  4GSS A;  1OE7 A;  4PQH A;  3HZ8 A;  3EVI A;  1UA5 A;  1WRY A;  2H1B A;  1JZW A;  1HYU A;  1F9M A;  3HVN A;  1TW9 A;  2B5X A;  2J9H A;  2JZT A;  2C80 A;  4XS1 A;  2C0F A;  4Z2T A;  5J4U A;  3KMN A;  3C1R A;  5JCU A;  3C73 A;  2IN3 A;  4EC0 A;  3DEX A;  1AQX A;  1FOH A;  2AHE A;  4HQS A;  2F8F A;  2IPA A;  3TKS A;  2DKI A;  4P3Y B;  4L8E A;  4IJI A;  3LJR A;  1JZO A;  3L9S A;  5GST A;  3WGE A;  1HNA A;  5GAN D;  2R6K A;  2YV9 A;  4NWY A;  1TRW A;  4HZ4 A;  1GL8 A;  5F8B A;  2PPT A;  3I6A A;  3GTU B;  4TR4 A;  4KA0 A;  3J7Y k;  3EU3 A;  4TXO A;  2C3Q A;  2DKH A;  2VOC A;  3WYW A;  1Z3E A;  3F4S A;  3UIW A;  2L4C A;  4O92 A;  3IK9 A;  6GSS A;  3TOT A;  2V41 A;  3H79 A;  1SK2 A;  1O6J A;  1LU4 A;  2BJX A;  2LQQ A;  4POM A;  3H1N A;  2VLU A;  1S3D A;  1PKW A;  4F0C A;  1B48 A;  8GSS A;  3CRU A;  2VCX A;  2MBT A;  4N0V A;  1GSQ A;  1K0B A;  2LJK A;  4KDU A;  4XCS A;  4OMV A;  3SWL A;  5CYY A;  4MZC A;  1GSD A;  2GST A;  2HRN A;  1TK8 B;  3Q18 A;  3GX0 A;  4OD7 A;  3GX8 A;  2IMI A;  4FO5 A;  4OO5 A;  5IMV A;  4ZIJ A;  4TVE A;  1PFO A;  3WGD A;  2H1A A;  4F0B A;  1ZOF A;  3HD5 A;  4PQ1 A;  2L6C A;  4PGT A;  3TKS C;  1EEJ A;  2K9F A;  4TR3 A;  1ZCP A;  2NTO A;  3H4K A;  3C8E A;  2JZS A;  2F51 A;  1FO5 A;  4Q5F A;  3BJ5 A;  1FOV A;  3VI5 A;  4PUA A;  2PBJ A;  2H01 A;  2ON5 A;  4MLY A;  4QL9 A;  1FHE A;  2DC5 A;  3CYN A;  1TOF A;  2HE3 A;  4KB3 A;  3KP9 A;  4HEA 2;  2X64 A;  4ML1 A;  2R37 A;  1J08 A;  4GQC A;  4QQ7 A;  4E8E A;  3L4N A;  2RII A;  5ECS A;  1ZYE A;  3PPU A;  2ZUP A;  3HJM A;  3IAS 2;  4CDO A;  4IS0 A;  3HJP A;  2B5E A;  1QXH A;  2JSZ A;  1RW1 A;  2TRC P;  2I81 A;  3I43 A;  4ZL8 A;  2ZCT A;  3IK7 A;  5IPH A;  4HOJ A;  4GLT A;  5IIZ A;  2ZNM A;  2H70 A;  4JZQ A;  4F2I A;  3CSI A;  1OKT A;  1T8E B;  4KF9 A;  1XWB A;  4O5Q A;  5ELG A;  1V2A A;  4DSQ A;  1FG4 A;  3MDK A;  4FH8 A;  2DIY A;  1NHY A;  2OE0 A;  1F37 A;  1HQO A;  4MJE A;  3DD3 A;  3DVX A;  4L5L A;  1SK0 A;  3ZIV A;  1EV4 A;  4KSM A;  2OA7 A;  2EC4 A;  3D4M A;  4IGJ A;  4MZB A;  5HR3 A;  2IMD A;  2MMO A;  2A2R A;  18GS A;  4I2T A;  4JR6 A;  1QQ2 A;  5ECH B;  2YN1 A;  1A8Y A;  5IOX A;  2KP1 A;  17GS A;  2M80 A;  2YWO A;  3TKP A;  2GQK A;  1Z5Y E;  3FR3 A;  3P7X A;  2LUS A;  3F8U A;  4MF6 A;  2I3Y A;  2X4A A;  5JWR B;  4JED A;  1K0M A;  2QGV A;  2WJU A;  3EUR A;  1QMV A;  5A4V A;  3VI7 A;  4H86 A;  2VM1 A;  5ENU A;  1OYJ A;  4IQ1 A;  1WPI A;  2M72 A;  2CX3 A;  5G5F A;  1GSU A;  4GQF A;  3ZYW A;  5DQY A;  2RLI A;  3DML A;  3GUS A;  