2QGYA

Crystal structure of an enolase from the environmental genome shotgun sequencing of the sargasso sea
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
376
structure length
376
Chain Sequence
NQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAGLGIVIHEDILSELSIYSLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enolase from the environmental genome shotgun sequencing of
publication title Crystal structure of an enolase from the environmental genome shotgun sequencing of the Sargasso Sea.
rcsb
molecule tags Structural genomics, unknown function
total genus 140
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qgyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qgyA01
3MUCA 3QTPA 4H1ZA 4FP1A 1EC9A 1SJAA 3FXGA 3EKGA 1NELA 3RR1A 3TCSA 4Z1YA 4K8GA 5BOEA 3CB3A 2FKPA 1PDYA 4M0XA 3VC6A 1TE6A 3NXLA 3S5SA 3ZLGA 2PS2A 3PWIA 4JN8A 1KKRA 4G7FA 3TW9A 3UJ2A 1SJDA 2AKZA 3DFYA 3QN3A 1KKOA 4GISA 5FJOA 3BOXA 2OO6A 3NO1A 3V5FA 4FI4A 3ZLFA 3STPA 3N6HA 1JDFA 2HXUA 2GGEA 3RRAA 3D46A 3R0UA 2DW7A 4MGGA 1WUEA 2AL2A 3CK5A 4HN8A 4MMWA 2CHRA 3DG7A 1R6WA 1P43A 3I6TA 3JVAA 1TZZA 7ENLA 4E4FA 2OFJA 2ZC8A 2ONEA 4F4RA 3PWGA 1P48A 3VC5A 3DDMA 3TQPA 3VCCA 1SJBA 2FYMA 3MSYA 3OZYA 3P93A 3OPSA 5ENLA 4HPNA 2PSNA 1EC8A 1EBGA 3RO6A 1R0MA 4IL2A 3IJLA 5FJUA 4H19A 2QDEA 3V5CA 2DW6A 3TJ4A 4YWSA 1OEPA 1WUFA 3RCYA 3N6JA 1MDLA 3SBFA 4DXKA 3UCDA 3T4WA 3R0KA 3TTEA 2PGWA 2OKTA 2ZADA 4GYPA 3IK4A 2XSXA 3MY9A 2QJMA 1FHUA 3CYJA 3VCNA 4KWSA 1IYXA 1JCTA 3SN0A 3V3WA 3GC2A 4H83A 2AL2B 1YEYA 3FYYA 3UXKA 3QLDA 3R25A 2QJJA 3BJSA 4J3ZA 3K1GA 2P8BA 3VFCA 1JPDX 2P0IA 2HXTA 3OW1A 2OQHA 3CAWA 3DGBA 4DN1A 3DFHA 2XH0A 3H70A 3NFUA 2GSHA 3N4EA 3UCCA 2OZ8A 3FJ4A 3S47A 3VA8A 3TWBA 4GMEA 4GFIA 2OLAA 2OQYA 4ZCWA 3UJRA 2PU0A 3UJSA 2GGHA 3ES7A 3Q45A 3DERA 3FCPA 1MDRA 3U9IA 3ZVHA 4DX3A 3NZGA 2QGYA 4HCLA 1XS2A 3PK7A 4GGBA 3ZVIA 1BQGA 2OG9A 1MRAA 2XH7A 5FJRA 3UJEA 4E4UA 1ECQA 3DIPA 1FHVA 3FV9A 5EU9A 2HZGA 5BOFA 3FVDA 4M6UA 2PP3A 3EEZA 2HNEA 2QVHA 3SSZA 3SN1A 3V4BA 4GYPC 3OZMA 3DG3A 3U4FA 1JPMA 2GDQA 3MWCA 4GIRA 4ZA0A 3RGTA 2GL5A 4KEMA 1MNSA 3P0WA 4K1WA 1SJCA 2PP0A 3GY1A 6ENLA 1E9IA 1L8PA 4IT1A 3H7VA 4HNLA 3H12A 3RITA 2PCEA 1KCZA 2AL1A 3T8QA 3Q4DA 3I4KA 2POZA 4G8TA 1ELSA 2P3ZA 3B97A 5FJPA 3TWAA 4HNCA 3D47A 2GGIA 3ZVHB 3MZNA 3TOYA 1DTNA 3R1ZA 4JN7A 2RDXA 4MKSA 3UXLA 4IHCA 3N4FA 1EBHA 5J04A 2I5QA 4A35A 1NU5A 2PODA 3JZUA 4ROPA 4A3RA 2PMQA 4HCDA 3SJNA 4ENLA 2OVLA 3OTRA 3DG6A 4Z17A 5FJTA 4E8GA 1RVKA 2QJNA 4E6MA 1EC7A 2O56A 2PTWA 3JW7A 4KT2A 3ZLHA 4DWDA 3IJIA 3DEQA 3T9PA 4IP4A 2MUCA 4J1OA 2PTXA 1XPYA 4HCHA 1TKKA 2NQLA 3DESA 4KPLA 4DYEA 4HYRA 3GO2A 3CXOA 2GGGA 2PPGA 2MNRA 2PGEA 3HPFA 3P3BA 2QQ6A 2AKMA 3QKEA 2P88A 3IJQA 2P8CA 1MUCA 2OPJA 4K2SA 3SN4A 3TJIA 3UJFA 2GGJA 4DHGA 3CT2A 4H2HA 1BKHA 4EWJA 2PA6A 3MQTA 2PTYA 1F9CA 1ONEA 5IDZA 4E5TA 2OZ3A 4A6GA 2PP1A 3ENLA 3ES8A 4X2PA 4GGHA 3OP2A 3UGVA 2XH2A 2OX4A 2PU1A 4IP5A 3KUMA 2PTZA 2XH4A 3T6CA 3VDGA 3THUA 3PFRA 3QPEA 4IZGA 2QDDA 2OZTA 3R10A 4JHMA 3GD6A 3H8AA 1PDZA 2XGZA 1KD0A 4IL0A 1W6TA 3BSMA 3SQSA 3MKCA 3I6EA 3R11A
chains in the Genus database with same CATH superfamily
4TVWA 5A6MA 3VOFA 2Z1KA 3ARYA 4O13A 4FALA 2J3NA 4DXVA 2FMNA 3THCA 4GZ7A 3VGDA 1HNYA 3S5YA 4K8GA 2GPTA 4NY2A 4CQAA 5C7HA 3N2OA 4GQQA 1R8LA 3H7UA 3W6YA 2F2HA 3B0VC 1SJDA 1V3JA 2VHLA 3QN3A 1D7YA 1KKOA 3ARUA 4F2UA 4Q8VA 3LXDA 1XD1A 3V5FA 4LAMA 4PTDA 2A3EA 5CC3A 2X0SA 1WXZA 3LN3A 1FXQA 2C1IA 2NLIA 3DFOA 3P84A 2VQUA 5D2WA 2Q3RA 3SRKA 4KFNA 4KCUA 4KW2A 4EXAA 2AL2A 4H04A 1NP2A 2X2GA 3AAMA 4R9OA 4S2BA 3W7CA 2Y24A 1VZWA 3WF1A 1TZZA 3OLEA 4GWEA 1PCKA 4QEHA 3EXTA 4FLSA 4I7WA 3PWGA 3SY5A 1VEOA 2O92A 2PFHA 4V1XA 4OE7A 3DDMA 1E3XA 3TQPA 3FGCA 1PX3A 2WNNA 3VCCA 3ARRA 5FEWA 6TAAA 1FWDC 3OPSA 2PSNA 3W00A 1Q6OA 3SSJA 3N25A 4O0KA 2RAGA 4ZQOA 3L2IA 1UROA 5KZMA 1KFJA 2Z6JA 3NVWB 3PNUA 2FH8A 3VINA 3T44A 2YA0A 5H8PA 3SBFA 4PH6A 2ISFA 3R0KA 4BI5A 2LLEA 2WJFA 3TW6A 3BW3A 4IFKA 5BXTA 2PGWA 5CKSA 2ZADA 1OD0A 1TPFA 3FXYA 1GRFA 3DHUA 4O12A 3MKVA 1KXTA 3E0FA 3KBVA 2IS7A 3MMDA 4P8VA 4WY0B 2V67A 3GE7A 4LUSB 4QFUA 2V3EA 2AMGA 1EJRC 2QJJA 3SECA 2G3FA 3T0BA 4DF0A 1TWIA 4PFMA 3KL0A 2CLMA 3GKAA 4MFEA 1OBAA 4DAFA 2A79A 1WNOA 3UYIA 3I3EA 1K1DA 3UA3A 3WELA 1W9BM 1FXPA 2X7WA 2BC0A 2Q09A 2X8RA 2Y5EA 3SCNA 3G2GA 2NZLA 2WSYA 1UQYA 1X6LA 1R7AA 3NVVB 2OQYA 2JEQA 4PMRA 3GR8A 3VK5A 1P6WA 2E9LA 3KLLA 4LCQA 2VENA 3U9IA 3OVQA 2G95A 1P0BA 4JIEA 5A6JA 2PWDA 1S7MA 2YDSA 3ZVIA 3GLCA 1GESA 4Z2LA 1FWSA 4PTVA 1PWLA 3UWQA 1XIIA 3UU0A 1FBAA 1U83A 3KHJA 3MBFA 1VQZA 3GTXA 4L1XA 3T08A 2HDJA 2VQTA 3KL5A 4AEEA 1FHDA 1QVBA 3CWHA 1GJUA 3N73A 2CC0A 1V02E 2DQWA 4L6OA 1F8IA 4GH1A 5HUPA 1B3ZA 2WCGA 3WQVA 1F6KA 3COTA 1JPMA 3L4XA 4AD1A 3KOXA 4B91A 1F8MA 1UCWA 1ZJIA 3NSXA 1MNSA 3NZQA 4AIOA 2ZRVA 3LNPA 4MDOA 4OKDA 2Z0IA 3T0TA 3C2FA 1UWSA 1BF6A 4ZE4A 4Q32A 1WX0A 2NSXA 3H12A 1HUVA 4LBRA 5LNUA 2VWSA 3I4KA 1XC4A 4IPNB 3L0GA 3L4WA 5LA2A 4EK7A 3BK0A 5CGMA 1SM9A 2BV9A 3R89A 5C7VA 2QCLA 4HNCA 2ACUA 2GWNA 4CQDA 4JN7A 3LPOA 1H63A 1JPHA 3TZFA 1ITXA 1PB0A 1TA3B 1C8VA 1J10A 2VX4A 4O57A 1IWPA 