2QGYA

Crystal structure of an enolase from the environmental genome shotgun sequencing of the sargasso sea
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
376
structure length
376
Chain Sequence
NQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAGLGIVIHEDILSELSIYSLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from the environmental genome shotgun sequencing of the Sargasso Sea.
rcsb
molecule tags Structural genomics, unknown function
molecule keywords Enolase from the environmental genome shotgun sequencing of
total genus 140
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qgyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qgyA01
3TQPA 3ZLFA 4YWSA 1SJAA 3HPFA 3MWCA 3RITA 1EC9A 3JVAA 1JPMA 1SJCA 3D47A 3DFHA 2PODA 4GFIA 3TWBA 5FJRA 2POZA 3CT2A 1JDFA 2PP0A 4IL2A 1E9IA 2P8CA 3SSZA 3N6HA 2GL5A 1MDLA 4K8GA 4JHMA 3SN4A 2DW7A 3PFRA 3STPA 3OW1A 1ECQA 1R0MA 4ZA0A 3OZYA 3R0KA 3RR1A 3MZNA 1JCTA 1MUCA 4X2PA 4H83A 1WUFA 3FXGA 4GGHA 3TTEA 3FVDA 4DN1A 4GIRA 3NXLA 4H19A 3N6JA 1FHVA 2QDDA 2HXUA 4DYEA 4HN8A 2OZ3A 2AKMA 3BSMA 3V4BA 2NQLA 1IYXA 2PGWA 1P48A 1F9CA 3ZLGA 3THUA 3U4FA 3P3BA 2OZTA 4DWDA 1XPYA 2OZ8A 3H8AA 3TWAA 4E8GA 2OG9A 5BOEA 2QDEA 4J1OA 3U9IA 3DEQA 3VCCA 3FJ4A 2ONEA 3OP2A 3MSYA 5IDZA 3R10A 3UJFA 2HZGA 3FV9A 2P0IA 3SQSA 2ZADA 3T6CA 2GDQA 2XSXA 3SJNA 1EC7A 4G7FA 3S5SA 3ENLA 2QQ6A 3H12A 3EKGA 3RCYA 4GMEA 3ES7A 3I4KA 3GC2A 3EEZA 4HCDA 2PA6A 3VDGA 1KKRA 5FJOA 3QLDA 1BKHA 3BJSA 2QJMA 3T9PA 3P0WA 4M0XA 2GGHA 3QN3A 2PP3A 4H2HA 6ENLA 3R25A 4E4UA 1OEPA 2MUCA 4DHGA 3CB3A 3UCDA 2AKZA 5EU9A 4KT2A 2XH7A 3H70A 2GGEA 1DTNA 4GYPA 2XH0A 2QJNA 4KEMA 3TJ4A 1TZZA 5FJPA 4IHCA 2OPJA 3NZGA 2PPGA 3RGTA 3ES8A 4HNCA 3VA8A 1SJDA 3IK4A 3VC6A 3I6TA 1NU5A 3DDMA 1PDYA 4ROPA 2OQHA 3IJIA 2AL1A 4Z1YA 3DFYA 2O56A 2PU0A 3SBFA 2HXTA 1L8PA 1TKKA 4DX3A 2QJJA 3ZLHA 2XH4A 1W6TA 4FP1A 4M6UA 3UJ2A 2ZC8A 1WUEA 4IL0A 4JN8A 2GGIA 4ZCWA 2OFJA 5BOFA 2PTXA 3BOXA 3DERA 1YEYA 2PMQA 5J04A 3V3WA 2GSHA 2CHRA 3SN0A 3ZVIA 4DXKA 4HNLA 1BQGA 3QPEA 3FCPA 3JW7A 3ZVHA 4IT1A 3QTPA 3UXKA 1KD0A 3CK5A 4GGBA 3GD6A 4IP5A 3IJQA 3N4FA 3TCSA 1PDZA 3KUMA 4MGGA 2GGJA 2XGZA 2P3ZA 1EBHA 1EC8A 4MMWA 3DESA 3DIPA 2PU1A 2FYMA 3CXOA 3MQTA 1KCZA 3VCNA 3T4WA 3Q4DA 3PWGA 3UGVA 4ENLA 4GISA 3TJIA 3GY1A 4EWJA 4Z17A 1SJBA 2QVHA 4HCLA 3Q45A 4K2SA 3DG3A 3FYYA 1EBGA 2XH2A 2OKTA 4HPNA 3JZUA 4G8TA 3OTRA 2PTWA 3RRAA 1JPDX 3K1GA 3V5FA 3VC5A 3MUCA 3PWIA 5FJUA 3MY9A 4E4FA 3NO1A 1FHUA 3TOYA 3S47A 3DG7A 1R6WA 3OZMA 3DGBA 2PP1A 1MNSA 2P8BA 2FKPA 4IP4A 2P88A 1MDRA 2PTZA 3P93A 3MKCA 2OVLA 3R11A 1MRAA 2MNRA 1KKOA 1ONEA 4J3ZA 4H1ZA 4KPLA 3ZVHB 3T8QA 2OLAA 4A3RA 3VFCA 4HYRA 2AL2B 4JN7A 2PGEA 3QKEA 2I5QA 3N4EA 2AL2A 3UXLA 2RDXA 3OPSA 4MKSA 2HNEA 2OX4A 3B97A 1NELA 2OQYA 3UCCA 2OO6A 3UJEA 4K1WA 3UJRA 4A6GA 2PSNA 3I6EA 1ELSA 5ENLA 3SN1A 2QGYA 2PCEA 4F4RA 2PS2A 3D46A 4KWSA 3R1ZA 2PTYA 4IZGA 1RVKA 3R0UA 3V5CA 3CAWA 5FJTA 3DG6A 4FI4A 3PK7A 3NFUA 3TW9A 3IJLA 4GYPC 4E6MA 7ENLA 3GO2A 2GGGA 1XS2A 1TE6A 3RO6A 4HCHA 1P43A 4A35A 3CYJA 4E5TA 2DW6A 3H7VA 3UJSA
chains in the Genus database with same CATH superfamily
1NVMA 1W0MA 3HG3A 4LVDA 1ZJHA 1B5TA 1J10A 3NNTA 4GJJA 4MSSA 3WJYA 5HQLA 3CAKA 4QNWA 4PRWA 4KWWA 3POHA 1YKWA 3LCWA 4AYSA 5FJRA 1E6XM 2G96A 4BF9A 3BGJA 5D09A 3IVUA 3G3DA 4MPQA 4XB3A 3GVRA 1WV2A 3RM4A 2QCHA 4E8DA 1ZTVA 2QJHA 4JHMA 2XVPA 2Y24A 5H91A 2WMGA 2Y2WA 2OT0A 1WPCA 3RILA 5G2HA 1NHQA 1GYNA 3ATZA 3ECQA 4NAEB 4TX9A 1MUCA 4L5ZA 5IDIA 4UZUA 2C6QA 1SSGA 3BH4A 1EX1A 4CU8A 2V5CA 3IIVA 3IV8A 1NIUA 3ARXA 5AHIA 3W7LA 3LXBA 1HX0A 4O1DA 3LBOA 2WHKA 4V15A 3MJYA 3DJGX 1QWGA 5MKGA 2VELA 3M5ZA 1P48A 1X1NA 5A8QA 4B9ZA 1JIBA 3H2AA 3W86A 5EBAA 1Y8BA 4AB4A 3WNKA 5A8NA 4KETA 1LWIA 1QNOA 4RJEA 4C6EA 3FDGA 2VFEA 3D3FA 3G1YA 1UR3M 1F3PA 2GDUA 4LRSA 2ZA1A 1XSIA 3TONA 3HA1A 1MO0A 1T96A 4CNUA 2QIWA 4C6QA 2Z1BA 2REQB 1GREA 2O0TA 1QWKA 2VXNA 3FV9A 3GVQA 5DBTA 4WR3A 4AWEA 1M1BA 3W27A 2Z27A 1FXPA 3GFZA 3ITGA 3L2LA 1VHCA 3CIWA 3FAWA 1MW3A 4H8UA 3EKGA 3IIZA 4QE1A 2GSJA 4TTUA 4DWSD 5FL0A 4M24A 4DM1A 3MHUA 3W82A 2XVKA 3UWEA 4ZQOA 5F4WA 1VZWA 2GLKA 1U1HA 3DAQA 3LHTA 3HMJG 3W85A 2WO5A 5JCNA 3O0HA 1S2WA 1NOUA 2MUCA 3W23A 4AZHA 4O57A 4ES4A 2V69A 1A5MC 2C14A 3VOFA 4J40A 2NSXA 3VAVA 2XZ7A 3AIVA 1JUEA 1TYTA 5ABGA 4MF4A 2VCCA 3HO8A 4ICCX 3WDRA 1M7JA 1VCFA 4RCXA 4L61A 1HO4A 4MB3A 4WK9A 4HGXA 2ZZ5A 2UY4A 1EGZA 2VGIA 3PULA 7XIMA 4DWSB 4IM4A 1F74A 3SCQA 4AEOA 4D9PA 3AMKA 4J7RA 1NU5A 1J5TA 2J27A 2EHHA 2O92A 4PYSA 3DFYA 1THFD 2FJUB 3AS0A 1D3CA 3W1NA 4FLSA 2HROA 4EXBA 4NXSA 2DJLA 1TYPA 4J4KA 1W6TA 2TODA 4YCPA 3QQ0A 3GG8A 2OODA 4UQEA 4IJBA 3UG8A 3SUUA 3LHWA 2WVTA 1CXFA 4LJ3A 3ZVIA 3QPEA 3BC9A 2XVLA 5F2MA 1K7XA 2VQUA 4MAVA 1BGGA 2Y6ZA 2C7FA 3QRHA 2PRLA 4UTIA 4DLFA 4V33A 3BURA 3KLJA 3CIXA 3G1HA 2HSAA 2D2JA 2GGJA 3APTA 4QISA 3H4GA 2QCLA 1EC8A 3BICA 3L5MA 3ZJ6A 4A2RA 2PDKA 4ACYA 3GHUA 1EA0A 4K6AA 4JTKA 1F6KA 1TPFA 1XLJA 3RDKA 4GA8A 3F4WA 3Q45A 3TZNA 5J5RA 4Q4RA 1TPH1 2BV9A 3RN6A 3CHFA 3ARRA 3C0JA 4YTUA 4AZGA 2DVUA 3MCMA 1Q6FA 3AZTA 3BO9A 2VD9A 2TRSA 3G6MA 2I56A 3WLHA 1SFLA 1BG9A 1VB9A 