2QGYA

Crystal structure of an enolase from the environmental genome shotgun sequencing of the sargasso sea
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
376
structure length
376
Chain Sequence
NQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAGLGIVIHEDILSELSIYSLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enolase from the environmental genome shotgun sequencing of
publication title Crystal structure of an enolase from the environmental genome shotgun sequencing of the Sargasso Sea.
rcsb
molecule tags Structural genomics, unknown function
total genus 140
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qgyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qgyA01
1XS2A 5IDZA 4GIRA 3D46A 3ES7A 3SQSA 2P8CA 2OVLA 4GMEA 2OG9A 3U9IA 3TWAA 2QVHA 3PWIA 1JDFA 2OPJA 4E5TA 3MSYA 4GGHA 1OEPA 2OKTA 2OLAA 3NZGA 3ZLGA 3HPFA 3JZUA 1L8PA 3QKEA 3TTEA 4DWDA 1BKHA 3FCPA 2XH4A 2PMQA 5ENLA 4GFIA 3OP2A 1R6WA 3MZNA 4GGBA 2GL5A 4DYEA 3UJRA 3R0KA 2PP1A 3PFRA 4HCHA 3V3WA 1MDLA 4E4FA 3S5SA 1MRAA 4H19A 4MKSA 4IL2A 2QDDA 3EEZA 4DN1A 5FJTA 4KT2A 4F4RA 5FJUA 3DGBA 3CT2A 3CYJA 3H8AA 3MKCA 2GDQA 3VDGA 3MWCA 3T4WA 3ENLA 1SJCA 1TZZA 1EBGA 3R0UA 1EC7A 4HCLA 2AL1A 3BJSA 4A3RA 1KKRA 2XH0A 3BOXA 1EC8A 4H1ZA 4IL0A 3OTRA 4IP5A 1JCTA 3CAWA 3DESA 3FV9A 4J3ZA 3FYYA 2PSNA 4JN7A 1R0MA 2XSXA 3UJ2A 1ECQA 7ENLA 1FHVA 3VC5A 4H83A 4E6MA 4Z1YA 1SJAA 3TJIA 3U4FA 1P48A 4G8TA 2QJNA 3I6EA 4HN8A 1KD0A 4IP4A 4H2HA 4ROPA 3IJQA 3UXKA 4IZGA 3TW9A 3FVDA 3B97A 2ONEA 3JW7A 2OZ8A 1YEYA 2QGYA 3P93A 3TQPA 3TWBA 2FYMA 1PDYA 1MNSA 1BQGA 2HNEA 4J1OA 3H12A 4HPNA 3OW1A 3UXLA 1RVKA 1IYXA 3MY9A 2P0IA 3D47A 3PK7A 2GSHA 2MNRA 2GGGA 3MQTA 3GC2A 2PU1A 2I5QA 2QJMA 4IHCA 2AKZA 1ONEA 5EU9A 3OPSA 3NXLA 3N4EA 2OFJA 1TE6A 3DERA 2PS2A 2PGWA 4KPLA 1SJBA 3P3BA 4A35A 4FP1A 3I6TA 5FJPA 4DHGA 3GY1A 4MMWA 1JPDX 1MUCA 3V5FA 2MUCA 3CB3A 1EC9A 4GYPA 3ZLHA 2POZA 2PA6A 5BOEA 3UCCA 2PTXA 4DX3A 3T8QA 6ENLA 3IJIA 2GGHA 3V4BA 3IK4A 1ELSA 3N6JA 3ZVIA 3MUCA 3N6HA 3EKGA 5J04A 3V5CA 1NELA 3THUA 4YWSA 3STPA 2PP0A 4IT1A 3T6CA 1WUEA 3OZMA 4GYPC 2PTYA 3VFCA 3DG6A 2ZC8A 2PCEA 4X2PA 3RITA 2XGZA 3DFYA 1JPMA 3GO2A 1F9CA 3SN1A 2GGJA 3N4FA 1P43A 3GD6A 2QDEA 3DG7A 3QPEA 1KCZA 3TJ4A 3ZLFA 3SJNA 3S47A 2PTZA 1PDZA 2AKMA 1EBHA 3R1ZA 4E8GA 2P88A 4HNLA 3JVAA 3Q4DA 2PP3A 2GGIA 3VCNA 4A6GA 3T9PA 2PGEA 2XH7A 4KEMA 1W6TA 3ZVHA 4E4UA 4ENLA 2QQ6A 3P0WA 2OO6A 2AL2A 4FI4A 4HYRA 1TKKA 3H70A 2PTWA 3TCSA 3UJSA 2ZADA 3DEQA 5FJOA 2HZGA 2NQLA 4KWSA 1SJDA 2OQYA 4G7FA 3DFHA 3K1GA 3ES8A 3CK5A 3H7VA 2RDXA 3QTPA 2P3ZA 2HXUA 3R25A 1KKOA 3UJFA 3DG3A 2PODA 3NO1A 2CHRA 3RR1A 3FXGA 2O56A 3UGVA 3DIPA 3VC6A 3TOYA 2PPGA 3OZYA 4ZCWA 2QJJA 4JHMA 4HCDA 4M0XA 3RCYA 2PU0A 3RO6A 2OX4A 4DXKA 3PWGA 4HNCA 4K1WA 3R11A 1FHUA 3R10A 4EWJA 4Z17A 4GISA 1DTNA 3NFUA 3QLDA 5FJRA 3SN0A 3RRAA 1XPYA 3FJ4A 3BSMA 4K8GA 2GGEA 2HXTA 2OZ3A 3UJEA 3SN4A 3SBFA 4MGGA 4ZA0A 3ZVHB 3SSZA 2FKPA 2DW7A 2DW6A 3IJLA 3DDMA 4JN8A 3RGTA 2AL2B 1WUFA 3VCCA 1NU5A 3VA8A 3KUMA 5BOFA 2OZTA 3QN3A 3UCDA 2P8BA 4K2SA 1MDRA 3Q45A 2XH2A 2OQHA 3CXOA 4M6UA 3I4KA 1E9IA
chains in the Genus database with same CATH superfamily
4LPCA 3E2SA 2V6AA 3ES7A 3VIFA 3WF2A 4UQ9A 1YBQA 1RP8A 3H55A 9CGTA 3GNPA 1UZ4A 3M5ZA 1TPH1 3WEMA 3VDCA 5KZMA 3CB8A 2D2GA 3MDUA 1H3GA 1EJVC 4JN6A 1R2RA 2FTYA 3TYUA 4DF0A 4HA3A 3OBAA 4DO7A 3FCPA 1IE7C 4RJEA 4UQCA 1W1ZA 4PB4A 2DSWA 1SSGA 1KGWA 1G9HA 1A5AA 1ITUA 3KBNA 3SCWA 1KB3A 1UZ1A 1GYLA 1NIUA 3DN5A 2PDPA 5I03A 2DDXA 4XZBA 3W1RA 4UFIA 3UJRA 3VNKA 2PP1A 4PGLA 3GZ3A 4TV5A 3V3WA 4AEEA 4F66A 1I2NA 1Q7ZA 1EUNA 4PUMA 3WLKX 1NDZA 3CL6A 2X0SA 1A3WA 3DGBA 1Q5MA 1FHLA 1TREA 2PDJA 1X97A 1VJZA 3IUHA 4B3ZA 1EL3A 1AK5A 3GD3A 2JQXA 2QCFA 2AL1A 1LRQA 4QJ1A 2H3DA 3SCNA 4JDYA 3K5XA 1W5PA 1KKRA 2W63A 3WL1A 3BOXA 1UD8A 3FXYA 3KCJA 4IJCA 4M19A 3M0HA 5CAKA 4H1ZA 3AHTA 4PB5A 3WLOA 1W5NA 4IP5A 3H4XA 4Z1CA 1XI3A 3RIKA 3MB9A 2VQTA 1ZK7A 4ZL1A 3W71A 3OLGA 1FWWA 4GINA 4XG1A 3IGSA 3DKLA 1U5JA 3APGA 3AHXA 4K7VA 1SO3A 3QR0A 4H7CA 5KSWA 3L4YA 1GVYA 4XO6A 2YVGA 1GRHA 2FH8A 3TYZA 4QIUA 4DVOA 1X2GA 3H2NA 1RHCA 4DBEA 4GCXA 2EG6A 2GVYA 4AZIA 3B8DA 3BL3A 1H7OA 3UXAA 2QGYA 3BMWA 1RPKA 3BLFA 4IQLA 5FL0A 4CEUC 2FYMA 3GTHA 2XVKA 3ARUA 1NM9A 2NXHA 5IHSA 2C91A 5KETA 3OW1A 4HA0A 3W75A 1ZENA 3H54A 4N42A 4O12A 5HNRA 1NFPA 1HVQA 2FFIA 2Z1BA 4XIMA 1JZ7A 2VP8A 5LNUA 4GVIA 3CS2A 4TXEA 2J7CA 1FWCC 1QK0A 3M0IA 4ZO6A 3Q2DA 3GB6A 4QR6A 1US3A 3N4EA 5A8QA 1MW0A 1JYWA 5LIKX 3FN9A 1CGWA 1LWHA 1TV8A 4Q8QA 3BV7A 4MMWA 1MFUA 2NQZA 1O5XA 1U1HA 4H8VA 5CSSA 2AMXA 3N2CA 3LV6A 5FEZA 1SZEA 5BMWA 4ZXOA 1DEDA 4UTFA 1QO5A 2EQ7A 3NOEA 2XHYA 3BWWA 2PLJA 2W55A 3T8QA 3NVVB 1XIHA 5F2GA 1XICA 2DH2A 4MNLA 3GRIA 3UNDA 4HTBA 1E55A 3IAPA 3QMSA 1Q13A 4H9VA 3SUUA 1WQ5A 4AZ7A 3SIZA 3GVWA 3S6OA 1G4TA 2UY5A 4TVYA 4KETA 3S8HA 2ACRA 3GVQA 1VIWA 1LT8A 3KZPA 1WDSA 3UERA 1EZ2A 3DJGX 3VNDA 2BY3A 1P1XA 2ABAA 1F9CA 4IMDA 4GD0A 3KS5A 1M03A 2C79A 2F5ZA 1K7XA 3CTTA 4WKHA 4O15A 1DXFA 3K8KA 4M3PA 1POJA 2WOQA 5JRBA 2FPTA 4N7QA 1A5UA 5BOOA 5F4WA 2J25A 2JALA 4AD1A 4YN5A 4HZMA 3Q4DA 3BAJA 1LCOA 3AIRA 3B4YA 