1JFHA 1FP8A 2WZTA 5C2CA 5BMWA 2OT0A 2NQ9A 1S46A 1GVYA 1JPIA 3GVVA 1JYVA 4UR9A 3W1XA 3KP1A 4BKNA 4GUFA 3AMZA 1GJWA 4IQDA 4CCDA 4DI8A 4FMVA 4FLQA 2E8ZA 3LCHA 3ORWA 3ZLHA 3DZ1A 1HIZA 1BWCA 4MWAE 2VI0A 4PBGA 3ZT5A 3S5ZA 2NQLA 3A7RA 4G7EA 4Y9MA 4AVFA 5BWAA 3H23A 3GD3A 4XSLA 2ABAA 2F5ZA 4GD0A 3IGUA 2EHHA 4YWIA 3VIPA 5HDRA 3BLEA 1VENA 3URAA 3DFPA 3DGZA 5E6YA 3WQCA 4O10A 3FG2P 4ZTXA 3K4AA 2P88A 4Z2JA 2C1HA 3NQ8A 1IZJA 5DF0A 2OPJA 5FJIA 4K2SA 2VC9A 1UD8A 2PDNA 4ZODA 3WQ4A 3IVSA 4C1KA 3GXFA 1BF2A 1R30A 3RHGA 3EOEA 4AWTA 2DZAA 3GRIA 4M19A 1TMLA 2D2GA 1P5BA 2HCVA 3KLKA 3WUEA 4WEVX 1JEZA 4C6IA 3CZ8A 3QKZA 1EX1A 2CBUA 1BRLA 4IG2A 3LLXA 5ABFB 3SCVA 2CCRA 3WQWA 3S1VA 5CZ0A 1M53A 4DYJA 3VD4A 4RR4A 4DZIA 3I3DA 3DYMA 3HQPA 2WWDA 3QH2A 2Z4GA 4QG6A 2QDDA 4H7ZA 3RMJA 4DVOA 2QAPA 4Q4OA 3G3MA 3IJ6A 1FRBA 1E72M 4C7FA 1Q66A 2DSZA 3CO8A 4MLRA 5LHEA 1L8NA 4M7TA 3U5UA 3I6EA 1S5MA 3MUCA 2E5CA 2VKZG 4XKYA 1NELA 3RR1A 2WZIA 1L9WA 4UTHA 2E6AA 3B0YA 1DXEA 3EPMA 5BOEA 4XZLX 1TR1A 3S46A 4QS5A 4J5NA 3U0HA 4HPGA 1DWFM 4HIBA 5T9BG 4B2DA 3S0CA 1GYMA 1UWQA 3ZOAA 3QQ1A 1N8IA 3AM9A 1ZFJA 1ZX9A 2OO6A 1OCNA 5DQPA 1P6BA 3S5NA 2QVNA 5DCDA 3PAJA 1G4PA 3NL3A 2X8CA 1M68A 2J27A 3VNDA 2ZRWA 3D46A 2P76A 2YR1A 3R0UA 3NVTA 1W3IA 4M82A 4HN8A 4LCSA 3BLDA 3CUGA 3PSWA 1HKKA 5A5WA 4AISA 4M5PA 2Y62A 3WNKA 4MLJA 3WH6A 2ZYFA 3G1XA 5ABTA 3QR0A 2W55A 5JBEA 3GSMA 4WJ8A 1A5NC 2WVUA 3CGTA 5I07A 1A5UA 1V97A 1EEXA 1EO5A 1XCXA 4AQLA 4OBSA 5J5DA 3RM4A 3G1SA 3UNDA 5GJMA 2VDIA 1IIHA 4JFWA 4TQTA 1X6UA 4KKXA 3KS5A 2BLEA 3N15A 5JCNA 1YPXA 2WW5A 3II1A 3K30A 3PJUA 3BOFA 1UKQA 6XIAA 3VKAA 2A3BA 2I57A 2OO0A 2VDGA 3RLHA 2PDPA 5EBAA 3MVIA 4LB3A 2WJDA 1PYFA 3W1MA 4HJFA 1IE7C 4M1BA 2OEJA 2ZUMA 3OYXA 3KHDA 3WQPA 3TYAA 4L6DA 4X3ZA 3FW6A 3TYCA 3E96A 4TMCA 4GLEA 5CPNA 4JIIX 3VTRA 4J3ZA 3K1GA 1LUCB 3CUFA 1OINA 1F3XA 4LUJA 4A8NA 3MBDA 3P62A 3QZAA 4M1RA 1IEXA 2VFIA 3CAWA 5HJLA 1R85A 1EP1A 3KTSA 1EOKA 4DN1A 1DJXA 2VCCA 3VNLA 5F7UA 3LOTA 1IIGA 1R7OA 1JQXA 1G69A 4B2DD 1GT8A 4ICNA 4GQ0A 1FH8A 1DJHA 1LQ2A 2A85A 2E25A 3PULA 3WL1A 1E55A 3H4GA 3AO0A 1Z32X 4HSOA 3ZT7A 3UJRA 1XLLA 1T8XA 3Q45A 1GKQA 1ECEA 3H2EA 3MMWA 4GBDA 5EMKA 3RCMA 1LT7A 3BANA 4QLLA 5BWFA 3A13A 4XSMA 5KINA 1XDMA 3LERA 1EIBA 3PAOA 5FA5A 2AAAA 2QUMA 1RY8A 4I3GA 2Z1BA 2Y85A 1Z9AA 3I4EA 4ZOAA 5AYBA 1TVNA 3SFWA 1K03A 1KM0A 2QVHA 3V4BA 3FYPA 3AIBA 1X2GA 3WQEA 2V3DA 1AL8A 1AL7A 1RA0A 4PE8A 4Y9NA 1ZALA 1SJCA 4I9AA 4GNJA 2WOIA 3CHVA 4D6DA 1RQHA 2Z1VA 3RK8A 4AY8A 1SFTA 3K1DA 3GXMA 4Z2HA 3P74A 3GHSA 3NG3A 4AD5A 1A47A 2W63A 1BYDA 4HTBA 3AZTA 3O1NA 4CD6A 2ZUSA 4FXFA 1YX1A 2IW0A 3LS9A 1W1TA 3V0TA 2ZXAA 3GBEA 1CXFA 1QFEA 4GI8A 5FF4A 1TE1A 4PB3A 4ENLA 3CZJA 2XIOA 2WANA 5FJTA 4DJFA 4IXXA 2WMJA 4E2VA 3OGSA 1BVWA 3W7OA 1GVSA 1C7TA 1KFWA 1TREA 3W24A 1MQPA 2KX9A 4JTJA 3RFAA 3B8IA 1XJBA 3B9EA 4GUGA 2C19A 2WZHA 3C3NA 5AVHA 4A3HA 4DBEA 3IRDA 2YCEA 1W2PA 3RLGA 1OYCA 4B16A 3FDKA 1UBPC 3SW6A 4B4FA 3C6CA 3GO2A 4UQCA 3H4WA 5FJJA 1F05A 4V27A 4MYAA 2QQ6A 3T0CA 2YBUA 4H41A 1UKSA 3A22A 3CEUA 1HJQA 2GR1A 5JU6A 4LVGA 2NV9A 3AYRA 4ZOEA 2RDTA 3BG5A 3UR2A 3D6NA 1NF7A 1HP5A 4I9TA 2WC3A 1QUMA 2X50A 5DXYA 2X8GA 4HMDA 1GOWA 2FZ8A 3WUGA 3U7BA 4Q6XA 3OBKA 3RXZA 2HTMA 3L23A 1NEYA 2VYOA 2Z25A 1E9LA 4WJEA 3U57A 3W74A 3SEPA 1WKDA 4MNLA 4E5TA 3DHFA 2V9DA 2W0UA 4X2RA 1PIFA 2BTMA 4WK9A 2DJLA 4JTIA 1U33A 1V3LA 3SDOA 5HQEA 1R2RA 1XLDA 3S1WA 2A7NA 1FP9A 4PMNA 3B9DA 1ZBKA 4ZO6A 3AOFA 1PZ0A 3E0WA 5KITA 1OX5A 4I8YA 4UZSA 3TW7A 3THUA 1ONFA 2G97A 1H7WA 4S3CA 4BZYA 3WNMA 2W3RA 1B90A 2PDUA 1VRDA 3UZ5A 3GD6A 1S5WA 3M5XA 3ZMRA 5FS6A 2BSLA 1EUNA 1AJZA 1E1FA 1IQ8A 1S3HA 3LGEA 4LVFA 5HK4A 5KMYA 4FNSA 4K39A 4NG3A 4DJFD 1C91A 3M41A 4XBKA 3KBJA 3WK1A 3A21A 1FWIC 2MANA 5BU6A 4IMGA 3S4TA 1U1UA 2VMFA 1U5JA 4BY3A 2YDQA 1TPEA 3PR2A 1XIDA 1XX1A 3LCFA 3BQ5A 1K8CA 3GFYA 3NQEA 4M3PA 1EJSC 1PDYA 4ATDA 1HJWA 1EEPA 3TROA 1VHCA 2OOGA 1JI1A 1VAHA 4MNMA 3C86A 1N63C 3DFYA 3IIXA 3VOJA 4QS6A 1J96A 2WSRA 3M7WA 3EUB3 4QCFA 4GOAA 2YKKA 4O8RA 1MFVA 4V15A 2GGEA 2PLCA 4WY0A 2ACSA 3BJTA 4LUSA 2OSWA 4H4SA 3DN5A 3E0VA 3LLFA 1IXOA 4GZIA 3XIMA 4M24A 1NDZA 1F3TA 2YL9A 2QAFA 4AX6A 4JDBA 1YADA 1J5SA 4B5VA 1JGIA 3MSYA 2BVWA 2PBOA 2C6QA 3HG4A 1PYMA 5TF0A 1FQ0A 4RNIA 5HUOA 1OEPA 5DT7A 3GDBA 1FA2A 3LCIA 1C3FA 1RJPA 3GVGA 3F2BA 1QI5A 3D9XA 3BLOA 4AX7A 2VEGA 1FFRA 3HMCA 4XIMA 2O9OA 1SFLA 3ARPA 4FOKA 4W84A 3VFLA 3WUBA 1JCYA 1W5NA 2QJMA 4C6LA 2DEPA 1LT8A 3Q94A 2XIIA 4JCLA 4KWSA 4AU0A 4D6EA 1J18A 4L1GA 1UD2A 1DWJM 2VCBA 1DJGA 5H91A 6REQB 2Z2AA 5BRQA 3NSMA 4EM3A 2ZWYA 1EYEA 2VR2A 3U5YA 1REQB 4MM1A 1PKLA 4PUEA 5GPRA 3VFCA 1LOLA 2XN0A 5AY7A 3JR2A 5K2ZA 1E0VA 3HPZA 3UFYA 4ZMGA 4JTGA 4CD8A 4Q8TA 1J8VA 3FAXA 5AVNA 3U48A 4H4QA 5HQLA 3KDOA 2V68A 4GI4A 5HWJA 4MY8A 4PCSA 2W92A 3W6LA 1UD3A 4GUIA 2IKHA 1SR0A 3ITCA 1RH9A 4IUOA 4FOJA 2XM1A 4IJRA 3DK4A 1JVNA 3N3MA 3AC0A 2POTA 1ZUAX 1G6CA 3MSRA 1NFBA 4JEJA 3N9SA 3W1PA 1NHSA 3ZJ7A 3KVJA 5AYXA 3GU2A 2EPHA 2UY3A 1LL7A 1ONXA 4E0CA 1P0KA 2VTFA 1TRDA 1TA3A 3V0SA 2KZHA 1DWGM 1S5NA 2EQ6A 1VFOA 2ACRA 2DZWA 2FHBA 1CLVA 3FN9A 4JTUA 2CIPA 1PTGA 1DHPA 1XBVA 3KRBA 5U1OA 