2O89 A;  2ALB A;  3HVS A;  1NM3 A;  1U88 A;  4EUY A;  1VF4 A;  2VUP A;  4HUA A;  4EL1 A;  5ID2 A;  16GS A;  1GNW A;  1TU8 A;  1WJK A;  3A5I A;  5AIX A;  4ML6 A;  4NMU A;  1EOG A;  4YQM A;  4CHS A;  4PNG A;  2H6X A;  1UVZ A;  1PD2 1;  4WEY A;  3CQF A;  3Q74 A;  3F9U A;  4ZL9 A;  2V6O A;  5EY6 A;  6GSY A;  4Q5Q A;  2R0P A;  1MD4 A;  3FR6 A;  3HDC A;  2HRA A;  14GS A;  4EXJ A;  2CZ2 A;  2LNS A;  3GST A;  2X8H A;  1UC7 A;  2TIR A;  1TP9 A;  2CVK A;  1OKD A;  4GWR A;  1FVJ A;  4ZXG A;  3VPQ A;  4ECJ A;  1QFN A;  3M3M A;  1G6Y A;  1VF1 A;  2PVO C;  2MYG A;  2IMF A;  3I9V 2;  4G10 A;  5IMD A;  3FHK A;  5JWQ B;  1JLW A;  5B7C A;  3TRX A;  3CTF A;  4K7O A;  3ISO A;  4LL1 B;  5B6N A;  5ECR B;  4FYU A;  1EOH A;  3D6I A;  3TB2 A;  4K7I A;  3VUR A;  3EYT A;  1BG5 A;  3FZ5 A;  3KH7 A;  2H19 A;  1S3C A;  3EU4 A;  3GL5 A;  1TRS A;  3F4T A;  3TGZ A;  4K6X A;  1TXX A;  3IPZ A;  3VWU A;  4ULX A;  4DSR A;  1X9S B;  4BVY B;  2NBS A;  3D22 A;  1Z9H A;  1M2D A;  1MDJ A;  1WIK A;  5E4W A;  4YQU A;  2H74 A;  4A5P A;  2GS3 A;  3IC4 A;  1KTE A;  3O76 A;  4EKZ A;  3EMP A;  3TRP A;  3LW9 A;  3BCK A;  2LTK A;  4TRX A;  1SL2 B;  1A2M A;  1XVQ A;  2H73 A;  2CVD A;  3QFA C;  2CVB A;  4RQR A;  3UVH A;  5ECP B;  4PXO A;  5GSS A;  2YOI A;  2GGT A;  1B8X A;  5CRH A;  2PGT A;  4ISD A;  4GXZ A;  1K0D A;  2A2S A;  2B1K A;  1GUH A;  1K0O A;  5LCZ A;  4ECI A;  1Q98 A;  5KN1 A;  3QPM A;  2LV3 A;  3M8N A;  1U3I A;  3IHQ A;  4YKF A;  3L78 A;  4OFN A;  4ZB9 A;  1NSW A;  1JLV A;  2C8U A;  5FHI A;  2CZ3 A;  1GSS A;  1QUW A;  2EIR A;  3A5W A;  2PWJ A;  3L9V A;  3QR6 A;  2HT9 A;  5J5N A;  1TJD A;  1ZMA A;  7GSS A;  3LGC A;  2DJ0 A;  4WET A;  4L0U A;  2JAC A;  1G0T A;  2LRT A;  1Z7P A;  4JRR A;  2WGR A;  5CRG A;  3A2X A;  2C0E A;  1SYR A;  2VCW A;  2DJJ A;  5J41 A;  4F9Z A;  2OAD A;  3UJ1 A;  5INY A;  4WBJ A;  2GSQ A;  1OE8 A;  2YWM A;  3F63 A;  2CAQ A;  4E8H A;  2FGX A;  1NW2 A;  6GSW A;  5LD0 A;  4IJ3 A;  3N9J A;  3PH9 A;  1F3B A;  1THO A;  2GQM A;  1A0F A;  2H30 A;  5IO0 A;  4AJ7 A;  1JFU A;  3NIV A;  4N30 A;  4ZBB A;  2VIM A;  3DRN A;  5ECI B;  1GTB A;  2H6Y A;  2G0F A;  2IWT A;  4GST A;  2FCH A;  4MJA A;  4EF0 A;  1VF3 A;  1V57 A;  2FWG A;  5JCG A;  2DJ1 A;  5AN1 A;  2L5L A;  2PN8 A;  1BAY A;  1SJZ A;  4MK3 A;  2YAN A;  1PA3 A;  3TUE A;  3TJK A;  2QA1 A;  4KSO A;  5A4U A;  4YH2 A;  5ECK B;  5DJL A;  1GH2 A;  4EIQ A;  1XW6 A;  2VD0 A;  3TDG A;  1OVN A;  2CX4 A;  3KZQ A;  5BMU A;  2YWN A;  1XWK A;  2P0G A;  4FQU A;  4BL7 B;  2QKE A;  1X9W B;  2LRC A;  2N5F A;  3D0Z A;  4BVX A;  4D73 A;  3HCZ A;  2AB6 A;  1XWC A;  5IM9 A;  5JWO B;  1PRX A;  2WZ9 A;  2FNO A;  1OC8 A;  4HI7 A;  3TJB A;  4DSS B;  1ZYP A;  3TKQ A;  3LYK A;  5ECN B;  4IN0 A;  4XS4 A;  3GN3 A;  4OWY A;  4MPF A;  4NV2 A;  1WMJ A;  2Z9S A;  2BMX A;  4JE1 A;  2OAC A;  4KGI A;  5CNW A;  4DEJ A;  1K0C A;  2GT6 A;  3V1W A;  4NHW A; 