3N19B 4OTKA 4A3HA 1AMYA 2OSWA 3PWIA 2EQ8A 2X8HA 1PS9A 3HGRA 3K46A 4BI6A 1FH9A 3S46A 3I6RA 4M3PA 3BGGA 1WAWA 4C91A 3RFAA 4S3BA 3DGBA 3N2XA 1JZ8A 2F6UA 4AIOA 4PB5A 1JZ4A 1R30A 4MHBA 3ANYA 4EE9A 3E3HA 1RQEA 3TR9A 2R82A 4KRTA 1NY1A 2CESA 2EO7A 2QUUA 5FS7A 3PZGA 4C5YA 2HVOA 1TPUA 2QS8A 1JDAA 3UA3A 5AB3A 2V63A 3RLUA 3L23A 3FJ6A 1XRVA 3ERPA 1DE5A 3U5YA 5EBKA 2D20A 4AXNA 3HG4A 1FFVC 3HQNA 4LCQA 3B3DA 3K30A 1JF6A 3ELFA 1EWDA 2VNCA 3M46A 3HV9A 4B92A 3W1RA 5D32A 1K02A 1DV7A 5FF0A 4A22A 1ELSA 4QJ3B 3SAZA 1SU5A 1YW1A 3NQFA 2WZHA 3EX3A 4XVDA 1W2PA 4XTIA 5XIMA 1SSDA 3MB9A 3D46A 4P7OA 4C65A 1XRTA 1J0YA 1R9ZA 2V2DA 3DG6A 5CPNA 3WDJA 3KRBA 3TKFA 3TQKA 2YBVA 1J0KA 4W8AA 2YL9A 3B8WA 1J4EA 3CB8A 3B0VC 4XUGA 4K1GA 1LF1A 2GGGA 3B0XA 4AD0A 4HNUA 1XS2A 5KTLA 4X60A 3HG5A 2EKCA 3GFXA 1VP5A 1KRMA 4ATDA 4YS1A 3EKZA 1VQZA 1XUUA 3TJXA 4O53A 1TPVA 1GJUA 1I1XA 3TQPA 2OSXA 1GEHA 2Q6ZA 3GW0A 4DQWA 2WZIA 3ONCA 4DXXA 2FB2A 1HKWA 1SJCA 1B9BA 3GRTA 9XIAA 5DRIA 1JEZA 4L6HA 3STCA 3WF3A 3W2UA 3GR4A 3WD3A 3N12A 2BVTA 2J75A 1ME9A 4ZQPA 1MDLA 2A3EA 1Q4WA 3STPA 4DJDC 3KL3A 4GQ0A 3RR1A 2ZC1A 1W3IA 4PMUA 4BQ4A 3V18A 3B9EA 4A4AA 3EWWA 1UZ1A 1IT7A 4GIRA 2FHBA 2BGNE 3CZGA 4JKLA 2C16A 4FNTA 4MJMA 2RKXA 5BOOA 1RM6B 1TELA 4F3HA 3VCRA 4M51A 1XRSA 1MEWA 1Q6LA 4RZ4A 1MW2A 3U4AA 2BHYA 4LEFA 4URIA 1V7YA 1DWHM 1EYWA 1J0HA 3WQ6A 2NQLA 1HQTA 1QI5A 2PGWA 4ZSUA 4ZOEA 4HU0A 3W28A 4F0MA 4AY8A 4PCFA 1G9HA 1XPYA 3BW4A 1UMLA 2PB1A 3JZEA 3EZ4A 3QKZA 2OG9A 1PEZA 3I3DA 1XYZA 3MVIA 5I06A 1HF6A 4J1OA 1XQLA 4AC7C 3M5VA 3H2EA 4YHEA 4D6CA 1XG4A 1J6OA 3QEZA 1O68A 3M0IA 3VUPA 5GRTA 4LBSA 4FIQA 4I90A 4ORIA 3W7OA 4XAYA 4RR4A 3A64A 3GNNA 3UCQA 2XIQA 2D2HA 2ZZCA 4R7WA 4FF7A 5TF0A 2Z6IA 2ZVRA 4GMEA 3O7UA 3ES7A 3S9YA 2D0GA 5IBXA 4JDRA 5CH9A 1EB3A 1CZ1A 5CC7A 4UUIA 2OEJA 3GU1A 4JXCA 2YJQA 5DANA 3QQWA 3S6OA 3R7MA 1STZA 5D2WA 2FZDA 4B5XA 1OEPA 5KSWA 1XYBA 1EWEA 4FHAA 1W9XA 3E5PA 2HV5A 2ON3A 1SMAA 1RHCA 1N61C 1V08A 3R0DA 3REQB 3CV2A 5KZDA 4UR9A 4GE8A 4CQCA 4FEZA 4QNEA 4DUWA 4H4YA 3GDKA 4GRTA 4OT7A 1RQBA 3NZGA 2PPGA 1F07A 3VIIA 2ESCA 3ES8A 3MSRA 1WDQA 4IFKA 4RLIA 1F6PA 2F5ZA 2NX1A 4US6A 2FZBA 2CHOA 3KCJA 4LX4A 3ZZ1A 3L68A 2I16A 2P3EA 1KXTA 3BCFA 3BAWA 2OQHA 3SCPA 4DJEC 1DKWA 3QYQA 3ARQA 3HPZA 3U2EA 1GWJA 3WLRA 3GXDA 2E6FA 2CBUA 1WOAA 2XTKA 3QQ1A 2QJJA 1VQTA 3Q58A 4XSLA 4MWAA 4AVNA 1RD6A 4MNMA 4PMVA 1O95A 4GY1A 4LUIA 6REQA 4ZQCA 5EMJA 3AIUA 1NOFA 3L4UA 1B90A 2YVGA 4PSRA 4W89A 5J04A 1E6RA 6TAAA 3WLQA 1R5YA 2X1UA 3LSBA 2QUTA 3O2LA 5I3IA 4EPEC 1GETA 4GC3A 1E0TA 1LLOA 1X7FA 1IEWA 3M5YA 3E2SA 1FBAA 1ADDA 3BOFA 2PURA 4UCGA 5E6YA 1M3UA 4IMFA 1KM6A 3GFYA 1R3VA 2XGZA 4G56A 3N17A 1LROA 1LQ2A 2X1RA 3NPWA 3ZT7A 1X6NA 4YCOA 1A53A 1VFSA 3JS3A 1GZGA 1MRQA 3ABRA 1SM9A 5AHFA 4JCLA 1IT8A 5CSRA 2XSAA 2Y61A 2H3BA 1M01A 1HVXA 5HNUA 5AC6A 4B91A 3GUWA 2BB0A 2WQPA 4CEUC 3BLEA 1C93A 1UA3A 1UP2A 1BWCA 3W7CA 4WY0B 4YN5A 3FYYA 1XJBA 3BZGA 5LHFA 4B4FA 1Z8AA 1HL9A 5I78A 4PCPA 3V0TA 3N2CA 1J0IA 4AZ7A 1R6WA 2YL8A 2PP1A 2Q8XA 2V8ZA 1CX9A 5JBDA 2PWFA 2PTZA 3DHUA 5JMUA 1EFZA 2VRJA 5M03A 4FNPA 1MRAA 1L8NA 3VZZA 2OEMA 2YIHA 1ZJBA 3A4JA 3L4ZA 1QCWA 1WA3A 2D3LA 2R6OA 3B9NA 1T0OA 4QAWA 4AWSA 1U2YA 3NZQA 3BQ5A 4JEQA 2PAJA 1FCQA 4H4PA 1NDVA 1W3TA 4AF0A 3WLMA 3T40A 3VU2A 2HNEA 2P0OA 5J5DA 1X6UA 3SUVA 2TMDA 2PDYA 3OVRA 4WF7A 3H23A 1OGGA 2YX0A 1KGWA 1FWCC 3TK7A 4Z1DA 1C8XA 2CU0A 2ZBTA 4FXSA 2AAQA 5A6BA 6XIMA 1ISYA 3UG3A 2YZ5A 2DZBA 2C18A 3S5YA 3K5XA 3GXPA 2H9AA 3CL8A 4WSKA 4HZ8A 1H6VA 4PL1A 5A6MA 2CIPA 2OU4A 2J7EA 3IJLA 3N11A 3WCZA 1ZU8A 1V0LA 1RR2A 3RO6A 5DY2A 2YDRA 3LHVA 4Z2JA 3CQJA 1V02E 2OYMA 4Q4OA 2WPBA 5LIKX 5HR7A 5A6BD 4B3KA 4U3CA 3ZJ7A 5IOBA 3N14A 1OVDA 3ANUA 1CBGA 2YOCA 2EG6A 3T05A 4XWUA 1I4NA 1JPMA 4UFMA 4BEQA 1OGSA 4CQ9A 2J25A 3I4EA 4CD5A 2POZA 1UMYA 1YXYA 1TSIA 4HJFA 1UD6A 3UETA 1GPWA 3PBYA 1LM1A 1WDWA 4M82A 3WEMA 3OZYA 4O1FA 4IPPA 3R5EA 5RUBA 1SFJA 4C7FA 2F9RA 2FDMA 1F3XA 2FZMA 5BMWA 4YVVA 3UZJA 3DYOA 1KBIA 2W92A 1OM0A 4Z0SA 4MG4A 1ZY8A 4D72A 1CB7B 2CLIA 5GVJA 3TQVA 2AQVA 2EQ6A 1EJVC 1OFRA 4GXWA 7REQB 3ABOA 3TTSA 1VAHA 4S23A 1I75A 2OOFA 1UJPA 2KX9A 1HXJA 4TX6A 1MUWA 5GPRA 4YXGA 3G8EA 4KFPA 5I0DA 1GYMA 5LYRA 3BOLA 2CLLA 3IRSA 3VKJA 5ABFB 3N25A 1DXLA 2O9TA 2Y62A 1BPLB 3IIOA 1WKEA 4Y90A 4LEQA 2NT1A 1XRFA 2PDUA 3T0CA 3W38A 3LXCA 1V7AA 3LDVA 4EQXA 2J9ZA 3HB9A 4UOZA 1E72M 1QPQA 4HA0A 1RCOB 1NHRA 1KLYA 4IFOA 4HHMA 1LCOA 4KF1A 3E6EA 4K68A 1GKRA 1RD5A 3NZRA 3I4KA 5HQEA 3LQLA 6XIAA 1HG3A 4GIAA 4LYPA 1R47A 5LXEA 1GRHA 1XYMA 2A7PA 4HOXA 1B4EA 3C2RA 4NZ3A 3MSDA 4MFEA 2ZYFA 3RU6A 1XL9A 1CXEA 2O4MA 4LH8A 4JHOA 4XZIA 4UFHA 2V2CA 5DLCA 3VIOA 4C6OA 2PDNA 1O4UA 4JTUA 2EBNA 5AFDA 1A49A 3P2VA 4KT2A 3DBNA 1YPIA 3CGEA 5CC3A 4UBPC 1UKOA 3UA4A 4F79A 1ZP4A 4AQLA 2P76A 3CEUA 1WZLA 1MQRA 2OPJA 4X61A 3MDUA 3W72A 4HU3A 1H61A 5AYBA 4R7JA 3ORWA 3WNPA 5HNRA 3I6TA 5FA5A 1XGEA 3L4YA 1TMHA 2VP8A 5HOSA 3PZ9A 3G1DA 5DCEA 3DBPA 1EUAA 4OZOA 2WWDA 2WNWA 3AYVA 1SW0A 1E1CB 1J9YA 3DFQA 4HD5A 1BQCA 4L4MA 4Y9NA 2VDHA 1OG6A 3U5UA 3W6LA 1EUNA 1PYMA 2HK1A 3ZS4A 4M6UA 3TTOA 1OFBA 4H50A 2WPGA 3QW4B 4MIMA 3N3MA 1KR0A 