4LV4A 5HNRA 4KFPA 2BGSA 3OQEA 4CQBA 3BQ6A 2YVFA 1NSJA 1I45A 5CAHA 5CZJA 4MB1A 1EQCA 1F3WA 4U10A 1GCYA 4Y9PA 3BCFA 2P50A 4KFOA 1CX9A 1V6XA 3L67A 1UYQA 3KE0A 4PMVA 4ZA0A 2PDWA 1KM4A 4HHMA 2PRLA 3CQIA 4GUJA 4MJ4A 4XVEA 2X42A 1UHVA 4HPHA 4ADWA 2QNEA 4W7VA 3H54A 3LV5A 2EEXA 4PMZA 1U1HA 2R1LA 4YTQA 5GQBA 3SGZA 4MDPA 3LU2A 3TWAA 4PUKA 2CYGA 4EAMA 4JDRA 3CWOX 3LGGA 3LENA 2J9XA 1YYAA 2AOSA 1U30A 4J57A 1Q6GA 3BZGA 3EB2A 1E51A 1UP0A 3N4FA 3GG1A 3VI2A 1ZK7A 3M5ZA 3NPWA 4NRSA 4AXNA 2I1OA 3W02A 3LHYA 1DIKA 4S3JA 4UTKA 1RP9A 1KLZA 3G18A 1EF2A 1MW3A 2FVLA 4AEFA 4CNNA 2QJGA 5ABFA 2UV8G 4KRTA 1ICQA 1KFEA 2R24A 1V3HA 2O56A 3E2RA 4URIA 5MF5A 3NQ7A 2R9ZA 3PZMA 3TQ0A 5HWNA 4PC8A 4Q8UA 3WD4A 1P0NA 3NEVA 5JXQA 3N13A 3CUHA 2FFCA 4BF7A 3S6OA 1HFBA 1HJUA 3QQ0A 5LSMA 4UQEA 4PUJA 2XSAA 3SCWA 1GHSA 2IQDA 3EANA 3CH0A 5JCIA 2CLEA 2EJAA 1BFNA 1TPUA 5HMEA 3NPXA 2ZUVA 2WMGA 2QLYA 1DKWA 3UJFA 2C71A 3GG7A 1VBHA 3CGDA 5GNZA 6PTDA 2ZRYA 4H6KA 3K46A 4EM4A 4F40A 2GVGA 2DIKA 3GNRA 1F8WA 3WX7A 2RKXA 3RX3A 5IDZA 4KIEA 1GQJA 4A6GA 1Y7VA 3W1QA 4L4MA 3H4KA 1UA7A 3OP2A 3TN4A 4REQB 1FDYA 2X41A 1JD7A 2YBTA 3SAZA 3AS2A 1AZ1A 3BXWA 1HO4A 4XD6A 1F6YA 1R86A 5HNNA 3T81A 4NQ1A 4BQ4A 2DT2A 2BB0A 1TO3A 4RZ5A 3AS0A 2JFEX 4JAWA 1EJTC 4DJEA 3GNOA 4LAZA 4GPNA 4HA4A 1POKA 3WF3A 4ES4A 1W6TA 1Q6EA 3NAVA 3ZO9A 4PMDA 1Z41A 1LYXA 1TR9A 5HMDA 5I09A 1C90A 2V6AA 5FF0A 1B3OA 3CZLA 4IIFA 1QHOA 3E74A 2V5LA 3UPBA 4OVXA 1G1YA 4PSRA 1SW3A 2BOFX 3ABOA 4JTHA 3UVAA 4S3FA 4C91A 4U3AA 4W88A 1JPKA 3MDUA 3LK6A 4OT7A 3W1LA 3ZLGA 3OOQA 1PS9A 1R3WA 1G01A 4NXKA 1UR4A 2NX1A 1OC6A 3TW9A 2PTDA 3BGJA 1Y5WA 2CFYA 1CXKA 2Q8LA 2C15A 5FJOA 5JRBA 3DFNA 4R88A 1Q5MA 1UH2A 1DJZA 3CGCA 1HGYA 2F6UA 4LNCA 3TTQA 1RXOB 4NZ5A 2DW7A 4EPBC 2BXYA 1BXBA 5A95A 2XVNA 3LBCA 1CGVA 3UGRA 3K8KA 2CHRA 4MAZA 3NA8A 5FCZA 1LLZA 3JVAA 1LUCA 1IT7A 3TMLA 4MWAB 1FECA 3AXIA 3SQLA 4MIMA 4B4HA 4K8DA 3UYCA 3RLUA 3F4CA 1IEQA 3W37A 1TMHA 4Q4QA 3RN6A 4Q6JA 3S1GA 3M0VA 2B7NA 2VEMA 1CLXA 1EO7A 4YVPA 5BROA 3KAOA 2CLKA 1FH7A 2WPBA 3SGUA 4EPDC 4JS3A 1I0BA 5FSEC 4A4AA 2DT0A 4B5UA 1OQFA 3BSHA 4AHQA 1GQNA 2YZRA 4L64A 1EIXA 3UZZA 5D38A 1RBAA 4DJED 4PUUA 4JGDA 3FA3A 4EQXA 5BNKA 1ZHAA 2D73A 3HW2A 2QCDB 2O9TA 4U28A 3S6DA 3UG8A 1KM1A 1AQFA 2G3JA 2O4QA 4A8IA 3IIVA 1RUSA 3VNJA 2Y7DA 4NNBA 3HJZA 3ANUA 5F1UA 3EX4A 3RPMA 2P0IA 1Z69A 2DUXA 4UTTC 4LU0A 1EXPA 4P7QA 1NFPA 3KBMA 1RV8A 1UOZA 3E5BA 1GOIA 3ZFHA 3NRZB 3NFUA 2ANUA 1QW8A 5CPQA 3WDRA 1TQXA 1Q6FA 2CZDA 1UKOA 2WM0A 4JQAA 1ZS2A 3V0UA 2CITA 1E71M 4O52A 3WNOA 2ZE3A 4EXQA 1ISWA 2ABBA 3TTOA 1QI0A 3N4AA 4QLJA 1GZJA 3VUSA 4NSBA 1X97A 3T09A 4H4WA 1XYZA 1UUQA 2FTWA 4Q8NA 1K70A 1DOSA 2FIQA 4AZIA 1CB2A 1TJ1A 3E02A 3OBEA 1FO4A 3MMUA 2CBJA 4EKJA 1BTCA 4HK5A 4JFUA 4P7OA 3FVDA 5CZTA 3BMVA 4A3YA 1IV8A 1Q2RA 1KCLA 3ME3A 5CCZA 1JG9A 3MWCA 4OHQA 2GL5A 2FTYA 1CLKA 2XVKA 5DBTA 4C6CA 4G1KA 2EQDA 3OLGA 1L6WA 1XG4A 3N6QA 3WQOA 3TYEA 4NJIA 3T8QA 1PJ9A 3O6DA 4HN4A 5HR7A 4N9EA 2CLHA 1RJRA 4UOQA 4M52A 4OBRA 4PZVA 3EPNA 3CHDA 5FJPA 4ZTYA 2E1DA 2FJKA 3UQNA 4HD5A 3ARSA 4RV3A 4GY0A 4XX6A 3VILA 1JL8A 5IDIA 3TXVA 3SO7A 2V5JA 3TYUA 2Z00A 4EMWA 3UF9A 2ZX9A 5I03A 3VD7A 1I60A 5D2TA 3PS7A 2A21A 4TTGA 4WDXA 4X60A 3GXNA 1WB0A 3I7SA 4IWWA 1AW1A 3B8DA 2X8HA 5CSUA 4XO7A 1OM0A 1HVXA 2OQLA 4R33A 1A0EA 2WOWA 1CXLA 1ME7A 4P8UA 5DCBA 1GVFA 3O0KA 4G56A 3CZGA 4FLRA 4B92A 2OT1A 4EIVA 2W54A 4W8BA 1QWGA 4DO5A 4FX6M 1A3HA 2XZ9A 1TKKA 1GUVA 1WYIA 3BURA 3H53A 3S8HA 1VBGA 4KEVA 4OUIA 3ITXA 4L61A 3VIGA 3ZYZA 1E3ZA 4RZBA 1LL4A 3EWZA 2OODA 3HURA 7XIMA 2QULA 3AJ7A 5C55A 3VDCA 1I2QA 3OVRA 4UFMA 3AJXA 2GK1B 4CNOA 4YTRA 1DYSA 2DIEA 3NQAA 3LMZA 3HGRA 3V18A 1IZKA 5AOUA 1QHZA 3WLMA 2VRKA 3TE9A 1HKMA 1YTDA 4NJJA 3LXAA 1JNDA 3DU0A 1EJWC 2UWFA 3TJLA 4C1NB 2FB3A 1GVQA 1QOXA 2OZ3A 4O4VA 1VIZA 4L6HA 3UGVA 2J66A 3TP4A 1EA9C 4LIIA 1HKIA 1H49A 1X98A 3CGBA 3N2XA 3B0PA 4G1NA 4MB4A 2DVXA 2C0HA 4HPJA 3AU2A 1Q85A 3TEVA 2QCCA 3WQGA 1XW8A 4PTWA 4XUGA 3NDOA 3QPEA 4FIQA 4Y9OA 3EOUA 1XBXA 4UTUA 1KC7A 1A4MA 3AN1A 2HEJA 1KD0A 4GACA 3IRSA 2WSQA 1UP2A 1UP3A 1T8QA 2VUYA 3KFTA 4FX7A 1FEAA 4US5A 4PUMA 4OQVA 3QQWA 5D2VA 1V4YA 1YQZA 3WFLA 1EP2A 4YVXA 2FDSA 1VKFA 1Y5XA 2VR5A 2DVUA 4J3UA 4PYSA 2F6XA 3MWAA 1TV7A 3KTCA 2CLIA 3BCJA 1VHNA 2YVGA 2J8GA 3W27A 4UQAA 4GVHA 3PUEA 1JROA 3ITYA 3Q67A 3W6MA 4G7FA 4LYQA 1ZLPA 3QR1A 4XZIA 4WDWA 4C5YA 2CLLA 3VM5A 1GOKA 4AWUA 1IXQA 4IGNA 4JIQA 1OIMA 4IMAA 2FVMA 3N18A 4LJ3A 4JL1A 3KRSA 3RRAA 3E0LA 3ZS4A 4EAYA 6REQA 2E0PA 1TV4A 2PDGA 3PJXA 2NV2A 5IHRA 2Y1HA 3ITVA 1REQA 1JRBA 1XUZA 3SY8A 5DBUA 1XYMA 2QV4A 2BHYA 4HPNA 3BG3A 3FHAA 3AUOA 3STFA 3ONBA 4RZ4A 3SRDA 2NW0A 2IKJA 1VJIA 5G4EA 3MT1A 1UB3A 3NVYB 1XLKA 1MXSA 4L80A 3Q65A 5CPTA 2ZX8A 3VAVA 1CXEA 4Y6GA 2QIWA 1FWCC 3S2JA 4XTIA 3DX5A 5C6MA 1EL3A 1GEHA 4IFOA 2XDFA 1ZTVA 2QF8A 3OZOA 1FHUA 1LWJA 3TMQA 5AHEA 1H7RA 2QYGA 4H6RA 4FZIA 4ZSTA 2FMOA 1MUWA 2CBVA 3M6YA 4JD4A 2DSUA 1JZ7A 3C2OA 4GYKA 1UR9A 2YXXA 3GIYA 2P8BA 2GQWA 3OW1A 2PDHA 1S5VA 4HK7A 3PANA 4QE1A 4CU6A 2X16A 3RPTA 5I23A 4HOXA 1CENA 3CO4A 2YL8A 3MSGA 4YYFA 1US2A 5C5YA 3CPUA 3T0AA 7REQB 1XYLA 3DKLA 3S9YA 3CV7A 