#chains in the Genus database with same CATH homology
 3QD9 A;  1O8X A;  1Z6N A;  1XFL A;  3QCP A;  3KM6 A;  4WF5 A;  4X1U A;  1V58 A;  2HZE B;  5HFK A;  3IXR A;  3MYD A;  4POL A;  3C1S A;  3ZMK A;  2HI7 A;  3IBH A;  5ECQ B;  1KNG A;  1YEP A;  4JBB A;  2LNT A;  3F0I A;  3KMO A;  1G7E A;  4AF2 A;  4K2X A;  3ZML A;  1WWJ A;  5B8A A;  3C7M A;  5ECL B;  4HJM A;  4Q5N A;  4LMV A;  1RQM A;  4YAV A;  1GTA A;  3RHC A;  3LEF A;  3G9B A;  3F4R A;  2XC2 A;  1ACV A;  1DSB A;  3Q6O A;  4L0W A;  1Z6M A;  2FWF A;  2H1D A;  3HVV A;  3WGX A;  1X5C A;  1USB A;  3VK9 A;  4F03 A;  2DML A;  4POK A;  5DBQ A;  2OE1 A;  3PGT A;  5DAL A;  2GSR A;  1SJI A;  4MF5 A;  2XPD A;  2MMZ A;  2GT5 A;  2YJH A;  5H5Q A;  2X49 A;  1AXD A;  1EP8 A;  2C4J A;  4G19 A;  1PMT A;  20GS A;  2A2P A;  1AC1 A;  4RUV A;  1GRX A;  1FB0 A;  1C72 A;  2J23 A;  1JZR A;  1XOA A;  1FB6 A;  3GA4 A;  1W89 A;  3GIX A;  2FWE A;  4XIH A;  3VFI A;  2IFQ B;  4O32 A;  1ML6 A;  3VWW A;  2FLS A;  2K8V A;  5H5S A;  1SD8 A;  4K5S A;  3ZTL A;  2YNX A;  5ELA A;  3P90 A;  1MTC A;  4TN8 A;  3QDN A;  5D73 A;  2JZR A;  4WR5 A;  2B6M A;  1GUK A;  4HU9 A;  5CP1 A;  5G5E A;  1U3A A;  2VAF A;  1ZYN A;  1YKC A;  3O3T A;  1DE2 A;  1WP0 A;  2PUK C;  2B7K A;  3D4T A;  4XTS A;  2DLX A;  2FD3 A;  3G7Y A;  5GZZ B;  4BWS A;  4ICY A;  2X8G A;  5D9W A;  2H1G A;  3E3E A;  4XHM A;  1YF0 A;  5BRT A;  1E6B A;  3LFL A;  2K6V A;  2HSY A;  4ZBD A;  13GS A;  4TR1 B;  5D93 A;  1OC9 B;  2VCV A;  1OC3 A;  1T3B A;  3QAV A;  2V1M A;  3KJY A;  1YY7 A;  2K18 A;  3I69 A;  1GP1 A;  1B9X C;  1LBK A;  2YZU A;  3UAR A;  3W8S A;  1K3O A;  2IIY A;  3GUR A;  5JCW A;  5D9T A;  2VCT A;  3CSJ A;  3TCO A;  3FY7 A;  3DGQ A;  2B1L A;  3KGK A;  3DWV A;  3APS A;  3M9K A;  1O73 A;  1PL1 A;  4O5U A;  3HZ4 A;  1A2L A;  4IBP A;  19GS A;  2QC7 A;  1AAZ A;  2HFD A;  2YCD A;  3LQ7 A;  5D8I A;  1HNB A;  3PIN A;  3UOM A;  1VRS D;  4L5O A;  3GYK A;  3HVX A;  2LKU A;  3A2W A;  2V32 A;  2FHE A;  4MH3 A;  2GDR A;  2C3T A;  1SYX A;  2R3X A;  2PER A;  4PQI A;  5IMC A;  5KEJ A;  2XPE A;  2BTO T;  3UMA A;  1X9M B;  2I9H A;  4QL7 A;  2P5Q A;  3M9J A;  3MNG A;  2LEG A;  