1STZA 2XH7A 3WNPA 2X8HA 1EYWA 3RPTA 1W6TA 3TA6A 2ZZ3A 4AD3A 2ZIDA 3LQGA 3A6OA 2FJUB 3UR8A 4RZ5A 2BNJA 5C8BB 4LV9A 4C5YA 4WSHA 2D3LA 2BASA 1TKKA 1I1WA 3LXAA 5GRTA 4MLJA 4LF2A 5E93A 2PF0A 1XLIA 5CC6A 3KBJA 3BVJA 1SJDA 3WENA 3BOFA 4PUEA 2VELA 3Q58A 4O8AA 2ZUSA 5FMHA 1Z44A 3FG2P 1FWDC 3DFHA 1P4CA 2YCLA 4ZODA 5A8OA 3QTPA 2QCNA 2HVNA 4S2CA 1SFLA 2X05A 3WEOA 1UQYA 1UH4A 1QW8A 1L6SA 3QR3A 4CU6A 2J75A 2PDYA 1YNQA 3SQMA 2E09A 3FHQA 3EXTA 5EYWA 3PN8A 1PB0A 2J47A 4HBKA 5AHFA 5F1UA 2RAGA 4QDWA 5EMKA 4M8UA 4BZYA 4XISA 7XIMA 3T42A 1HJQA 2CLMA 3FSUA 1EUAA 1LM1A 1UW9A 4AD0A 3M4HA 3EOEA 4NZFA 3M7WA 1ZAJA 1J11A 3KTSA 3ZSSA 3NQEA 1SZGA 3PB0A 2R8WA 3OLDA 3VINA 5CJNA 4JKKA 1U1JA 1FOBA 3N6QA 2TODA 4GX8A 1KTBA 2PBOA 3CGTA 4WXYA 1I0DA 2X50A 4AX7A 1AQ0A 1H5VA 3S2CA 1SQ7A 1JEHA 5D2YA 3B8WA 4OFCA 4IISA 3IJLA 3SSJA 2D69A 3NDOA 2V3AA 8CGTA 1X6UA 3VA8A 3IK2A 3WD4A 5C0QA 3NO3A 3W7QA 4JPGA 4ZQCA 1ITQA 1Y65A 3Q45A 1QNRA 3V18A 4QAIA 3W1LA 4LALA 1UASA 2X7WA 3CU2A 4HP5A 2BC1A 2EQ8A 3NQDA 4Z2LA 3D46A 2FB2A 1RR2A 5EGRA 3A7RA 3FIGA 4KIRA 4RPPA 1ZJHA 1ITCA 3TMQA 4GY7A 5ABEA 3VKJA 1IIHA 2ZCGA 2R1KA 1I2QA 3VKKA 1PZ1A 3QZ6A 3FGCA 4RDVA 3ZFHA 3PZUA 2PGFA 5AB3A 4WJ8A 2I5GA 1B57A 3DAQA 3SQPA 2ZX9A 3EX1A 1LLZA 4EQWA 2F2HA 3E02A 3O1NA 4EOUA 5ENLA 5DRIA 3MI2A 4AVOA 1LUCB 1FRBA 2ZZ1A 3URHA 1U5VA 3W87A 2OTDA 1PHWA 1MXGA 2BVWA 3EOOA 3LG3A 4EF9A 4DO6A 3G8EA 1A5MC 2EPMX 4N02A 1XYLA 2W5FA 5A6LA 1UYQA 5GNYA 1GK8A 2XN2A 5F2IA 3WIJA 4Q8VA 3EKZA 1NHRA 2VL4A 1SYTA 3CJPA 6ALDA 1TV3A 1JXJA 1C8YA 4B2DA 3BAWA 2HJPA 1HN1A 5LIXX 3W1XA 3HV8A 2C8NA 4DJFA 4H9XA 1XLJA 3AUJA 4HNNA 5A94A 4U28A 1MUMA 1W3TA 2YW3A 3L68A 2XYLA 5I3DA 3CIVA 5FF2A 4W87A 1ZFJA 2QXWA 3VC5A 1UD4A 4Z1YA 2GPTA 1ZHAA 4JIHA 4OGZA 1OSEA 3QGAC 4N6EA 3GYEA 5DBTA 5I3FA 3FDGA 2DZPA 2O7QA 1OD8A 4OBRA 3UQNA 1CBGA 3GH5A 3V0SA 1X8FA 3TW9A 2ZE3A 4WOZA 5I3GA 2QMJA 3WO8A 5CBBA 4NRRA 1B4KA 3JW7A 3DECA 3N2BA 3JUGA 4S2BA 1VCVA 3W6YA 3TQPA 3OQ8A 1TR9A 3P7YA 5EPDA 3B9NA 1NEYA 4FOJA 4DF2A 3PZTA 1G7UA 3BLPX 3H12A 1QRQA 3LNMA 1XISA 3AS1A 1V02A 2WJEA 4PMRA 3BSGA 3LY0A 1HKWA 3LCIA 2W0UA 2WBAA 1TRDA 1KBLA 2WSQA 1K6WA 3QLLA 4WY0B 4F8XA 3STCA 1L6YA 3RU8X 1FEBA 3TLQA 4AFYA 3H7UA 3VXGA 4LNCA 2HQAA 2PB1A 4NP7A 3ZSTA 1H7RA 2FLIA 1UWTA 3LNPA 2YB4A 3BGAA 4EMWA 3LHTA 3F4VA 1QO2A 2TMDA 4DWSA 2FMNA 3L4UA 3NQMA 4FX9A 1C93A 3B9OA 1TSIA 3YPIA 3WQ8A 2A4AA 3WQPA 1B1YA 3SADA 1X6LA 3LCWA 1GWJA 2ZZ2A 2VENA 4IXXA 1HG3A 2YVFA 2NQHA 4ZENA 3TQVA 5HA7A 4HGXA 2HV5A 3F2DA 4QDPA 1BWLA 4U2ZA 1JL8A 1NOWA 2JEPA 3GTFA 3GO2A 1ADSA 1S5MA 2D20A 3SN1A 3TAOA 2EXOA 4PRTA 1ISYA 2QDEA 4KF1A 4GUJA 4F9JA 2VX7A 2DJXA 2HNHA 2PRLA 3EDFA 1TTJA 4AEFA 1E73M 1R3VA 2BX7A 1IXOA 1RD5A 1S2VA 3P84A 2NQ9A 3W1TA 3AC0A 5CGTA 4MDOA 2P88A 3A3HA 1JULA 4XD3A 4IPLA 4RCXA 3GQYA 3MHUA 1IXQA 1EF2A 3VCNA 2W0HA 3LD5A 1RCQA 3QY8A 3CTLA 5I79A 2EQ6A 1F3TA 4E4UA 3AJXA 3OIXA 1VD6A 4IX2A 2DZWA 4QNEA 1PYMA 1YYAA 3DHDA 3JU2A 1GUVA 1N7KA 1BWVA 4MY1A 1E70M 3TR2A 6CGTA 3N4AA 4IPNB 2OB3A 3OA5A 1LQAA 3KEHA 4J3SA 3HB9A 2Y63A 3L4XA 4EIVA 3PB2A 4GQQA 3DC8A 1J2WA 3GAKA 3M0ZA 3CIWA 4JGDA 5FAGA 3VABA 1H2IA 4LY8A 1AVAA 1UIOA 1AJ0A 4PMJA 3CHVA 3XINA 2XJ7A 4ZOAA 2DIKA 4F48A 2ZZ0A 2QAPA 3ARWA 3PJXA 4V28A 3UP8A 4JHMA 5AVNA 4G7EA 4JQAA 3MVIA 3GU9A 4GACA 4KIEA 1VENA 4ES4A 4REQB 1EOKA 5EMUA 2VEIA 3E5BA 4K1WA 3PZIA 3U2OA 4DF1A 1XUZA 2OO0A 4YHGA 3ZIZA 1J79A 3W7RA 2GK1B 1QW7A 2W4XA 4JTAA 2NSXA 3EF6A 1G4PA 3AFBA 1WE5A 3IWPA 2YFNA 4FNUA 1XH2A 3S9ZA 2C1GA 1YDYA 4MGGA 3P8JA 3ZVHB 4H8NA 1XIJA 4YYCA 1K3UA 4WDXA 1M9HA 3H21A 1TZ7A 4MFEA 4WSKA 4MVAA 3DYOA 3UCDA 1LBMA 1RK6A 4K2SA 4PB3A 4Q6XA 1HUVA 3HFTA 1IGWA 1E5JA 1BTMA 2EQ9A 1FFRA 5LA0A 5LHEA 1IT7A 4NZCA 2CU0A 2QIWA 2I17A 4ZB2A 2ZRXA 1HO1A 4JCLA 4B5VA 4PL1A 1OEPA 3WLHA 1HP5A 4LRSA 3TVAA 3AIEA 2RABA 4P7NA 3C52A 3WQOA 2FB3A 3THCA 1US2A 1O7AA 1TX2A 2W27A 4JXCA 4GJIA 4QISA 1XH0A 3KL3A 2WNZA 1GW1A 3BMVA 2J8TA 2C15A 4L6DA 3R0KA 1OX5A 2PE4A 1F3EA 3BG9A 1SR0A 7REQB 2NLYA 3U3HA 1PIFA 3BPWA 3L0KA 1GCYA 2X40A 1P5BA 1H2JA 2D2HA 2YCKX 1XDMA 2WOIA 3MWCA 3ENLA 1EGVA 4C1LA 4FNRA 1W2VA 3C2VA 3LB8A 1EBGA 4JFUA 4LV4A 1E0WA 3KCOA 4HCLA 3TJXA 1T8XA 3WBAA 3R8RA 1MEHA 2AQOA 3AIBA 1RBLA 1EC8A 1L6FA 1XGDA 1BF2A 3AMGA 4TVUA 3OTRA 4XK2A 4LUSA 1KWGA 3U2ZA 2ZUWA 4HU3A 3CEPA 3KLJA 7TIMA 5JVLA 3OGVA 1T0OA 1E6ZA 4ONVA 3BANA 3PUGA 4NNAA 1FTXA 1NF0A 1HGWA 4JNYA 2OSXA 5E09A 4DPQA 2Z27A 1SFTA 5D32A 3KL5A 1PTGA 4PEEA 2ZA1A 3H23A 3OB8A 3QGKC 3LOTA 3WQVA 3QHOA 4I8YA 1S3TC 4JY8A 5BCAA 4EF8A 2KZHA 1TV7A 1BQGA 2WO5A 3TH6A 3WD0A 4QS5A 5REQB 3T0AA 1LJYA 2CBUA 2D0HA 2Y88A 3UXLA 5A8GA 3OBEA 1PBGA 1I8JA 3IJ9A 2YL9A 3LLFA 1SZFA 5BRPA 1ZCCA 1XIDA 4Y8EA 3LRLA 2ZZ5A 1PVNA 2WMGA 4Q8WA 3NPWA 2NVCA 4YCPA 1FX6A 1EHAA 1IT0A 1XXXA 1PSCA 2NVKX 3WFZA 3MMUA 3BE7A 1P7TA 3VDBA 2PGWA 5E0KA 3P3BA 3WDHA 1RZMA 1KR1A 1O6IA 4A35A 4P8WA 4QEHA 1GOWA 4A3UA 3VIIA 1ICQA 4CCCA 3R4IA 4F2TA 1JPDX 4Q4PA 5ABFA 3SR6B 2MUCA 1OF6A 2CLHA 2R6OA 1TIMA 2O9OA 4NZJA 2WB5A 4B5WA 4Q4KA 3ATZA 2REQB 4J2PA 2POZA 5HATA 2BCPA 1A0CA 4DX3A 2RH9A 4JNZA 3G1SA 2QYGA 5FA5A 5LZLA 4HOWA 4QX4A 3VNZA 3N19B 4DZAA 1Q7MA 2A3CA 3REQA 