2QGYA

Crystal structure of an enolase from the environmental genome shotgun sequencing of the sargasso sea
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
376
structure length
376
Chain Sequence
NQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAGLGIVIHEDILSELSIYSLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from the environmental genome shotgun sequencing of the Sargasso Sea.
rcsb
molecule tags Structural genomics, unknown function
molecule keywords Enolase from the environmental genome shotgun sequencing of
total genus 140
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qgyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qgyA01
2OQYA 3CXOA 2PP3A 1JDFA 2O56A 2P88A 2DW6A 3R25A 5BOEA 2NQLA 3NXLA 3TOYA 5IDZA 1L8PA 2P8BA 2XH0A 3N4EA 3RCYA 5FJRA 3I4KA 2OG9A 4HCLA 1MNSA 3FJ4A 2QDDA 4KWSA 4F4RA 3UGVA 3OPSA 2GGEA 3ES7A 5FJTA 2AL2A 2GGIA 2ONEA 2OVLA 2OZ3A 3ZLFA 2CHRA 4JHMA 3SN4A 3DDMA 3TTEA 3SBFA 2PTXA 2PP1A 3H12A 4H19A 1PDZA 1KD0A 1JPDX 3U9IA 3NFUA 3JW7A 2GGJA 2HNEA 4H83A 3U4FA 3DESA 1DTNA 3UXLA 3QTPA 2PA6A 3MY9A 2QJNA 1MDLA 2P8CA 4JN8A 2HXUA 5FJOA 4E4UA 4IL0A 3I6TA 4K1WA 3ZLHA 4GMEA 5BOFA 3N6HA 3TW9A 3OZYA 5EU9A 2GDQA 4H1ZA 3V3WA 1IYXA 3S47A 3SQSA 4GGBA 4HNCA 3UXKA 1SJBA 3EEZA 2AKZA 4GYPC 4ZCWA 3UJEA 4IL2A 4GFIA 2PPGA 3DIPA 2I5QA 4KEMA 3TQPA 3VFCA 4DHGA 1EBHA 3D47A 3ZVHB 2ZADA 4KPLA 1MUCA 4X2PA 3N4FA 2OLAA 2PGEA 3TWAA 3MKCA 3I6EA 5J04A 3Q45A 1TZZA 7ENLA 4A3RA 5FJUA 3SJNA 3OW1A 2OKTA 3VDGA 2QJMA 3QN3A 1MDRA 3CAWA 3V4BA 4H2HA 2OQHA 4E5TA 4HN8A 3PWGA 2RDXA 3VA8A 1NELA 1BQGA 1YEYA 4J3ZA 4K2SA 2DW7A 3IK4A 3VC5A 3BOXA 4G8TA 3TWBA 3DFHA 3V5CA 4Z1YA 3IJIA 2XGZA 2PCEA 3MWCA 2XSXA 3RR1A 2PTWA 2OO6A 3ES8A 4J1OA 1FHUA 3JVAA 4YWSA 2OFJA 1EBGA 3NZGA 1ECQA 2QQ6A 3H8AA 4DWDA 3IJQA 3R0UA 2QGYA 3QPEA 3MSYA 3Q4DA 1XPYA 1BKHA 1FHVA 3VCCA 2AKMA 4GIRA 4E6MA 3D46A 2GGGA 4IP5A 1E9IA 2PODA 3GD6A 2XH7A 1WUEA 2P3ZA 1EC9A 3ENLA 4G7FA 1PDYA 2P0IA 3CYJA 3PK7A 3OTRA 1P48A 3K1GA 2AL2B 3N6JA 3SN0A 3THUA 3PFRA 3P93A 1W6TA 2GL5A 3CB3A 4IT1A 4IHCA 4FI4A 3FCPA 2FKPA 3R10A 4KT2A 3FXGA 3T6CA 3DG7A 2QDEA 3H70A 3NO1A 4GYPA 4JN7A 3T9PA 3ZLGA 3UCCA 2OX4A 1SJDA 3RRAA 3QLDA 3MQTA 2PP0A 2GGHA 1EC7A 2OZ8A 3JZUA 4K8GA 2QJJA 1KCZA 2POZA 3CK5A 4EWJA 3OZMA 4FP1A 4HYRA 4MMWA 1R0MA 3SSZA 3BSMA 2AL1A 4MGGA 3RGTA 2PGWA 3P0WA 3HPFA 4ROPA 1EC8A 5ENLA 3V5FA 3EKGA 1TKKA 2MNRA 4HCDA 3RITA 3GC2A 2HZGA 2PU0A 4DX3A 4ZA0A 1NU5A 1P43A 2XH2A 3SN1A 