2V2HA 1SO5A 3GC5A 3TJLA 3AXMA 1AUSL 1YBQA 3CUZA 3AIQA 4WLCA 3N1AA 4C1LA 5LGZA 1EHAA 1FECA 1FWFC 2CLEA 3KXQA 4BS0A 3SN0A 4FK9A 1V4YA 1JAEA 4XD6A 2VRQA 1BFNA 1Z6KA 3G2GA 1O7AA 3GXMA 4IIDA 1C8YA 2WOIA 1YMYA 4IOTA 1EBHA 4EAMA 3DHPA 4FR6A 2V3DA 3ZIZA 1N60C 1JXKA 3OBKA 1IEIA 1YBQB 1RSCA 3TYUA 1S2AA 3TMQA 2ZXDA 4ALDA 4RV3A 4XZWA 2PLKA 3GKAA 2QYGA 2YFNA 4O0KA 5BZAA 1XPGA 5EL1A 5C55A 2HE5A 3GVGA 1AQ0A 1RH9A 4I9AA 2PLMA 1TZ9A 4AHOA 3HGOA 1D8CA 1WDRA 2Y70A 2FLIA 3M7SA 4IIFA 3WFLA 3QZEA 4ZO9A 3P6LA 3BTNA 1Q1RA 1KV8A 1YQZA 1DPMA 1CTNA 4PC8A 2GSEA 1SGJA 5I3KA 3MHFA 3V5FA 2Q01A 2WHLA 2XYLA 1FQ0A 4K38A 4IISA 3QOMA 1GJPA 2ZRWA 1XFCA 3MY9A 3DI1A 3E2VA 3LCXA 5SWUA 4M6VA 5KINA 1OT1A 2WNNA 2WVSA 5BCAA 3L65A 1P6CA 2FKPA 2EQ9A 2XJ7A 3DHDA 3GU2A 1UH3A 3P93A 3BG5A 4LV9A 4KMQA 2Y8KA 1Z42A 3CZ8A 1A0DA 4LA1A 4ROQA 4ZFCA 2J8FA 3PNZA 3KDNA 4AZBA 1W1YA 4Z2HA 3UU0A 3VIJA 3PZUA 1EP1A 2OLAA 3ABZA 4DAIA 2O4QA 1FH8A 3NVTA 1VS1A 3F2BA 1EJUC 1GZ1A 1QI4A 3GR7A 2Z2BA 4N02A 2R1KA 3AWNA 1CCWB 4EMJA 1GTEA 2PRHA 1A5NC 1GV4A 4AX6A 5C6MA 4TV5A 3N04A 3P84A 3H26A 2GVGA 3ZR5A 3ME3A 1CGYA 4KWSA 4IZGA 3KHDA 3II4A 2D24A 4Z08A 1F3TA 1BWKA 4FSAA 3ZR4A 5TR3A 3Q94A 4AD2A 3V35A 1FHLA 1P0NA 1VBJA 4RE0A 4NEVA 4L9ZA 1PCWA 2WMIA 3UESA 3B8UA 2QDHA 4GUGA 1TWZA 3KHJA 1VLWA 3QPYA 1IE7C 1YTKA 1NEYA 4H6KA 3B9DA 4IG2B 4XBKA 5CSYA 5C8BB 5HQMA 4JBRA 5DXXA 1MWOA 3W1QA 3AROA 3AYSA 1LBMA 5CZSA 2XIOA 5BYWA 2ZX9A 1Q8JA 3CHVA 2AQWA 1GQKA 5EA9A 4GOAA 1I2OA 4H9UA 1BYDA 4JTDA 4F2TA 3SSZA 1R3TA 1RBAA 2YCEA 2ZZ3A 4DELA 4ZQRA 1R0MA 4JKMA 4KIRA 3G1FA 4OUEA 2W0UA 1ZDLA 3HGJA 4DM2A 4H7ZA 3STEA 4LB4A 1XCWA 3CL6A 2PC4A 3IIXA 3RNMA 4UTLA 1AJZA 1WYIA 1A5UA 3N6JA 1KFJA 3LK6A 4I8YA 2XFWA 2OZ3A 2DORA 3LTPA 3QGKC 4H00A 5BWFA 3H6OA 4PCSA 1GT8A 5HATA 4MJ2A 3IEBA 4NVTA 3LOTA 1F9CA 2QCEA 2JEPA 2O7QA 4ZGYA 1GOKA 2R9ZA 3VM5A 2E3ZA 3NO5A 5HUPA 1XR2A 3GAYA 3IS4A 4M8UA 3MYOA 3EA3A 3GHSA 5BOEA 5I3JA 3DEQA 3PJWA 3DGHA 1I6NA 4G1NA 3PG6A 3KS6A 2WQDA 4LY4A 2X1IA 3TUUA 5GNXA 3MSYA 3MSGA 3U2CA 3RMEA 1SQ7A 5EY5A 3T6CA 3C0SA 2B7NA 1FKXA 1LWHA 1EC7A 3GDLA 4G7FA 1RY0A 2JK2A 2BX7A 4O14A 2W63A 2VOMA 3KL0A 3B8VA 2ISFA 1KRAC 1ZL1A 3CUHA 4C60A 2E0PA 4Z1CA 1JCXA 1J12A 2WJFA 4D6HA 2SFPA 2PLCA 5AC7A 3SI9A 5AVNA 3AS2A 3GG0A 3QN3A 1W5QA 4H2HA 3M47A 5A69A 2B31A 1LOQA 2J7FA 1M65A 1QHOA 3VMPA 6TIMA 4B9YA 1OZQA 2GJPA 2WV8A 3ARYA 1DTNA 5MF5A 3AALA 1ENUA 1DQWA 1R2RA 3H2MA 4KEMA 2VCBA 3NUKA 4QR6A 3L4XA 4MPKA 2Y7FA 1NWTA 2NXIA 1M5WA 1CGXA 2BLEA 4DNMA 3ETRB 2WMIB 1YDNA 1BG4A 3S3GA 5TBOA 5G5HB 3AHYA 3T08A 2GR3A 1US2A 1UB3A 1XKJA 3EOOA 4OBRA 7PTDA 1R38A 1HL8A 1UROA 1H51A 1RBOB 1AQMA 4JGDA 2PDCA 1LL7A 3Q67A 3MW7A 3KBNA 2VMFA 4AG0A 2YVJA 3PBVA 4RE3A 4UQBA 2ZXBA 3AXKA 2H9AB 8CGTA 4MYAA 3R13A 3S1VA 4ZZ9A 5LIWX 3EPOA 2YR1A 1GVFA 2GGIA 4ZCWA 4Q32A 3B8DA 4LUSB 5D04C 1FWBC 3V3WA 2NUWA 4CLMA 1M7XA 2CZVA 3C2YA 1W3KA 1XCXA 3GYCA 4O1AA 3S9ZA 3TA9A 3O0FA 3ZVHA 4LVGA 3HBLA 1U83A 1VHNA 1U1JA 3UXKA 3KVKA 4GGBA 3GD6A 3TW6A 3LCLA 3N9SA 4WOZA 1I0DA 3RUBL 2FIQA 4GWEA 3OLEA 3LRKA 3KZSA 2QPXA 3DIPA 3PN8A 5D9MA 3S5NA 1J0ZA 2FFIA 3H2FA 1SMDA 2OLSA 4NHVA 4O16A 3PFMA 5D9NA 1W5MA 3N34A 4RV8A 1P1MA 2HE8A 3T4WA 4ZB2A 3MWAA 1W1IE 4PTNA 4S39A 1BXCA 3H53A 1RLDA 3PC0A 5CZTA 1OHLA 4R5EA 1P7TA 2BCPA 1KXHA 4O15A 4EPBC 2IW0A 3MV01 4O8RA 5I7GA 2GPTA 1K4GA 5A2AA 3VI2A 4MKVA 4NJJA 2IQ0A 3K1GA 3VOGA 1F8IA 4L4OA 4D1IA 4O54A 1GRGA 2ISSA 4UFJA 4M1RA 2GJLA 3T07A 5DFAA 4IH3A 1JZ7A 2QJIA 1UWUA 1UD4A 4S3KA 3LXDA 4P7LA 1PBGA 3S83A 4LC8A 1HKIA 1QW9A 3DC8A 2RJHA 4PBGA 3ABXA 1UD3A 4OHQA 4ADSA 4GQQA 2CPUA 2A8XA 3EWBX 1LRNA 1JF5A 5GJMA 3LRLA 1TWWA 4X9SA 1JJKA 1VPYA 1KXQA 4AYGA 1FHDA 1QPRA 1WB0A 4A3RA 3G0XA 4HYRA 1E1EA 5FS6A 3T0AA 4M7TA 2GK1B 1E15A 3WL1A 3CQKA 4KEZA 3AHVA 1ICQA 1HP4A 3WBEA 2OSYA 3GLCA 3VIKA 3NM1A 4EQWA 3N2MA 4Y8FA 2RABA 4EMWA 3BCJA 1F3WA 3OB8A 3WH7A 1DJQA 4W7UA 4K1WA 1XGZA 2A6LA 3WZ0E 2WBGA 3I6EA 4DZHA 4LW7A 1S46A 2PS2A 3CU2A 2W6RA 4DBEA 6REQB 1UW9A 1ZENA 3KW3A 4J3XA 3EKLA 1EF3A 3GZAA 3NQ7A 2F2HA 1GHRA 2NX9A 2ZQ0A 1A50A 3CYJA 4UQDA 4WEVX 3UVIA 3PF3A 4N9DA 1U5VA 1S3HA 1OIFA 3K8LA 1TR9A 4XZLX 5F4SA 4F0HA 3E2QA 5HINA 4FNQA 4NJHA 3LG3A 3W88A 1LOSA 4EF8A 2VM8A 1A80A 3G1SA 1TV7A 1EDQA 3L4TA 3CT2A 1DIDA 1OJXA 3BDKA 3U3HA 4NJIA 1T8QA 4Y9PA 3VKKA 1TWIA 1HGYA 4QLKA 4YIWA 2OELA 2WVUA 3PZVA 3MZNA 2VR5A 4AW7A 3W6YA 1GOWA 1FRBA 4X2PA 1JRBA 1R9YA 2Z1XA 4DO6A 1XYCA 4ERAA 1X6LA 4PRRA 4JR5A 2FTWA 2OYKA 3AAMA 2IKGA 3WDQA 3LPOA 3WH5A 4LALA 4DYEA 3IJ6A 1H7PA 3MI2A 5I07A 1XIIA 2BGSA 3B9JB 2AKMA 4E4PA 1OWQA 4WJEA 4IIGA 1IYXA 4LS0A 3L5AA 2CERA 3LZ3A 3UZXA 1UQZA 3QV8A 2PZNA 1LLZA 2OLHA 1E4LA 2IXUA 3FFSA 4PCNA 3TC6A 1BEUA 2GQWA 3RIKA 2WOQA 2CXGA 3LV5A 4NYYA 1OC5A 5C5YA 2WNZA 1DJXA 4IJCA 4E2VA 1TWDA 3EOEA 2I17A 2J6XA 3KWSA 4HSHA 4XZHA 5LNRA 4K8EA 4H41A 1EOMA 3H12A 4CN6A 1OX4A 3NDZA 1G67A 1LBLA 5DMYA 3FA4A 1JYXA 4ZOCA 1ISXA 3WSUA 2X30A 3AHTA 4IICA 1FO4A 3VDGA 4DZ5A 3WQDA 2NV1A 3NCOA 3W25A 2F8QA 2WOWA 1XYAA 2PDXA 3DFTA 2NQZA 1M7PA 1NQKA 3UY7A 5BXSA 3IWPA 7A3HA 1BRLB 7ODCA 3UCDA 2AKZA 4S3AA 4PTMA 2I5IA 4AZ6A 3A4WA 3PTQA 5CEWA 1VR6A 2D73A 5CGQA 