1QI2A 3ZWSA 4Z2IA 1W1IE 4ZVJA 3GNPA 3AU6A 3IK2A 1LRQA 4LF1A 3AI0A 6CGTA 3F4VA 1S2AA 3TC3A 2JKEA 4ILSA 1UBSA 3G5EA 3HTWA 5KZDA 4DWSC 5BZAA 4UFHA 4GIEA 3NZGA 3ARTA 1D3GA 4GRTA 1VRXA 3APYA 4GGBA 1VIWA 2Y89A 5U25A 4F8XA 4H3DA 3CEPA 1E6RA 3UJEA 2E5AA 2WMIB 3R13A 2V5KA 3B8UA 3ABXA 3QR3A 4LSBA 4D6IA 5DLCA 4LY8A 2WOVA 1E43A 3UXAA 3KLJA 2ESCA 2PP3A 1QK0A 3N12A 3PF3A 3WO8A 4DIAA 1AFSA 4JTAA 1TYGA 3BAWA 3OIHA 3SCTA 2NWRA 3UETA 3R43A 1DE6A 2YA2A 3WJWA 4R7OA 5B7YA 2VXNA 3R4IA 3ETRB 3FLUA 1EDTA 4NJGA 1LOQA 4UQ9A 3ARZA 3ITOA 1QPQA 3CQJA 3NQGA 1WZLA 3K5XA 3QEZA 1UR0A 2DSKA 3R58A 1M3UA 1T99A 4HSHA 3M44A 3OVGA 2H9AB 3HRDC 3R0DA 4CN6A 2HQMA 1EYWA 3WMBA 5F4SA 3SQPA 4LXFA 5ABGA 4H4UA 3VGBA 4E38A 1ZXIC 1YXCA 1TG7A 2A3HA 2Q01A 4B5WA 3NVDA 2BHUA 3O6AA 1LP6A 5J8LA 3QGAC 5EFFA 3SUTA 2OEKA 2HBXA 1J5TA 2ZRXA 4YWOA 3FA5A 4CEUC 2TRSA 1F5ZA 2Q71A 2H3BA 4GVIA 1ZU8A 4PMUA 2G5WA 4CUCA 1LRTA 5G1TA 4REQA 3I6RA 5I3KA 4DWDA 4MUPA 3WH8A 4WX2A 3LI1A 4NYYA 4ERIA 1LQAA 1GKPA 2QJHA 4IOTA 4JIHA 5E0FA 1DVJA 3K13A 9XIAA 3CUJA 4HK6A 5BOOA 2FGBA 6XIMA 3W81A 3DI1A 9RUBA 4TV5A 5E0KA 3W76A 5TNVA 1BWVA 5I5RA 1SSGA 1KB3A 3I7RA 2VVNA 4AZBA 1JJKA 2QPXA 1W32A 4IX2A 2Y7GA 3O0HA 3LBMA 2F61A 2A2IA 3UG4A 2BXVA 1JYWA 2WP5A 1YPIA 3FDGA 4C1LA 2F7FA 4XV0A 3DI0A 2GZXA 1RCXB 3QC0A 4NZ4A 2J75A 3MO4A 3MQTA 3TR2A 1U2YA 4AZ7A 4ASTA 1XR2A 1ZSXA 4KWOA 5D32A 4YYCA 4PSPA 2ZTKA 1KXHA 5AZ0A 3SCPA 4TVCA 2B7PA 3ENLA 3GXTA 3ES8A 4NZ1A 5G4WA 2J7BA 5CJNA 1D8CA 3KXQA 1MEWA 1FWHC 2XH2A 3PZOA 4PBEA 5HBFA 5A3HA 3UZXA 3LV6A 4HB7A 4J3WA 2XH4A 1XYAA 4QLKA 1PE1A 4AUBA 4ECLA 1WP6A 5HPOA 1KBIA 1KN0A 2OZTA 4JHMA 3R10A 2GJNA 2E1WA 2ADAA 4NI3A 3H26A 3GC4A 4AMAA 4MWAA 1T0OA 4EF8A 4XUYA 3SQSA 2V30A 3BL3A 4Q4MA 2ZCGA 2TODA 4GCAA 3OG3A 1YDVA 1FWJC 3WH5A 3R11A 2D0GA 5LNVA 3W7IA 3MCOA 5DRCA 4C6PA 1EHNA 1TX0A 3IUIA 4M81A 4B3ZA 1GG0A 4OJYA 3F4NA 4CVWA 3OG2A 3GDRA 4RL3A 1E6SM 4INFA 5D9OA 3SCOA 1F74A 1WPCA 2BY0A 3PWIA 3TAOA 3AFBA 4KCWA 1E0TA 1I8JA 2IKIA 1P7TB 3VD9A 4QQUA 3E2SA 2O4MA 4GY7A 3DH7A 2GSJA 2EF9A 2QCDA 4LYPA 1FDJA 1J0YA 4K6AA 4ICCX 4RKAA 4M51A 1YE4A 4O17A 3VZXA 3M0IA 1S2VA 3S1XA 1R3QA 1AG1O 7ENLA 2OFJA 3CPGA 1QXLA 3LSBA 3QJAA 1RD5A 2O9RA 2OWCA 4FHAA 2E6YA 3CV2A 2PWHA 5CC6A 1XUUA 1YLVA 2BZNA 2I14A 3PZGA 4JQ4A 1GERA 2PBGA 2ZE0A 4D1IA 1XGDA 2ZVIA 3MPGA 4PMXA 4DXKA 1WZAA 3KX6A 3WLKX 1X1ZA 4H9ZA 4CNUA 3M64A 2IXVA 3IK4A 1JUBA 3MUZ1 1XC6A 2B81A 2VFGA 1BYCA 3LHVA 1K6AA 4R7JA 1J2WA 5M03A 3AMLA 4PCTA 4MWAD 3UWZA 1OWQA 1GQLA 4IPLA 3R94A 1V6TA 3BLFA 3TU9A 3S5OA 2DSWA 1HXJA 3E2VA 3BJSA 2O55A 1TB3A 5A69A 1PWMA 4YJ5A 1SZRA 1AH3A 3ITLA 1AJ0A 3EWYA 3KWXA 3IJ7A 4AD4A 1F76A 4H4YA 1WQ5A 2WPFA 4QITA 1E4NA 1HTIA 1ZJHA 1KXVA 4HA0A 4C6JA 2HVNA 3KEHA 1Q7QA 4ZFCA 4JTQA 1XLHA 1JAKA 4X9SA 3ALFA 4NZ3A 3G0UA 3M1ZA 4RV8A 4UMAA 2BOEX 1J93A 3L2MA 2EPOA 1TMQA 3EDJA 3ARWA 2FDMA 3W73A 2ASHA 3LPPA 1N55A 3CT7A 4CNPA 3N19B 3QF0A 4Z2GA 4UQBA 4DO7A 3F4WA 1SO6A 3ERPA 3N29A 3EOOA 3FCPA 2B7OA 3WEMA 5D09A 2TPRA 3MV11 4WOQA 4M8UA 4XWUA 4DX3A 4WSJA 1UJPA 2P1FA 5FJRA 2PURA 2DZXA 3DC8A 5A6LA 3GHTA 1DQWA 3EMCA 4N7QA 2VZSA 1IXPA 4AAJA 5B7ZA 5KSWA 3TQVA 2R8WA 1QMLA 4ADTA 4PUDA 1OVDA 3RNDA 4C5ZA 2VGGA 4GNKB 3GC5A 4DI9A 1PHQA 5JUVA 1RD6A 5FF2A 5L6UA 3QVQA 3TUUA 3FEMA 5F2GA 4S3AA 5H1WA 2A3CA 4DF2A 1OGBA 3I65A 5JCLA 4EPKA 1HT6A 1HJVA 4IT1A 3T2OA 2WP6A 1XXXA 4PEKA 2X0HA 1F73A 1ZJBA 3D0CA 1W9UA 1EFZA 2G3NA 2XM2A 1R5YA 3FVMA 4GFSA 4MY9A 1A5LC 4A2SA 1ISZA 1DEDA 4AXKA 3FIGA 2GFTA 3VOHA 4ZB2A 1B5TA 1KGXA 2GK1A 4DBUA 1KLYA 5TAOA 4EVZA 1RQEA 1FFVC 3R5EA 4CD4A 2DJXA 4CLMA 4RXGA 3SJNA 3N14A 3AIUA 3AMGA 4C1NA 1XIJA 3VKKA 4OECA 3PBVA 3VOCA 5D8WA 3V1HA 4CD7A 4H4TA 4QISA 4MNKA 1FWNA 1AH0A 1EA0A 2WAGA 1FWBC 4U2ZA 3P14A 2C14A 3VM7A 1UWIA 4K68A 4EWND 1VB9A 4JHOA 3QM3A 4DUVA 2OB3A 3BVJA 4HCHA 2G0WA 3L4YA 1TV2A 3BAIA 4ZO8A 2E77A 4LS0A 5A8OA 4DYEA 1E40A 3F03K 4M7SA 2HVOA 2GQ8A 4JY9A 2CXEA 1AQ0A 4UWMA 4JTKA 3D3FA 4HU0A 3KOYA 4NI8A 2Y88A 1KFKA 4JTEA 3QLLA 1M1BA 2NQ5A 4JPGA 3VDAA 4NAEB 4H2HA 1PTDA 5A8PA 1QNSA 4BHYA 4A29A 4I7UA 2PCQA 4X0VA 1BKHA 1XWYA 4H4XA 4PL1A 1OFEA 3FK4A 1L6GA 2GJPA 4H6QA 3NYZA 3OLDA 4N0RA 2OYMA 4NZCA 3GRTA 1Q2SA 3L4ZA 1D7FA 4N9CA 1H3GA 3UY8A 4S3GA 5DCEA 1XIEA 1UJQA 1A0CA 1A5SA 3VDGA 1J0HA 1V3KA 3MHGA 4FNUA 1V03A 4M29A 2YFOA 3G24A 1HZYA 4R85A 7CGTA 2FQIA 2WV8A 2ISWA 5E0CA 5EMJA 4H2CA 1H60A 4FOUA 1STZA 2EJ1A 4I8DA 3GQYA 3G1AA 3VE7A 3J7HA 3PB0A 3PHAA 3KCOA 4FF5A 3CGEA 1BPLB 3W7RA 3W2NA 2BY3A 2VUNA 1TV8A 3LQLA 1E73M 4GKTA 3O63A 3LTPA 5C54A 2WJZA 2GUUA 1O5KA 1ZENA 1GK8A 3CQKA 3A9IA 4W87A 4ZE5A 1BAGA 1UWUA 2HNHA 4HNUA 4JN8A 1I4NA 1LPFA 1KQYA 1EPXA 3MKKA 2XUCA 1Q6LA 4DZAA 1JDDA 1TWSA 3VXGA 1YPFA 1V6YA 5AC6A 3ZLFA 3T40A 4UZUA 4JEQA 3H2NA 1BSIA 3BLLA 4U31A 3ALGA 1EGMA 2Z2BA 3GG8A 4O19A 1EGVA 2Y63A 4HBKA 4RW3A 2R14A 1R6WA 3EX6A 2FJUB 2CNCA 1WDPA 2VRQA 4M6PA 2QUVA 4ZQMA 5AN7A 4BQ2A 5A2AA 4PUWA 1Y5VA 3T78A 1GVRA 1H7XA 2FYMA 2Z1XA 1MQQA 2DV0A 3CS2A 1DQXA 3LG3A 1UQZA 1W0MA 7REQA 5ECVA 1H7NA 2OLHA 1KRMA 8RUCA 4FS9A 2WPGA 3B4YA 4U5KA 2QCMA 1WDQA 4GYFA 1U5VA 2BXZA 1FKWA 4WLCA 1Q13A 2PWFA 4O1DA 2OKTA 3MJYA 3BV7A 