4KW6 A;  1SKS B;  4MJC A;  1I9D A;  3KEB A;  2CQ9 A;  4V1A p;  2ES7 A;  2GQL A;  3GKK A;  1IYH A;  1W4V A;  3ZFB A;  2H66 A;  4V1A g;  2HNL A;  5DAK B;  5CAX A;  1ST9 A;  1ZYQ B;  2AUV A;  2K8S A;  1XXU A;  3MWH A;  1A0R P;  3HHV A;  2R2J A;  4MNN A;  4IKH A;  1GLP A;  2N5B A;  4HU7 A;  4YKG A;  1YJ6 A;  3FZA A;  4LMW A;  1SL1 B;  5KOX A;  5EVO A;  4O5R A;  5FT3 A;  1H4O A;  6GSX A;  1J0F A;  2RUE A;  4ACS A;  3BD2 A;  1A2J A;  2FA8 A;  1SKW B;  5D9X A;  2H75 A;  3N5O A;  3A3T A;  4KX4 A;  4TXV A;  2I4A A;  3J7Y b;  3BCI A;  2WFC A;  1CQH A;  3ZZX A;  4DVC A;  3W6G A;  1AUC A;  1ERT A;  1Y6E A;  4G0L A;  5B6M A;  1TI1 A;  2IME A;  5AIS A;  2C1Y A;  3CBU A;  1PQN A;  2G2Q A;  3GKX A;  1EGR A;  3D5J A;  1XW9 A;  5KN0 A;  2GZZ A;  3D21 A;  2GVP A;  3Q19 A;  4N11 A;  1PN9 A;  2YWI A;  4FIW A;  1M7T A;  5IQY A;  2OJL A;  2LQO A;  2UZ8 A;  5C04 A;  4MF7 A;  4EIP A;  2R4V A;  3LG6 A;  1J9B A;  3APQ A;  1O81 A;  4TXO B;  1PKZ A;  4HS1 A;  4EDY A;  4KND A;  1O8W A;  3CRT A;  1T1V A;  5G1L A;  5IPG A;  1Z7R A;  1X5D A;  3ERF A;  5DQS A;  2V2G A;  2C3N A;  2MMN A;  3CXG A;  2O8V B;  3GMF A;  2HZF A;  5DJM A;  5F07 A;  1XZO A;  4G9H A;  2H0I A;  2FA4 A;  4IP1 A;  4ECB A;  1GWC A;  3GH9 A;  3GRX A;  2RM5 A;  1N2A A;  2GSS A;  3PR8 A;  3A2V A;  2JAD A;  3ZIT A;  3LXT A;  3HXS A;  1A24 A;  3IHG A;  3LXZ A;  4BA7 A;  5HR1 A;  3AY8 A;  4EE0 A;  2F9S A;  3MAK A;  2H71 A;  1M2B A;  1K0A A;  3UAP A;  4MMM A;  2KP2 A;  3L9U A;  1SK1 A;  3KIJ A;  2WCI A;  4MP4 A;  1BED A;  1ZL9 A;  3O6T A;  4ZB6 A;  5IMZ A;  2DMM A;  3U6V A;  2B5Y A;  2AJQ B;  3GL3 A;  3FK8 A;  4ZIL A;  3L0H A;  1EV9 A;  1OAZ A;  4GRF A;  2IJY A;  2R0G A;  3RDW A;  4YQV A;  5GAP D;  1AW9 A;  4KH7 A;  3HY2 A;  2AV4 A;  4XS6 A;  2PVQ A;  1VF2 A;  2H8L A;  2RM6 A;  4JR4 A;  3FZ9 A;  4USS A;  3TJJ A;  4Q5R A;  4CW9 A;  5L71 A;  4TW5 A;  3QAG A;  4ZBA A;  3F6D A;  3KH9 A;  2VL2 A;  4NV5 A;  2E2G A;  1XIY A;  2XHF A;  2X99 A;  2YZH A;  2KUC A;  3IA1 A;  3TKS E;  5IOW A;  1B4Q A;  1SEN A;  5F0G A;  9GSS A;  3GFK A;  3GNJ A;  4HJ2 A;  3DYR A;  3GKM A;  3R2Q A;  1B4P A;  2YPM A;  3TOU A;  4NXI A;  3VPT A;  2L4Q A;  2H6Z A;  1GNE A;  1VGL A;  2VCZ A;  4CY8 A;  2PU9 C;  4MAB A;  3ERW A;  6GST A;  5HQP A;  2CA8 A;  2QSI A;  1FVK A;  1T00 A;  1TI3 A;  2L6D A;  3EC3 A;  4NHZ A;  4WKW A;  3FZ4 A;  3TJG A;  4V2L A;  3FW2 A;  1R4W A;  1V98 A;  2VL9 A;  3ZRD A;  2L57 A;  4YAP A;  5F05 A;  1M2A A;  4BVY A;  4BWQ A;  1DUG A;  4X0X A;  4OFM A;  3DKS A;  1TK5 B;  