2GWNA 5ABTA 3QV9A 3GNPA 1JGMA 3QFBA 3QC3A 4FNUA 2BG5A 3P0XA 4BQ2A 2Q02A 4MWAB 5KZMA 4HPHA 1ZALA 4FF5A 4GI8A 1HKVA 5U1OA 1PHWA 3TTQA 1FH7A 2XDFA 3VD9A 2IXVA 4G7EB 1VLIA 3F2DA 4Q8UA 4PUJA 1XLFA 5FF3A 1BWLA 5DT5A 1A5SA 1TJ0A 2OGYA 4X0VA 5DXYA 5C0QA 4MB4A 2XH4A 2OJPA 5E9AA 2J7GA 1GRTA 2X0YA 2HEJA 2I57A 3WDPP 2CFFA 4NSBA 4QCFA 4JN8A 4C5ZA 4WVXA 1KV5A 1TJPA 3I7RA 3SUSA 4R9OA 4HA4A 2Q71A 4O1EA 3P67A 4PE8A 2V38A 1ZXIC 3EMZA 3M0JA 3L4WA 5CPLA 4NNAA 1NHPA 2R91A 3QY8A 1PAMA 1OGBA 2W62A 3C2VA 3GS6A 3AJXA 4GYJA 3C3NA 4GBDA 2P10A 5DCBA 5GJPA 3EDKA 2BOGX 3VX0A 3W07A 2V30A 3CASA 4W9TA 3CHEA 2YA1A 4CNOA 3S0CA 4YU1A 3STFA 4F0KA 5CG0A 2DH3A 3G77A 3TFCA 5E0CA 5C9RA 2GQ8A 1EF2A 3EOUA 4DBDA 1A5OC 3NZ1A 2R8WA 2C0AA 3CUFA 3AXHA 4AY1A 3VKBA 1M04A 2FPVA 1X8FA 1XM3A 2C71A 2RFGA 4IQJA 1V6UA 3E2RA 1I60A 2NWSA 1CGUA 3N9RA 1TUXA 4GUJA 2CWNA 4I7UA 4C6BA 1Q3NA 1DJHA 4DRSA 3QBUA 5G4WA 2E6AA 1J6PA 4KS0A 3RLVA 1JPDX 3OG2A 2OGJA 3NZPA 3A7UA 3H4KA 1JPKA 3MUCA 1GOIA 4M5PA 3ITYA 3PB0A 4KH2A 4H3DA 2PD5A 3TOYA 3IRDA 4E2BA 1HL2A 2Y1HA 3TVAA 3PVFA 4Z1BA 1G4TA 3GNRA 3M0XA 3W81A 2DZWA 1P0DA 4GZ7A 2A3CA 1GQLA 3WMCA 3PS7A 1W5PA 5G2WA 3CPGA 1MZHA 4ZXOA 1RLCL 4GZEA 1E0WA 1QNRA 3ZSSA 4TMBA 1VPQA 1IZJA 1R2SA 4NL1A 4F0RA 2VC9A 3DH9A 3B03A 2HJPA 2Z0IA 2ZZ6A 4U28A 1HP5A 5I24A 1LTDA 3TYBA 3B97A 4CUCA 4P7RA 3CV1A 4UQ9A 3NVZB 3DFPA 4IG2A 3LX9A 4N7QA 1TB3A 3C6CA 2XFYA 4GUHA 3NWRA 3ZMRA 3D3AA 2Z4GA 4MYXA 5ENLA 2GRTA 4F4RA 3QSRA 3M0VA 3WNOA 1G1YA 4A8RA 2B7PA 1TX0A 4HHPA 2WHJA 4LBRA 2YVFA 2JK6A 1NWSA 1LL6A 1YX1A 4AEEA 5JIPA 4E6MA 3QR1A 1VIZA 1A4LA 3ID7A 3KVJA 5HMFA 3TYAA 1JRPA 2CC0A 3WBWA 2DT1A 2XGIA 1PKMA 4JFUA 3GTNA 1GG0A 2DW6A 1GTHA 1V59A 3UJSA 1WXJA 3B4YA 4TV6A 4MWAD 1FCUA 3WLTA 1DTUA 3D47A 1B3OA 3F2CA 1UD5A 3S2JA 3T0DA 2NQHA 1CW2A 1JOAA 4LUYA 3V1PA 1YXCA 1JDFA 3MU7A 4PMZA 2GVJA 4Q8OA 3W7HA 1JCNA 4M56A 4AIBA 2GUYA 2V6AA 1VDVA 1W3JA 1UIOA 4B90A 1WZAA 2NXGA 1OK6A 4Y9AA 5CXPA 3NL6A 3ZT6A 1HJQA 4HSOA 3CV6A 3H4WA 5JU6A 3FVDA 2G50A 1XDIA 1MXSA 4HOWA 4F9JA 4RDZA 3KBVA 1ZAJA 4DNAA 3CM4A 5LNWA 1GOOA 1VFTA 3FKKA 4D8LA 3BSMA 4EX4A 1UWAA 4PTXA 2QR6A 3JU2A 3NQ6A 1A47A 3MP3A 2NSOA 4ACZA 4GABA 1RA0A 1M6IA 3ZLGA 4AZCA 2OOGA 3H22A 2QUMA 3O1NA 1PX8A 1XDLA 3EUB3 5B7ZA 4QDPA 5D03A 4ZOHB 1S5NA 5T9CE 5FAGA 2J4GA 3EDDA 3TQ0A 5BNKA 2V3EA 1ICPA 1EGMA 3KFTA 3T2PA 2YB4A 2XN0A 3WELA 3NQVA 1FX6A 2HZGA 2P0IA 1UWIA 3GW3A 2E6DA 1I45A 2F38A 3PZTA 5D33A 4P8UA 2A5HA 3SJNA 3P5YA 3QR0A 2WCSA 5LIUX 1WCGA 3FDKA 3OZPA 4LYRA 1DQUA 3VNYA 1YTEA 4AWTA 3LUTA 4UXDA 1AL8A 2V68A 4JICA 2WC7A 3PZIA 4R85A 1E6NA 2D0HA 4AF0B 4CD6A 4APNA 1DORA 3HU7A 4UOQA 3IACA 3K4WA 4M7SA 1JUBA 3B8TA 3DGZA 3NQBA 1N8IA 5E09A 1EO7A 4Q4QA 3R8GA 4ZO8A 1XIMA 3CBWA 2H90A 1H1NA 4I5UA 5T9BG 4Q6JA 4CD8A 4CCDA 2GGEA 1JPIA 4U4MA 4WDTA 4ZOAA 1EJRC 3TJ4A 2VFHA 4DLMA 1NWUA 3W26A 4IHCA 4QQUA 3RG6A 4HZMA 4ML4A 1A3HA 3NIYA 4GRSA 4XZMX 2VX7A 5TNVA 3W76A 4IIBA 2C19A 2RDUA 1FFUC 5C70A 3KWXA 2CWXA 2D2GA 5LIYX 1WZMA 1EP3A 1L6WA 4DPPA 1MEHA 1GCYA 1RP9A 1XQKA 3FEQA 2PU0A 1TKKA 4OJYA 3TMLA 2PZ0A 3IIPA 2XM2A 1B3YA 3I3EA 5CBIA 3A6OA 3PBWA 3CZEA 2HDJA 1ZUAX 1H41A 4X63A 3VNJA 1FVPA 3EWDA 1OFDA 3VGHA 4UCFA 5KVHA 3CMGA 4W8BA 2RH9A 1JXJA 3W7RA 1A0EA 5LA2A 3ICJA 3HGSA 4UMCA 1UBSA 1R7OA 4IGNA 1UP3A 5HXMA 3WQEA 1XKYA 1GUVA 1X1OA 3ITXA 4HZ6A 4MMWA 3ARSA 5CPQA 3FX4A 2G41A 3CXOA 1YYAA 3CMJA 4R27A 3AUJA 4QP0A 3P81A 4WZHA 1R3YA 4H9YA 3PWGA 5H8UA 3LCHA 3TJIA 3WF4A 4F2BA 1E6SM 4AEFA 4HCLA 5AZ1A 5AC4A 2JKEA 1K3UA 1UWSA 1F8MA 1FUYA 3AYRA 4OQVA 2Y7DA 3QMTA 1RJQA 3QY7A 2FHFA 2CBJA 3CQIA 1DWGM 3DYPA 3W2MA 3VXGA 3OTRA 1E56A 2PTWA 4HZ7A 1XLIA 4BEUA 3FHAA 3UWYA 4D6DA 2ZZ7A 5BRBA 4IIHA 5A6LA 1F4AA 3GQYA 2VUYA 4D6JA 3FJLA 3W29A 4B2DA 3FOKA 1FHUA 1GXFA 4P7NA 1VH7A 2CBIA 1YHTA 4OBSA 3LTYA 1FKWA 4NIRA 3PR2A 3RJYA 2YFOA 2I14A 5A94A 2X42A 1XDJA 4WGHA 4WDUA 2QF7A 1XLKA 3EX4A 4N6EA 4EKJA 1DWJM 1XLDA 1DVJA 3R11A 2KAUC 2VTFA 3KP0A 2QDGA 3R8HA 3SCRA 3UWWA 2ZUSA 4KPLA 1C7TA 1PIIA 3QHMA 1MW0A 3TXVA 1OJTA 1N5WC 4PULA 4RDWA 3EWYA 2C13A 1UPPA 4X9YA 3HJZA 1FWSA 1ZBCA 3A12A 4R9XA 3UXLA 4UFLA 1O1ZA 4H4RA 4MKSA 1HFBA 1SO6A 3WUBA 1OYBA 5JVLA 1AQFA 4K7YA 1XD1A 4KQNA 2YLAA 3P82A 5HA7A 4LAUA 2DZAA 4FB7A 4BI5A 1PZ3A 1TIMA 2W79A 3GTFA 3A4AA 3CAWA 3BANA 5FJTA 1XP3A 4TVYA 3C8NA 3UGRA 3ALGA 1K4HA 1M53A 3WD1A 3U48A 4NRSA 2CLKA 3KLKA 4FS9A 5JCLA 3QGVA 2C3CA 3H2NA 4WXZA 3GO2A 3LXAA 1GORA 4HA3A 4Z2GA 2PWDA 3PTDA 2YAUA 3VKDA 4AC1X 1QW7A 1EQCA 1UWRA 4NILA 4H7VA 3GD3A 3BPWA 3QM3A 3GNOA 2PODA 1WYGA 2GUUA 3CUIA 5EMYA 2A0NA 1GHSA 4MAZA 2HS8A 4G1KA 4BR1A 1IIGA 4NP7A 3UFYA 3S42A 2JEQA 4XK2A 2QAFA 4IFRA 1GEUA 3UR8A 2D69A 4BQ5A 2GDVA 1KNWA 1DJYA 2ABBA 3DUGA 2ISDA 2PBGA 1LG2A 2ZZ2A 4DPQA 1DJIA 1JCTA 4LNYA 3WQVA 4U31A 3TDFA 1B31A 4DN1A 3NXLA 2ZVIA 2DIKA 4JTLA 3DECA 4YYFA 3E0WA 1OQFA 5FJJA 4J27A 3S1GA 4ZB5A 6ALDA 1O5KA 3RAOA 1EJTC 2NQJA 3UZZA 2GR2A 1EPXA 3PWAA 5M17A 3CWOX 3V1HA 1XANA 1HJWA 1L6GA 2P1FA 3LYEA 1TTJA 5CGTA 1FFQA 1M68A 2QKFA 3I7QA 4O0ZA 1OD0A 4US5D 3DFNA 3I68A 5CZ0A 3MP4A 1B4KA 2OZ8A 2D23A 3IUHA 2XFFA 4HB7A 3IGUA 3TN5A 3UG5A 1TJRA 5JBEA 3VNIA 3BAXA 3OYXA 