3IK4A 1OYAA 1FWGC 1JDAA 1R3RA 2PWHA 3HGRA 1J0KA 1O5KA 1DJQA 1QI3A 1XLKA 1HJWA 4GJJA 3UGRA 3A4JA 2OX1A 3IIZA 4O1EA 1KFJA 3BXWA 3T6CA 3C2FA 4H4PA 3GSMA 3FX4A 3THAA 4JDRA 3ONCA 4O53A 4Z1AA 3VPLA 4POCA 4Q7BA 1ECEA 4S38A 1TQXA 2G3MA 5I5RA 3FFSA 2V5KA 1J6PA 1KCZA 4BJHA 1OY0A 1TYGA 5IXEA 1F74A 1IF2A 4AZGA 1LWIA 4LC6A 3EB2A 5A6TC 4LB4A 3CQIA 2NPXA 2WHKA 5T26A 1F8WA 3WF3A 1KC7A 4UTUA 3BICA 3ISIX 4H4TA 1BFNA 4KEMA 4Z2HA 1WAUA 4AAJA 3AIWA 3O8AA 1FCUA 2D0GA 1DQWA 4PUUA 5LIWX 1VAHA 3VOFA 1AH3A 3UPWA 4I3GA 1W9UA 2BG5A 2XIMA 1WNOA 1K70A 1GVRA 1L6GA 5C2CA 4L4OA 4L56A 3CH9A 2F9RA 3W6MA 1ZBKA 4ILSA 3TW6A 4Q6JA 3VNJA 2HDJA 4V27A 3EDKA 3HQNA 1RJRA 3H7VA 4M80A 4S3FA 1S7MA 5FL1A 3WN6A 2GOUA 3MCNA 2Z6IA 2J7EA 1V8EA 1TR1A 5E9XA 3T05A 3GW0A 3FKKA 1KM1A 4D6GA 4F79A 3W2JA 1YTDA 2CBJA 4LBSA 2XDFA 3B04A 2CDUA 1ZUAX 3GDMA 2GR2A 1UUQA 5FIPA 1EEPA 3GVGA 2ICSA 1I60A 1DIEA 3B0YA 3GR8A 3I6RA 3RHGA 1PWLA 1V3KA 4JKMA 3Q94A 3WH5A 2J62A 3OBKA 2NSOA 2A5HA 1WXYA 2DUXA 3S5NA 4DI8A 5MKGA 2B7OA 4MUZA 5LNVA 5KVIA 3MPGA 5IFPA 1Q6LA 3WMSA 4Y9AA 1F6PA 4EQXA 1H50A 2HXTA 4CQCA 3U2EA 1YXDA 3CUXA 3V75A 4Q8PA 2OWWA 1Q1RA 4HU0A 1DJWA 2QCDA 4UBPC 5AC6A 3B9JB 2AL2B 3NL2A 3MKKA 4GIAA 4P8VA 4M5PA 1UHVA 4CVWA 3TXZA 1SO5A 1XL9A 4XKMA 2OCZA 1K8XA 3DI1A 4JTIA 2F6KA 2HBXA 5HANA 3SCUA 4DB7A 4ZOEA 4DJEA 5D05A 1UR0A 3AHVA 1LBFA 3SQSA 3I3DA 1NH6A 3U9IA 4H4ZA 2OPJA 1J6OA 1CGVA 3URNA 2WPEA 3H4KA 1BXBA 2BGQA 3VIOA 3VOGA 3UD6A 2P3EA 1CGTA 2D22A 1F2JA 4AD5A 3TYCA 2WCAA 1Q6CA 2J9YA 3QC3A 3QY7A 1D7FA 4U3CA 4UOQA 2QNEA 5AYXA 3AN1A 3MI6A 5BU6A 2Q02A 2O4MA 4AY8A 1Q6RA 1XX1A 1MDLA 3EX2A 3UW6A 5AYZA 3W28A 2F7FA 1YXYA 2QF8A 1QNOA 1ESWA 1ZS2A 3GDRA 4RNIA 2Q8LA 2BWGA 3PZOA 4L7ZA 3NCOA 3PBMA 1WA3A 1QAPA 3QOKA 3RMJA 2JKAA 3LDVA 3LHUA 4D8AA 4MNJA 1V59A 1KQZA 1Q7QA 2CNCA 3IVTA 2ZZ7A 4NSBA 4DZ5A 3FJLA 1H51A 3VZXA 1YKWA 2DIEA 1V6VA 5TF0A 3QW4B 1EJ7L 3UWVA 5CBIA 4AZ5A 1UCWA 2J9XA 4IH3A 1DYSA 5I3KA 3MHFA 2WSKA 3E0IA 4M6PA 3CAWA 4PTNA 4PC8A 3LMYA 4HPJA 1TWWA 3H26A 4XBKA 4IUGA 2D23A 2E7FA 4DELA 1JROA 2R9RA 3PTDA 2VHLA 3OHMB 1EH9A 5M1TA 3UJ2A 7ENLA 3H2EA 1UP0A 2XTKA 4US6A 1UD5A 3TJIA 3CBWA 2NX9A 3EOSA 4TUFA 3RJXA 5C2GA 4PMYA 2VFEA 1VBHA 1KM0A 3IJQA 4QG9A 1VH7A 4U5KA 1XIGA 2YVJA 3T0DA 1ENUA 4L80A 5IDIA 1Z7AA 5HWNA 3HMCA 3OIHA 2PDWA 2Z1VA 3PFMA 3VD7A 4MJ4A 3PWAA 1VYRA 2POTA 1NDVA 4W88A 1JG9A 4C5ZA 4D71A 4W7UA 3CYVA 3EUB3 2GVLA 4PBEA 4PRWA 2YA0A 1B5TA 4UC5A 1DHPA 1QHZA 4AEOA 3MQTA 1W17A 2PU1A 3TNBA 1UROA 3WQ6A 3ABOA 4QHRA 1QI5A 2JBMA 2I5QA 3IGUA 1GQLA 2VZVA 4W8LA 3VD3A 3PP7A 3F5LA 4HN4A 5CPTA 1W9BM 4GC4A 4GQRA 1VJIA 4CCZA 4DYKA 3SO7A 3IIVA 3ANUA 3ABZA 3NL5A 5I3HA 3I6TA 4PSPA 5D30A 3FW6A 2FGZA 1RLDA 4UTWC 4PRRA 4S3CA 2W3SA 1IIGA 3V5FA 1WDPA 2WXDM 3B9EA 2DZSA 1VFFA 2VT0A 3CQ0A 3W29A 3LERA 2VRQA 3R8HA 2J8GA 2CFYA 2AAQA 2PGRA 4ICMA 3GFXA 2G4FA 4H6QA 2F2KA 3ME3A 2J7DA 1FIQB 3B40A 1E15A 3N34A 3CEUA 1LP6A 2OYMA 4TX6A 2PDQA 3N6HA 2GJNA 2ZX5A 1W1YA 1W3LA 3THUA 1EXBA 1ME8A 3MYOA 3ITXA 2BY2A 3STPA 3C3UA 2TPRA 2ZUUA 3KOFA 2XN0A 4PZVA 4C6MA 2DZUA 3EXRA 2QV4A 1ZX9A 2GGJA 4M1BA 5DT5A 3DH7A 4DJFC 2HCVA 4AISA 4R7JA 4X61A 3AM9A 4IPIA 1O94A 1E3XA 2ESCA 3R6IA 4ZFMA 2PRMA 4MB4A 3CGBA 1XDLA 4B2DD 2C16A 3V1PA 4D6FA 1C7TA 1ITXA 1KFKA 2OODA 1P0DA 3GS6A 4PMNA 3VIJA 3TQ0A 1DJXA 1UWRA 4JFWA 3C56A 1QNSA 3T9PA 1FH7A 2Y61A 1XHGA 2G0WA 4NZ5A 3TOPA 4E2OA 1S1PA 4OE7A 4TTUA 3DU0A 4CD5A 5D2TA 3V7PA 5DX7A 2GLKA 4RZBA 3E96A 1IV8A 4WX2A 4EP8C 3MHGA 4FS9A 3KVJA 3O2LA 5F7UA 4A22A 1FWSA 5FJOA 2V5CA 3SY1A 3WQ4A 5T9BG 4UQBA 1DXLA 2ZDSA 4AZHA 4E2DA 2FMOA 2ZBTA 2YZRA 2OWCA 1HX0A 4TO8A 3VGBA 3UZWA 1MQPA 3NYZA 1BXCA 1IZKA 1EX5A 4H4XA 2F84A 4M1RA 4Z1BA 1UD2A 2G96A 2O56A 3WY1A 4UFKA 4CN1A 1H6VA 1E6XM 3UZJA 4PBFA 4HMCA 5TD4A 2CKSA 1YLVA 5HJLA 1BG4A 3IC9A 3O0KA 4AIBA 3W7DA 3LK6A 2GFTA 3T8LA 1X98A 3BAKA 3C4UA 1DVJA 5D09A 1LRNA 3PWGA 1XKYA 1EQPA 2P76A 4DWSC 3R11A 3CUHA 1XYMA 1VPQA 1NDWA 4C6DA 4QCEA 1GREA 3AWNA 2W92A 4IM4A 4CNOA 1WDQA 1TZ9A 3ZQ9A 1CPUA 3NO5A 5HNUA 5JUVA 4H9YA 2IQDA 3BSMA 3OJGA 2OZ3A 5JIWA 4NXSA 1VEMA 4PMOA 3CNYA 1VF8A 3U5YA 1WUFA 3UY7A 1JGIA 1I75A 4PMZA 2P8BA 3VIHA 1E9IA 4ADUA 3MV01 4MNKA 4N0RA 4UTTA 4ATDA 1XLLA 3ARQA 1Q6DA 1X2HA 4IJRA 3MSYA 4UMBA 1GPWA 1MSSA 4N2YA 1FWJC 4FIRA 1MW3A 3QXBA 3SRFA 3LHVA 3KWSA 2EPHA 3NEVA 4XD5A 4V2XA 1BKHA 5KZDA 3C0LA 3CUGA 2A3EA 3MZNA 2GL5A 2CERA 2DSUA 3AXXA 3MSGA 3RYSA 3M43A 2WVSA 4KPRA 1V51A 1VYSX 2ACQA 3FKRA 1OT1A 3AZRA 1I4NA 1EQCA 2GVJA 4ZQNA 4IOTA 1A47A 1DXEA 1FXQA 3B9DA 1WKEA 5I3JA 2PWUA 4LCSA 5FJUA 1OWQA 2CHOA 4X3ZA 3A4XA 3MCMA 3RAOA 4KEUA 4RUBA 3UEQA 2VFFA 5EMYA 2FVKA 4W5UA 1EC7A 4Q8TA 1D8CA 2C7FA 1HW6A 1EA0A 2VJXA 3E0VA 2A79A 1HL8A 3EEGA 1G01A 4O0ZA 5LYRA 5KITA 1VZWA 1UC5A 1KW1A 2A8XA 1K4QA 2PSNA 5FJJA 4IF2A 3VYLA 2FZBA 2XSXA 2GYIA 3EWWA 4AYGA 3G3MA 2Y5SA 1VBRA 1F05A 4TX8A 4H04A 3U4FA 2OGYA 1AUSL 1DNCA 3U4AA 4UFJA 2PDNA 1DTUA 4O10A 4RPQA 1UJPA 1OIMA 3AZTA 1OCQA 5CC3A 1A80A 1YDNA 1W54A 4Q4QA 2ONEA 4B92A 2VGIA 5FEXA 1RK5A 2Y1HA 1T5AA 1U83A 3TWBA 1E43A 2CWNA 3SIMA 2BSLA 2EG7A 4B15A 1CXEA 7A3HA 4TIMA 1I1XA 3ITGA 1OQFA 3E49A 4J57A 2NV2A 3IIOA 3PBGA 