3MZ2A 1OADA 4A8RA 3BAXA 2WHJA 4K8EA 3MP5A 5H8UA 3LMYA 2YJQA 4NAFB 1JCXA 4JYEA 2D24A 2EG6A 2WMIA 3CU2A 1XBZA 3EX2A 3P0XA 1YEYA 4AC7C 3CL6A 4AG0A 2BMBA 3OVPA 1JZ4A 2C3ZA 1JULA 4FR1A 5DFAA 1UW9A 1W1ZA 4LY4A 1EQPA 1CXIA 2Z29A 3SIZA 4YHGA 3GNXA 4Q7NA 2R82A 4NJHA 4WY0F 2GSHA 2IQTA 2OWWA 4DO6A 2OZ8A 4NNAA 3M16A 2VO5A 4UTWC 3FJ4A 4F9JA 4FLOA 3TWBA 2RDUA 3UVIA 1KTNA 3KCJA 2XVPA 4GFIA 4C60A 2I5IA 3HV8A 5HJXA 2I7GA 3CTLA 1KBJA 2FZBA 3UG3A 2H9AA 4HOWA 3AMCA 1BG9A 2J8FA 3LI0A 3E0IA 1QNQA 3T2QA 4IQLA 3W71A 5KZ6A 1MRAA 2XH7A 1OC7A 1YE6A 1VYPX 1ECQA 5EYWA 2GJRA 1VPYA 1Q7ZA 4F66A 2KAUC 4Z0JA 5C70A 5FSDC 2PDJA 4WXZA 4XBJA 5TD4A 1WDRA 3QFBA 3NZPA 1V6UA 4LW7A 4J40A 1KRBC 2DZBA 1RJQA 5CSSA 1UUOA 4TX8A 4F48A 3L4VA 1ZBWA 1GTEA 4XZNX 4RNHA 5AHLA 1R3TA 1ISYA 1AK5A 5HMFA 4K36A 1T40A 1XIHA 2XHYA 4Y2WA 2EQ9A 1WOBA 3AXKA 3CHEA 1YHTA 1JXKA 2VOMA 3S2MA 3G1RA 3EZ4A 5FESA 3NOYA 3R7MA 3EX1A 4JNYA 3NSNA 2NLYA 4QGCA 4HNNA 4Z1BA 4UC5A 1GVEA 3OO2A 1GQKA 4WKHA 3S2LA 1EX5A 4PRWA 2VL4A 4XAGA 3VKCA 4W8AA 4RE2A 5CPSA 4ICMA 2ZA3A 4BWLA 2W27A 3JS3A 4Y9AA 4A3RA 4C6FA 4OBTA 3WN6A 1V08A 2FPVA 3NPUA 5JIPA 4B9ZA 5G5HB 5E09A 1BHGA 3TSDA 3CMJA 4YTSA 3W86A 4E6MA 1EOMA 4JKKA 5FF7A 4P7LA 1GZ1A 5XIAA 1DWIM 1XICA 3DEQA 4NU7A 1RY0A 4DLFA 3M0HA 2C7FA 4K38A 2PTXA 4IIEA 5K4XA 4JFVA 4S3KA 2WB5A 4J56A 1IR2A 1NM9A 5EGRA 1TUXA 1OK6A 4L5ZA 2W0HA 2ISSA 4ZQNA 5FEPA 2PPGA 3PZVA 3NZRA 2QCEA 2Z7GA 3GIPA 3GNDA 1HL2A 5JBDA 2V3AA 3OQ8A 1R3SA 3M46A 4UXDA 1LBFA 1JYXA 2ZX6A 4JNZA 3IJQA 3TJIA 2DSVA 4FEZA 3BMXA 4R34A 1E6PA 3EEGA 1B9BA 2V5CA 1W5MA 2F38A 4IMFA 2WSPA 1YMYA 2FLIA 5E6ZA 5G2WA 1XSJA 4K7YA 3L4UA 4Q4KA 1ZPTA 4UNIA 4IM4A 3QW3A 2JQXA 3S42A 1ZL1A 1JCLA 1IGSA 3HG3A 1TTJA 4O1AA 1EJVC 1CZ1A 3AMDA 3KS6A 2YYUA 1VS1A 5EBUA 2YCLB 3W7KA 1SPQA 5I3GA 1RM6B 1QOPA 1P7TA 1DV7A 2TPSA 2FGZA 5I3JA 1Q6DA 4GQBA 1GQIA 3WIJA 3B40A 3F1QA 1JRPA 1ZCCA 5LXEA 5I3HA 3C0LA 3NPVA 1J0ZA 4P5UA 3TN6A 1RBOB 1M6IA 1PKNA 3UY7A 1GOOA 4O1BA 4EMIA 3VU2A 2Z2UA 3TDFA 5GNXA 2XZ7A 3PWAA 5A94A 1QAPA 3GHUA 1R3YA 1X39A 1R87A 3UZWA 2I9EA 1TYPA 3PTKA 1BGAA 4U5IA 3TFCA 1VR6A 3CC1A 4Z2KA 4LFYA 4D2JA 1PL9A 3E12A 1KWKA 4WD0A 1FCUA 3V1PA 3IAPA 5C0QA 2W9MA 4MYXA 3IEBA 4AWSA 2V2DA 4LALA 4L4PA 1CEOA 1OFAA 2NX9A 1B3XA 2ZXDA 5TQLA 5G2IA 2TYSA 4AVOA 1DE5A 5DXXA 1AD1A 5DRIA 4GISA 2FPTA 1NARA 3ZJKA 3NQCA 4IQEA 2ZRUA 2GUBA 1I1XA 5BYWA 3QZ6A 2G37A 1JDFA 5D33A 1XCFA 1X38A 1GEUA 2A4AA 3DCPA 1A5AA 4TVUA 1BXCA 3CL8A 1QHPA 4ZBCA 2XINA 5FS9A 4NX0A 4Q7IA 1I2NA 2YCKX 4OZOA 2XSBA 4H4PA 2GVEA 2QPSA 3KWSA 1ZQ5A 1KV8A 4JKLA 3VC5A 3HV9A 1UWAA 4PMJA 5A6SA 5ENLA 4O16A 4GZJA 2HQAA 1O1HA 2HBVA 3BZJA 3IJLA 1TZ9A 5JH2A 2HS6A 1QJWA 5A6AA 1YTKA 1QW9A 4PTNA 3EWCA 2VEPA 3UR5A 2G96A 3N6JA 4Q4RA 1O5XA 3RJXA 2YDAA 1G4TA 2ZOXA 4YIWA 4IJBA 4IIHA 2DPEA 4LVBA 1YDNA 2DZTA 4O15A 3F5KA 1CI1A 4KMQA 4DJFC 5F1VA 3KOZA 3M07A 1E0UA 1N2VA 5AHFA 3W9ZA 2VX5A 3DKJA 2ZVRA 3IIOA 3OBAA 3HPXA 2V2HA 4AD3A 5ABEA 2XWEA 3WQ5A 4H4VA 2X1SA 2R9RA 3RIKA 4H8NA 4AWEA 4LH8A 4DJDA 1ODZA 3WL0A 1FX6A 4QDMA 2HXTA 1H61A 1JYNA 5CBBA 3GFXA 5H2ZA 2BFGA 3ARXA 4J3TA 7A3HA 1A5OC 1DJYA 2VVSA 1O68A 5AHIA 4AFYA 3DJJA 3QXBA 4O4WA 5AHNA 2FZDA 3S47A 3AXHA 2BG5A 1GVIA 2XFYA 4G5DA 3XISA 4KRZA 1HL9A 4V28A 1MDRA 2ZUWA 4ZOBA 3UZJA 3D5HA 2PC4A 3EGJA 3MHFA 1QNRA 1N5WC 1JZ2A 1DL3A 1LJYA 4FNQA 2O7SA 3L4TA 1T41A 3PK7A 5F2IA 1WAWA 1FFQA 3BSGA 5LNRA 3CZEA 2AGTA 4JYFA 1UZDA 1PZ1A 1W5OA 1A0DA 2FH6A 2YFNA 1OYAA 3URNA 2PLMA 4X0NA 4AYSA 1GORA 5I2UA 1K77A 3M0XA 4Q33A 1TJ2A 3QY8A 2A1YA 5BOFA 1JXJA 4GXPA 1RLDA 4PCNA 1PIGA 1V6VA 1ITCA 1V7YA 5EFDA 3EEZA 1TPH1 1ADOA 3VO0A 1IGWA 1I2OA 3DG3A 3UXDA 3U3HA 4QEEA 1PUDA 3EX3A 2O0TA 2WQDA 1WDDA 2V69A 1IZCA 4B5TA 3GVQA 4W7UA 5G2HA 3SCRA 1JRCA 3C2EA 3MCNA 4WJXA 4W4QA 4P8XA 3DGRA 3PPHA 3CAKA 2C13A 5CPOA 2VC7A 1QI4A 4APNA 3RM8A 1LDCA 4GXMA 4BQ3A 3MW7A 2YYTA 2HSAA 2D3NA 4DJDD 3N2CA 4GCXA 1RR2A 4EANA 2E5BA 4NAEA 3UR7A 1SGJA 3QSTA 2I5QA 1NU5A 1H7PA 3E1F1 1GRTA 4ROPA 4W8LA 5A8NA 2UY4A 4HCDA 4FB7A 1CXHA 2OVLA 4CNSA 2E7FA 4DLMA 2CDUA 1ICSA 2WPEA 1WYGA 1QBBA 2I16A 3QFAA 4IMEA 1VFFA 1MZHA 2V38A 3A6OA 3V7PA 4N2YA 2PTWA 1OCQA 3WH7A 5CJ5A 4QE4A 2ZZ7A 2E09A 5D9MA 2EPMX 4ZQRA 2MUCA 1C93A 4J1OA 3K2GA 3NL5A 2VZVA 4S39A 2OGYA 3GHRA 1X8CA 4H6EA 4E3TA 1UC4A 1P1MA 4LGXA 1DNCA 3VZZA 5FD0A 3TJXA 1GEQA 1RALA 2AKMA 1QO2A 2B31A 3C3UA 4N4PA 4CN4A 1XRTA 2ZDRA 1XSKA 4CN1A 2P8CA 2QT3A 3RUBL 3SN4A 3FJ6A 4QIUA 4DAIA 2GH5A 4AD2A 5C2XA 1XKJA 3N1AA 4BF5A 1G5AA 3WD3A 1JFXA 1E6XM 2YAUA 1KRCC 3NXFA 5FI8A 2AQOA 4FDCB 3O15A 4TVDA 4Z1CA 2VGFA 2J4GA 3LCXA 2VWTA 1EKOA 4E3VA 2YOCA 3WYZA 1AJ2A 1Q6CA 2QPUA 1OGGA 3VKBA 1GG1A 3JUGA 4DXXA 1XLIA 1PKYA 4C6DA 2ZZ1A 2B4GA 1FCBA 4AH7A 3RNMA 3F5JA 3MC5A 3BMWA 1G67A 3DJGX 1TJPA 4IL0A 4AZ6A 3M0KA 1E70M 2W6RA 4LOCA 1LBMA 3ZT6A 2WVSA 4LT9A 4WR3A 5CSRA 5CGTA 4AMCA 3C52A 1NWUA 2PDXA 1LROA 1W1B1 5EB8A 3EAOA 4FP1A 1EC9A 3VNMA 1L6SA 1WV2A 1ZY9A 5CEWA 2Q8ZA 1O66A 4E8CA 1W17A 1X1OA 5I3IA 1KM3A 1XYFA 1XQKA 3CAQA 1B57A 4BR1A 1H09A 2ZZCA 3SUUA 3V75A 1JCMP 3UJ2A 5CBIA 1OB0A 4WUIA 4I7VA 2W3SA 1KM6A 2VOTA 4FPSA 1A4LA 3STPA 4NAFA 1M5WA 3ZR4A 2NUYA 3AISA 1VFLA 