3FYYA 3DGBA 1ONEA 3OP2A 3DG6A 1MRAA 4HNLA 1TE6A 3RO6A 2GSHA 3B97A 1RVKA 3KUMA 1KKOA 2PU1A 2PSNA 1JPMA 3QKEA 2PS2A 1JCTA 3H7VA 3UJSA 3BJSA 4ENLA 3T4WA 3FV9A 3R11A 1XS2A 1WUFA 1SJAA 3VCNA 4A6GA 5FJPA 2QVHA 3VC6A 1ELSA 1R6WA 4DXKA 3TJ4A 1OEPA 3IJLA 1SJCA 3ZVIA 4HCHA 4Z17A 4DYEA 2OPJA 6ENLA 4IZGA 3MUCA 4E8GA 4A35A 4GGHA 1F9CA 3MZNA 2FYMA 2PTZA 3FVDA 3R1ZA 3P3BA 3UJFA 2ZC8A 3DERA 4MKSA 3GY1A 3UJ2A 3DFYA 2OZTA 3T8QA 4GISA 3UCDA 3DG3A 1KKRA 3DEQA 3TCSA 4IP4A 3PWIA 3TJIA 3UJRA 4M0XA 3ZVHA 4HPNA 2XH4A 2MUCA 3S5SA 3STPA 4DN1A 4M6UA 2HXTA 3CT2A 2PMQA 2PTYA 3R0KA 4E4FA 3GO2A
chains in the Genus database with same CATH superfamily
3ZSTA 2OQYA 3CXOA 2INFA 3I4EA 1OX6A 3Q37A 5DCBA 3S1GA 4HTBA 1NTHA 1UWRA 3T55A 4Q7BA 3PPHA 1KM6A 5BYWA 1E1EA 4L9ZA 3B9JB 3TEVA 1J5TA 1I1XA 3VTRA 1ZK7A 3MV01 3ZXWA 4YTQA 1FECA 5ABGA 5JQ9A 3NZQA 3TXZA 1EKOA 1O12A 1R2SA 3ICJA 3RLHA 1M01A 3R5EA 3VNDA 2Y7EA 1UP3A 1D3GA 4MAZA 1TR1A 4ACZA 3N29A 3A7UA 5FF7A 1NDAA 1D7KA 1K70A 4PCTA 4QSFA 3R4IA 4M6PA 5E09A 4CVWA 4H8VA 2DSUA 4BI6A 3W02A 1E0VA 1YPFA 2ABAA 1CW2A 4HSNA 3NXFA 1KQZA 2FLIA 1R46A 2X0SA 1GVYA 3BPWA 4AQLA 3DESA 5GJPA 4NAFA 5I07A 1ZNNA 2G37A 3WMLA 3M0XA 1JZ5A 2BXVA 4MDOA 4WSHA 4BF9A 2WCSA 2EPNA 4TO8A 2J8FA 2ZKMX 4F0MA 5HQMA 4EQXA 5EMYA 4MFDA 1ADDA 1RM6B 5JMUA 3GHTA 2B7OA 5D9OA 3K46A 1TZ9A 5TD4A 4XAFA 1IYXA 1GVRA 1R5YA 3AIQA 5MHBA 5M17A 4O18A 1REQA 4AC1X 1P6BA 2YSWA 5C5YA 1V6WA 1A0DA 1KN0A 2YZ5A 2REQB 5BRPA 3EA1A 1S38A 2WBGA 3NM3A 1OZMA 1ZBCA 4AHOA 1H2IA 1DHKA 2X1IA 4ADUA 5FSEC 3TAKA 2ACUA 4IQJA 3TQPA 1AJ2A 4FOUA 1P7TA 5CZTA 4K38A 4OHQA 5BXTA 2VHLA 3R6IA 3CV2A 1YPIA 4EPBC 1OGGA 2BGSA 1HJQA 3QFAA 3GKFA 1TRDA 2F9RA 5DEZA 3WQCA 1HKWA 3CQKA 1VFSA 3U6WA 1O1ZA 4Y2WA 1MUWA 4RXGA 4QG8A 1IEXA 3LPGA 4X3ZA 1GYNA 4J3ZA 3CASA 1IR2A 1VBJA 3CMJA 5HJXA 1K03A 4FNSA 2VRKA 1C29A 1JFHA 4EWND 5A8MA 5C54A 2W3SA 1E6PA 1EJXC 3KXQA 5KZMA 3VM5A 2RAGA 1M53A 1F8WA 1M5WA 3HFYA 5A3HA 4Q8WA 2YJQA 4A05A 4M82A 1SQ7A 4W84A 1WZKA 3LBCA 3SURA 1DHPA 2NW0A 4PRTA 3OQEA 4CU8A 1ICPA 4EMJA 1GV4A 2P1FA 1FHVA 4E6MA 1WDPA 1BKSA 1WDRA 1BGAA 1ZQ5A 2CBVA 3ZWTA 1H51A 2YCIX 2XH7A 4PGLA 1GKPA 4WSKA 3WJWA 1W8SA 3CWOX 3EUB3 4HSHA 1R85A 2VCCA 3PZGA 3MA8A 3SQPA 1AZ1A 3PK7A 2FGZA 4P5UA 4A8NA 1P48A 3TR2A 5D2YA 4JQAA 1TQJA 3RLUA 4W9TA 3W81A 7TAAA 3RO8A 3IV3A 4FLRA 1MUMA 2XSBA 3REQB 1V59A 3BGAA 1MQPA 2F5ZA 4KCUA 3S4TA 1B3YA 3M46A 1KNWA 5A6KA 5EKYA 4DZAA 1F76A 4Q8TA 3SUTA 4FOKA 1WP6A 4YTSA 5FKYA 1PHQA 