3FHAA 3IIXA 3G8RA 3WLLA 4R7OA 1RALA 3A21A 4LAOA 3WUEA 2J79A 1TX0A 2VCBA 3TLLA 1XUUA 1DQUA 1EX1A 3GC2A 4IHCA 4J4KA 5F1VA 1NWRA 3BAYA 1ONEA 3HTWA 3ONBA 3GC4A 4Y90A 3B8IA 4HKPA 5C7HA 1X39A 5E9AA 1GOOA 2OEJA 3VGEA 3AALA 4C1NB 4WDTA 1K8YA 1XQKA 3PZQA 1CWYA 2RGLA 4XZWA 2YDRA 3CUZA 4AIUA 3FK4A 7TAAA 1VB9A 1AD1A 5CPMA 2Q3RA 4JTQA 2G95A 3F2BA 3L2LA 1OFPA 3TC3A 2CYGA 4K1GA 4KGJA 3WQ5A 5CZTA 2PLCA 4PMUA 4C6BA 3DC0A 1CI1A 5HNTA 3APYA 4QTGA 4CQBA 2X2YA 3FJ6A 3OLIA 4GVGA 2LLEA 3DGHA 4JYDA 1CYGA 3HU7A 2FFCA 1JCXA 3TW7A 2ZVRA 4YWSA 4G6CA 2PP0A 2INEA 4O4VA 4ERGA 3W7LA 4R9OA 4K7YA 3EA2A 4LNYA 1EJXC 4FLOA 3W7OA 2WPFA 3RLHA 3LB0A 4FLSA 2E28A 1GJPA 3CQHA 2EF9A 2Z2AA 1DIKA 3B8UA 2IS7A 3QPEA 3SURA 2V3DA 3GZAA 1GV4A 1W1A1 3NRZB 1WZMA 4QQ3A 1FFQA 2IQTA 3EWCA 1JF5A 2PDCA 3RUBL 2FH6A 3S6TA 1IQ8A 1NP2A 1EIXA 3UWEA 3WFLA 3KBVA 2GGIA 1MVYA 3NWRA 3CUFA 3C3NA 1RP9A 3GW3A 4UFMA 1NHPA 2PDUA 4NF7A 4L4MA 4AG0A 2YDQA 5E1QA 1ONWA 2PDBA 2J6VA 5G2IA 2DJLA 1OC5A 4QE1A 2NXIA 1X1ZA 3MJMA 1U5HA 3TCSA 1Z9AA 1IWAA 3CWOX 1TJ0A 4GR1A 3STEA 2QCGA 4A21A 3CPUA 2BHZA 4LUYA 3WLIA 2I9UA 1FH8A 1H1YA 3TNOA 4CVUA 5G2WA 4NXKA 1PXGA 4GYFA 2HBVA 4EM3A 1GKRA 5BROA 3C8FA 4G7EB 1SW3A 3DG3A 4UZSA 4CQ8A 4TOQA 3TC7A 3ANVA 2ISWA 1Z41A 1EO7A 1G5AA 1D7KA 3W2UA 1UKOA 3VTRA 3NM3A 4JR5A 2VOMA 2WPBA 2GVEA 1LUCA 1WPCA 3EXSA 3W37A 1QNVA 4D6DA 2L5HA 4TX9A 3ELFA 1DV7A 3KX6A 2Z25A 3RDKA 1FHUA 2WSRA 1WZAA 4DJDA 1NQKA 2IKGA 2H90A 5EL1A 5D9OA 3NPVA 4K8DA 2WMFA 3VUPA 1NTHA 4O16A 5DLCA 5BZAA 4YVXA 4MFDA 4X60A 4ZTXA 4K8GA 1CTNA 2B81A 4FLQA 3G0XA 2BC0A 2E5DA 4ZSTA 1W3KA 3TUUA 1F4HA 3O05A 4XSMA 3LTPA 1UR2A 3QKZA 4KRTA 3ARZA 2WV8A 4P5UA 3O63A 2BFGA 1C8QA 1I2PA 1NU5A 2OZTA 4EVZA 1F8IA 1UZDA 3L2MA 3M7SA 2OQHA 5TIMA 1VDVA 2D3NA 3I4KA 1X1OA 3BLDA 1VRXA 2IPFA 3QVQA 3NXFA 1EDGA 3B03A 2PAJA 3CHCA 3NVDA 3TZNA 3EPNA 2XSBA 3EWZA 3O3RA 1R47A 4F0HA 1JDCA 1NHSA 4FX6M 4GMEA 2QVHA 3IVSA 1ZTVA 5CGMA 1G94A 2FTPA 1V6UA 3KE0A 2CLEA 3OO2A 1KRCC 3GH4A 4C6NA 5BMXA 1J0JA 4HIBA 2ZZ4A 1TJRA 4CQAA 1C9WA 1IR1A 3PM6A 3C2OA 3KTXA 4K8EA 4OWGA 1VHNA 3W00A 5BYWA 2VFGA 1XYCA 1M01A 1JCJA 3PFRA 1VR6A 1ONXA 5IHRA 1C3FA 1E1CA 3GWQA 1NPXA 2FDMA 3HQ1A 4MKSA 3FVMA 1S39A 5IBXA 4DN1A 1RCOB 3WMCA 3P5YA 3POCA 4LVDA 3QC0A 4WY0A 3F5KA 3D0CA 1YHTA 4AHPA 2ATSA 1JYVA 5CH9A 2VVNA 1H09A 3CZGA 4C7GA 4WDWA 1BSIA 3IVUA 1QOQA 3VIMA 4YWOA 1BSLA 1MW2A 5HMFA 4IMCA 4O19A 4YCOA 3P81A 3L5AA 4WDUA 2INFA 4AC1X 3WUFA 1EWEA 4AB4A 3CMJA 2CW6A 3OVGA 2WSPA 5H1WA 3CV1A 5AYBA 5M2FX 2ZUTA 4EK7A 4GUGA 2DT1A 4XKYA 5KZEA 5C5YA 1S46A 3I7SA 1HT6A 2YB1A 3TC6A 4RX0A 3K8MA 4YHEA 4N9DA 5DT7A 1BD0A 1WDWA 3I6EA 3LYEA 1F07A 2E67A 3MUIA 2P1FA 3UXKA 4DNHA 1KGXA 3W1PA 3B97A 2Z6JA 1WDDA 3P93A 1J2BA 5GVJA 2QT3A 3DCPA 3MO7A 3Q67A 2SFPA 2GQWA 2X1UA 4HHMA 2HNEA 1EJUC 4IFKB 1N61C 2PDXA 1QDSA 1UKPA 5LA1A 3NG3A 1CLKA 2ZUVA 3URAA 2VGFA 1IYXA 3ZJ8A 2GQ3A 2I16A 5FF4A 3LXBA 4O13A 5FF3A 2MNRA 5JCLA 1JQVA 3BGGA 2OEMA 3LHWA 2BHYA 4ZQMA 4DJEC 3D3FA 2GR3A 3LPPA 3RLUA 2XWDA 3WH7A 2BHUA 2DZBA 5FSDC 4FXJA 2B7QA 1GTEA 3GRSA 3S83A 3TTYA 1D2KA 4FLRA 1QHPA 1PV8A 2O9PA 1SJBA 4R34A 5JIPA 2GJPA 1HKMA 3AXKA 3CGDA 3I7RA 2XVNA 2VUNA 1IZJA 1G4SA 4DUVA 2VX4A 3CH0A 4CGTA 2C1HA 2CLKA 4ADSA 3M0XA 1VBJA 2D2JA 3VO0A 3VM5A 1T41A 4GPNA 4ACYA 4Q4MA 2BS9A 4B4FA 1PZ3A 1EZWA 4ZOHB 4WLCA 4RDZA 4MPQA 4BA0A 5D37A 3W7CA 3TX9A 5CC7A 3U8GA 4LYQA 4HMNA 2YYUA 3S1GA 1M04A 1OVDA 2YX0A 1KRBC 2O7SA 3CZJA 4ZGYA 1I2OA 3LSCA 2ZWYA 2P53A 4GI8A 3DFYA 3K30A 3ZOAA 4IGSA 3WBEA 1JYXA 5JCMA 1F3WA 2O9RA 2WLZA 1DJHA 4PA8A 4ICCX 5FS6A 3F1QA 4I6VA 2R82A 4REQA 2Y0FA 3SECA 4JEJA 4V1YA 1HJSA 2PTZA 2AKMA 4NZ4A 4US5D 1E0TA 1BF6A 4OKDA 4TMBA 5E70A 2GK1A 4H4SA 4IIEA 4C6JA 2A21A 4HVXA 4A6GA 5F2MA 3K2GA 4BI7A 4GYKA 3SCTA 2NV9A 3VDAA 1SU5A 2PD9A 4W8AA 3ZVHA 2HK1A 4KKXA 4YWIA 2HISA 4D6IA 1E6RA 1Q6OA 2E6DA 1W3HA 1WOAA 1XBYA 2FVLA 3H70A 2B7NA 4PSRA 3K8LA 4Z0JA 3A22A 2HZGA 4UNIA 3I4EA 3NZ1A 2YBTA 4G7FA 1WV2A 3CK5A 5M3WA 1TV5A 2A0NA 1VKFA 2EKGA 4F0SA 3PF3A 3JS3A 3FXGA 5EFFA 1PPIA 4A8LA 1B3VA 4UMAA 3SR7A 3LPGA 2OOGA 4LS2A 2Y85A 5BU9A 1UMYA 1Z8AA 2JE8A 2J13A 2OMAA 1O5RA 3N9RA 4XAPA 3NQVA 3UR7A 3GIPA 3W26A 5CBJA 1S38A 1S3HA 3RCYA 3O16A 2WKLA 3ZS4A 2XVPA 4HZ6A 1GTHA 3NQ6A 1JF6A 3S2JA 1VCFA 2J88A 3GDLA 1GQIA 1RY8A 2ACUA 4MWAD 2VOTA 3L21A 1K9EA 2DP3A 4AWUA 4LFYA 3G5EA 4M7TA 2W54A 5DANA 5J8LA 1NJJA 5FJRA 3TP4A 1GKPA 2ZXDA 1CXLA 3UETA 1YQ2A 1BVNP 1LYXA 4XBJA 1I6NA 1EOMA 2CFFA 2IMRA 5HDRA 1YPFA 1QFEA 3IRDA 3RGTA 2IKHA 4DUOA 3SGGA 3MI3A 1DJZA 1VQTA 1M7OA 3SCQA 1A3XA 4PFHA 3SFKA 1A4MA 4X63A 3FOKA 4J40A 5A6BA 3MV11 5JMUA 3BO9A 3NPXA 4K3ZA 2ZDRA 1XS2A 4PTMA 1W1TA 2X8RA 4GLEA 3TWAA 3PWIA 6PTDA 1FFUC 1F4AA 3FSTA 4MB3A 4TQTA 2YIHA 3HPFA 5CG0A 4GY1A 4CEXC 2GJXB 3PNZA 2OZ0A 4O1FA 2DV0A 3WUGA 4YXGA 3SRHA 3EA3A 3AU2A 3LTSA 3PG8A 4GFIA 1QUMA 1BTCA 3WNNA 3S1VA 2Z7KA 3ZJ6A 5REQA 2W9MA 2R1MA 1KO0A 3MW7A 2WP5A 1MRAA 1JZ2A 2ZRYA 3W0KA 4D2JA 3AXIA 2X8CA 2VX5A 4U5IA 3AS3A 4MG4A 3ZWSA 4Q4SA 2EBNA 1TCDA 4W5ZA 3P0XA 2HS8A 5DBUA 1S5WA 5G4WA 3N2MA 4O17A 4ADTA 2E9LA 1UP3A 3NZRA 2WK2A 5CKSA 2YXXA 3HJZA 3A5VA 2W3RA 3BQ5A 4RNHA 4JX5A 