3PZNA 4PZVA 1G7UA 1W1ZA 4IPIA 4XAPA 2NVDA 4P5UA 2L5HA 3W7NA 3THDA 2W55A 1ONRA 1XDMA 1FFRA 3TC3A 4GI4A 4NRRA 2CZ5A 3GSMA 3EWZA 3WYZA 2PF0A 2Q3OA 4MNLA 1CPUA 4DZAA 2J66A 4PMOA 4AUBA 3FSTA 2INEA 1KFEA 5JXQA 1EIXA 2F84A 5DMMA 3T9PA 4ADTA 1X97A 3KOXA 3W1MA 3EEGA 3G1VA 3M6DA 4IQDA 2VGBA 1UR0A 3BMWA 1RVGA 4OFCA 2XIJA 4TTGA 4FXJA 1NDWA 4EAYA 2PWUA 3L2MA 4F0LA 1HUVA 4C6NA 1BXNA 3GHTA 1PVNA 2FQIA 4CN4A 9RUBA 2ZXQA 1SFSA 2EAWA 1OF8A 3UR5A 1FTXA 2EEXA 4S3EA 4QS5A 1F73A 4GIEA 3CLWA 3ZJKA 3GH5A 1GONA 1G0CA 3BAYA 4HNCA 2ZRUA 5H6HA 1SJDA 3IK4A 3C8FA 4AAJA 4C6LA 5JRBA 2PDQA 1TV3A 4P8WA 2W61A 3WEZA 3VMOA 1N63C 1K9EA 4KESA 4TXEA 1X2HA 1QHPA 3UEQA 2G97A 5F4XA 4Z1YA 1EO5A 5G5GB 4NZ5A 4GCAA 3PHAA 1LZOA 3ZWSA 4RE2A 1W1B1 4JQAA 4QLLA 4GCXA 1Z7AA 4AD1A 4C7GA 1JL8A 4KIEA 4DF1A 3MKKA 1Q2RA 4G6CA 4AHPA 3GTIA 1YE4A 2GVYA 2I5GA 4GJ1A 3UVAA 3TYDA 3W02A 1NWRA 4PB3A 2TYSA 1K8XA 1PL9A 2BWGA 2PEVA 3FGCB 2E25A 3QTPA 3OBEA 4Y9OA 5HK4A 2NPXA 3WLLA 1S2TA 4CNPA 2XUCA 3LHUA 3VGEA 4NAEA 4EPDC 1WOBA 1K6AA 4MGGA 4P8VA 1YIXA 4FX9A 5T91A 5CBBA 3TSMA 4KCTA 2VHLA 1CGTA 5BROA 3EPNA 4MTVA 1AJ0A 1P1XA 3VO0A 2XU2A 1JPHA 3BXWA 3S5OA 4PMDA 1R87A 2X40A 4HMCA 5CBJA 4EP8C 2W3SA 4CQDA 1Z9AA 2WKJA 5C9XA 3QYSA 1BGAA 1T6MA 1TPDA 2OWWA 1C8QA 1C9WA 3KTSA 4W8LA 2WHMA 2HVMA 3H21A 3BARA 5A2CA 2REQA 1UH4A 4W7VA 2A3BA 3C0LA 1FWNA 2WMJA 1DP0A 3HPSA 2WBKA 4H04A 3R43A 2ZTJA 2EPLX 1HJXA 4AY7A 3DC0A 7TAAA 2VURA 4XD3A 3SIMA 3EANA 3H2OA 4DUVA 4KFNA 2EGZA 1IZCA 3L2IA 1TV4A 4D6FA 4GYFA 2BOEX 3ARPA 4CQ8A 1OCBA 2ZTKA 4HJWA 4RX0A 2J9YA 4JTSA 1GRAA 1XGDA 4CU6A 5D9PA 3WDIA 1ICSA 2X1SA 2I5QA 2R9RA 3U2OA 4H4WA 2V5KA 3OYZA 3RF9A 1F7BA 3VGBA 1NELA 2GK1A 4YHGA 4WKFA 2QCFA 3A47A 4A3QA 1K1DA 3B05A 4HKPA 2PCEA 3AISA 4TR9A 1C7SA 3TROA 3W3OA 2BZNA 3CUXA 1VKFA 1ITUA 2NT0A 3EDJA 2Y89A 1S7MA 1QMLA 3RMJA 4KBXA 4JCMA 2CEQA 1DXEA 4V1XA 3CGTA 5J8LA 1E6ZA 4GVIA 2YCLA 1XISA 1BYAA 2QCGA 3OG3A 4TQTA 4S1FA 5A6TC 5FEWA 4Q3MA 2P50A 2V9DA 4H4ZA 3L8KA 4GKLA 1SJAA 1REQB 1MI3A 1IXOA 4MB1A 1EC9A 4XBSA 3JVAA 2PFHA 3M4HA 1AOGA 4OV9A 3UY8A 5KZ6A 3LERA 3VGGA 3W7IA 2VQTA 4J2MA 3LQGA 4XIMA 2C91A 4WHBA 4AMCA 2QAPA 2HNHA 1GOXA 3D5HA 3O16A 3WJZA 4C1NB 2VDIA 5I00A 4BKNA 5G4EA 4NZFA 2WVVA 3OW1A 1CWYA 4NI8A 4UFKA 2X05A 1PKLA 2DSZA 2ISVA 3KEHA 1W5OA 3MVTA 4FNRA 3WN6A 1SZFA 4HK7A 1VC4A 4H19A 3G6LA 4QG6A 3MI6A 3QFEA 3WK1A 3UW6A 4EQSA 1R9XA 2A7RA 3ITTA 3TZFA 3QY6A 1W91A 1KCLA 2H3DA 2WMKA 3MMDA 1VRDA 1Z32X 5FMHA 3GBDA 4AFYA 4UTJA 3VFLA 4L6OA 1OFAA 2PDMA 5FL1A 1CGVA 5F1VA 5H1WA 3WLNA 1W9UA 1JG9A 4P7QA 3GXIA 4JYFA 3P3BA 5F1UA 2WJDA 5AC8A 4S2BA 4A8IA 1SYTA 2RHGA 2AMXA 1XIBA 3DI0A 4E8GA 1B9ZA 1QXLA 3NL5A 1Q4NX 4NQ1A 2Q3RA 1BHGA 3AO0A 3GK0A 2PDFA 4H2CA 1A5AA 4WKHA 5AC5A 1FWDC 4IMAA 1IIHA 3E5BA 2Y4SA 4ERIA 3RO8A 1JUKA 3SM0A 4LXFA 1K4QA 3HJEA 5LA1A 2GJXB 1PTAA 3TOPA 2IPJA 1DJNA 3EX1A 4J3TA 3QZ6A 2Z1SA 4JL1A 5HBFA 5CSUA 4H6EA 1UKSA 4LBUA 4HCDA 3ITLA 5F7UA 4DI8A 3FK4A 1BKHA 3NGJA 3SEPA 3R07C 2PLJA 3WNNA 1U33A 3RYSA 2PDPA 1KRCC 1K8ZA 2ACRA 2DPEA 4XUYA 1ZJAA 2VZTA 5A95A 2KZHA 3CB3A 4J3SA 1H5VA 1C91A 5EU9A 1Q1WA 2QZRA 5I79A 4PSPA 3MPGA 2BFGA 1O66A 3TCEA 2GOUA 2QF8A 2J47A 2Z7KA 2E28A 2ZRYA 4L64A 3UYCA 2XVNA 4U2YA 2BODX 4FLQA 5G5IA 3A9BA 4QTGA 2BY2A 1DOSA 3J7HA 3DKLA 3LV6A 3CL7A 4MKNA 1S5TA 3RNDA 4K3ZA 3O6AA 3M7WA 3SGUA 2PUZA 3CPUA 3GXTA 4WY0A 2QV4A 2PD9A 2WNQA 1AD1A 4MOZA 4Y6GA 4QSHA 1I0BA 2ADAA 4QX4A 2HXTA 1ZJIA 1L8PA 3GZ3A 5LNSA 3A21A 4MZ1A 4ONVA 1K7FA 2V81A 3W1XA 1VBGA 4AIEA 4KWUA 4DWSA 1DJWA 5I23A 4HYVA 3EPMA 4LUTA 4IMDA 3SGGA 3BW2A 4XO7A 3IJDA 2Q8ZA 2W9MA 3CO8A 4FX8A 1W9DM 3GVWA 2F61A 4H4UA 5EB8A 4B5WA 5HPCA 1J18A 2ATMA 3SY1A 2DT2A 2PRMA 3P5ZA 4V27A 4QLJA 2Y5EA 5FI8A 1HKMA 2BGQA 4MADA 4S3DA 4HN4A 1YE6A 1TPB1 5C2XA 4I5XA 4PL2A 2XZ9A 3LHZA 4JHZA 2QHAA 2NUXA 1E73M 4H9ZA 4AVOA 2D2OA 1K9TA 3UD6A 2WP6A 4EXQA 3HW2A 5JQ9A 1TJ2A 1PCKA 2ZUUA 3N29A 3N9KA 1UR4A 3PB2A 4GISA 4OU1A 5K2ZA 5JCKA 1XYLA 1GEQA 5D30A 4XO6A 5EMMA 2YKKA 1GRFA 3DK8A 5ABFA 3NSXA 4DUOA 2IQDA 4XVEA 3A23A 3DG3A 4NASA 4EPKA 2WPCA 1GVOA 4R7OA 2GJXA 1H3GA 4G8TA 3HF3A 2XIMA 2C1IA 2XISA 4GJIA 4GINA 1Z3NA 1JNDA 3VC5A 5GNYA 3FNDA 4HTYA 2RAGA 4LAOA 3KP1A 3ITOA 1T7LA 1ODZA 1W1VA 5FKYA 2BVYA 2XHYA 4DF0A 2HS6A 2OO0A 1R3SA 1KA9F 2YXXA 4HNVA 1NARA 3WG6A 4L7ZA 4ATWA 3EXSA 3KTCA 5KITA 3I65A 4PUEA 2CCRA 1AH0A 2BHZA 4RZ5A 5I3GA 4J3UA 4HQVA 2FMOA 4UTFA 1CXLA 2FGZA 4NF7A 5AVHA 2XFRA 2WJZA 3PUEA 2ODOA 3KOZA 2VOTA 2CFYA 1JYVA 4PTDA 5IRPA 3L0NA 2YA0A 1I2PA 1P0KA 2R94A 4REQB 3SRKA 1GW9A 4RZ6A 2QUNA 3TTYA 4YTRA 1LBFA 4JN6A 4QS6A 3LRMA 2YL6A 1X39A 2D3NA 1V97A 1XSKA 4WXYA 1VBHA 2PTYA 3APGA 1G4PA 2OB3A 3R0UA 1FXQA 3WLSA 3RLGA 2AGKA 3WUEA 4LQ1A 3B06A 4RDYA 1GGOA 4GYPC 1US0A 2PCQA 1V6TA 3I3BA 2FZNA 1QDSA 2C1GA 4X3ZA 2CYGA 1TE6A 3HMCA 1HGWA 3IC9A 4W93A 3Q65A 4HCHA 3OA3A 1VYSX 4BF5A 1X7IA 4C6DA 4E5TA 2GQ9A 3WQFA 4WRHA 3NVYB 4JIPA 1R85A 3MV11 4MZYA 3EDFA 4JAWA 4BFAA 1H0IA 3MWCA 3W7MA 2YLLA 3RITA 5K9CA 5DMLA 1GJWA 1VPXA 5IFPA 2CDUA 4Q7IA 1QK2A 1J79A 2EF9A 4ZMGA 1VF8A 2WP5A 1NP2A 2YYUA 1IR1A 4R53A 1EZWA 1SW3A 2GL5A 1EXPA 2J77A 2A6NA 3PFRA 4NT0A 4DYJA 3NEHA 