5LGZA 3K4DA 4JIPA 2NSOA 1ZBWA 3EEGA 1JI1A 1NFBA 1W8GA 3U57A 2QUVA 1LUCA 5LHEA 1MXDA 3RX4A 2PC4A 2WMJA 4CEUC 4ZXOA 1BD0A 3VZXA 1WXYA 5D9NA 2TRSA 2DUXA 2A21A 2G95A 1MWOA 2E6FA 3OA5A 4JY9A 5I5RA 5E93A 3G3DA 4F2UA 5I77A 3BAIA 4LYRA 4V1XA 4K3ZA 4RPQA 3WFLA 4AWTA 4IJCA 3PBWA 4HCDA 3SCTA 4UOJA 2HZGA 2PU0A 4LAUA 1GOOA 3VGEA 5HQEA 1XM3A 3SCPA 8XIMA 2EHHA 4YHEA 4PUUA 1UBPC 9CGTA 1FP9A 4G2DA 4GNJA 3NS1B 3WNMA 1US0A 4UCGA 4AZHA 5BMXA 2VR2A 3EPOA 2WKLA 3QGAC 3PG9A 4X0VA 1FFRA 2EQDA 2OYLA 3U2EA 3A12A 4JD4A 1DBTA 3UY8A 4JDRA 3OA3A 3VKAA 2FZDA 2ZDSA 4UTWA 2W27A 2BLEA 4GJ1A 4AHPA 2PLKA 1J01A 1U5JA 2VRQA 2YYUA 5AYYA 4J3TA 1XLLA 1A3HA 4QXIA 3P8JA 2GWNA 3BG9A 4P61A 1LF1A 1UASA 4OUIA 3VABA 4JL1A 1VJSA 3HPXA 3W27A 2PWFA 1KXVA 4AZ6A 2PTZA 4WKAA 2R1LA 3WD1A 1Q6DA 2X05A 1QASA 1LRNA 1QT1A 5JCMA 2OTDA 3OIXA 4JTFA 2VZTA 3ALGA 2OZTA 4KGJA 4N02A 4IIHA 5HANA 3C0SA 3WF2A 1JXKA 1GJUA 1NF7A 1N2VA 3GC4A 5CKSA 2ACRA 4KFNA 3SQLA 2HXTA 3W4RA 3NQ6A 4HU8A 1YNYA 1XC6A 4CN6A 1XISA 3WEOA 4GC3A 1Z3NA 1O60A 4GKTA 4HNOA 5GQBA 1V6TA 4ZOAA 5U4NA 3LXDA 1LQAA 1XDMA 4S3JA 5I3IA 4Q33A 1R3WA 2FFIA 1A80A 3LMZA 4O1DA 2H9AB 5DLCA 4D6FA 1Q3NA 4N7QA 1EDTA 1XIIA 3O1NA 1W1TA 3I4KA 4RLIA 3USBA 2YDRA 5G4HC 1YX1A 5LYRA 2QDDA 4QHRA 4H50A 1E3ZA 4XVDA 1AQ0A 3NPWA 1XKJA 4Z0SA 2LLEA 5HK4A 3BV4A 3KWXA 1H4PA 1KW1A 1A5UA 3AM9A 5CC7A 1NAL1 3KTXA 5E6ZA 1LOLA 1Q65A 1JF6A 3G1VA 3A7AA 3E6EA 3ANUA 3WUFA 3U9IA 3QZ6A 1G67A 3AXIA 3GG7A 4ATDA 3SB0A 3GXNA 3LBOA 3GW0A 4JTLA 1DXLA 1YDOA 2GVJA 3GTIA 3N13A 3FN9A 3MHUA 4OFCA 4J9JA 4H1ZA 4GFSA 4B91A 1V3KA 2ZX5A 1DWAM 4C6KA 3GVVA 5C9RA 1H5VA 1X6LA 1EJRC 4E38A 3NQAA 1B9BA 4RR4A 4DF1A 4YCPA 4CD8A 1OFBA 1R86A 3RK8A 4N9DA 1KLZA 4IL2A 3F4VA 1E6XM 4PTMA 3C4UA 4NZJA 1IZKA 1C9WA 1EEPA 4NJGA 3V0UA 5XIAA 1Q63A 1RALA 3D47A 3KRBA 3DAQA 3QYSA 2QMJA 1U1JA 4JFTA 4CD4A 3M43A 4G7EA 2PGEA 2I57A 2HE5A 2W3ZA 3WQVA 4J3XA 5JBEA 1XGDA 3BLKA 3IPWA 4HQVA 3T05A 1QWGA 2NX1A 4JTQA 1VFHA 1TJ1A 2I14A 4EPEC 3RFAA 3BV7A 2RGMA 2JGQA 3AS3A 2CW6A 3NEVA 2ASHA 1F2JA 1Y8BA 2PB1A 3P2VA 1H5YA 1GG0A 2Z1KA 2CFYA 4HN8A 4JQ4A 1XIBA 3EGJA 3KTSA 4JTTA 1C7TA 3M9YA 5IDIA 2IKIA 1EA9C 1E4NA 1KV8A 1M7JA 1UR2A 3IAQA 3NQEA 2EQ7A 1K8YA 3V5CA 3T44A 4O15A 1DJIA 1JCJA 4DPPA 5D30A 2VEIA 3TP4A 5FEZA 1YPXA 4GK8A 1WDQA 3EX6A 1P6CA 1QATA 2FVMA 2O0TA 4YNGA 3I68A 3R0UA 2PC8A 2YFOA 2WCAA 1CIUA 1G7UA 2FGBA 3MSYA 2AQVA 4ZR8A 3QC3A 4LY4A 4CUCA 1I2NA 1E9IA 5A8QA 3VX1A 4LRTA 3KCOA 4FDCB 4W7VA 3ENLA 3UZZA 4BY3A 