2JIWA 2E5DA 4MMWA 1E6ZA 1M41A 2X1IA 2XISA 4HMEA 1UD5A 5D37A 2ZRZA 4AZHA 4PEEA 4IMDA 1SJBA 2Z26A 1M9HA 3IJ9A 4PTXA 3OZYA 4J3VA 1PHWA 4GHRA 4PULA 1SO3A 4R9XA 4TV6A 4H19A 2AQWA 3NEHA 5TBOA 4W89A 5AC8A 5LGZA 1B2YA 5IBXA 4BCEA 3A7UA 4HU4A 3TJ4A 5RUBA 1T3QC 4GJ1A 1KFLA 3B05A 5EMYA 4S3EA 3T4WA 3AHXA 3TTEA 5BU9A 1KM5A 1FWFC 5F4WA 4XKMA 5PTDA 3DUGA 3U4AA 3AROA 3CQHA 1QPOA 4F9DA 3A7AA 4AD0A 1H50A 1GZGA 3MUIA 3DGHA 3N2BA 2A8XA 1ITQA 1BXNA 3BTNA 3WLJA 3U2OA 4WXYA 1G0CA 1T5AA 1W5QA 4A2RA 2H8ZA 3PTMA 4MB5A 3G6LA 3FSUA 4XAPA 2HE5A 3WJZA 4D6HA 4JQ9A 3QLDA 3UCQA 1K8ZA 1XH2A 3WBYA 4O0QA 5FEXA 3W7LA 1XPGA 4HNOA 2V8ZA 3GAKA 4A05A 3P2VA 4KWUA 1UR2A 1RHCA 1GRHA 3HMJG 2J6VA 1LWHA 3B9JB 2V63A 2BBFA 3SUSA 3BAJA 4H00A 3E49A 4QHRA 2D1ZA 2D69A 2R1PA 1AW5A 2E68A 5DX7A 3NQFA 2D22A 4XZHA 5TIMA 4UCGA 4F0HA 4L56A 3VMNA 4RW5A 1XRSA 4KF1A 3WDQA 3OA5A 5FS7A 1X7FA 5HANA 3CTTA 5I78A 3GYEA 2QGYA 1VBRA 4UTMA 1NDWA 5LIYX 2EQ7A 1GOMA 5E5CA 4I5RA 2GUYA 2B0MA 3ID7A 3NL2A 2ZX7A 3G22A 3HQOA 5LGXA 2VR4A 3SRFA 3XINA 4PRRA 4M6UA 3M0ZA 4LQ1A 1GETA 1ONWA 3T55A 4KESA 4YNGA 1M65A 4D8ZA 1B30A 3OZMA 3LHUA 1BD0A 3W1TA 3H4XA 1G7VA 4GIRA 3T42A 3HF3A 4O18A 4DJEC 1UH3A 3QYSA 1SMDA 4D6JA 2ZIDA 2CZ5A 1FWTA 3W22A 4QSFA 3SFKA 4UMCA 5LNWA 2YBVA 1UD6A 4C6OA 3RITA 4J2MA 4QAIA 3FKRA 4Z42C 5CG0A 4QTGA 1W37A 4MZYA 4DEFA 1VJZA 2PUZA 2ODOA 3D47A 3TAKA 5GVJA 3ZVHB 5HXMA 3O0FA 1AD4A 1XF0A 2IUZA 3PY2A 1FDZA 4CVUA 5AECA 2JK6A 1EPVA 4MF4A 3ZR6A 4IIGA 4IP7A 1ADDA 4ROQA 4F79A 1D3HA 4BI6A 1QK2A 4XO6A 3PBUA 3O6YX 4A22A 3SB0A 4LBSA 4EP8C 2YCLA 2FHFA 3KBSA 1OFRA 4JZ5A 1WKEA 2C3DA 4LANA 3DK9A 4GQGA 3QSRA 3O6CA 3Q37A 3JW7A 3SRHA 3P5ZA 1M7JA 4R27A 3CNYA 1WZKA 4ZQCA 4MPQA 3K8LA 4JTSA 1WAUA 4IP4A 1B54A 4KCTA 2BWGA 1BTMA 4P7RA 3HJEA 3PG8A 4DYKA 4NZJA 2J7FA 3M4HA 2PDLA 4IX0A 5CBJA 1YDYA 1V8EA 4BEQA 3DH9A 4NASA 2NXHA 4RDZA 4DELA 3CLMA 3P3BA 3QKEA 1KGUA 3LB0A 4MVAA 1SUXA 4H7CA 4ACYA 5FS8A 4FNRA 3W23A 2J74A 5A6TC 1H0GA 3GDTA 4O1CA 3T1GA 3TFXA 1WCGA 4RNJA 2DH2A 3TH6A 1O5RA 3M47A 4LV9A 4ZR8A 4NUWA 2WMKA 5HATA 2YIHA 1F9CA 4PL2A 1M7OA 2R94A 1G9HA 2VEIA 5MKGB 1IHIA 2PP1A 1A49A 1J0IA 2RJHA 4TTUA 4DNMA 2WNQA 4JCMA 1QO5A 4IP5A 4C6QA 3W83A 4CQ8A 4FAMA 3KVKA 4K1GA 1S39A 1N60C 5F2LA 3EWXA 1D7KA 4KCVA 1XDLA 4LUTB 5AYYA 5D30A 4HGXA 2GVYA 1D8WA 3N17A 1GYNA 1PDZA 2TSYA 3FJNA 3APTA 2HMCA 2PC8A 3ANYA 3GS6A 4W7WA 3PZQA 2XN2A 3BSMA 2VD8A 1CT5A 1JZ6A 3G77A 4MTVA 3O16A 3W7JA 1XQLA 2PDBA 2EPKX 4P8WA 3PFMA 5I06A 3HGSA 3EA3A 3QTPA 3LHZA 4NIRA 7TAAA 2VEKA 3G8RA 2YL5A 3QRHA 5BRPA 2PDCA 1ISVA 2V6OA 3KZPA 1YW1A 4N6FA 1TPDA 2Z24A 1UZ1A 4DNHA 2PAJA 4N42A 2PF0A 4YU1A 3CHCA 1L2UA 5ABHA 1XSIA 1HQTA 5CPLA 4XB3A 2HPMA 1XDJA 3GVWA 4A3QA 3BICA 4QG8A 4S38A 3MB9A 3VIMA 4TUFA 3TLQA 1A5KC 1NIUA 3VDHA 4LAKA 1W9PA 4LC6A 3S2NA 1ML1A 1OGSA 3OGVA 1H11A 3N3TA 4LEQA 1VEPA 1J0JA 3DG7A 1OF8A 3C5QA 4OV4A 4UCFA 1ME8A 1GJPA 1LLWA 3H24A 1P48A 4QJ3B 1OFPA 4HU3A 3PVFA 4UFKA 1DXFA 5HAOA 1W1PA 2W67A 1D3CA 4JFTA 4IL2A 4NEWA 5XIMA 2DZUA 2X40A 2XTKA 1R3RA 2QUTA 2OJPA 1VLIA 3SI9A 4RUBA 3H55A 1ZZMA 3QY6A 3RCYA 4MOZA 1MDLA 1I1WA 5ECUA 2FHCA 2VD9A 2FFIA 2HVMA 1EGZA 2DT1A 3R8HA 2BCPA 2X1TA 3HQ1A 2DY3A 1GYLA 2YDRA 4ZSUA 5ER0A 4ALDA 2Y8VA 1M03A 3TNBA 3VNIA 1MZRA 4YHEA 1NVMA 1Q1WA 4IICA 2NXIA 1C92A 4HMNA 3GW0A 1SQ7A 3QHMA 1JZ8A 1DBTA 3NO3A 1JF5A 2P10A 2AGKA 1YTEA 2YA1A 3B03A 1H5YA 4MJ2A 1LG2A 2OQHA 1VFUA 4GJJA 3WK2A 3DGBA 1TVLA 2VFDA 2Y5SA 3A3XA 4E2DA 5T26A 2NSOA 4GK8A 3MUY1 2G50A 3M9YA 3N4EA 4PB4A 2BVYA 3KVMA 1YXDA 1NP0A 2A5HA 3ZWTA 1SW0A 3SURA 3V35A 1DPMA 3QV6A 2OLAA 3NZ1A 1OZQA 3VYLA 1PTAA 3C61A 3WJXA 3EAUA 1QASA 4UOJA 5DMNA 3M6DA 1HJXA 2EQ8A 5EBKA 1NOWA 1QNVA 3EDEA 1OY0A 1XISA 1ZY8A 3FY1A 3BC9A 3W88A 1NHQA 3ABRA 5HJYA 1Y8BA 2EGZA 1VBJA 4HZMA 3L5MA 4H4IA 3DYPA 4KH2A 3WLPA 1VBUA 3MCMA 5MHBA 5G1YA 5K3VA 2W66A 1FHVA 5D8ZA 4D8LA 2J6XA 3VKDA 2WKJA 2C8NA 2VP8A 3E5PA 2QAEA 3IV3A 3U4FA 4AHOA 3S2CA 2CBIA 7ODCA 3SCQA 3OIXA 5C9XA 1VGAA 5JCKA 4BURA 3EF6A 3LY0A 3V16A 3ARQA 3PM6A 4WSHA 3T05A 3Q4DA 5EKYA 5AYZA 1TPWA 1Z42A 2YCJA 4JXCA 1MVYA 2A3LA 1MEIA 4R3UA 2BNJA 4ATWA 1F3PA 1KRAC 2PLJA 2VDHA 3GDMA 1BLIA 3MZNA 4HQVA 1DTNA 3O9NA 4RLIA 1ZAJA 1DQUA 2VGBA 1E15A 4HYWA 2Y8KA 3WLSA 1DIDA 3GK0A 3UXIA 4PB5A 3FNDA 1AMYA 3NGFA 2PODA 1CB7B 1PPIA 1WKYA 3JZUA 3IWPA 1ESWA 3VZYA 4LUIA 3POCA 4GKLA 3ZSSA 3WQ6A 1I0DA 3VABA 1TUFA 4H9UA 1QDSA 2IXUA 3W29A 1VQTA 1UPPA 3NQBA 4N4QA 4ONVA 1MFUA 2XVGA 1CGWA 1P6CA 1UR3M 2HROA 4JX6A 3K4DA 5CJMA 3A5VA 4L9YA 3C8FA 2V0TA 1J9YA 1K4HA 4KPLA 2BASA 2JKPA 1RPKA 5G5IA 3IJDA 4MUZA 4EMJA 3CXOA 4JOMA 1K9FA 1FTXA 2C1GA 3G3DA 2WVTA 3DFSA 3HGJA 4HA1A 4D1JA 1MUCA 1VYSX 3WLHA 1Z89A 4ZENA 2NXGA 1GTHA 3CT2A 2QXWA 3WBWA 4HU8A 5G4HC 3RM9A 1UIOA 2DUZA 4HYVA 2PLKA 5H8MA 1YQ2A 3CUIA 4XD5A 3TC7A 1W91A 4RE4A 3HG2A 3BGAA 4OGZA 4R53A 3BW4A 1B4KA 3GU1A 3OU8A 1XYCA 1DXIA 4U3CA 2NT1A 4O11A 1RLCL 3GNNA 3ABZA 4X2PA 3T7VA 4DQWA 3VD3A 4LS2A 4AF0B 1S2UA 4IXHA 1GHRA 3VVGA 2E3TA 4R7WA 2OX4A 3TZNA 3KUMA 3IGHX 4EQSA 4NP7A 4LVAA 1YRRA 3T6CA 3AHVA 4JTCA 4D8AA 3WENA 2JBMA 1KQZA 4Q8OA 4LUYA 4J7RA 4JTFA 1F61A 3NQVA 1N5XA 4KS0A 3C0SA 3HPAA 4RK8A 