3WDHA 4ZA0A 3RXZA 4IGHA 1GVIA 2X8GA 4JNYA 5I09A 4CVWA 2UBPC 2NVAA 3M9YA 1UASA 5U7SA 1H50A 4Y2WA 3I10A 4MUZA 1UZ4A 3GDMA 1CDGA 4GY7A 1SZNA 2QDDA 3VGDA 2C3DA 5FEZA 3TC7A 2WWCA 4DJDD 1RCXB 2VEMA 4GK8A 3RPMA 3FLUA 3B8SA 3GU9A 2JIWA 5FCZA 2X0SA 4M81A 3TWAA 5AECA 3NDYA 4W87A 2VEIA 1FWHC 1NM9A 1HNYA 1I1WA 5HJYA 3H4XA 6CGTA 3CT7A 2FDSA 3VE7A 3K4AA 1VENA 3M0HA 1RAKA 1HW6A 4L1WA 5CZJA 4KEVA 2XSBA 3GB6A 5IDZA 1ONXA 2IS7A 3B0YA 3LBCA 2HBXA 4JTRA 4KGJA 1G7VA 4UR7A 3N6QA 1XLHA 3SQPA 3P61A 4GI9A 4LF1A 5D05A 2Z2UA 4IGMA 4U33A 4LCSA 4H4SA 1OFQA 3EEZA 2PA6A 3QMRA 4DIAA 1P0EA 2W4XA 1SZRA 4REQA 3WQGA 3A3XA 2O9PA 5XIAA 1C90A 1A5CA 3O15A 2E7FA 1QNSA 1V6YA 2PP3A 2YDQA 3IGHX 3SUWA 2ZX7A 3NURA 1DL3A 2X16A 2ALRA 1G01A 2VKZG 1IXNA 4Z2LA 1CXHA 3KBSA 2YDSA 3GBEA 5LNVA 2OX1A 5ABEA 1P6BA 3EMCA 1O5XA 4S3FA 3WFZA 1F3EA 2V82A 1UIPA 1N82A 1T8XA 4H8HA 3BLOA 4LYKA 3L67A 3VA8A 2J79A 2LLEA 5CZKA 1JYWA 1CGWA 1AODA 4GC4A 3VNZA 3MUXA 3FEMA 4LV4A 1YXDA 2NVCA 2YDAA 3F5JA 4XD5A 4XZ9A 5CG7A 2OT1A 1F05A 3SUTA 1RK6A 4N4QA 3R94A 3LPGA 2CLHA 3C61A 4FP1A 5C71A 2X2GA 2ZC8A 1BF6A 2GR0A 2FFCA 2VFDA 4B15A 4N6FA 4AVFA 2OFJA 2BXYA 2J24A 3P60A 1AJ2A 2YGYA 3RX4A 1TQJA 4JTTA 2V5LA 2GSHA 3GH7A 4PTVA 5CLTA 3ZOAA 4N2YA 1GG1A 4K8DA 1BQGA 1IGWA 3E38A 3EA1A 2YB1A 5E70A 3YPIA 1YNYA 4KPRA 4IT1A 3M43A 3RX3A 1NPXA 2V3FA 4F2UA 3UZ5A 5A8OA 2UZ9A 4HP5A 3VABA 3DK9A 3WQ5A 2B0MA 3PBUA 3FGCA 4UZSA 4ZR8A 2QXWA 2YL5A 4BWLC 2JF7A 1G4EA 2FMNA 2ZUNA 4J5NA 3VDBA 3PJUA 4G2DA 5CJ5A 1RP8A 2DV0A 2IKIA 4P61A 1PB0A 2EQDA 5FSDC 1RJPA 1W9VA 3OOQA 1TCDA 2NWRA 3UPMA 4ENLA 1TZ7A 3R12A 4O4VA 4KEUA 1L9WA 1XH0A 1CXIA 3JUGA 2PGFA 4RXFA 4PB4A 2Y63A 4B5TA 1OBAA 5DEZA 5M1TA 1D3GA 2CLMA 1TE1A 3QLLA 2PE4A 1K9FA 2OKTA 2RGMA 3W1PA 4OIFA 2YZRA 1L6YA 1WKDA 3RRAA 3TW7A 3KOFA 3NPVA 1IWPA 6A3HA 3F7JA 1K8CA 4PA8A 2VC6A 4R33A 1EJSC 1UR2A 1H5YA 2ACQA 3NL2A 4EQRA 4ZXLA 1EEPA 2VRKA 3CEPA 1IV8A 4K7VA 4V2XA 5KETA 2P8BA 3MZ2A 3AU6A 1GKQA 2WM1A 4MJZA 3SY8A 1KM2A 1W32A 5KMYA 3WL0A 4GBUA 2CHNA 3L5LA 4L9YA 4PMYA 2OVLA 1VBRA 2C8NA 3TSDA 3GIPA 4QJ4B 3OJGA 5D8WA 4FA3A 1Y0EA 3V5OA 4J3ZA 4XV0A 4FDCB 3AIBA 3LHYA 3A24A 1RBLA 2DY3A 2AMGA 1KM1A 3RX2A 4D2JA 1P4CA 4PCTA 3T44A 3QKEA 4IQEA 3N4EA 3OBAA 1L0PA 2V0TA 2FTYA 2OKOA 4BK9A 3WENA 9XIMA 4XKMA 5ABHA 5A5WA 4KW2A 3M07A 3L9CA 4ZSTA 1A5LC 3ZR6A 5BXTA 3GTXA 1Y5VA 4M80A 1J11A 2PSNA 3AIEA 1E55A 3E49A 4TX8A 2VC5A 3E0IA 3S9IA 1U30A 2CZEA 1TV2A 5AY7A 3W0KA 1RVKA 3WH9A 2XGBA 3DX5A 1D9EA 1NH6A 1PTGA 4A3YA 3S2MA 1OCJA 4S3JA 4E3VA 2J78A 5LA0A 1E3ZA 4GD0A 1GVQA 2J13A 4ILSA 4FR1A 1AD4A 1XWYA 1BLIA 4JY9A 1ZGDA 1JAKA 3SW6A 4HOZA 3K4DA 1K70A 1A3XA 1TMQA 2PWGA 4JQ3A 1JQXA 2HPIA 2JBMA 3VD4A 1FCVA 1GRBA 5K4ZA 3IJ7A 3KVMA 3BCDA 4ICMA 2DSUA 1F2JA 4EIVA 4YWSA 5LIXX 3ZJ8A 1UP0A 4PGLA 4TO8A 2DGAA 3U8GA 4FLRA 2VEFA 4GFIA 3DENA 3TWBA 4QDWA 1LUCB 1S39A 5DELA 4FALA 1GQNA 1EXBA 4NJGA 3UQNA 1IT0A 5F2IA 3LEPA 3VIGA 3HFTA 1KQZA 1TTIA 1M41A 1J01A 2CNCA 4F9DA 3VPLA 1GW1A 3UWVA 3G3MA 4QRNA 4IMGA 4N9CA 3EB4A 3TTEA 4H4IA 2HRWA 3MS8A 5TAOA 1Q7QA 3MI3A 1W1TA 2E9BA 5LZLA 3A5VA 3IAQA 1BD0A 2DQWA 3AUOA 2X09A 1RPXA 3MUY1 3PG9A 3NGFA 2J7HA 1NHSA 2IPFA 3GWQA 5AZ0A 4L56A 4Q33A 2CW6A 3WQ4A 1DJZA 2X7VA 4JIQA 2OYLA 4A05A 4CNTA 4S3CA 4NX0A 3CAQA 3R58A 1FOBA 1EL3A 2BP1A 4PBEA 4ZTYA 1E4IA 5C2CA 2HTMA 2ZIDA 3HTWA 3S6DA 1Q5MA 3EDEA 4WY0F 2ONEA 1W17A 1H63A 1R2TA 2Z1KA 2WYSA 1O60A 3B40A 4OVXA 2GQAA 3C52A 3QHNA 1CLKA 1OK4A 1A5BA 5EMLA 3D9XA 4GHRA 3BAIA 7TIMA 1XBXA 1ZHAA 2BSLA 2QQ6A 3EOSA 4IJRA 1ZP3A 4JQ1A 3AWOA 3PJTA 3SQLA 4HNOA 3WQ8A 3CC1A 2BHUA 3CUJA 4GIYA 2VFFA 1LP6A 2ZZ1A 1X2GA 1KKRA 3QLDA 1O12A 2XG9A 3ZM8A 4I9TA 4Y96A 4MY1A 4X0NA 4Y8EA 4DBSA 3SCVA 2A21A 2PF8A 3NSNA 3JRKA 1JGIA 1PE1A 2QLYA 4C6PA 4U2ZA 3V75A 3W1LA 3THQA 4O8AA 3CWHA 1C9DA 4GYPA 2WSQA 2UV8G 1ZRQA 3RCMA 4AH7A 3LS9A 4HNTA 3WD0A 1KFWA 3WJSA 2XIBA 1K77A 4D6EA 1UYQA 2C15A 1AK5A 3GD4A 4DEFA 5LSMA 1TJ1A 1I9CB 2BY0A 1LVLA 3IJIA 4US5A 2ATSA 3C0QA 2CLFA 3O8AA 1OT2A 5D02A 4ZQMA 3WEOA 3LLFA 3PAOA 1WNOA 2PI6A 8XIAA 4IIEA 2YSWA 3HN3A 3LMZA 4WJ8A 4IXXA 3L4VA 5BRPA 1N8FA 5BOFA 2XN2A 3LENA 2PMQA 2G4FA 1JZ2A 3HRDC 3ISIX 5CKSA 1KW1A 1F61A 1PO9A 1TIWA 1WP6A 3KE0A 1QOQA 1X98A 2IQTA 3JW7A 1IHIA 5D9OA 4ICNA 4YTQA 3CQ0A 4IP5A 1Q7MA 3PAJA 1ZMDA 1LUCA 1BVZA 1PIFA 3V7PA 4UTHA 3QSTA 4CU7A 3P7YA 3T4CA 2ZDRA 2G8ZA 4H9TA 1RPKA 3OEXA 1UOZA 3VNMA 4E0CA 4J35A 1QU4A 1OCNA 3M16A 1OADA 2X50A 3FW6A 3UGVA 3PBMA 3NVWB 1WBJA 1UKTA 3EMQA 3AS1A 2VC7A 1TO3A 3MC5A 2H8ZA 2YPIA 3QFAA 4LAKA 3RHGA 3STGA 1Q13A 2WXDM 3AMLA 5HDRA 3AZRA 3NQCA 4JY8A 1EX5A 4GH3A 1JCLA 2RJGA 3TU9A 2RDTA 4LAZA 4FMVA 2YQUA 2H8XA 1NDZA 3EAUA 4UTMA 5EMKA 4E4FA 2FJKA 4MDOA 1QNVA 3IJ9A 3USBA 3S47A 2ZICA 2FGLA 2DUAA 1Q45A 2CBVA 1H7OA 4Q4MA 5E6ZA 3IPWA 5D38A 4GZIA 5EFFA 4RKAA 3WD2A 1XLGA 1DYSA 5CAKA 3TE9A 3OGVA 2DZUA 4MNJA 1J8VA 2W27A 5F2GA 4H1ZA 2WCGA 4WDXA 4YL2A 4DJEA 4O0QA 3SZ8A 5A2BA 3T8QA 3IJ8A 3KL5A 2C0HA 3MHGA 5ER0A 2AL2B 1BRLA 1MZRA 2EG8A 2NQ5A 3AMGA 1KM3A 1ZQ5A 1TVLA 4JS3A 3WMSA 1VFHA 1FP9A 2XVGA 1KWKA 3A9IA 5FACA 3G1RA 1U22A 3SSJA 1XH2A 3CPRA 1IR2A 3AJ7A 4NUWA 3UNTA 1KBBA 5I2UA 4DO5A 