3AWNA 4R88A 4BI7A 2FGLA 2P0IA 5LNWA 3KVMA 1XBYA 3W07A 3U7VA 2VGGA 4WSJA 2YW3A 4L7ZA 3K1GA 2UY5A 3BWWA 2CBJA 4ZQNA 3TC6A 4H8UA 3B0UX 3W7OA 1F6PA 3JR2A 3AO0A 1D3CA 2Z26A 3GXPA 3BLIA 3NO3A 1TJ0A 3AJXA 1O4UA 3LQGA 5BXSA 4E3TA 1GHSA 4PL2A 4UTHA 3BXWA 3LERA 1PYMA 3NGJA 5HDRA 1A5OC 3U7BA 2XVGA 3UQNA 4JYEA 1IWAA 4JTAA 2ZRVA 2QDGA 4IIDA 7REQA 3K4AA 4AMCA 2C0AA 4FNUA 2C91A 2JFEX 3LV5A 3ID7A 4X2RA 1TWZA 4BWLC 2C7FA 1YE4A 4V28A 2WOWA 2QCFA 2ZA2A 3SCUA 5D04C 1CGTA 3A21A 4HZMA 3TN4A 4I9AA 4JPGA 3EX3A 3UWQA 5D02A 1MFVA 3ELFA 4DQWA 1ADOA 4A2RA 5B7ZA 3PSVA 3MCNA 1SYTA 1NARA 3M0MA 3O3RA 4BHYA 5BWFA 1VC4A 2XH2A 1GRBA 3QOKA 2DH3A 3ZWSA 2CFFA 4LVFA 3VAVA 2ZZ5A 3CS2A 2D3LA 3I3DA 1MRAA 1LWJA 1TE6A 5T8GA 2GSHA 3GNPA 3QFEA 4NG3A 2Z2UA 4U10A 3NQDA 3RMJA 1XFBA 4BI5A 1JYVA 2Q01A 2DZBA 1NVMA 3QKEA 4LAZA 2Y7FA 2FJKA 4C91A 2SFPA 3RLVA 2FZBA 4H9YA 5LNUA 3LBMA 2D0GA 5JIPA 5AHMA 3A5VA 3T4WA 1OM0A 3GC5A 4XB3A 2EPLX 5E9AA 2D24A 1T6MA 3EWDA 3POHA 5A1AA 1OCJA 4O50A 3WK3A 3MUZ1 3IARA 3OZOA 2WWDA 3CUFA 3MUCA 5D9PA 4GI4A 4FEZA 2YDSA 3VD3A 3CUIA 1G9HA 4BQ2A 2UV8G 2PD5A 4I6VA 1EA0A 3L4YA 1XDLA 1GQIA 1TPUA 2V5CA 3WLOA 2KAUC 1GQKA 2OOGA 4NVTA 2Q71A 4EANA 1S2WA 1VZWA 4HPXA 6TAAA 1QWKA 2QCGA 1TWWA 1RH9A 2YZRA 1WDWA 2Q3OA 1CGXA 1XXXA 1S5MA 3S5SA 1A5CA 2A4AA 3A23A 4V15A 1ODZA 4PULA 4NNBA 5HQLA 1YKWA 1AQHA 1J2WA 3B9OA 4AU0A 5CJNA 2E5AA 1J18A 4FIRA 5L6UA 2J88A 3CPUA 3QLLA 4K7YA 2Y8UA 2DUZA 1E0UA 5IDZA 2V6OA 3BMWA 3QV9A 3TTOA 3GG1A 3P61A 4AX7A 4MWAC 4NZ5A 1KM2A 1VEOA 4B15A 3GH5A 3POCA 5BOOA 5CJ5A 3KHDA 4Q4MA 3S2MA 1P1MA 5HOSA 4US6A 2DSZA 3RUBL 1TPB1 2VEKA 3NJ3A 3FVMA 4I5RA 1DV7A 3WUGA 1W3NA 5K2ZA 5KINA 5FF2A 3DN5A 1QI4A 4QR6A 1B1YA 1J0HA 2V81A 3BAJA 5DT5A 1X39A 1XI3A 5CSRA 3L4TA 1BYAA 1F3PA 5CSSA 5HR7A 3ZLFA 3IGXA 4JIEA 1WOBA 5A6AA 1UOZA 5CG0A 1EF2A 2DU2A 4R7JA 3OG2A 4WJ8A 1N63C 2VVSA 1OC5A 5JU6A 2RFGA 1Q85A 3SIZA 3WBWA 4PCNA 3W7EA 1W3JA 2NPXA 3KFTA 1ZAIA 3L8KA 3TSBA 4RDYA 4GI8A 2IPFA 4DY1A 1XLBA 4H4UA 3W28A 1MDLA 3G8RA 2DFAA 3C2EA 3QXBA 5JUVA 4A3UA 4QS5A 1FP8A 4H41A 3B8DA 3OZYA 5JCKA 4EF8A 4QLKA 3VD9A 4OV9A 1JUEA 3NCOA 1PXGA 5AZ1A 3LLDA 4JTEA 3PBMA 4AVOA 1OF6A 3ARYA 1A5BA 3UJEA 5DT7A 3VOJA 1QFEA 3DKLA 3DIPA 4AXNA 5C9ZA 4PB3A 1S5WA 1Z41A 4BZYA 2W61A 4M6VA 4F0KA 2OLSA 4C6JA 4ILSA 4ZB0A 3R12A 1UIOA 5LNVA 4LYPA 3MP5A 1H1YA 3CQJA 3DC0A 4L4OA 3NRZB 4DJEA 3E1F1 4EXAA 1HUVA 4MG4A 3TFCA 1TV2A 3OW1A 3AZRA 3K5XA 3VDGA 1PZ3A 2CLMA 3CPRA 4LYKA 5K4XA 1FWNA 1RY8A 3H54A 