5G30 A;  5DCH A;  3ZFL A;  5IO2 A;  4I8B A;  1MDI A;  3HYP A;  5D96 A;  3ZL5 A;  2WUL A;  4LL4 B;  4BPY A;  3RPP A;  2DJ3 A;  3GV1 A;  1TU7 A;  3TKR A;  1DE1 A;  4KDX A;  3MSZ A;  1SJ6 A;  1TRV A;  1E2Y A;  1SD9 A;  1M9A A;  5J9B A;  4I6X A;  2VL2 C;  1K3Y A;  3ME7 A;  3G7I A;  5AGY A;  1GUL A;  4KCE A;  1T4Z A;  3UEM A;  3ZLP A;  1T4Y A;  1F6M C;  5G31 A;  5ID2 B;  2C0D A;  3EWL A;  5IMA A;  1K0N A;  3FKF A;  5CO3 A;  2OE3 A;  4G0K A;  2O85 A;  2EIO A;  4I97 A;  1GTI A;  3F6F A;  3LYP A;  4J56 E;  3GKN A;  3QMX A;  3MIX A;  4K7N A;  5HR0 A;  3UBL A;  1ON4 A;  1GSE A;  4G2E A;  4PNF A;  1MD3 A;  4IVF A;  1FAA A;  1GLQ A;  3H8Q A;  4ZB8 A;  1CQG A;  3U5R E;  3P2A A;  2B3S A;  3ZVJ A;  4MPG A;  3FR9 A;  5ABR A;  1U87 A;  4CY6 A;  3TRQ A;  2HRK A;  3DXB A;  2GZP A;  3IAM 2;  2HSM A;  1THX A;  2L59 A;  5FWG A;  4ZL7 A;  3S9F A;  1XBS A;  4WXT A;  1QK8 A;  4V2M A;  4N10 A;  3GH6 A;  3NOF A;  3IOS A;  1MDK A;  2WRT A;  4AJ8 A;  1K3L A;  2E2M A;  4GF0 A;  1M9B A;  2H0H A;  1TKD B;  3EE2 A;  4OCF A;  2NDO A;  4RI6 A;  1GSF A;  2C0G A;  2XBI A;  3ED3 A;  4MCU A;  4OFT A;  1YZX A;  2JSY A;  5G2Z A;  2FY6 A;  4KDY A;  2O87 A;  2DJ2 A;  1XWG A;  2HRF A;  3GSS A;  3SBC A;  1A8L A;  4EVM A;  4MZW A;  3F3Q A;  1MEK A;  5CRE A;  5C00 A;  2VM2 A;  1BJX A;  3DIE A;  2E7P A;  2A4H A;  1Y25 A;  6GSV A;  1SU9 A;  5KN3 A;  4NPB A;  3ZRE A;  4IQA A;  4KAE A;  1BX9 A;  4RI7 A;  3H93 A;  4TOP A;  5J3R A;  1X5E A;  2F3M A;  2DJK A;  2DIZ A;  1S3A A;  3C71 A;  2F8A A;  4HZ2 A;  2OBI A;  2YP6 A;  1NHO A;  3CSH A;  4GCI A;  3LSZ A;  1M99 A;  2L5O A;  3IE3 A;  1FW1 A;  4BL7 A;  3IV4 A;  2H76 A;  1LJR A;  6GSU A;  2P31 A;  1B9Y C;  4GSN A;  4K1F A;  5CRW A;  1XWA A;  1URM A;  2LRN A;  4O7H A;  4X4J A;  4DSS A;  3KP8 A;  1AQW A;  1EWX A;  1XCC A;  4IEL A;  3QOU A;  2MMA A;  2DSA A;  2KOK A;  3RAZ A;  4F82 A;  3BBY A;  2KHP A;  1TDI A;  4ILF A;  3WT2 A;  2LS5 A;  2DBC A;  4HDE A;  2VO4 A;  3ERG A;  3GTU A;  1R7H A;  3FRC A;  2HZE A;  4IHU A;  2LJR A;  1YEX A;  4KUN A;  5KN2 A;  1PL2 A;  1EP7 A;  3VWV A;  3IDV A;  3JCM L;  3UVT A;  5J9C A;  5D9V A;  1G7O A;  3R3E A;  2TRX A;  4K2D A;  1PX7 A;  5KOW A;  3E9J B;  3G7J A;  1R5A A;  1YKA A;  2X8C A;  2LST A;  4Z2U A;  5A4W A;  2ON7 A;  4AGS A;  2R0C A;  2GZY A;  2WS2 A;  3EIN A;  1XW5 A;  4IW9 A;  3UL3 A;  1XPV A;  3LOR A;  1JZD A;  1KEB A;  4K9Z A;  3KD0 A;  1O7U A;  1PN0 A;  3FYG A;  1ERV A;  1EZK A;  2MZC A;  2YJ7 A;  2M46 A;  4Z2R A;  3US3 A;  2HSH A;  1ZGN A;  4NAX A;  