2NT1A 5K9CA 4JL2A 3UZXA 1Q1WA 3QFEA 3T2PA 3HQPA 2XM1A 4TR9A 3TV8A 3VD4A 5DRCA 2V2HA 5CG7A 3HW2A 4ZB0A 1YNYA 2NXGA 2REQA 3RLVA 3WF0A 4H50A 4O11A 1QPKA 5J5RA 5LKYA 3AICA 3PZMA 2KX9A 3OEXA 1FWTA 2C3DA 4AD2A 3NJ3A 3CHEA 4D6JA 1VFSA 1Q85A 3TTSA 2DSZA 1T3QC 1QR7A 1ZL1A 2Y70A 4Q22A 5A5WA 3M0KA 4Q4RA 3DOPA 3BCJA 5DMYA 3QF0A 1E51A 3LCFA 2Z1KA 5JCKA 4CN4A 3GLCA 3M0MA 3UG5A 2GQAA 4D9PA 3VNLA 1PDYA 2PWGA 3HM7A 4IQJA 3K1DA 4BEQA 1AZ1A 2VDHA 4ZR8A 1HKJA 2UY2A 5DXXA 4MWAB 3VE9A 3UWQA 3G1FA 5DMMA 2ZOXA 4ASTA 3PK7A 4O57A 4HT3A 2PZNA 3K4DA 1C92A 4JX6A 1D9EA 1CDGA 3UA3A 1WXZA 3GK0A 3FAXA 3P67A 4FP1A 2ZRVA 4RXGA 1ICPA 3G6MA 4C6PA 1GQKA 4WVXA 4MM1A 5GQBA 4DZHA 1V77A 3CQJA 2RUSA 2CZDA 1HP4A 1VLIA 3MA8A 1OGBA 2VMFA 4X0NA 2IXUA 4NJKA 4J3VA 1JUEA 3QMRA 5EMJA 1N63C 4GXMA 3WK0A 4WKAA 2DZTA 4CU7A 1RY0A 2E5CA 1ISWA 3EKGA 4AHQA 3RMEA 2X30A 4H9UA 4P7OA 1BZLA 3N17A 2OR2A 1KBJA 2PTYA 1EIBA 1X7FA 2GJRA 3GR7A 3WUBA 4DXXA 3HURA 1A5BA 2PFHA 1WZKA 2UY3A 1B90A 2Y24A 1OINA 3L4VA 2ZA3A 5ER0A 1SVDA 2QF7A 4WXZA 1KV5A 1ADDA 2VCCA 3WMBA 4D6HA 4R5EA 3SJNA 3HG4A 3VKAA 4GZEA 2P5NA 4E0CA 2VCAA 2Q01A 4YTQA 2VZSA 3KFTA 3MMDA 3W7GA 3SZ8A 2B0MA 3R1ZA 4A3HA 1EDTA 4GNJA 2XUCA 3UZ5A 3W73A 4Y96A 1GRGA 4PBGA 4NYYA 3ZM8A 3GXFA 1KBBA 5LHFA 4RE0A 5M5DA 1OB0A 3F4WA 2AGKA 2FZ8A 2AGTA 1S2WA 3GU2A 4GO9A 5CSYA 1XFCA 2AL2A 1FXPA 4FI4A 1JAEA 1KBIA 2BB0A 3BURA 1CX9A 4AWEA 4CU8A 1TFVA 2A7RA 1XCXA 4CQDA 3DEQA 1RUSA 2BP1A 2BBFA 4CNNA 4QEEA 2ZZ6A 4JFSA 1BRLB 2X09A 1MNZA 3SGUA 3EWUA 2Z2UA 3VGDA 1W9DM 1LT7A 1UWQA 4NJGA 3L0NA 1AQMA 2FHCA 2HXUA 1A50A 5G2HA 5D9NA 5FSEC 1PYFA 2PODA 5HK4A 4Z1DA 1A5CA 4WD0A 3DFTA 4IG2A 4B5SA 3LV5A 2Y62A 1WXJA 2GUYA 2E77A 3STGA 1KXQA 3N04A 5IOBA 3H2OA 3MC5A 3A24A 3KRUA 3TROA 3P82A 3GD4A 3R94A 3N14A 1H7XA 3LTYA 3GDKA 2Q3OA 1AMKA 3SCPA 5LGZA 3NQBA 1K8CA 1CB2A 4HNCA 4ZQPA 4MUPA 3UVAA 2X0HA 2DZXA 2UWFA 5G4EA 3S9YA 2CITA 4UTLA 4AXNA 1XYAA 3AHZA 5C9ZA 5HMSA 1U33A 1ZB5A 1ZBCA 1NOFA 3UJEA 5EFDA 1GJWA 2R91A 3LLDA 1UWSA 4PMXA 5C70A 2QDGA 2A6LA 3OYZA 3PUEA 1GVQA 3SSZA 2YZ5A 3DDMA 4OUEA 3S3GA 1LWJA 4UR8A 1FWBC 3AS0A 2VYOA 1F8MA 3BW2A 4ZO8A 2Y6ZA 3NQCA 5CCZA 4ZQRA 3LRMA 3WD2A 4L4LA 3CHDA 1RPXA 1ZALA 5AC7A 1GSNA 4JFTA 4WSJA 3FLUA 2QHAA 5HWJA 2QR6A 2NWRA 4F0KA 1EJRC 1F6KA 1BG9A 1XFBA 1OJTA 3EDEA 5AHNA 2DVTA 3M64A 4B5UA 3AYVA 2OKTA 4NX0A 4ZE5A 3UZYA 1O95A 3CLWA 4MKVA 1O1HA 4AMCA 4BF9A 1L8PA 1RXOB 1ODUA 4E3TA 1D3CA 2H8ZA 2XH4A 1QWKA 4HNTA 4M6QA 2XN1A 1KM6A 4QG6A 3EPMA 1R6WA 3N2TA 4NEVA 3N12A 1S1RA 2OU4A 3L23A 1Z32X 2RDTA 3HF3A 2E25A 2QW5A 4AZCB 1XANA 1TTPA 3A4WA 3M5XA 1MOKA 1JCLA 1OFQA 1X1NA 4WZHA 3DHFA 3LLXA 3WNMA 3DENA 3AO0A 1BGAA 2QCEA 1I0BA 1LVLA 2V5BA 1YXCA 3MKCA 3NR0A 2UZ9A 3DKJA 1TZZA 3TMLA 3L7RA 4BEUA 4HYVA 2GQ8A 1RD6A 5JU6A 3KL0A 1OD0A 1CLVA 1TA3B 3CL7A 2XISA 4FNQA 1XIBA 1YMYA 2FVMA 2V2CA 3N2OA 1JCTA 5FESA 3AQUA 1OYCA 4KCWA 5AY7A 4FMVA 3EX6A 4CD4A 4IFOA 7CGTA 3GG8A 2G8ZA 2EGZA 3ZJ7A 1GVOA 1LLWA 2J4GA 2OJPA 2YCEA 3VKBA 3KTCA 2OYKA 2GZXA 1B31A 3OZOA 4RW3A 4H83A 3OQEA 4FALA 1P48A 4EXAA 2BTMA 3L5OA 2UY4A 5C9UA 3HN3A 5D8ZA 2VQUA 2Z26A 3EYPA 1PKNA 1CNVA 5DY2A 3M6YA 1TWSA 1ZGDA 5AHIA 1E72M 3WH6A 4XVDA 1ZZMA 3D9XA 1L8NA 2VR2A 1DKWA 4DXVA 1L0PA 4NT0A 4AUBA 4GH3A 1JUBA 3KVLA 3B0PA 1KFBA 1GVFA 1MNSA 1WP6A 4RL3A 4H4VA 1BYAA 1CT5A 2X41A 4R85A 3L65A 4DJDD 3KOYA 2ZX7A 3L9CA 1FO4A 1UBSA 5BXTA 3MY9A 2OSWA 4K7ZA 1GONA 4M56A 4LAUA 5A3HA 3HPAA 4GUHA 4L61A 3B0XA 2QJMA 2C3CA 1DHKA 4H01A 2OT0A 3PBWA 4OOUA 4UOZA 4BWLA 4LIIA 2OLSA 1F5ZA 2BLEA 3QFBA 1H60A 3S6DA 2WNNA 1AW5A 3MMTA 5EBKA 2VR5A 2HPIA 3GFZA 1DORA 1Q2SA 3HPSA 2WM0A 2WMIB 1Q65A 2V9DA 3AUOA 1NHQA 3HV9A 1EWDA 4B9YA 1DWFM 2GWGA 2NUXA 2R1PA 3W83A 2GGHA 1J0ZA 3M07A 1Q4WA 5IBXC 1RA0A 2G4JA 1TPC1 1IEWA 3W01A 3NVWB 1HIZA 3K4AA 3S0CA 1N62C 1A49A 2IXVA 4JTJA 3VK5A 4QNWA 5XIMA 1R85A 4I9AA 4GYPC 2GDUA 3R5EA 1PTDA 4H6EA 1W1PA 2ZC8A 3RITA 3SM0A 2G97A 4UIOA 2AAMA 1BYDA 1KCKA 2WZIA 1MUWA 5HAOA 4DUWA 2WKJA 4PMQA 4WHBA 2AQWA 3CMGA 1OCBA 4DAIA 3QW3A 1W1B1 1RCXB 1PTAA 1O5QA 3S47A 1K02A 1V7YA 4ICNA 3HIJA 1EBHA 4AY1A 1K9FA 1RV8A 2VWSA 3UCQA 5G1TA 2G37A 3AOFA 4WIWA 4XBSA 1GKQA 4CNPA 5A2BA 1FWEC 4D6EA 3SDOA 3W70A 4KCVA 4LW7A 4NI3A 4J35A 1VEOA 2Z7GA 4GH1A 2Q6ZA 3ARRA 5TAOA 4Y8FA 4FR6A 2NX1A 3H4GA 5D33A 1V6TA 4X22A 4IGNA 2QUUA 4LAKA 3L0GA 3T55A 1TPWA 5LGXA 3BSHA 3EDDA 3G77A 5FJIA 3II1A 1LOQA 4IX0A 3O7UA 2ASHA 3GIQA 4ORIA 3GUWA 2DY3A 3K1GA 1EA9C 4QGCA 1A3HA 2DUAA 3PSVA 3W81A 5F2LA 8XIAA 4AYSA 4NNCA 3GXTA 3T07A 4MJ2A 4Q32A 3E38A 2G3JA 2ISFA 4UXDA 3BMXA 1G0CA 3FNDA 4NZ3A 2WC7A 4I90A 1Q6QA 3BC9A 1XKJA 3E2RA 4MIMA 1JRCA 3TYDA 1UIPA 1MO0A 2QUVA 3ITYA 1J8VA 3DX5A 1XF0A 5I06A 3S5ZA 4HCDA 1PKMA 1V0LA 1JFXA 3RO6A 4X9SA 1JD7A 2OX4A 4RKAA 4NIRA 3LCXA 1ZNNA 1YE4A 2X16A 2H9AA 1WX0A 2X1TA 3ITTA 4B5NA 2EO7A 5LNRA 2WKGA 2D2OA 3P62A 4ATLA 6TAAA 1HNYA 3W25A 1Q4NX 2OQLA 3CASA 3ITOA 2VO5A 1UOZA 5TNVA 1PUDA 1H49A 2ATMA 3GTNA 4KCTA 1NWTA 4K36A 1W1VA 6XIMA 3VNMA 4ZA0A 2BGSA 3F4DA 2EPKX 2NLIA 1QMLA 2XWEA 1GOQA 4UTKA 3ARPA 2HE8A 2EPLX 4XQ6A 1GVEA 1BVWA 3TN3A 1BWCA 5C55A 1TJ2A 3II4A 4L64A 4JKLA 1P0EA 2QJGA 5JCNA 3DFPA 4JX4A 