2G3FA 1PL9A 4DUOA 5IFPA 5DQPA 2J6XA 3D5HA 4Q8OA 4PBEA 2ZXBA 3EDJA 1NELA 2X2YA 1Q6QA 3RM4A 2OZ0A 1BVNP 1Z44A 4HPJA 3IGHX 1REQB 2NV2A 4S3CA 4FNPA 1NHPA 4W7UA 3EB3A 4IGSA 2I17A 3KAOA 5F1UA 3LTSA 3N34A 4LGXA 2E5BA 3BTNA 1K3UA 2INEA 3ES8A 1RJRA 1C90A 2GOKA 1B3ZA 3M64A 3HMCA 4GQQA 1QOXA 5C70A 2XFWA 2QYGA 3B03A 4XIAA 2Y61A 1V77A 3S5NA 3CUXA 1G0CA 2ZYFA 1CPUA 2Q8ZA 3T0BA 4MADA 1UCWA 1Q6EA 4YTTA 2BTMA 3QV6A 4QDPA 2VX7A 5F7UA 1J93A 3VMPA 2R91A 3O6DA 4Z0JA 3V36A 5IM51 3PTDA 3VKKA 2V2DA 2G4JA 1P0BA 2VDIA 4ZXLA 2FFCA 4UXDA 3VDBA 1RCOB 1V0KA 4IFKA 3EWUA 1LROA 1RQEA 4LUYA 1M6JA 1UA7A 3TA6A 3W00A 2V38A 4OZOA 3L5LA 1QHZA 4JQ2A 2ZUUA 2W9MA 1HW6A 1FWIC 2VKZG 1W37A 5D4YA 4H01A 4DF2A 4AB4A 2WMHA 3L68A 2Z00A 3SW6A 3BE7A 4LT9A 4LUTA 1A5LC 1NP2A 3CMGA 2XIIA 1UBSA 2OX4A 2WHJA 4FNRA 3TFXA 1VLIA 2E1WA 3ABZA 2OZ8A 5TAOA 2EG7A 2QJJA 5D37A 1QVBA 1S3TC 2Y7DA 1JF5A 2Z27A 5CJMA 3SUWA 2J9XA 3W7KA 2GDUA 1PIFA 2RKXA 3U8GA 1MXGA 1XL9A 2C3CA 1DE5A 3HPFA 3ISIX 1A5SA 5AYBA 4P7NA 4X9YA 5H8MA 2QS8A 3LHYA 3C0JA 5CGQA 1TKKA 4Z2KA 1XW8A 4GO9A 2VFDA 3ITCA 4ZENA 4N9EA 4OIFA 4EACA 4LA1A 3ZR5A 5A95A 4X22A 1OFEA 3CAKA 2QUNA 1RP9A 3S8HA 3DENA 3DGBA 3UETA 5I3GA 1E70M 2E4TA 4U33A 1JVNA 3CXBA 4XUYA 3ZMRA 1F07A 1PKMA 2X41A 4UZUA 1Z42A 3GVGA 1HJWA 3GX9A 1EX5A 3WL0A 3W1PA 3GBEA 2VOTA 1K9FA 2Y5EA 4MFEA 4WDXA 3HIJA 1ISXA 2XM1A 3BLDA 2QJGA 3AQUA 2HS8A 2J62A 2QDHA 3R8RA 1EDQA 5C9XA 4US5D 2RABA 4NHVA 1SJAA 3OLGA 2XWDA 4BQ3A 4DXKA 1OEPA 3G1SA 3ECQA 4KCTA 2D20A 2OSXA 2PUZA 2HSAA 1I1WA 1CXFA 4DXVA 1W1PA 4B3KA 1H49A 2O9OA 3E0LA 3M4HA 2BVDA 5ABFA 3W7MA 2OQLA 1AD4A 3WK2A 5F2IA 4RX0A 4ACYA 4JCLA 1KFJA 3W22A 1ITQA 3W73A 1A5NC 3B0XA 1TSIA 5EPDA 3LNMA 1UZ1A 1BXBA 4GIYA 4O1EA 5LA0A 4KFOA 4MJMA 4RL3A 1Z89A 1JEHA 3C8FA 5I24A 3S42A 3R0KA 4RK8A 3GNNA 3WLRA 1QI2A 3FHAA 1Q2SA 1LORA 2O56A 1X7IA 2C1HA 4LC8A 1GTEA 4HT3A 3LEPA 4C6NA 1ZB5A 2YL8A 1MNZA 2WZHA 3VOFA 4DAIA 2YKKA 3IIZA 5AFDA 1BG4A 4AHQA 4ICNA 3WQEA 1C8YA 4WOZA 1SB3B 3VYLA 1OC7A 4MJ4A 2CLLA 4A2SA 4ZB2A 2D2GA 3OOQA 2IKJA 3BMVA 1OZQA 1GVQA 1XIGA 3PULA 5U1OA 1N62C 3UZWA 1O68A 1JDEA 2IXUA 3L65A 3MMWA 5DFAA 3SN4A 3KE0A 3PWAA 1JZ6A 2AAAA 1RQHA 1RP8A 3VKJA 3HF3A 4CEXC 3GDLA 4W85A 4JAWA 2Q8XA 4JEQA 4LRSA 2VEGA 1XYLA 3EDKA 2P8CA 4H7ZA 4HZ7A 1SW3A 4R9OA 3HBLA 3VIIA 2OYMA 3P5ZA 4QTGA 5A8OA 1WZMA 1F6YA 3NQVA 5CZ0A 1CYGA 2IPJA 3N6HA 2W91A 1BYBA 3DKJA 2GDQA 2O9TA 5FSDC 2FB2A 3QZAA 4HA3A 4HGXA 4FXSA 4C7DA 3QHMA 4O0ZA 4RW3A 1S2TA 4LCSA 