5G1K A;  3HJO A;  2E0Q A;  5ECM B;  2MBS A;  5B8B A;  1SKR B;  1YDK A;  4K5R A;  2CAI A;  1TRU A;  1GSY A;  1XOB A;  1HNC A;  1XVW A;  2FWH A;  5DVB A;  4J57 E;  3WT1 A;  2CT6 A;  2VLV A;  4KE3 A;  2HYX A;  2IFQ A;  2H72 A;  1SL0 B;  3VWX A;  3TJF A;  2B7J A;  4D73 B;  4BVX B;  3RHB A;  1Q4J A;  3KXO A;  5DDL A;  4WBR D;  3FEU A;  5A5K A;  3ME8 A;  1WE0 A;  5AIV A;  2REM A;  4LA1 A;  2EIQ A;  5ECO B;  4XRA A;  4XS4 B;  2R5G A;  3F3R A;  4TKY A;  4J2F A;  2AYT A;  1ILO A;  3GHA A;  2A4V A;  2PMT A;  3M0F A;  4JU5 A;  1GUM A;  1G6W A;  4ID0 A;  4HQZ A;  1O85 A;  1N8J A;  1V9W A;  2WDU A;  3IRA A;  3FMW A;  4K0G A;  1JHB A;  2HLS A;  5LNK e;  4EDZ A;  4WF4 A;  4I5Q A;  4TR1 A;  5DCG A;  2RUF A;  4V2N A;  1OC9 A;  1EGO A;  4EO3 A;  4AJ6 A;  4TR0 A;  3EMX A;  1F3A A;  1H75 A;  3W8J A;  4PUR A;  1BQ7 A;  2NPB A;  4PUF C;  1DBY A;  4OCE A;  1A23 A;  3KCM A;  2HXK A;  3CTG A;  4ECC A;  2VD1 A;  1V40 A;  2NVL A;  4KCA A;  3ZIJ A;  5H5R A;  4MA9 A;  1X0R A;  3LWA A;  1R5P A;  1ERW A;  3HKR A;  4G0I A;  1PSQ A;  1KBN A;  2JL4 A;  1ERU A;  3UBK A;  2IL3 A;  4X43 A;  2OBK A;  1AQV A;  2N5A A;  2D2Z A;  3EPT A;  4FYB A;  3CMI A;  4PX1 A;  3IR4 A;  1PGT A;  4POB A;  4RQX A;  5CRD A;  2CV4 A;  1I5G A;  5DAL B;  5E59 A;  1BYE A;  1WOU A;  4FYC A;  4WR4 A;  1T7P B;  1ABA A;  11GS A;  10GS A;  1IYI A;  2XBQ A;  4MH2 A;  2P5R A;  2FUG 2;  1TK0 B;  5HR2 A;  2I1U A;  4MDC A;  3QFB C;  3KTB A;  4PTS A;  3E0U A;  4IP6 A;  2V6K A;  2JU5 A;  3RBT A;  4K0N A;  2GLR A;  3HA9 A;  4OO4 A;  3NZN A;  2H0G A;  3M1G A;  1M0U A;  4GTU A;  5F06 A;  3ZVJ D;  22GS A;  5IMF A;  2YV7 A;  2VL3 A;  2OKA A;  3OR5 A;  5COH A;  2IMK A;  4N0Z A;  2KLX A;  1F2E A;  2VLT A;  5EL8 A;  5DAK A;  1R26 A;  1TTZ A;  3BOA A;  5HFI A;  1QGV A;  1UN2 A;  12GS A;  2LJA A;  3WD6 A;  1YF1 A;  4I2U A;  4Z7X A;  5EPF A;  4XRD A;  4MJB A;  1ZZY A;  3IC8 A;  1GTU A;  1YQ1 A;  5HFG A;  3VLN A;  3KTL A;  3P8W A;  1EEM A;  1HD2 A;  1AIU A;  2GTU A;  3RPN A;  4K8M A;  4LLR A;  1U6T A;  2O7K A;  3APO A;  3DVW A;  2QA2 A;  2WB9 A;  3K8N A;  3QAW A;  2AAW A;  1PX6 A;  2VCQ A;  1RK4 A;  4GSS A;  1OE7 A;  4PQH A;  3HZ8 A;  3EVI A;  1UA5 A;  1WRY A;  2H1B A;  1JZW A;  1HYU A;  1F9M A;  1TW9 A;  2B5X A;  2J9H A;  2JZT A;  2C80 A;  4XS1 A;  2C0F A;  4Z2T A;  5J4U A;  3KMN A;  3C1R A;  5JCU A;  3C73 A;  2IN3 A;  4EC0 A;  3DEX A;  1AQX A;  1FOH A;  2AHE A;  4HQS A;  2F8F A;  2IPA A;  3TKS A;  2DKI A;  4P3Y B;  4L8E A;  4IJI A;  3LJR A;  1JZO A;  3L9S A;  5GST A;  3WGE