4QSFA 4JTKA 2ISVA 1S2CA 3MUY1 4AVFA 4N9BA 3FAWA 4KEVA 1UKSA 3M5YA 4AC7C 3J7HA 1D7YA 3O6AA 1LBLA 2YOCA 4GA8A 3NZGA 1ZY9A 3HGJA 2DT2A 2VGBA 1E1CB 1V0KA 3UVIA 2R9ZA 4WEVX 2PC8A 2G5WA 4KEZA 3T44A 2Z1XA 3A23A 3CWHA 1XGZA 4EANA 3Q37A 5FF0A 1SFSA 2DPEA 3KRBA 3P80A 3NVTA 1RSCA 1A5NC 1XIIA 4NU7A 5FCZA 3WBYA 3AISA 5CZ0A 2QDDA 1J9YA 1PX3A 1VJSA 1XLEA 4Y9NA 3BZJA 4BCEA 3CYJA 2VZUA 3H8AA 3B0VC 1W9VA 5H6HA 5DCDA 4J5NA 3OYXA 3DBPA 4DPPA 3QM3A 3NPUA 4C1NA 4N6FA 3OVQA 1LL7A 1K7EA 2EKCA 4XKYB 4KFOA 3USZA 4LVFA 4JICA 2QIIA 1JIBA 4XVEA 4CD6A 4O1DA 3N2XA 2VX6A 5DY3A 1J0YA 2ZXQA 4XD6A 1R0MA 1SW0A 3UYCA 1SR9A 3JZEA 4RE3A 1GETA 1ZY8A 1J18A 4AF0B 3U48A 1H5YA 2H8XA 4EXBA 5BW6A 1CXKA 4G8TA 1YIXA 3CM4A 2GVGA 4W7VA 4YIWA 3W1UA 1ML1A 4QCFA 3USBA 2VZOA 1XCFA 4H2CA 2RFGA 4HMEA 3LRKA 3FVDA 2QJIA 3IACA 2Y7GA 5A6KA 3V1HA 3ABXA 1FHDA 3ZXWA 3SGZA 3GRTA 3BW3A 1UWUA 3MUAA 1LOSA 1JPHA 1JQXA 5D4YA 5HMDA 2JIWA 3EWBX 3K13A 4A2SA 1BGGA 3IUDA 1E1EA 1UKTA 2GGGA 2ISDA 4MDPA 1NARA 1FY6A 5A6AA 1R2SA 4GKTA 2YDAA 1JDEA 1ONFA 4LJ3A 5A6MA 1XLFA 4JEQA 3A13A 3OPSA 4UMCA 2BXVA 4KWUA 3KRZA 3P14A 5A6BD 4AIOA 5GJNA 3OZPA 1ZPTA 4L9XA 1E1FA 2YBVA 3N25A 4FNPA 3MBDA 3N11A 3CC1A 5I24A 5TR3A 3N13A 2PA6A 3AWOA 1X8CA 4HPXA 4JHZA 5JBDA 4L1WA 2AQVA 5I6SA 4BI5A 4GRTA 3UPBA 4IGHA 4XUGA 3N9KA 5FEWA 4FB7A 1ELSA 3N6JA 1PAMA 1XCWA 3C6CA 1HJUA 4HK5A 3AYSA 4FF7A 1ZP4A 1YE6A 3ECQA 5BXRA 4IT1A 2WPCA 1JDDA 4G2DA 1IEQA 3GG0A 2XU2A 4DO5A 1TMHA 4C6LA 3C61A 3ARTA 1WKYA 1E71M 3KLKA 4QAWA 2XM2A 1R7OA 1XSIA 3GD6A 3P60A 2VEKA 4P7LA 2HPMA 1DQXA 4NHVA 3QQWA 1E6NA 3ZLFA 1LDCA 4GQBA 3T1GA 1PEZA 3IANA 4KESA 1KXVA 3PTKA 1E4IA 1NQ6A 3V5OA 2TYSA 5FD0A 4BHYA 4UR7A 1XYBA 1ZDLA 4R7WA 2QLYA 1OG0A 1JXKA 1W3IA 2BXZA 1XW8A 2VC6A 1R9ZA 1HJVA 1VCGA 3S4TA 3VKDA 2QPUA 3KVKA 1F61A 1GZGA 4INFA 4PR4A 3WBWA 1Q8JA 3VD5A 1VFHA 3THDA 4X0VA 2CXEA 4LBRA 1VBUA 3UJSA 1E4MM 2NQLA 4KWSA 3S42A 1JD9A 5M03A 3EMCA 3ES8A 2CZFA 2ZRWA 4LY4A 1YPXA 4KW2A 3W7IA 3PTMA 4HSHA 3M47A 1XLCA 3R25A 1GRFA 4TTGA 4N9CA 3W1NA 1NWSA 1MEWA 3U0HA 1J93A 1TPDA 3HZ3A 3THQA 2WHLA 4C6FA 1H61A 3TK7A 1FCVA 1PWMA 1X38A 2C19A 3GU1A 3FYPA 3DI0A 3OG2A 5AN7A 3NUKA 3TN6A 3UU0A 4QROA 4DLFA 1GG0A 2I1OA 3GVVA 1JRPA 2DQXA 4M0XA 2PU0A 2FGBA 4KRUA 1QNQA 1W0MA 3W7EA 4LUTA 1JI1A 3HOJA 4RZ6A 9XIMA 1DTNA 4XTIA 1XRFA 4G9PA 1RH9A 4XZHA 1WCGA 5BRQA 1UD3A 1C9DA 1PKLA 3UG4A 1E3ZA 3H53A 3PHAA 5CLWA 1OFBA 3GAYA 2BODX 3KZSA 4L9YA 3NYDA 1IEXA 2OEKA 1YTKA 1POKA 5BWFA 3SAZA 4EMJA 1V0NA 4GC3A 4MAZA 2XFRA 2OYLA 3T0TA 3KP0A 4XAYA 2CETA 2PC4A 1W31A 4IICA 1R9XA 5E6ZA 2XH2A 5DELA 5AZ1A 3RU6A 2PDHA 3CV7A 4LYPA 4EAMA 3UFYA 2V5LA 1LORA 3D5HA 4FA3A 4ACZB 4FIQA 4A8IA 1OZMA 4DI9A 1OHLA 4JAWA 3BLOA 4PCNA 5HQEA 5JCIA 1MI3A 5D2VA 3PTQA 4E5TA 1JZ8A 4UTHA 1EFZA 1E0VA 1O12A 4W7WA 3RM9A 2GR1A 1S2AA 3VAVA 3KS6A 3CQKA 2YDSA 4PUNA 4C6QA 4ZZ9A 4BQ3A 3SUSA 3PAJA 2PMQA 1JVNA 3P61A 4JQ4A 1FVPA 1Z42A 2WM1A 4GBDA 1WBJA 2ON3A 4IFKA 4EXQA 2E9BA 1TPFA 2WWCA 4ZBCA 4S3JA 2J8FA 4NZ1A 3TYAA 3S5SA 1LZOA 1N8WA 1MWOA 1FDYA 4ZTYA 3ZR5A 2XINA 4NAFB 5FS7A 4Q8NA 3TXVA 4F4RA 3V0TA 1VFTA 3BZGA 1DWGM 1GEUA 2J7FA 2GUBA 4JTLA 3VIPA 3Q6JA 1ICSA 4QLLA 2X99A 3T4WA 3CXBA 4D1JA 2CZ5A 3M1ZA 4RZ4A 3B9AA 3R8GA 4S1FA 1MXSA 1W5OA 1KXHA 4JQ9A 3I10A 2PURA 2JKPA 3G24A 1XRVA 3JRKA 2PEVA 5C54A 2DSVA 2DFAA 4BQ4A 8RUCA 3TTQA 4HYWA 2VD8A 5AVHA 2ISSA 5C2XA 5HULA 2HEJA 3UPMA 2QV5A 3I3EA 2PTDA 4P2VA 1VGAA 4W8BA 4Q4OA 2E1DA 3SUVA 3L2IA 1FHVA 2ZE0A 2F61A 3HG2A 4W89A 5PTDA 1JZ6A 3RO8A 1KTCA 1WB0A 3R12A 5BXPA 1VFMA 4DBWA 1KA9F 1FECA 2VXNA 1MQQA 3P5ZA 2OZ8A 4LX4A 3T08A 4N4PA 2YAUA 3LI1A 3LM7A 1M3UA 3A3WA 4RK8A 2HROA 5ABGA 4FHAA 5K9XA 3RG6A 1AFSA 1O66A 2HQMA 4O0QA 1U1UA 3PNUA 1GEHA 1HO4A 4JOMA 2JK6A 2XGIA 5GJPA 2I5IA 3HA1A 4EX4A 3EWXA 2BY1A 3R79A 5C9RA 4S23A 1OGGA 4FDCB 3TZFA 1T96A 3MUZ1 1UWIA 3NIYA 1OBAA 4ZXLA 1KFLA 2OXNA 2F6XA 4QSHA 2JGQA 4DHGA 1K77A 3VD9A 1M68A 2ZTKA 1M1BA 4V1XA 4V15A 1SZRA 1MUCA 5CSRA 1AQFA 1YRRA 5I23A 2DVXA 4XTDA 1GESA 4WRHA 2ABBA 1M6JA 4HMDA 5J5DA 2DZAA 3M0VA 1G7VA 2QS8A 1UJQA 5F4SA 6ENLA 3L12A 2WJFA 2E5AA 3IJIA 2QDHA 4GBUA 1TV2A 1QATA 4JTSA 3BAIA 4WK9A 4Q3MA 4XWUA 2OOFA 4BS0A 1TVNA 3K4WA 2INZA 5J04A 5JH2A 4L65A 1KM2A 3V5CA 4OV4A 1XBZA 2ZQ0A 4ECLA 3H22A 5FKYA 3KVMA 2NUWA 2VZTA 5H8UA 1N60C 3GNXA 4U31A 5EB8A 3UT0A 1XGEA 3TKFA 1MFVA 4HNVA 2HRWA 1G4EA 1XSJA 3TFCA 5LNSA 1JPMA 1UC4A 4RNFA 1Q45A 4NG3A 1QCWA 4Q8UA 3AYRA 5K9DA 4FXRA 4RLIA 1L9WA 5T91A 2W91A 3E74A 3LPFA 1IGSA 3GE7A 1RBAA 2QPXA 4FOUA 4I9TA 4UZUA 1OX4B 4QXIA 3O6CA 4JTHA 3PSWA 1PDZA 3BUVA 1P1MA 4GOAA 1EYEA 4E8GA 3GNNA 4FOKA 1SO6A 2V5JA 2A7NA 3JVAA 1WYGA 1RAKA 1QWGA 3VU2A 3FY1A 1QBAA 4EPDC 3JR2A 3TYEA 4FZIA 3GG7A 4KERA 4OV9A 3O6DA 3PULA 3MBFA 3MANA 4OIFA 4C6EA 5AYYA 3QPYA 3PZGA 5G1YA 4JTCA 2EG8A 2FGLA 2Y2WA 1E6QM 2CWXA 3A7UA 1R30A 4IG2B 1JPKA 2ZA2A 4J7RA 3BLKA 4ZMGA 3V36A 2E68A 4OZOA 3GTIA 4B3KA 1NFBA 5H8PA 4HNUA 1KKOA 3OLEA 4HOZA 1EXPA 3WH8A 4NY2A 3B4UA 2DORA 4ZEPA 2YPIA 3APTA 3CZ8A 4W84A 2GJXA 1UA7A 2VDGA 1VFUA 3VNYA 3LI0A 4BWLC 2CPUA 5G1MA 4DAFA 4JHOA 5HOSA 1ZMCA 1KQYA 1QT1A 1XDJA 1DBTA 1OK6A 4R88A 2X7VA 2OELA 2C1IA 4F0LA 