1HIZA 3WK1A 1VHNA 3MV11 5D38A 4KPLA 3SM0A 4NX0A 2WYSA 5LIYX 3UA4A 3SCOA 3LU2A 5HMFA 1E1FA 2OSWA 4TTUA 1OFDA 5K9XA 3B06A 2A7RA 2PRMA 1NWUA 2FMOA 2GVLA 2CESA 1ZBKA 4OWGA 3WKZA 2QJMA 1OYBA 2DZVA 3NL5A 5CAHA 1BWKA 3AMCA 2E0PA 3OVPA 4E5TA 4X61A 2DDXA 3VPLA 2NXGA 3BCFA 4B2DA 2ZVIA 4QM1A 4WDWA 2E9BA 4RZBA 4DIAA 2IPGA 1TA3A 3L67A 5REQB 3MYOA 4N6FA 4XZBA 2EGZA 1JR1A 1VLWA 1UD5A 1YTKA 4UQDA 4BQ4A 3PJUA 5I03A 3LRLA 4NJIA 1GEQA 3D9XA 4MKVA 4AEOA 4GCAA 5F4WA 3VNZA 3EBVA 3G1DA 3L12A 5LNSA 4RNIA 4PEKA 3W1XA 1F3TA 4JNYA 4NX5A 4EE9A 4MLJA 3AHTA 4PTDA 4DZ5A 2P50A 1LWIA 1XYZA 1EQPA 4ZZ9A 2WPCA 4HJFA 1TIWA 4JTDA 3WMCA 1H7OA 1EFZA 4PYSA 3W70A 1KBLA 7A3HA 2WANA 3SAZA 3PAOA 4O12A 4O1FA 3RX3A 3KRUA 3L4VA 3OTRA 4GUGA 4GJJA 3MI3A 2VCBA 4BURA 2OT1A 1E51A 2WNZA 3IVSA 4EIVA 5CH9A 2HISA 4JFUA 1BGGA 1FWCC 3LGGA 1FRBA 3KBJA 1OX4A 2ISFA 5IRPA 2GJXA 3S9IA 1KBJA 5ABEA 3SGZA 3R10A 3P74A 2ZZCA 2CZEA 3FDGA 3T07A 4R34A 3GHUA 4HMEA 3IANA 4J3VA 3UG8A 1QO5A 3ABQA 1QDSA 3LQLA 4WIWA 1YNQA 1SJDA 4X63A 4MJZA 3SSJA 2D73A 2DT3A 2YX0A 2WQPA 3MT1A 1SZGA 2V5KA 1EC7A 4B92A 3P60A 1UHVA 2REQA 4LANA 4ZQCA 2NLYA 2DY3A 4AY7A 3RILA 4HHMA 4HYRA 1V0LA 3RRXA 3SSZA 2YA1A 3O16A 4MGGA 2YVFA 1RLDA 3P0WA 1CTNA 1UIPA 1RQBA 3RNMA 3P7YA 2X7WA 3KWSA 4DUWA 2VFHA 2MNRA 4E8DA 4B5WA 3MUY1 4AH7A 4XD6A 1PKLA 2J79A 1BXCA 3GYEA 1PV8A 3PC0A 3VZZA 4Q8NA 2ZRZA 3VNKA 4MB4A 4EK7A 1HP4A 2WSPA 1W3KA 2PDNA 3RXZA 4HBKA 2E3TA 3VOGA 3NVWB 1FDZA 1GKRA 2JF7A 2C3ZA 4PMZA 1W9VA 3L4UA 2CKRA 3GNDA 4BKNA 1XANA 2WOVA 5C0QA 1LUCB 4FR6A 3AS0A 2JKEA 4E3VA 2DH2A 3TVAA 4ERGA 3VINA 1H62A 5AC4A 1S1PA 1E1CA 3CAVA 1GQLA 6ENLA 4V33A 4GD0A 3QTGA 1XP3A 2PWUA 2PWEA 2FYMA 3LX9A 3ZZ1A 4TOQA 2BY2A 2YL5A 3TX9A 4K36A 4EMIA 4GISA 2XSAA 1T41A 1UR3M 3PWIA 2R1KA 3FAXA 4TVWA 3GNOA 1DQWA 1XYBA 3N25A 2IQDA 3GTXA 4WY0F 1C3FA 2A0NA 1WKDA 1PAMA 1VAHA 1TO3A 4U2ZA 1PX8A 3WLSA 3D0CA 1Q2RA 2BOEX 2VFGA 2DW6A 1J0KA 4PRWA 1ONRA 2C13A 1UH2A 4ICMA 3E38A 1H2JA 3ARXA 1UZHA 4AXKA 1OY0A 3G1RA 4H8HA 4AD5A 4ALDA 1AFSA 3AUJA 4ECLA 3MJYA 2XH0A 3EXSA 4MUPA 3KLKA 2OEJA 3UG4A 3WDJA 3UXAA 3RCYA 3RNDA 1WBJA 2VTFA 2RJHA 1STZA 5A6BA 3DC8A 4WF7A 1SMAA 1XX1A 4JY8A 3UZJA 1FCBA 1ESWA 4LV4A 3URQA 4UB9A 2TSYA 3T42A 1X8CA 1LZOA 4F0LA 1CLVA 4GR1A 4IX0A 3QC0A 3HPZA 1ZJBA 2FZMA 3STFA 1TTPA 1M6IA 3DGZA 5I2UA 5AN7A 1GG1A 3QGVA 4GNKB 1D7YA 2VQUA 2WXDM 2ATMA 1ZLPA 3ZJKA 3M0YA 3TU9A 4H4QA 4H83A 1WBHA 1WB0A 3MY9A 4J35A 4MUZA 3ERPA 1E1CB 2OSYA 3EWWA 2WOQA 5BRQA 2DJLA 