A;  1HNA A;  5GAN D;  2R6K A;  2YV9 A;  4NWY A;  1TRW A;  4HZ4 A;  1GL8 A;  5F8B A;  2PPT A;  3I6A A;  3GTU B;  4TR4 A;  4KA0 A;  3J7Y k;  3EU3 A;  4TXO A;  2C3Q A;  2DKH A;  2VOC A;  3WYW A;  1Z3E A;  3F4S A;  3UIW A;  2L4C A;  4O92 A;  3IK9 A;  6GSS A;  3TOT A;  2V41 A;  3H79 A;  1SK2 A;  1O6J A;  1LU4 A;  2BJX A;  2LQQ A;  4POM A;  3H1N A;  2VLU A;  1S3D A;  1PKW A;  4F0C A;  1B48 A;  8GSS A;  3CRU A;  2VCX A;  2MBT A;  4N0V A;  1GSQ A;  1K0B A;  2LJK A;  4KDU A;  4XCS A;  4OMV A;  3SWL A;  5CYY A;  4MZC A;  1GSD A;  2GST A;  2HRN A;  1TK8 B;  3Q18 A;  3GX0 A;  4OD7 A;  3GX8 A;  2IMI A;  4FO5 A;  4OO5 A;  5IMV A;  4ZIJ A;  4TVE A;  3WGD A;  2H1A A;  4F0B A;  1ZOF A;  3HD5 A;  4PQ1 A;  2L6C A;  4PGT A;  3TKS C;  1EEJ A;  2K9F A;  4TR3 A;  1ZCP A;  2NTO A;  3H4K A;  3C8E A;  2JZS A;  2F51 A;  1FO5 A;  4Q5F A;  3BJ5 A;  1FOV A;  3VI5 A;  4PUA A;  2PBJ A;  2H01 A;  2ON5 A;  4MLY A;  4QL9 A;  1FHE A;  2DC5 A;  3CYN A;  1TOF A;  2HE3 A;  4KB3 A;  3KP9 A;  4HEA 2;  2X64 A;  4ML1 A;  2R37 A;  1J08 A;  4GQC A;  4QQ7 A;  4E8E A;  3L4N A;  2RII A;  5ECS A;  1ZYE A;  3PPU A;  2ZUP A;  3HJM A;  3IAS 2;  4CDO A;  4IS0 A;  3HJP A;  2B5E A;  1QXH A;  2JSZ A;  1RW1 A;  2TRC P;  2I81 A;  3I43 A;  4ZL8 A;  2ZCT A;  3IK7 A;  5IPH A;  4HOJ A;  4GLT A;  5IIZ A;  2ZNM A;  2H70 A;  4JZQ A;  4F2I A;  3CSI A;  1OKT A;  1T8E B;  4KF9 A;  1XWB A;  4O5Q A;  5ELG A;  1V2A A;  4DSQ A;  1FG4 A;  3MDK A;  4FH8 A;  2DIY A;  1NHY A;  2OE0 A;  1F37 A;  1HQO A;  4MJE A;  3DD3 A;  3DVX A;  4L5L A;  1SK0 A;  3ZIV A;  1EV4 A;  4KSM A;  2OA7 A;  2EC4 A;  3D4M A;  4IGJ A;  4MZB A;  5HR3 A;  2IMD A;  2MMO A;  2A2R A;  18GS A;  4I2T A;  4JR6 A;  1QQ2 A;  5ECH B;  2YN1 A;  1A8Y A;  5IOX A;  2KP1 A;  17GS A;  2M80 A;  2YWO A;  3TKP A;  2GQK A;  1Z5Y E;  3FR3 A;  3P7X A;  2LUS A;  3F8U A;  4MF6 A;  2I3Y A;  2X4A A;  5JWR B;  4JED A;  1K0M A;  2QGV A;  2WJU A;  3EUR A;  1QMV A;  5A4V A;  3VI7 A;  4H86 A;  2VM1 A;  5ENU A;  1OYJ A;  4IQ1 A;  1WPI A;  2M72 A;  2CX3 A;  5G5F A;  1GSU A;  4GQF A;  3ZYW A;  5DQY A;  2RLI A;  3DML A;  3GUS A;  2O89 A;  2ALB A;  3HVS A;  1NM3 A;  1U88 A;  4EUY A;  1VF4 A;  2VUP A;  4HUA A;  4EL1 A;  5ID2 A;  16GS A;  1GNW A;  1TU8 A;  1WJK A;  3A5I A;  5AIX A;  4ML6 A;  4NMU A;  1EOG A;  4YQM A;  4CHS A;  4PNG A;  2H6X A;  1UVZ A;  1PD2 1;  4WEY A;  3Q74 A;  3F9U A;  4ZL9 A;  2V6O A;  5EY6 A;  6GSY A;  4Q5Q A;  2R0P A;  1MD4 A;  3FR6 A;  3HDC A;  2HRA A;  14GS A;  4EXJ A;  2CZ2 A;  2LNS A;  3GST A;  2X8H