2XGZA 3LM3A 1WDSA 1Q4WA 4UNLA 3EWDA 1XLAA 2WNZA 3PZIA 1VF8A 3CJPA 3E38A 1SO5A 4LVDA 3AZSA 2WJEA 1TZ7A 4EACA 1OK4A 1TSIA 1OFOA 4H1ZA 5C9RA 1OT2A 3URBA 1BQCA 4LB4A 5CZSA 1A53A 3PPGA 4RJEA 1FCQA 4ZXLA 3MDWA 2OYLA 5D02A 1KNWA 4LAUA 1W3JA 3CB3A 4M0XA 2OX1A 3NXLA 3S5SA 3GBDA 2QW5A 1EWDA 1KKRA 3HG5A 3RRXA 4A8LA 1H0IA 1RCQA 1XHGA 1W9VA 4MFDA 1O60A 2WHKA 3W53A 4QJ4B 1E4IA 3MA8A 3LSCA 4V1YA 4BK9A 4UFIA 1XP3A 4LBUA 2V81A 3BOLA 4R5EA 2FGLA 4UTWA 2DVTA 1WUEA 1DORA 3CK5A 4I5UA 4C6EA 4J3XA 3I7QA 3NM1A 3M0YA 4H9TA 2PI6A 6TIMA 4GX9A 4AZCB 4H9XA 1HF6A 2ZC1A 4LCRA 3QMRA 1XL9A 3H2OA 1OHLA 1IF2A 3QYQA 2BY2A 2Q02A 4Y90A 1O12A 5LIWX 4GABA 2WMHA 2WCAA 1F4AA 2QR6A 2QDEA 2YB4A 5KVIA 4L4OA 7PTDA 1OCBA 2V82A 3H7RA 1FWRA 1I75A 4JL2A 1K7XA 1WUFA 1OSEA 5JBFA 1ZBVA 3UCDA 3W3OA 4F3HA 3IAQA 3VOIA 3W7DA 2DGAA 2HWGA 1CYGA 2EG7A 3AHYA 1EDQA 1LZOA 2INEA 3MY9A 1KCXA 3CYJA 3OLIA 3TN5A 4YN5A 4WKAA 4ERAA 1JCTA 3AS1A 2FPYA 3ITGA 5HINA 1V6WA 3EDKA 2HRWA 1NDAA 5CLWA 4QJ5B 1OFQA 3N9RA 4MB3A 1SYTA 1HL8A 2R6OA 1ZP4A 3LD5A 3G1YA 4PMQA 4IISA 5I79A 1ZRQA 2XH0A 5DMMA 3H70A 1E9ZB 4HPXA 4XAYA 3INPA 4Y96A 1SZFA 2YGYA 3B04A 4QJ1A 2Q3OA 5T8GA 3VNZA 5BXRA 3CUZA 3RG6A 5HA7A 3E3HA 4POCA 1N7KA 3RDKA 1M7XA 1Q6QA 2VC6A 3DBNA 1JDAA 3QHNA 5D2XA 4C7GA 1UWRA 2PGFA 4JNMA 2XFRA 4OWGA 1P0DA 4BS0A 1XIBA 3LHTA 3B8VA 2GWGA 3HM7A 5K4ZA 3C2RA 2IKGA 1K7FA 3H21A 3ZVHA 2D2OA 4WDTA 1YNQA 3WY1A 3U2EA 4RPQA 3L0NA 3ZJ8A 3PP7A 1JF6A 4U33A 4CCEA 1BGGA 4HHPA 4E4UA 3QBUA 3WMLA 3CUXA 3DIPA 1DIEA 3D3AA 1C9WA 3BGGA 1XI3A 2HNEA 3WLLA 5A2CA 1B3VA 4C6KA 4GYPC 4L1WA 1QWKA 5CH9A 3L21A 3MUXA 4UUIA 4KEMA 1GW1A 3VX1A 4MWAC 1CPUA 2PP0A 2RHGA 3W1RA 3PUGA 4Z1AA 3H22A 2IMRA 4HNLA 3WUFA 2AL1A 4I90A 1JZ5A 2IPJA 3OJGA 4JTRA 3STEA 3CHFA 4DM2A 5FAJA 3M5YA 1MO9A 5K9XA 2CHNA 1LLOA 2Y7EA 3REQB 1UIPA 1DXLA 1UZHA 4MKSA 3LRMA 3P80A 3RR4A 3HFTA 4GBUA 2RFGA 1YNYA 1BEUA 3LRKA 1EBHA 2X05A 4HOZA 4W5UA 4A35A 3OHMB 2WO5A 3AZRA 5JVLA 3EMQA 4QDWA 2ZKMX 3QZEA 4XZMX 4E8GA 4W5ZA 3DECA 1E1EA 3A24A 1XLFA 4MHBA 5MKGA 3GZ3A 1JOAA 1L6FA 2BHZA 1NF0A 1UKPA 3OODA 4KWVA 3MANA 2GJLA 4QM1A 3T9PA 3LXCA 1KWGA 1H41A 2ZWZA 3EBVA 1CNVA 3LHWA 2R1MA 3CV6A 1XPYA 3GUWA 1YBQB 4D6FA 4LUTA 2PGRA 2EG8A 1XRVA 2NX3A 4GRSA 4UMBA 4XD4A 3UD6A 2DFAA 1QTWA 5AZ1A 2XVLA 4JTLA 2W79A 3CPRA 4LYRA 4RE0A 3W1NA 1W1A1 4QNWA 2PE4A 3THQA 3R07C 4L7ZA 3IUHA 3VGGA 3O07A 4BFAA 1BVZA 1NHPA 1BWLA 1US3A 3QV8A 2J7CA 3UWVA 1O1ZA 3USZA 4YCPA 3WKZA 2GGJA 4I9MA 3OEXA 2EPNA 2VT0A 2XJ7A 3APGA 2QS8A 4AVNA 4KQNA 3WCZA 3NVZB 2AAMA 4GXWA 2PA6A 2I9UA 2QCFA 1NAL1 2GR3A 1B3YA 2X30A 4RPPA 5AHMA 1LORA 5E93A 3JZEA 4BEUA 4WVXA 3S9ZA 5M1TA 4F0SA 1TTPA 4C6BA 3S9IA 1EJUC 1NOFA 4RDYA 2CETA 2Y2WA 1LG1A 4AC1X 2E9MA 4Q4PA 2C91A 4LRTA 3LA4A 3W1UA 2XIJA 3TX9A 2NQJA 1CGYA 1W3NA 3OA3A 1KXQA 1EZ2A 2J25A 2IPWA 4MY1A 4G2DA 1KFBA 5D9PA 2VZTA 4BV6A 3W7NA 6A3HA 3A4XA 2VX7A 3L2LA 1A3WA 4KBXA 3W26A 2PDKA 1HN1A 2GQAA 3ELFA 3WEZA 2XFWA 3PBMA 4XQ6A 4QE5A 2DZPA 3TYDA 4ML4A 4US5D 3B8WA 1A3XA 1OX4B 2G4FA 3MTWA 1Y65A 3TQKA 4QXIA 3GRSA 3RU8X 3B8TA 4P7NA 3WD1A 3TCSA 3N9KA 4Z1YA 1I9CB 3VMPA 3HO8A 3CIVA 1DP0A 3GXIA 1EF3A 3KRZA 4GNVA 1TE6A 4B3KA 3KVLA 1N8FA 3FEQA 1DJIA 4ML9A 1KBKA 3RYSA 1S2CA 1HKJA 2QCGA 4IF2A 3GXPA 3W2UA 1RP8A 2NT0A 1FFUC 1H1NA 1MXGA 3WDIA 1XYBA 2H90A 3WLRA 1ODUA 4F0KA 4FX8A 4H8VA 1H1ZA 1MQRA 4KPRA 3C4UA 1P43A 1XLEA 1CGUA 1H4PA 2ONEA 1N61C 3Q2DA 2QDHA 4NXSA 3ITTA 1L6YA 1PVNA 1QRQA 3GG0A 5XINA 4CGTA 4E4PA 1TIWA 4QBXA 5M5DA 3CIWA 2DW6A 3U2ZA 1D9EA 2QIIA 3HBLA 1HKVA 5M17A 2R1NA 2J7DA 3AUJA 3VIIA 4RXFA 3CQ0A 4AB4A 4UTFA 1OABA 4IIDA 3WLIA 3GU9A 4JICA 3VIHA 2NPXA 3IARA 1KV5A 1NTHA 1I2RA 4Q22A 1NJJA 3PBWA 3B06A 2OCZA 3SADA 3RPDA 2BOGX 1KCKA 4J27A 5EL1A 5DMLA 1MXDA 2O7QA 3NTYA 3UESA 3TA6A 1B31A 5AKQA 2I17A 5CQ1A 2REQB 4Z0SA 1ICPA 3PJTA 1TTIA 3BUVA 2QUNA 3WEOA 1VH7A 2Y8UA 2V2CA 3A47A 4IGMA 4O1FA 5GJNA 2EKCA 1PX4A 3LX9A 1PSCA 2P3EA 4H9VA 1LF1A 2PWVA 3A4WA 3E9AA 2W62A 3BCDA 3UCCA 1E5JA 1EJXC 4CQCA 3R6IA 3GH7A 3Q58A 1NDYA 3MYPA 2YL6A 1AW2A 3VGFA 1WA3A 3VD5A 1QI3A 4GYJA 5KEZA 4QX4A 4K8HA 1J0KA 1V02A 2OSYA 3IVTA 4C6NA 4WHBA 3ZR5A 3Q6JA 3KBWA 5EPDA 1QNPA 3UWWA 2YXGA 4I6VA 4D9PA 1GONA 3L66A 5GNYA 3IUDA 3HU7A 4U4MA 4Q8QA 1H2JA 3DOPA 4HHHA 5LZLA 3ANVA 4ADUA 5HMSA 4PCPA 1R9XA 3P67A 4HNVA 4BF9A 3NDZA 3HA1A 2OEMA 2HZGA 3A23A 4AYGA 2V3BA 2HISA 3M5VA 4IPIA 3STCA 1SR9A 5FOOA 4Y8FA 3SSZA 3TN3A 3WSUA 4Q8MA 3WJSA 1JD9A 2ZQ0A 1NPXA 3MI6A 3PSVA 1BZLA 4FNPA 1Q3NA 3O7UA 3LTYA 1VPQA 3WF0A 4DPQA 3ZSTA 4WGHA 2J62A 1QCWA 2P53A 1FWGC 1L8PA 4O28A 1E5NA 4C6MA 4Q8WA 1FKXA 1K8YA 4I9JA 2DQXA 2W5FA 1VEMA 1J01A 2CWNA 5BW6A 2POZA 3HQNA 2QJIA 1S1PA 4HKPA 3NQ2A 3NUKA 3L68A 1J11A 1SB3B 4XAZA 2JEPA 3VPLA 3PTDA 3UXLA 4A21A 4IHCA 4J2PA 2ZICA 2VZUA 3TA9A 2OZ0A 3C2VA 5J04A 3GH5A 3B8SA 1DWHM 1H1YA 1JZ3A 3R79A 4WZHA 3QW4B 1IWAA 3H2AA 4KEZA 1R2SA 5EA9A 2EPLX 3P60A 4XTDA 1FEBA 2XGBA 5I77A 2V3FA 1ME9A 1LL6A 4YCOA 2J7GA 4K7ZA 4E2OA 2FZ9A 4AF0A 1F7BA 2ZBTA 1CECA 4XZBA 1PAMA 3LYEA 2ZFAA 3ISIX 2GDUA 4HA3A 3N11A 3NWRA 2GVLA 3FAWA 2WLZA 1GKRA 3DBPA 2OTDA 4ZOHB 4O53A 1EHAA 5I6SA 2C79A 1Q4NX 3GDKA 1F4HA 1OCJA 3B9OA 