3BL3A 4PTVA 4RDZA 5D2VA 1S39A 1M7XA 2BY1A 3PJWA 5BWAA 3V3WA 3TTQA 5HUOA 3WEMA 2PBOA 1E6RA 4DZHA 4A3YA 3A4WA 3PB0A 2ACQA 4D2JA 1EO7A 4B3ZA 2JEPA 1KTBA 2CIPA 3KOFA 1LLWA 1WX0A 3HB9A 3UR7A 1RJQA 2X2GA 2WNWA 5G1MA 5D03A 1RHCA 2ZUMA 4Q32A 4EM4A 4DJFC 2ZADA 2PDLA 1US3A 4LQ1A 1ZX9A 1XLGA 3MMDA 3NM1A 3CPGA 1RJPA 1J0YA 3A22A 5CPTA 3I6EA 5J04A 2PWDA 1TYGA 4DJFA 4H3DA 1VEPA 1MDRA 3PUEA 4MTVA 2V63A 3N2XA 2PWVA 1HF6A 4O1AA 3DFPA 6XIAA 1HX0A 2YOCA 1L2UA 4C6IA 3Q6JA 1P0KA 3B4YA 2J7CA 2E5DA 3GDKA 1CXHA 2BS9A 1NHRA 3O05A 3PG8A 1QI5A 1M65A 4CN1A 1KRAC 5KEZA 1T3QC 4XZNX 2A1YA 2GQ9A 2PDIA 3PNZA 3QMTA 3GS6A 2VGIA 3UYIA 5FL1A 3TK7A 3KBMA 4Y9AA 2V3BA 1BZLA 1PTGA 2VL4A 4C6DA 1CBGA 2OFJA 1H0IA 3H8AA 4XKMA 3KVKA 3P14A 4L61A 1EXBA 4URIA 4EF9A 1CWYA 4UTFA 2AKMA 3FX4A 3D46A 1VCVA 2WNQA 1AMKA 5D32A 1EJWC 2QT3A 4LNYA 2P3ZA 3DOPA 1VB9A 4IMAA 3OBEA 4I5UA 3W2JA 1OCQA 2W79A 3B4UA 3PTQA 5LA2A 2P3EA 1LBMA 3MP3A 5D05A 1VS1A 4XKYB 4I7VA 2Y89A 2YBVA 3THUA 4LNCA 2X8CA 4TV6A 3FY1A 3E0IA 3TYEA 1BYCA 1V7AA 1XPGA 1XG3A 2GL5A 5U25A 2WHLA 2VJXA 4LH8A 2Y24A 4Q4KA 3A3HA 4QJ1A 3O6CA 4D6JA 5D9MA 4DUVA 4H2CA 1QUMA 2XYLA 3PFMA 4K68A 3ZIZA 3RRAA 1RPKA 5LSMA 1Q6LA 4AZCA 4IH3A 4UR7A 3TV8A 2VT0A 4GY1A 3VIFA 3WO8A 5CG7A 3PPGA 1XGZA 4PR4A 4DBSA 1J4EA 1M7PA 3CZJA 3BSMA 3R58A 2XZ7A 2VX4A 2QZRA 1NOUA 5FF4A 3DHUA 1EDGA 4GACA 3ONCA 5GNYA 3EB4A 4H9ZA 3DGRA 3OBKA 4H6QA 4J3WA 2WZMA 4DJFD 1PSCA 2EKGA 4Q4OA 1HJXA 1GQJA 3FGCA 1XBZA 5TIMA 1W5NA 3OP2A 3F4CA 1R3YA 4R7OA 1RVKA 1XIFA 5DXXA 4V2XA 3TDFA 4O8RA 1GWJA 3B9EA 4QNEA 3WF1A 1FKXA 3ITVA 2ZTJA 3QW3A 1XWYA 4L9YA 4N0RA 1XYFA 1JPMA 1JD9A 3PZQA 1ML1A 2HPIA 1M41A 3LPFA 2E1DA 2A85A 4JIIX 3WK0A 1IV8A 1P1XA 2GZXA 3EMQA 1DL3A 4QE4A 1VD6A 3FEMA 3AHVA 4GINA 4N42A 1SJCA 3CJPA 4GJIA 4B5XA 2EPKX 1TCDA 5BU6A 5ECVA 1ICSA 5LZLA 3F5JA 1LQ0A 4DBEA 1TTJA 1LRTA 3NQGA 4GX9A 1E55A 2BVYA 3A9BA 1H7RA 3APYA 2X0HA 3MANA 4AY8A 1W9DM 2EQ8A 2NUYA 1B3OA 2QAPA 3CV7A 1TV7A 2HQAA 2F61A 4NEWA 2BC0A 4Y8EA 1V02A 3XIMA 3S2JA 3DEQA 3TCSA 1FTXA 4HIBA 3NWRA 3S5ZA 4IJBA 3TYBA 2Y1HA 1M68A 2WJEA 1EO5A 5CSUA 4KEZA 1LL4A 3RYSA 1EOMA 3P8IA 3W2KA 1VJIA 2WPGA 3U3HA 1S2CA 3VKDA 3R79A 1R3TA 4AIOA 2E6DA 3HQNA 2NQLA 3SQMA 2G97A 1DIKA 3B9NA 4J5NA 3AMZA 5D2WA 3ZYZA 2D2HA 4KRZA 1R2RA 3LTYA 3E5PA 1PZ1A 2WZEA 3S5OA 1FWTA 3CHCA 4LUTB 4RNFA 3M5YA 3ITXA 1Q45A 4TX8A 3UXDA 4GH3A 5BMWA 3KOYA 2E40A 3SUSA 4KWSA 3AUOA 1OFRA 3RPMA 2IUZA 1X1OA 4MWAB 1VF8A 3CHFA 3W6MA 3V0SA 3IC9A 1PJ9A 3VD5A 