A;  1UC7 A;  2TIR A;  1TP9 A;  2CVK A;  1OKD A;  4GWR A;  1FVJ A;  4ZXG A;  3VPQ A;  4ECJ A;  1QFN A;  3M3M A;  1G6Y A;  1VF1 A;  2PVO C;  2MYG A;  2IMF A;  3I9V 2;  4G10 A;  5IMD A;  3FHK A;  5JWQ B;  1JLW A;  5B7C A;  3TRX A;  3CTF A;  4K7O A;  3ISO A;  4LL1 B;  5B6N A;  5ECR B;  4FYU A;  1EOH A;  3D6I A;  3TB2 A;  4K7I A;  3VUR A;  3EYT A;  1BG5 A;  3FZ5 A;  3KH7 A;  2H19 A;  1S3C A;  3EU4 A;  3GL5 A;  1TRS A;  3F4T A;  3TGZ A;  4K6X A;  1TXX A;  3IPZ A;  3VWU A;  4ULX A;  4DSR A;  1X9S B;  4BVY B;  2NBS A;  3D22 A;  1Z9H A;  1M2D A;  1MDJ A;  1WIK A;  5E4W A;  4YQU A;  2H74 A;  4A5P A;  2GS3 A;  3IC4 A;  1KTE A;  3O76 A;  4EKZ A;  3EMP A;  3TRP A;  3LW9 A;  3BCK A;  2LTK A;  4TRX A;  1SL2 B;  1A2M A;  1XVQ A;  2H73 A;  2CVD A;  3QFA C;  2CVB A;  4RQR A;  3UVH A;  5ECP B;  4PXO A;  5GSS A;  2YOI A;  2GGT A;  1B8X A;  5CRH A;  2PGT A;  4ISD A;  4GXZ A;  1K0D A;  2A2S A;  2B1K A;  1GUH A;  1K0O A;  5LCZ A;  4ECI A;  1Q98 A;  5KN1 A;  3QPM A;  2LV3 A;  3M8N A;  1U3I A;  3IHQ A;  4YKF A;  3L78 A;  4OFN A;  4ZB9 A;  1NSW A;  1JLV A;  2C8U A;  5FHI A;  2CZ3 A;  1GSS A;  1QUW A;  2EIR A;  3A5W A;  2PWJ A;  3L9V A;  3QR6 A;  2HT9 A;  5J5N A;  1TJD A;  1ZMA A;  7GSS A;  3LGC A;  2DJ0 A;  4WET A;  4L0U A;  2JAC A;  1G0T A;  2LRT A;  1Z7P A;  4JRR A;  2WGR A;  5CRG A;  3A2X A;  2C0E A;  1SYR A;  2VCW A;  2DJJ A;  5J41 A;  4F9Z A;  2OAD A;  3UJ1 A;  5INY A;  4WBJ A;  2GSQ A;  1OE8 A;  2YWM A;  3F63 A;  2CAQ A;  4E8H A;  2FGX A;  1NW2 A;  6GSW A;  5LD0 A;  4IJ3 A;  3N9J A;  3PH9 A;  1F3B A;  1THO A;  2GQM A;  1A0F A;  2H30 A;  5IO0 A;  4AJ7 A;  1JFU A;  3NIV A;  4N30 A;  4ZBB A;  2VIM A;  3DRN A;  5ECI B;  1GTB A;  2H6Y A;  2G0F A;  2IWT A;  4GST A;  2FCH A;  4MJA A;  4EF0 A;  1VF3 A;  1V57 A;  2FWG A;  5JCG A;  2DJ1 A;  5AN1 A;  2L5L A;  2PN8 A;  1BAY A;  1SJZ A;  4MK3 A;  2YAN A;  1PA3 A;  3TUE A;  3TJK A;  2QA1 A;  4KSO A;  5A4U A;  4YH2 A;  5ECK B;  5DJL A;  1GH2 A;  4EIQ A;  1XW6 A;  2VD0 A;  3TDG A;  1OVN A;  2CX4 A;  3KZQ A;  5BMU A;  2YWN A;  1XWK A;  2P0G A;  4FQU A;  4BL7 B;  2QKE A;  1X9W B;  2LRC A;  2N5F A;  3D0Z A;  4BVX A;  4D73 A;  3HCZ A;  2AB6 A;  1XWC A;  5IM9 A;  5JWO B;  1PRX A;  2WZ9 A;  2FNO A;  1OC8 A;  4HI7 A;  3TJB A;  4DSS B;  1ZYP A;  3TKQ A;  3LYK A;  5ECN B;  4IN0 A;  4XS4 A;  3GN3 A;  4OWY A;  4MPF A;  4NV2 A;  1WMJ A;  2Z9S A;  2BMX A;  4JE1 A;  2OAC A;  4KGI A;  5CNW A;  4DEJ A;  1K0C A;  2GT6 A;  3V1W A;  4NHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...