3G24A 4L65A 2ZXAA 4QFUA 1G4SA 1H4PA 3LGGA 1EEXA 1F4HA 1KLZA 1FEBA 4PEEA 4UTWC 3CMFA 3WQWA 3E1F1 3TIMA 5LKYA 1UC4A 4ACZB 3L21A 2R14A 1UD2A 1W37A 1C29A 3M0YA 1S1PA 4GKTA 4H6QA 1P43A 5D2VA 2NLYA 3LMYA 1S38A 2VR2A 1WBHA 3NL3A 3TLQA 2DVTA 1E0UA 2E77A 5XINA 2J7BA 4J28A 1QPNA 3C5QA 5H2ZA 2DSVA 3WQOA 3WKZA 4LY8A 5K9XA 2WLYA 2IMRA 3E9AA 1W8SA 4M29A 1LRQA 4GQRA 2W0HA 7REQA 1E9IA 3S8HA 1UHVA 3KRZA 4OBTA 2BXVA 4NEWA 4W88A 4K8GA 3E96A 1T40A 3FG2P 1JI2A 1VFFA 3C2FA 3CZJA 4JTEA 2QNEA 2G3FA 4PUMA 2GQ3A 2FPYA 2HBVA 1SPQA 4CCZA 5I77A 3C86A 4FXFA 3AM9A 3LM3A 3CO4A 2WZTA 1T5AA 4NX5A 3PP7A 1ISVA 3OLGA 1EKOA 1Q65A 2VX5A 2W66A 2A3HA 4PEKA 4LVFA 2V5DA 1CEOA 4IWWA 4D1JA 2Z00A 2YCLB 3A5FA 4AD5A 4CN1A 1QBAA 4YJ5A 3RRXA 3AN1A 1V3LA 3MJMA 5AN7A 3SRHA 2P53A 4JX6A 3A7AA 4IX2A 5IHSA 2JFEX 1UR8A 5C2GA 2ZCGA 2FHCA 3IV3A 3LD5A 4HK5A 2WSYA 4XAGA 3PZOA 2PDLA 1UPMB 3COTA 3UYIA 4H4XA 3K8KA 4GLEA 1C92A 3TAOA 1R46A 5LGXA 2GDQA 1QAPA 1V3JA 4HPXA 3ENLA 4RXGA 2BY1A 1D7KA 1H60A 1BAGA 1L2UA 1XW8A 3C2OA 3RCYA 1UUMA 4RZBA 5FD0A 1FA2A 2UY3A 2VEPA 3GC2A 2RDWA 4GVFA 3S1XA 3URAA 3AYTA 5I03A 3A3HA 3S2CA 5FJOA 2J62A 3BJSA 3HIJA 3VGFA 1KFKA 4UTTA 3MO4A 3GH4A 4IUGA 4YWOA 4TMCA 1WDSA 1P5BA 2PWHA 3R25A 4QGCA 4DO4A 4Z42C 1R8LA 1V3MA 4E8CA 4BZYA 3TX9A 4WJXA 1HKJA 1M6JA 3OGRA 3SJ3A 3H70A 3F03K 1JI1A 4JEJA 2FZ9A 3MYPA 1ME8A 5IBXC 4I7VA 3BQ6A 4DJED 2NV2A 4Q6XA 5A3HA 3S5ZA 3RCNA 3UZWA 1XIHA 3RGTA 5IXEA 5HWJA 4INFA 4PMNA 3T0TA 4Q8WA 1BVNP 2EPMX 3EWUA 3WD4A 4BV6A 4YVXA 1UZDA 3M1ZA 3MUZ1 4GQBA 1ZK7A 2Y5SA 4MB5A 1QI3A 3SBFA 5JBFA 1ZFJA 1E1FA 1DBTA 1DWIM 3RPTA 3W24A 1TPEA 4NKCA 2Z6JA 5I5RA 3FJNA 3NQEA 1WUEA 2G37A 5AHEA 5E5CA 3CLMA 1KB3A 2PC8A 1OCQA 1O6IA 2ZX8A 2CHRA 3QV6A 4CNSA 1BKSA 5C7HA 4OECA 3UXAA 1R3RA 3UWUA 3O07A 1AW2A 1EPVA 3KS5A 4J2PA 4H9MA 1PKYA 3DXIA 2PWVA 1Q8AA 3VK5A 1W31A 3KX6A 4JYEA 1PDZA 4UWMA 3GXNA 2CKSA 1H62A 1T99A 2QCDB 1DIOA 3UWQA 4PUUA 5TQLA 2VYOA 3QZAA 1PJ9A 2FYMA 4JDBA 3T55A 3IANA 4AD3A 1SVDA 3HG2A 2PBOA 1H1YA 2YW3A 4KFOA 2V6OA 3ONBA 3CQHA 1ITCA 4F48A 2A2IA 5HULA 1FIQB 4AISA 2ZOXA 1SJBA 5FF4A 4JFSA 4M19A 1H09A 4IQLA 3N3TA 3ARVA 4TOQA 3I7SA 3WY1A 3VNDA 3GVVA 1J96A 2EKGA 2WKLA 2I1OA 2QPSA 4R3UA 3WF1A 2Y0FA 1R86A 2NW0A 4MVAA 3AOFA 2E3TA 1ZBVA 2HMCA 1IWBA 4GVGA 1BWVA 1XYFA 4FLOA 3SECA 3A3WA 3INPA 3K2GA 4UR8A 1YNQA 3W2JA 1KRBC 1ZSXA 3DYMA 3PANA 1TQXA 2WZMA 1UKQA 2POTA 4XD4A 4NU7A 3LZ5A 4J3WA 3FA5A 4BY3A 1OX5A 4Q7BA 3KBWA 5D2YA 1YDOA 2CLPA 3EAOA 1ONEA 5DT7A 3WNMA 5FJIA 4CQBA 3G0SA 4UTWA 3CH0A 4I8DA 1K6WA 2QJGA 5AHNA 1TTPA 3ARUA 3TSBA 4GH1A 3UBPC 3A4XA 4B5NA 3G0UA 4ZO6A 2VZOA 2AL2A 3SFWA 3XIMA 3CH9A 3S1WA 3E0LA 4IPNB 4AHQA 3VE9A 1ML1A 1ZBKA 3VVGA 2OQYA 1EIBA 1RALA 1TA3A 3UCCA 3URNA 2C3ZA 3APYA 4EWND 1XINA 3AZSA 1WQ5A 2HVNA 2WJEA 4JFVA 2WBAA 1PPIA 3MT1A 3PBGA 3SN1A 4WKAA 4NY2A 4HU4A 3WH8A 4PMJA 1ITQA 3R1ZA 3WO8A 3GNXA 1ZX9A 3H7RA 5CJMA 2WLZA 3LI0A 4P2VA 2UY5A 3QPZA 1H7NA 4IP7A 5T26A 4EOUA 2DT0A 1IZKA 3VTRA 1Q6QA 1XBYA 4H01A 5A6AA 3RLHA 1BSIA 1Q6GA 1U5HA 4LRTA 4AX7A 3GUGA 3WK2A 3NQDA 1FP8A 3W7DA 1ZPTA 4KWVA 4XKYB 3FVMA 2NUYA 4XTDA 1S3TC 4B3ZA 1BYBA 4WQ6A 1N2VA 3P80A 2WSKA 3DFHA 5I3FA 4HVXA 1DQXA 5REQB 1PWMA 1FY6A 3R4IA 3T2OA 2GUBA 1E51A 1ONFA 2P8CA 3GG1A 4F40A 4GPNA 1WZKA 4Q4KA 5JIWA 3EB2A 3SRFA 5ECVA 2YXOA 4WUIA 2WK2A 3W71A 4C6KA 2Y5JA 1US3A 1W5NA 2J74A 1CXKA 2BASA 1WUFA 2RGLA 3UXIA 4HBKA 4QE5A 1V93A 1PHQA 2YCJA 2PDBA 2A4AA 1I2QA 4K37A 5AKQA 1EJ7L 4LVAA 2ZKMX 1AMKA 3V4BA 4M52A 1XFBA 4AU0A 1PV8A 4S3GA 1AW1A 2VWSA 3TYZA 1L6FA 1Y7VA 4L80A 1LRTA 4PMQA 3DN5A 3K13A 2OZTA 4IGSA 4XKYA 1DE6A 1WKFA 2Z1VA 1JQVA 2INFA 2B81A 2WAGA 5DY3A 1SO3A 3PNUA 4YTTA 5BW6A 3FKRA 3SCUA 4FPSA 5HMDA 1P6WA 3KOWA 2DFAA 2DSWA 3TEVA 1ZKQA 3H54A 1G5AA 3AFBA 3KDOA 3SIZA 1KN0A 4PFMA 3N73A 4WIWA 1IQ8A 3POCA 4ZFMA 3EOLA 3FYPA 3LGEA 1DXIA 5C54A 4W85A 4QJ1A 4ASTA 1XLCA 2CZDA 1UA7A 4D6GA 3MMWA 4BURA 5MHBA 2EPOA 3P0WA 4A3UA 5FSEC 1HZYA 1V3IA 4LU0A 3ZXWA 4KKXA 2QW5A 1Q7ZA 1XV8A 3VIHA 2Q09A 3QF0A 3FXYA 3MO7A 3W7GA 4RW3A 3TV8A 4QQ3A 3VDAA 2Y85A 4FOKA 1ESWA 3MDWA 4OGZA 3NRZB 1V03A 3F4VA 4XG1A 4N4PA 1QNQA 5U25A 5G1YA 3WBXA 1DIKA 3DFOA 4G9PA 1KCKA 3QMSA 1JR1A 4D8AA 1SFTA 2IPGA 4GUFA 2V3AA 2ANUA 1ISZA 5A6KA 2HQMA 1TV5A 5I02A 1NAL1 3HOJA 4I9JA 1RXOB 3BW3A 2VDGA 1U5JA 4H7CA 3NS1B 3AIRA 4LB3A 1DEDA 1Z41A 1GQJA 1IXPA 2QEZA 3WLJA 3O05A 2FB3A 3BV7A 1Z89A 2AL1A 2VZVA 1JULA 3MMTA 3FYOA 3VUSA 4L4LA 4Q7NA 4XX6A 2NZLA 5CAHA 4O4WA 3ZT5A 3VD7A 4FNSA 2CZFA 4ZVJA 5AOUA 4J57A 3TN6A 1XIEA 5DRCA 4ZQNA 4J9JA 4Q8NA 5HJLA 3CGBA 4YTSA 4LIIA 3AHXA 2D1ZA 2PTXA 3BOXA 3KM8A 1YEYA 4O18A 8A3HA 3KVLA 2A1YA 1MXGA 3T78A 3VYLA 4DXKA 4JDYA 2AGTA 2YBUA 1VYPX 3W73A 3PPGA 1XLBA 4GX9A 2E09A 5ECUA 4QITA 1F5ZA 4V28A 2BOFX 1UWTA 3BL3A 3TCSA 5LXXA 4JTQA 3RPDA 3VM7A 3UXDA 4A8NA 5GNZA 1R3QA 3H2CA 3U57A 3WFAA 3S1UA 3W1AA 3WLPA 1OX6A 3LCGA 4ZODA 1KCZA 3NSMA 3VNKA 2E4TA 4FOJA 1OYAA 3SCNA 1OFEA 3BLFA 1LOLA 3S4TA 2PGRA 2OWCA 1HJUA 5TIMA 1B1YA 3F5KA 1HO1A 2FPTA 3KBJA 3VOJA 1KQYA 1ONWA 1E4MM 1N55A 3KCLA 5HMEA 3SO7A 2ZX5A 3NOEA 3VIPA 2HQAA 4LUJA 5DCDA 1FDZA 4HU8A 1EBGA 1D7YA 1VYRA 1N62C 2ZRXA 3JZUA 1ODUA 