1XLBA 1O94A 1F6PA 1Z48A 4D72A 4RE3A 2J9ZA 3SCSA 5D04C 1JUEA 2GRTA 2E4TA 4QQ3A 1OJTA 3UA4A 1JCNA 4DHGA 4DUOA 3PZUA 5I7GA 2OKOA 1S38A 1N8WA 5FEZA 4EWJA 1EH9A 4MKVA 3GR4A 1PEZA 2V5BA 3F2DA 2PTYA 3W72A 4AHPA 1XDIA 1RSCA 4QROA 1LVLA 3L5LA 2JF6A 4ACZB 2WZMA 3G1HA 3QOMA 3KOWA 5DMYA 3DYOA 1VCVA 2Q8XA 1UH4A 4XZ9A 4HZ6A 5BXPA 3MI2A 2JF7A 1ZDLA 2J13A 2PU1A 4H9MA 2C16A 3VX0A 6ALDA 2GJXB 4QG9A 4CEXC 3LPFA 2PTZA 5HWMA 5LYRA 1V93A 2QKFA 2XGIA 4JN6A 2GOKA 1E0XA 3IV8A 3PFRA 1VPXA 4RCXA 3NOEA 3HIJA 1TVPA 4AZCA 3UWUA 1S2TA 4B5NA 3ZM8A 2ZTJA 9XIMA 3CZKA 1K8XA 3DK8A 3W38A 1W9XA 3BW2A 3MKCA 5EMLA 5FF3A 3EB4A 3GW3A 4GVGA 1EJ7L 2G8ZA 2HPIA 4H8UA 5GJPA 1AUSL 4KIRA 4M80A 1X7IA 4G6CA 2GSEA 4IGHA 4UTLA 4YMZA 2UZ9A 4Y8EA 2IPFA 3VMOA 1Z3NA 4GQRA 4Q7BA 1M04A 3DAQA 1K4GA 3F5LA 3VC6A 3AHTA 2JK2A 3NL6A 4B15A 3PZTA 4U2YA 3E6EA 5BMXA 3L8KA 1AH4A 5E9AA 2JGYA 1QOQA 3AYVA 1SMAA 1E0WA 1PV8A 4M6QA 4QRNA 3BOXA 1PX8A 1VJSA 4GUHA 3QFEA 2H8XA 2IQ0A 2HXUA 1I2PA 4J35A 1YKWA 3U7VA 2RUSA 4DZ5A 4IQJA 2HK1A 2Y7FA 3IVUA 4GI9A 4RZ6A 4FF7A 2P0OA 3EWUA 3UR8A 4E4FA 2G4JA 2WKGA 3MHUA 2ZC8A 1JI2A 3A4JA 4AIBA 1NWRA 1FOBA 4J9JA 1HG3A 3SZ8A 4KGLA 2NUWA 2L5HA 5FL1A 4MZ1A 4NT0A 1JGMA 3VNKA 1MWOA 4GO9A 3QGVA 1R0MA 4TVYA 1ISXA 2VEFA 4WCJA 3VIFA 1TWWA 3SR6B 1V51A 3KP0A 8XIAA 2CW6A 4G9PA 3DHPA 1Q63A 4HZ8A 1LWIA 3KOFA 3HN3A 3SJ3A 2F6KA 1B1YA 4BWLC 3VE9A 3BDKA 2YB1A 1PBGA 1XGZA 1QATA 5J5RA 1JCJA 2DZSA 1Z6KA 4ORMA 2W91A 3VDBA 4NX5A 3P7YA 3ARVA 1K9EA 3LUTA 4S23A 5M2FX 2E3ZA 2OELA 1V79A 1IYXA 4DB7A 3SN0A 5BXSA 3V3WA 3GC2A 1QBAA 3P81A 1LOSA 4YTUA 4F2BA 5LA0A 1AQHA 3UXKA 1ZB5A 7TIMA 4JX4A 1IWBA 1JPDX 3PPCA 4S3BA 3VOGA 3WNPA 5IXEA 4EF9A 3AQUA 9CGTA 1LTDA 2D0HA 3B9NA 2OYKA 1O4UA 3BH4A 2CERA 3PG6A 5A8GA 4LEFA 2R91A 3ZQ9A 3W2JA 4OU1A 1XV8A 3ABSA 4QAWA 3WQDA 3HFYA 5E9XA 1X1NA 2XU2A 3QY7A 4H4ZA 3RCNA 1K7EA 1FH9A 1AQMA 2D2JA 2E40A 4GE8A 2XPKA 2NVCA 4PBFA 1E6NA 2BX7A 4YLWA 3TOPA 4MPKA 3CXBA 2RABA 5M3WA 1J6OA 4OV9A 3REQA 4GR1A 3G0XA 2E6FA 1RCOB 3QMTA 1QPKA 2WNWA 3WK3A 1QT1A 4HMCA 3M0MA 1XS2A 2UBPC 1TPB1 3MP4A 3DFTA 1FWWA 3DFQA 1DWAM 1XM3A 1RK5A 2WC7A 1NOUA 3LBOA 5I0DA 1MUMA 3LZ5A 1ZKQA 3G8EA 3BJFA 3H2MA 5HPCA 1TRIA 4LA1A 3B0UX 2YQUA 3LTSA 1TWZA 3LEPA 4WOZA 4PRTA 4FIRA 4X63A 5FKYA 4K1WA 5D4YA 5D03A 1MRQA 3CWNA 1NFGA 3UNTA 3W75A 1YBQA 3GVRA 3W25A 3W7HA 2BY1A 3P6LA 1QU4A 2XFFA 1C7SA 4QP0A 4ADSA 3ZJ6A 1ZCOA 2G3MA 4PR4A 8XIMA 3WNNA 5AC5A 1J12A 5A6KA 4B3LA 2ZZ6A 4G8TA 1Q65A 2PDMA 1QW7A 2INZA 2GGIA 5JCMA 2JE8A 3AS3A 3GXDA 2VFFA 3FA4A 2GR2A 3E2QA 4MADA 2WC4A 3M43A 3PN8A 3MI3A 5C9WA 1V0NA 4FX9A 2WBKA 3TTYA 1XCWA 4ZB0A 1WDWA 1N62C 1P1XA 4CU7A 4LC8A 5EMMA 1VCFA 3DG6A 4DPPA 4FXJA 3P61A 5AC4A 3TVAA 3JRKA 3O05A 5C2GA 3SM0A 1X8FA 3VIKA 1S5TA 1RVKA 1TX2A 3H2FA 3KBNA 2DH3A 4TOQA 3V36A 3BPWA 3IJ8A 1EC7A 1J4EA 2ICSA 2AMXA 2WBGA 4Q8PA 4K37A 1ZGDA 2GYIA 3BO9A 2X09A 2BGQA 2E8YA 1MW1A 1LRNA 4K3ZA 5CG7A 1PZ3A 3EMZA 3L12A 3S1UA 1RVGA 1V0LA 5G1MA 2OGJA 1QNOA 1AOGA 1YXYA 4ORIA 3TC6A 2UY2A 2GGGA 3SGGA 2MNRA 3TNOA 2PDFA 3HPFA 3THAA 2EXOA 2Z6IA 3FSTA 3FS2A 3LCLA 3SCUA 4BI7A 3IACA 4W93A 1OX4A 1MYRA 2VJXA 4UBPC 1IEVA 1OF6A 1SZNA 4XBSA 3TYBA 3IGSA 2PD5A 3W2KA 1HKWA 1XBYA 2ZDSA 4PA8A 3S6TA 2ZXBA 4Y7EA 3WQ8A 4BA0A 1THFD 2XIMA 2ALRA 4WKFA 1SVDA 3EA2A 3T2PA 1JAEA 4GGHA 3TTSA 3GDLA 2ZXQA 2V3GA 4TR9A 1KA9F 3AIVA 1X96A 1KW1A 4DJDC 3UWYA 5C9UA 3IPWA 4GVFA 2WXDM 1XIGA 1ZAIA 2D20A 2DU2A 3CM4A 1VCGA 1PIIA 3C0QA 2W3ZA 2NVKX 4F0RA 2CZEA 1R3VA 2WM1A 4QSHA 1W8GA 2X2YA 2CFFA 3PBYA 2OSXA 4W85A 3CMGA 1KBLA 3QPYA 4O8AA 2OOFA 3RU6A 5A8QA 1SJAA 3FXGA 1S1RA 4FXRA 4GC3A 4DBDA 1GGOA 3PUOA 5CXPA 2OXNA 4V33A 1GREA 4PODA 2OWXA 1FVPA 2ACQA 4DWSB 4UFLA 1E56A 4AZGA 4ZL1A 4YVVA 5IOBA 1GOXA 3TKFA 1EP3A 1KM2A 1XH0A 2P5NA 1JR1A 2AKZA 3W84A 3WD2A 2E9BA 4O50A 3PG9A 4FI4A 3W7GA 5LIUX 4QR6A 3GTIA 3WMCA 2EBNA 1V77A 2CU0A 4NVTA 2QV5A 4IPPA 1CDGA 4RX0A 2RGLA 2XG9A 4DO4A 1M01A 2JIEA 3O06A 4CKQA 1G7UA 3OB8A 2REQA 3MUAA 3WD0A 4Q4SA 5T91A 1WOAA 1UR8A 1XRFA 3CL7A 5DY3A 3CASA 3PZ9A 3EDFA 4JX5A 3WLNA 3DHDA 3AYSA 3LADA 3P93A 1FHLA 4B5SA 4UIOA 1EC8A 4LTSA 2A7RA 3WDHA 3V5CA 3WBXA 2DDXA 1FWAC 3BV4A 2Y61A 1Q1RA 4YS1A 1OFDA 5F4XA 3BARA 4NKCA 4E8DA 4JYDA 3W7MA 3EPOA 1UKTA 4JDYA 3LCWA 4JIRA 3PUDA 3RO8A 4IPJA 2YVJA 3AIQA 4PFHA 1Q45A 1QPNA 1US0A 2WVVB 3F7JA 5SWUA 4HT3A 1NWTA 1CGXA 2ZZ3A 3MYOA 1EWEA 1AODA 1CCWB 1BYAA 4H83A 1R9YA 3PB2A 4L65A 2ON3A 3I10A 3G0SA 3MO7A 1NQKA 3TYZA 3R25A 1K3UA 1W2VA 1VFHA 1KR1A 5CGQA 3TSMA 1FUYA 2J7HA 3RX2A 4EQRA 1A5MC 1TIMA 2Y6ZA 5K9DA 3EKLA 1NY1A 1NH6A 1B3WA 5U7SA 1N82A 3DFHA 1E4MM 3ZZ1A 2PWUA 4UR7A 1G4EA 1HP4A 3R12A 3KZSA 1ADSA 1EZWA 3GYCA 4HTYA 2FTPA 4TU1A 3VA8A 4GMEA 4ZZ9A 2VNCA 4NILA 5F2MA 1JDCA 3R2GA 1LQ0A 3UPMA 2YLLA 4ZO9A 2ZZ5A 1MO0A 3PTQA 4O14A 4DBSA 2NVAA 1K9DA 2C3CA 3OYZA 1JUKA 3VKJA 1K6WA 4W86A 2GGHA 4A3UA 5GRTA 3DERA 1H51A 3H6OA 2DZVA 1Z7AA 2A6LA 4NNCA 5I24A 2EAWA 3BG9A 4GC4A 5D2YA 4O0ZA 3ECQA 1B9ZA 4HCLA 2WHLA 8CGTA 2WBAA 3M0JA 2YX0A 5IFPA 2VFHA 5IFTA 1W31A 4Z1DA 1K02A 1AVAA 3SY1A 3GB6A 5LKYA 4N02A 1RBLA 4XISA 4XZWA 1GRAA 3PNZA 1W8SA 1VC4A 3ZIZA 4XD3A 4HVXA 4UTJA 5HOSA 1XD0A 4PCFA