4JTGA 4US5A 3ARYA 3CLMA 4Y9PA 1VQZA 5JXQA 1T40A 1TO3A 1UOKA 2VURA 3PR2A 1TELA 4C65A 4Z17A 1XR2A 5EY5A 3E0WA 1EJTC 3RNDA 5E0CA 3UF9A 3QHNA 3MMWA 5JQ9A 2HK0A 1FEAA 3WQWA 3FJ4A 3BARA 4YVVA 4HQVA 1XLDA 4MF4A 5GNZA 2Y8UA 1GPFA 1OABA 1THFD 4XAFA 1ZJAA 2CLPA 2PWVA 3N29A 3GNOA 5AHLA 1R3YA 1ADOA 2IKJA 4Y6GA 2X1IA 1L2QA 4MZ8A 2WCSA 2CEQA 4QDMA 1XC4A 5BOFA 5BWAA 2VC5A 1YNPA 1M53A 1VPYA 3QQ0A 1QPRA 4MTVA 1XINA 1ZJIA 2PDFA 1EF3A 3DBNA 4H4RA 4GIRA 4UTJA 3N73A 5ECVA 4JD4A 2VRJA 1FCQA 4ZO9A 5I02A 1Z89A 3SRKA 1OIFA 3PBYA 3BGJA 5HINA 5M17A 2VWTA 4NJJA 2CHNA 5LNWA 3VMNA 4BV6A 3DFOA 3ZLGA 3ZYZA 1KV8A 1V5XA 1AOGA 3NEHA 5I77A 3UY8A 4H9MA 2XIQA 1DP0A 3LN3A 4GGBA 3W84A 5JBEA 3OU8A 4A05A 1VPXA 3GR4A 3TJLA 4J3XA 4YVPA 5G4HC 4MWAA 4K68A 3ALGA 2PDLA 4OUIA 4HCHA 3SEPA 5H91A 4S39A 5K2ZA 1JJKA 4JS3A 3AMDA 1JZ4A 4UOJA 5C6MA 1R2TA 4IFRA 4GE8A 3VCRA 1NY1A 2R14A 3W23A 2DUZA 3FA5A 3W82A 2QKFA 4EPKA 1GOKA 4F2UA 1ZJBA 5CC5A 3PVFA 4W4QA 4AMAA 3U5UA 2HE5A 5FEPA 2J66A 1IT8A 1GRBA 3WJYA 1JOAA 2FQIA 4XSLA 4IIHA 4PTWA 1B3WA 3ICJA 1KNWA 3EPOA 1EHNA 1ONRA 4LWWA 1CCWB 4DBSA 3LBOA 2RDUA 3FV9A 4GI6A 4J3ZA 4PUKA 2DEPA 5HUPA 2QEZA 1N5XA 5A95A 1BWKA 4HA1A 5K3VA 3DFQA 2WHJA 4OVXA 4B9ZA 3RF9A 4AY7A 3M44A 4E6MA 3MP4A 1FBAA 4QS6A 2WCGA 4HZ7A 4CCEA 3VGFA 5JBFA 3N1AA 3TDFA 4RXFA 1KD0A 1IEVA 2ANUA 4IP4A 3E3HA 3AIUA 4DYJA 2VEMA 4H2HA 3V0UA 4HB7A 1PS9A 2YKKA 2XIIA 4P7QA 3COTA 1PL9A 4IZGA 1V3MA 3HJEA 1VRDA 2CBVA 3IARA 1T8QA 1B0IA 2G3FA 2ZXAA 3KLLA 2HVOA 1QNPA 2QUTA 3GTXA 3CPGA 3NS1B 4J1OA 4K8HA 3MO4A 3WBXA 4YTTA 1H11A 4HPNA 4A29A 3G22A 1ISXA 4QLKA 4P61A 2GUUA 4UTWA 3NSNA 5KEZA 1FFVC 1T99A 3G6LA 4ML4A 4PFMA 1KM3A 3NVYB 2OSYA 4RDYA 2V3BA 2VKZG 3U7VA 2QPSA 1Y5VA 1EDQA 4NASA 1V03A 1P0BA 1CB7B 2TRSA 3ERPA 4AU0A 1OGSA 1OYBA 3BV4A 1KFEA 3BLEA 4H3DA 1E5NA 4LYRA 4IMGA 4M6VA 3GY1A 4Q7IA 3ZMRA 4PODA 4YYFA 2A3LA 1E0UA 4XUYA 3QY6A 1U22A 4H4IA 4NJIA 4UQAA 4RE2A 3W7KA 3ZT7A 4JIQA 3DHPA 4NRSA 2Z29A 3BOLA 2R1NA 2Q8ZA 3S1XA 4JIPA 5U25A 1TG7A 3HPZA 4PMDA 1OFDA 2QCLA 2YJQA 2O9TA 1BRLA 2WVVB 3GM8A 4C91A 3O06A 4K6AA 4HK7A 3W85A 4M52A 3RILA 4GCAA 4MLRA 3WL0A 1O60A 4BK9A 4W85A 3M16A 2WJDA 4GYJA 1UR1A 1W8SA 3MTWA 4HPHA 3WSUA 1TVPA 3STFA 3SCSA 2VUYA 1BHGA 4DQWA 4R9XA 3P2VA 3WKZA 5DF0A 4ML9A 5G5IA 4FK9A 3H6OA 3DUGA 4FF5A 1BKSA 3RLGA 1UMLA 7PTDA 3A4AA 1AD4A 2Y7FA 3TAKA 3VVGA 4YJ5A 4LS0A 4HPGA 1GOIA 4V33A 2VR4A 1J96A 3VOIA 1OCJA 1V6XA 4Z2GA 2E6FA 1NWUA 3NL3A 3NGFA 5AHEA 1SSDA 4HNLA 5CPLA 2DT3A 2YFOA 1XPGA 2B7PA 3OA3A 1WO2A 4I7WA 1UZHA 2V0TA 2BDQA 2EEXA 4LRTA 1RBOB 3DGZA 2IQ0A 2DQWA 3P0WA 3G1AA 1CGYA 4GIYA 1GZ1A 4HYRA 4GQGA 4LTSA 5AECA 2VFDA 4FEZA 3T2QA 1R3TA 4BKNA 3WK3A 3M0JA 3W22A 1OG6A 4LVBA 1OFOA 3PG9A 8A3HA 2ZZBA 2VC7A 3QZAA 4YNGA 2OQYA 1BPLB 1K1DA 3T09A 2G3IA 4C6IA 2QUNA 3A9BA 3UG8A 3CWNA 2W61A 4NEWA 1HKVA 2XVLA 4IIBA 1CEOA 3NO1A 3RR1A 3TQKA 5FAJA 1OFRA 2YA2A 3SCRA 3VC6A 2H9AB 1D3GA 1EP3A 3LX9A 3QFAA 1D3HA 2V3EA 3EGJA 1V7AA 4S3DA 5AOUA 1VIZA 1U30A 3FS2A 3D3AA 2JIEA 4AZCA 3T4CA 3VX0A 2ACSA 2FHBA 2XZ9A 4CUCA 1DWHM 3ITVA 4AWTA 4RV3A 5CPQA 2V69A 3A7AA 3HO8A 1H7PA 3WJSA 3WLMA 1NF7A 3E0LA 2NQ5A 2VRKA 5G5HB 3W7PA 5K4XA 3P8IA 2QMKA 2B4GA 1W9PA 2VNCA 2UV8G 3UWYA 2OKOA 2P10A 3QGVA 4FXFA 1TA3A 5I3IA 1HVXA 4CQ9A 3AXMA 2DW7A 4D8ZA 2A1YA 2CZVA 1K4HA 3WEZA 3VCCA 1TUFA 2XIJA 4DEFA 3KOXA 3AZSA 4HNOA 3UWZA 4XZ9A 4GRSA 4PCFA 3OGRA 1P6WA 2OG9A 3W24A 4BQ5A 1JDFA 1N82A 3TSBA 2EJ1A 4WUIA 3MS8A 4GGHA 4HU8A 4P8UA 2GJLA 2EQDA 4LEQA 4GJ1A 2OLAA 1E56A 3W53A 1F73A 3AROA 2O92A 5I7GA 4AD4A 5I00A 3FDKA 4YPJA 3IGXA 2ZRUA 3SI9A 1S5VA 1XG3A 3OP2A 3O07A 4M24A 1C91A 3H7RA 2WNWA 3N9SA 2R1LA 4D72A 3G2GA 2OT1A 1UKQA 1E6PA 3S5OA 3F7JA 3BQ6A 4HK6A 3FEQA 4PYSA 2NV1A 4H19A 2C13A 1EB3A 1LL4A 3AMZA 3EEZA 3B8SA 4PUJA 1VEPA 4Y2WA 3G1YA 3CT2A 2PRHA 5D9MA 4ORMA 2GDQA 4KH2A 3GXIA 4C1KA 2VEPA 4QITA 3MUXA 3WELA 1J4EA 4M7SA 1O68A 3W74A 2WZEA 3QV8A 4L9ZA 4ZOBA 5XIAA 3EDJA 4PEKA 5BXSA 1M65A 5HXMA 2UBPC 3PJWA 1HXJA 3EOLA 3KCLA 2H6RA 1MW1A 4AQLA 3PPCA 3CAQA 3OGSA 2Z24A 2WC4A 2WMIA 4DM1A 4L6OA 2A2IA 4HU4A 3A3XA 4KWVA 4ZE4A 5D02A 2V82A 3P74A 2P0OA 5IFTA 1PIIA 4WGXA 3TSMA 3WDQA 3WH9A 4GY0A 1VYPX 4UTMA 3PY2A 2XFFA 2I14A 3KP1A 3SB0A 1JEZA 4O1BA 4EQRA 1XBXA 1DJNA 3ARVA 3ITCA 4MNMA 4TVDA 3LGGA 1LLOA 1XM3A 3QH2A 1E40A 4WCJA 3GXPA 2OWXA 1VBGA 3LM3A 5JH1A 2O55A 3DK4A 2FHFA 6REQB 4CD7A 2CXGA 4P8XA 3LUTA 4X2RA 4DNMA 3G0SA 1TB3A 1FKXA 1RA5A 3AI0A 4O54A 3UZZA 2WLYA 1GT8A 3A12A 2WZHA 5HMEA 2ZYFA 2P0IA 4D1IA 3VGGA 3C86A 4JIEA 5CLTA 2A6NA 4CKQA 2IPGA 3ETRB 3GC5A 3H2CA 4PCPA 4XZIA 1OZQA 3MZ2A 3AIVA 4IIGA 4HOXA 3RN6A 4BF7A 4KFNA 1JRBA 5CPNA 3VIGA 5CEWA 5A8MA 2DIJA 4BY3A 2EAWA 1M41A 4O0KA 1TYPA 3OVRA 1E4LA 5KZ6A 2C0AA 2DT0A 4JY9A 1FWFC 4XV0A 1EGZA 2IPJA 3VDHA 3WQEA 5U7SA 1QI2A 1M6IA 3MKVA 1QPNA 1EJSC 2CLLA 5G5GB 3NZQA 3KAOA 4LAMA 4EKJA 2ZKMX 2WHMA 4NL1A 1MZHA 5DXYA 3UESA 1WUEA 2ADAA 6XIAA 3CAVA 4X2PA 4KGLA 1PX8A 3GXNA 3UWWA 3WLQA 2A85A 2HVMA 4Z2IA 3N4FA 3NGJA 4GZJA 1FP8A 4MJMA 4IP7A 4BI6A 1UB3A 5DMLA 3MWAA 1OJXA 3MP3A 2FPYA 3T7VA 4HA4A 3GXDA 3GXMA 1AH0A 4JIRA 1QBBA 3H2FA 4GO8A 3QRHA 1U2YA 3GDTA 1BXNA 4H8UA 1ODZA 