2IUZA 3CWNA 5DMNA 3CAVA 4EVZA 3MA8A 3W84A 2DIJA 1GVEA 1B2YA 1TUFA 1P7TB 1K9DA 2X8RA 4DVOA 2C1HA 3AI0A 1WAUA 3EWCA 2DZTA 3AU2A 2FGBA 3NA8A 4DJFD 2Y8UA 3PG8A 1RA5A 3ITVA 1FWWA 2OXNA 4J3VA 4ECLA 3XISA 3O6YX 1Q6CA 1TVPA 2OWXA 3LI1A 4QEEA 2DT3A 2X1TA 4HHHA 5JCMA 3FN9A 2Z29A 4TVDA 4W86A 2PTDA 1MQQA 2EPKX 1T41A 3R89A 1XLMA 3AIWA 3IUDA 2Z2AA 1YPFA 1HJSA 2YYTA 2PGEA 4BF7A 2VEKA 2W54A 5HWMA 3QJAA 4L9XA 3OPSA 4BJHA 2A7NA 3QOKA 3PUGA 1BSLA 4H4VA 4I6KA 1DIEA 3G8RA 4LUSA 2J88A 1RZMA 1ECEA 2I7GA 2PDGA 5DQPA 4KWOA 1XBVA 1KR1A 4D6IA 4OUIA 2E5BA 5REQA 4W7WA 2YBTA 4YLWA 3NO3A 4XZNX 1V51A 3N4AA 4L4PA 2JGYA 4JQ9A 3PK7A 3SQMA 1W1PA 1QOPA 3OQ8A 3NFUA 3TW9A 1RK5A 4R34A 3W75A 3L7RA 4AZCB 4JQ4A 4JTGA 5BWAA 1VFOA 2DUXA 5EKYA 5IHRA 3KZPA 3GM8A 1AH3A 3VMNA 5I3DA 2WB5A 2VZSA 1GERA 3RU8X 1IGSA 1I2NA 1CYGA 4D71A 2O9RA 4O11A 2QCNA 2EQ7A 1PX4A 2Y7GA 3LB8A 3P8IA 3LGDA 5U4NA 4YWIA 2TAAA 1Q6DA 4KRUA 4GI6A 4TIMA 2YCKX 4FX6M 4IL2A 1EYEA 2J8TA 1KM0A 1ZCOA 1AZ1A 2W67A 1Q6EA 3BG9A 3UERA 3CIVA 3QC0A 1Y5WA 3AS3A 4GXMA 1CT5A 3SN4A 2O7SA 2DW7A 1JZ5A 2R24A 3OHMB 1XF0A 1KBKA 1G94A 3NQMA 3BLIA 3TR2A 2E8YA 3W6MA 3FXGA 1BF2A 1WKYA 2ZX6A 3URBA 3VOCA 1TFVA 1F6YA 2CXEA 3M0KA 2I9EA 4XBJA 3BGAA 2ZZ4A 2HXUA 3CNYA 5FF2A 1BXBA 4N9EA 3BUVA 2BNJA 1ZY9A 4PTWA 3VD5A 3PPFA 4Q8TA 1LDCA 4MNKA 4TU1A 2J8GA 3SB0A 2EJ1A 3VILA 3N2TA 2EPHA 4IF2A 3BMXA 3W7PA 2DZVA 1B54A 4Q8VA 2ICSA 3UNDA 2WCAA 2EPNA 4AZ5A 3WQPA 2A3AA 5DBUA 3IUIA 1E1CA 1JFXA 1MFVA 4JTIA 2YW4A 3AC0A 3G22A 1W54A 4QAIA 1AQHA 3QVQA 3OP2A 3P8JA 1OY0A 3R10A 4B4HA 3LCFA 4JKKA 2XWDA 2ZADA 3SQSA 1QBBA 3PY2A 1G69A 2XSXA 5K3VA 2Z25A 3S5SA 4PFHA 4ZEPA 2ZUMA 1XLEA 3MKVA 3VD3A 1WX0A 4QBXA 2BXZA 5I3HA 4YMZA 2FVLA 3CXBA 1O94A 4OOUA 1QI0A 4CD4A 2QJMA 4JQ2A 1H2JA 4LPCA 2XM1A 4C6MA 6ENLA 3P74A 2BDQA 1MYRA 4GZJA 2ABAA 1OF6A 4I7WA 4IMEA 1XHGA 1UG6A 5DX7A 4B5SA 3E0FA 3WF0A 1W3LA 3S6TA 3N18A 4HPGA 5FS8A 3UPBA 4M6PA 4XZBA 2FTPA 2GJRA 3BJTA 1MUMA 5FJPA 4DNHA 4K7ZA 3THAA 1X8CA 2MANA 4N42A 2G95A 4E2OA 1SO4A 1IEXA 3LNPA 1MNZA 3BLKA 4PR4A 2B7OA 1A5KC 3HPXA 4DO7A 3UF9A 2INZA 3DDMA 1OSEA 3W22A 4HYWA 1SZGA 1B30A 4H4TA 1EH9A 2WOVA 4FAMA 2A3LA 1W1A1 1EJWC 1H7WA 1QOXA 3L12A 3NTYA 4BHYA 1F76A 3B8IA 3OLDA 1MSSA 2DUZA 3IARA 3UWZA 4GACA 4NXKA 1MQPA 4XAZA 4LFYA 1OC6A 4X22A 1FDJA 4XISA 5KEZA 3DERA 5D4YA 1XSJA 2Z26A 2ZUTA 5G1TA 1E3XA 1WE5A 2HK0A 2E1DA 1UR1A 1L2QA 1XI3A 4HNLA 2ZFAA 3G1AA 3M0MA 1XIDA 3ZFHA 1UD8A 3QH2A 1JROA 1FWJC 3N13A 4C6FA 3CK5A 4F66A 3LPFA 2HISA 3IJQA 1RUSA 4QSFA 5FESA 1S2CA 3BAJA 1GSNA 3KLLA 4C6IA 1BZLA 2P3ZA 4OV4A 1F8WA 1XC6A 1DWFM 3T09A 1V6XA 3QXBA 3VCNA 1S2VA 1QRQA 1W3HA 1OB0A 2YXGA 3NVDA 3Q4DA 2JKAA 3GIYA 4RPQA 4O50A 3M44A 1Z48A 3PZQA 3ATYA 1OG0A 1B3XA 3W7QA 2X2YA 1ZLPA 4C6CA 4GR1A 1VIWA 3QW3A 5M2FX 1OABA 3O0KA 5BU6A 2J3NA 1JCYA 5K4XA 2OZ0A 3GRSA 4ERGA 1FWTA 3BK0A 2VGGA 4L1GA 2DVXA 3IVSA 3TFXA 4GVHA 2YCIX 4O19A 3LADA 4EM4A 4HHLA 2V3GA 4ATLA 1X1ZA 3TN4A 1QT1A 3PUOA 3OHIA 4IP4A 3L5OA 2GFTA 3K8MA 4NZ1A 2ZUWA 3B9AA 4DBWA 1OC7A 4I5RA 4ZOBA 4JTAA 4ZTXA 5M5DA 3AXXA 5IM51 1AL7A 2EG7A 2X99A 3ZVHB 2Z7GA 2E9MA 2Z1WA 2H6RA 1LT7A 4JTHA 4PBFA 4CCCA 1AA1B 4JN7A 4QIUA 1AZ2A 5HJXA 1IXQA 4U3AA 3CJPA 2J7CA 3CTLA 2NXHA 5DF0A 3NQ8A 1FWAC 2OX4A 4KCVA 4GNVA 4ADWA 4O28A 1J5SA 3WJWA 1NDAA 2X41A 2XPKA 1Q6OA 5HUOA 2OO6A 1WO2A 4EXAA 1JVNA 1BTMA 1FWGC 1UKPA 4U5IA 3GR8A 1J0JA 1PZ0A 4Y9MA 1EJXC 1EP2A 4GQGA 1KFLA 4DWSC 3UR2A 4JZ5A 4O17A 2NVKX 2ZZ0A 1BVWA 2E9LA 4FI4A 3NQGA 4S2CA 3LCIA 1KGXA 3MUAA 1NDYA 1K7EA 2PDWA 4LVBA 3VDCA 1EHNA 5E9XA 3ALFA 4XSMA 4OOZA 3UR7A 4J56A 2IKHA 4KGLA 2QT3A 2NV9A 3E74A 3VKCA 3AXIA 3UG4A 1PYFA 2OTDA 1KWGA 3ZLFA 2G5WA 2J6VA 3HPFA 3PPCA 5HR6A 5M3WA 5E0FA 3WLOA 1POJA 4NZCA 4MLJA 1Y65A 4MWAE 4NAFB 2VJXA 3UP8A 1JCMP 1ZMCA 1B3ZA 5A6JA 3ANVA 4KCUA 3B0PA 5HNNA 1S2UA 3LNMA 5D8ZA 4Y7EA 2GVEA 5CLWA 4NI3A 1KFCA 1UQYA 3GHRA 3CV7A 1JZ3A 2JKPA 4UMAA 3O6DA 3WF2A 5FIPA 3PTKA 3R0KA 3HPAA 2OEKA 4U10A 2NX3A 1E9YB 4H83A 2AQOA 1SR0A 1YQ2A 4M6QA 1NF0A 4K36A 3DK4A 3W2KA 3XINA 5EGRA 4CEXC 2BBFA 1A0CA 4HN8A 1JDCA 1JDDA 1JEHA 5I6SA 1FWEC 2DEPA 3LN3A 4RW5A 3WK0A 3EX6A 3R8RA 1JNEA 3GRIA 2QVNA 3QGAC 1QR7A 1HT6A 4DYKA 3ARTA 4DWDA 1PIGA 3H8AA 2OCZA 5CC6A 3EXTA 4FIRA 2QDEA 1CLVA 4H9XA 1EDGA 3GX9A 1ZS2A 3D6NA 3O6CA 3GDRA 3VCCA 3GDBA 5BU9A 4HK6A 3FJ4A 2P5NA 2NQ9A 4CCEA 4IFKB 2GZXA 1W56A 3HFYA 5H8PA 1S5VA 4PUKA 1Z69A 1MFUA 2BVDA 4QDMA 1S5MA 1PZ1A 5AHLA 1QK0A 1QPKA 3CYVA 4HMDA 3W53A 2HWGA 4NZ4A 1VJIA 1GQIA 2W3ZA 3S2NA 3OO2A 4BWLA 2C79A 5AYIA 2GGHA 1CB2A 3O06A 3WBYA 3NOYA 3UPWA 5H8MA 4LANA 3ZYZA 3BJFA 1PWLA 4NNCA 5CSSA 4E4UA 4A2SA 3RR4A 4TUFA 1WXZA 4MY8A 5CPMA 2B4GA 2AAMA 4AXKA 1YADA 4OWGA 1JD7A 1WDDA 4HMEA 4MUPA 1LPFA 4RNFA 1AG1O 2DP3A 1I2RA 2TSYA 1J2WA 4EACA 2V5BA 4ADUA 4EANA 4QXIA 5T8GA 3WLKX 5C7VA 5HNTA 4JTCA 4NYUA 3VNLA 1TX2A 4LGXA 5CCZA 1UWQA 2ZE3A 2F2KA 3U6WA 1EA9C 1LWJA 4AWUA 3U7VA 5LNUA 1YDYA 1KGUA 1KXVA 2PDHA 1XXXA 2R1MA 4Q8QA 1PDYA 3FS2A 4LS2A 1LLWA 2E40A 2DDXA 3GAKA 3CGDA 5EPDA 3WH6A 3HM7A 1E70M 2VO5A 4C1KA 1QUMA 5TD4A 4QROA 1KC7A 1O1HA 2ASHA 1QFEA 2O9OA 3BLPX 1VCGA 1VCVA 4JTFA 4GX8A 2GR1A 4ZBCA 1ITXA