1LQ2A 4JYEA 1R3WA 5D2XA 3C2EA 4EWND 4MKNA 3SQLA 1AW2A 3WDIA 3AYTA 4A8RA 4WF7A 4O52A 3FA4A 4C6OA 2E6AA 2ZXBA 3QQ1A 4NAEB 2GDVA 4HSOA 4I6KA 3G3DA 1A53A 1LG1A 1UD6A 1MZRA 4K38A 1P6BA 1QPQA 3PPHA 2NUYA 2PTWA 1Q6EA 2VDIA 2ZADA 3A5FA 3LENA 2PLKA 4G1KA 3UXDA 1ZKQA 4LS1A 2E3TA 5I09A 5LXXA 2WNQA 1EP1A 5U1OA 4U4MA 3EKLA 3MT1A 1WZLA 4MYAA 1Q63A 1RJPA 1CXFA 1TYTA 4PTXA 1H4PA 4URIA 2PF8A 5EMMA 3N18A 4LUTB 3NQGA 4ADWA 5SWUA 4YL2A 2RJGA 1KRAC 3W76A 2Y89A 1CGUA 3HG5A 3GNRA 2BOEX 1UR4A 3W1QA 3GFYA 4MB5A 5A8PA 4ZCWA 3DXIA 1XD1A 4O28A 1JFHA 3C8NA 2NVDA 2QULA 1FUYA 3WYZA 1PIGA 1G67A 2E1WA 1REQB 3C2RA 4LBUA 1GQJA 2WC3A 1SM9A 1V6YA 3SN0A 3NQAA 3F2CA 3RRAA 1J0HA 3BK0A 1XPYA 4AW7A 3EMQA 1A5LC 2O0TA 4CNUA 3CO4A 5DEZA 1B30A 3O0FA 3QBUA 4H4UA 1KLYA 4JQ1A 4GXPA 3W7NA 3NAVA 2FKPA 4AXKA 2Y5JA 2WPGA 2DW6A 1K6AA 3KUMA 3WG6A 1XRTA 3QN3A 3LGEA 1C7SA 3G18A 3U2CA 4M29A 2VGGA 3H4WA 4M6UA 1IEIA 2C6QA 3M0YA 4DIAA 1V02E 3QSRA 4AF0A 2PDIA 5HPCA 3WD3A 4GVHA 1JGMA 5AC4A 4A4AA 4NNBA 1J5TA 2YL6A 1EPVA 3GUGA 4H6RA 4DRSA 4U10A 3WFAA 1B3OA 2Z28A 1R87A 4LU0A 2A3BA 2QCCA 4K37A 3WCZA 1P6CA 2J3NA 4DWDA 5EMLA 3VMPA 2ZZCA 3B3DA 1R5YA 3WDJA 3N3MA 2QJHA 4ATWA 4ZFCA 1JCNA 1YDOA 4BQ2A 4DYEA 3NDYA 1NFGA 3VX1A 4H9TA 1UR9A 3M9YA 3DH9A 1DE6A 3G1XA 1CLXA 4W86A 4H41A 3HG3A 2ZRZA 2ZUMA 1BLIA 2PWEA 3B05A 2QCMA 3VOHA 1HGYA 1W8GA 5LSMA 5CSUA 3LSBA 3KM8A 4RE4A 2QAFA 2DU2A 1KCLA 2KAUC 4JIIX 3NQ8A 4OU1A 1N8IA 4AHOA 1JNEA 5FF7A 2E5BA 4OBTA 3SY5A 4L4PA 4IL0A 1PJ9A 2BVTA 3DESA 4XAZA 4DY1A 1XIFA 3R2GA 4Q33A 4H9ZA 4UCFA 3MYPA 1B54A 4GX9A 2WVUA 1XYFA 2QGHA 1YBQB 4MPKA 4TVCA 4PCSA 4A3QA 2PZ0A 2BOGX 3CL8A 4B3LA 2Y7EA 4PTDA 4PTVA 3BJFA 3VIKA 4CLMA 5CZSA 2G50A 3QOMA 3LBMA 2Z1WA 2XPKA 1HZYA 1AJ2A 1HKKA 4ZO7A 1ISZA 2J78A 1K9TA 3W6LA 2Y8KA 4GZ7A 1GW9A 3PPFA 4Z08A 2NQJA 1RQEA 3O6YX 3ZR6A 4KFPA 5B7ZA 5GNXA 1S2UA 2XVGA 3POHA 4AWSA 5A6SA 3TIMA 4HD5A 1OK4A 4S3AA 5KVHA 1K4GA 1UR8A 1V08A 3VMOA 3BG3A 2V81A 4NX5A 4RR4A 4BR1A 3WLNA 3CPRA 1B9ZA 3GHUA 3W27A 3HQOA 3C0SA 5D2WA 1EP2A 4YTUA 2WQPA 3QYSA 2J7BA 5FJPA 2D0FA 5D9PA 5TQLA 3WLSA 2Y7DA 1PHQA 1FWAC 3HFYA 3SCOA 3U6WA 1V3IA 3ABSA 1BEUA 4S3EA 3W02A 1EC9A 4RNJA 2A7PA 4PN2A 3K46A 4MY9A 3LCHA 4B4HA 1K7FA 2H3BA 4B5XA 5BOEA 3OVPA 5HJYA 4MWAC 1TWIA 3BJTA 3DFSA 4RV8A 1VHCA 5C7VA 3G1VA 1PCWA 2GSEA 3T0CA 1M7PA 5KMYA 1Q66A 4LVGA 3ITLA 3ATYA 3MUCA 4LAZA 1UH3A 3A64A 5T8GA 2Y4SA 3S2NA 4PUDA 1NELA 3MDWA 5HQMA 3O9NA 2PD5A 3SUTA 4D8LA 4FPSA 1ISVA 1HJXA 1XJBA 5I0DA 4QRNA 3NSXA 5ABTA 3VFCA 1M5WA 1AW1A 1FWNA 1CENA 3EWDA 4NUWA 1FDZA 2J6XA 1KGUA 4I9JA 3TU9A 3TN4A 1GG1A 5DCEA 4EQSA 1GRTA 4KS0A 5RUBA 3S9IA 3E9AA 3GDBA 2J9ZA 3D6NA 1R7AA 4H00A 1QVBA 1QASA 3MCOA 3WMLA 2YL8A 3BLLA 4Y9MA 5FS8A 3P6LA 2AMGA 5K7JA 3W2LA 1A4LA 1T6MA 3W2MA 5FI8A 3INPA 1XLBA 4JTTA 2WJZA 3B06A 4JTEA 1VLWA 4LSBA 4D6CA 2NT0A 2WP6A 2CLFA 3TSDA 2QQ6A 4EPBC 1QPOA 2WZMA 4P7RA 4EE9A 3OHIA 4F0RA 4N9EA 3RRXA 4FNSA 3QJAA 3MJYA 4FXSA 4DO4A 1IHIA 1DWIM 1TV4A 3LA4A 4S3GA 5D8WA 2FIQA 3QSTA 1H1NA 1VFOA 6TIMA 1HQTA 1Z3NA 2ZTJA 1W37A 2HSAA 1OADA 1A5KC 4J3UA 4ACZA 2YL5A 1GXFA 1TPVA 3PUDA 2PDKA 1ZQ5A 3GVRA 4MZYA 1SO4A 1C8VA 1TPB1 2PWFA 1DE5A 2WWDA 3VZZA 3UJFA 4QE5A 5A6JA 3RX4A 1GVSA 3S1WA 4JZ5A 2WVTA 1GYNA 1V3HA 1OX6A 4R53A 3R0DA 2WBKA 1DL3A 2Z0IA 4LH8A 1EBDA 1Q6FA 3XISA 2NVAA 2FTWA 1ZBWA 2WMHA 2YBUA 4Z2KA 4QFUA 3OZYA 4BURA 4TMCA 2O4QA 4LYKA 4OOZA 1ZXIC 1F6YA 1V3JA 4LXFA 1XG4A 4YLWA 5TBOA 3FYOA 2HWGA 3L66A 4OT7A 2C71A 1YX1A 1TWZA 1B4EA 3R10A 4NAFA 4JTDA 1MQRA 3TN5A 4H4YA 4ERAA 3NFUA 1JCMP 5H8MA 2RJHA 3Q65A 1Y5XA 1GZJA 3ARSA 2ALRA 3M6DA 2VM8A 9XIAA 1GEQA 3SN4A 1MXDA 1OC7A 1AL7A 2WSYA 3S2LA 1RQHA 2Z2BA 3BLIA 4F2BA 4G56A 4DBUA 4GXWA 4RW5A 4Q7NA 1OT2A 5EA9A 1C90A 1PX4A 4PL2A 4NVTA 1J10A 4DJFD 1C29A 1J12A 1PZ2A 3IUIA 1TJPA 2X42A 3LU2A 3TE9A 1G6CA 2PBGA 2P8CA 1IXPA 2ODOA 1ALDA 5LXEA 4IXHA 2YCLB 3LADA 1SFJA 1OFAA 4EACA 5XINA 1TPUA 4J56A 3GBEA 4I8DA 4GVFA 4M51A 4AVNA 1LOLA 3DYPA 3RM8A 1SZNA 3W9ZA 2IUZA 4KCUA 4LB3A 1AZ2A 1E6SM 3HBLA 2J74A 1LROA 1P0KA 2G3NA 1B3YA 3LXDA 1GQNA 4KWWA 3WJWA 2Q71A 4UB9A 2GWNA 1QI0A 4UTTC 2C18A 3ZT6A 2I57A 3SUWA 2DH3A 2V38A 3NL6A 5LIYX 2AOSA 3W3OA 1E0XA 2W67A 5HR6A 1AA1B 3NSMA 2XFYA 4GI9A 4KT2A 1OM0A 1K03A 3CV2A 3TCEA 1H41A 5FS9A 2XFWA 1PO9A 1B9BA 3PJTA 3VILA 3BJSA 3CZKA 2BVYA 4EMIA 1GYMA 1GNXA 2PDGA 3KHDA 4WQ6A 4XZLX 2E8YA 1YW1A 1V97A 2W6RA 2D73A 3ZT5A 4I5UA 4MOZA 4E2BA 1AJZA 3URBA 3E2QA 4DWSD 4MJZA 3BG5A 4DUXA 3LS9A 1W1IE 1JAKA 1SJAA 1ZRQA 5HBFA 3NQFA 4H4WA 4QJ4B 3GH7A 4L1GA 1ZCOA 2W66A 2WMJA 3DGRA 4ROPA 3FGCB 4MYXA 4Q8OA 3TFXA 1SMAA 3LZ3A 2AAAA 3NZPA 1QK2A 1WAWA 3PBVA 4PULA 1Z69A 2CKRA 1OC6A 4DBDA 4FAMA 2J27A 2CLOA 3VUSA 4H7VA 4L6HA 1V3LA 3PS7A 4B5TA 4XX6A 3HMJG 1OFEA 2EJAA 5AKQA 5GJMA 3V35A 2V3FA 1RVKA 4X9YA 1Q3NA 4E4PA 3AMCA 1FQ0A 1HTIA 1OX4A 1JPIA 5HPOA 3EAOA 2R24A 1IWBA 1S5TA 2QCHA 5E6YA 1Q8AA 2AKZA 1FWIC 5EU9A 1NSJA 2VFHA 3OOQA 1NOUA 4CNSA 2OFJA 4ZB5A 1DJGA 1ZP3A 1JUKA 1WOBA 3QV6A 4KPLA 2Z4GA 3I3BA 3GHSA 4H8HA 3IIPA 4O18A 4BFAA 2JF7A 4JYFA 4JCMA 3QPZA 4OHQA 4GG9A 3CGCA 4UQEA 2EPNA 2TSYA 4EM4A 4NYUA 1NP0A 3R7MA 1AQHA 4IUOA 2GH5A 4R3UA 3TR9A