1SFLA 4NF7A 3MVTA 2E09A 3SRDA 3WLMA 1JZ8A 3CQ0A 2TPSA 2Z6IA 2PGRA 4GZ7A 2L5HA 1TMLA 3SBFA 1ZL1A 3ZJ6A 3IS4A 1NHSA 1IIHA 3WH7A 1ZCCA 5HJYA 3U4FA 2VEMA 3LM7A 4GY0A 3WH5A 3TQKA 1J0IA 2YW4A 2ZZ3A 2OX1A 3I6TA 4LW7A 3TW9A 3V75A 3GXDA 4GVIA 3M41A 4PMOA 1B57A 2NQZA 2HQMA 4XZWA 1CLXA 3URBA 4S3GA 2HVOA 5JCNA 3C0LA 5DO8A 1UC4A 1P6WA 2GDVA 1UH3A 4QCEA 3HQOA 3SFWA 5FEWA 2WJDA 5FF0A 4A21A 1H0GA 1E6SM 1OT2A 2HROA 2YDAA 2WLYA 5EMKA 3A47A 1R3RA 3S6TA 1UR8A 3GNRA 3NSMA 1BWVA 2WLZA 4MNLA 1AW1A 3TN5A 3BGGA 1VBGA 2R8WA 2OLAA 3N4FA 3HGRA 1GEUA 4IGNA 1X38A 4H9UA 1J6PA 3G18A 1MW3A 1CCWB 5ABFB 2Q02A 1OCBA 1E5JA 2C14A 4UR8A 3UZXA 4MY9A 2OR2A 4E2OA 1A5KC 3AICA 3JUGA 3KVLA 4WKFA 2OWCA 4C65A 2EQ9A 3KW3A 4H4ZA 1VIZA 1TUFA 2UY3A 4GY7A 5G1TA 1XHCA 4S23A 4H4YA 4MWAD 1E4MM 3CHEA 4KESA 2QCEA 3S9ZA 3N9SA 4IIBA 1CI1A 4HYVA 1FWWA 1YQ2A 1HJSA 1HTIA 3KHJA 2D2JA 2PTWA 3GU9A 3SCWA 2D2OA 4GHRA 3C2OA 1SU5A 5HWJA 5KVIA 4I9MA 1EBGA 2VC9A 2Y7GA 3NZGA 4D8AA 4DWDA 5H6HA 5DCEA 3M5XA 1OFOA 1KBIA 2VM8A 1BSLA 1A4MA 1IEVA 3L66A 1E6ZA 3D3AA 1XPYA 1LOQA 2ZZ0A 1AL8A 4GI9A 3W1RA 3GVRA 3GD6A 3G1AA 2CNCA 3PBYA 2YLAA 1AUSL 1W1IE 1OGSA 4GUJA 1U22A 5KVHA 3TMQA 1J6OA 4G7FA 3WLJA 3EOUA 3SDOA 1WKYA 4H04A 1UD4A 5C55A 1R7OA 2ZCGA 3GDBA 4US5A 3CWHA 4NU7A 3VCRA 3LCHA 4MZ8A 4YWOA 3P84A 5AC5A 3UR5A 4PH6A 2AQWA 4IT1A 3SUUA 3RAOA 1QNPA 5DXYA 5KSWA 2PBGA 3BCDA 4TX6A 3DG7A 3NQMA 2QDEA 3KRSA 3UR8A 4JIQA 3T9PA 2DIEA 3ARVA 3VGGA 4ONVA 1OYAA 3C5QA 2GFTA 1ECEA 2F6UA 1E73M 3OGVA 3JZUA 4LUSA 1FDYA 3T2QA 5DY3A 2UWFA 2PDWA 2Z1VA 1XHGA 1DJXA 4K1GA 4ORMA 1W9BM 4RJEA 2WMIB 5L9FA 1SO5A 1GZ1A 2BFGA 1A53A 2X09A 4UMBA 4C6PA 5EBUA 1THFD 1XRFA 4HN4A 3QH2A 3UBPC 3CHDA 1JEZA 3EKGA 5B7YA 3GFXA 2A7NA 3NAVA 3V5OA 3QSTA 4HNTA 3L0NA 1F7BA 3FA3A 2GQ8A 1J9YA 3TYAA 4GQGA 4JHOA 1QOQA 4P8UA 3TQ0A 1PTAA 5EA9A 3B8SA 3A9IA 3TOPA 4HHPA 4IQEA 4Q8UA 1OD8A 5CXPA 3KUMA 1KKOA 1FXQA 3TNOA 3VNYA 1ZCOA 3WFAA 3P5YA 8A3HA 1YXDA 4IMCA 4PTNA 4KEVA 1PE1A 2IKGA 4O16A 4H6EA 3HJZA 4G5DA 1KM1A 5D2TA 4LS1A 1B5TA 2CEQA 1CENA 2Z2BA 3OEXA 3L5AA 1ELSA 3WNPA 5AVHA 7XIMA 3IJLA 1T8QA 2WP5A 3AXHA 5HATA 2WK2A 4OJYA 1TPEA 3LCFA 3PZIA 4IP7A 4CCDA 2G3JA 2JF6A 4D6CA 2BZNA 1H6VA 1JI2A 1UR1A 3JRKA 1OCNA 1U83A 1NOWA 1TPDA 1P4CA 1Z8AA 3BMXA 1HKIA 5A8GA 1H3GA 2X1SA 3MZ2A 3N2BA 1VRXA 1LT8A 4HPNA 1JXJA 1I9CB 2XH4A 1EX1A 4HA0A 1H1NA 9XIMA 1RV8A 2FTPA 5DANA 2EG8A 4DXXA 3LLFA 1IEWA 2XWEA 4AD2A 3CUGA 4IWWA 3WELA 4B16A 4LWWA 4BEUA 4J3SA 4A3HA 1MYRA 3GSMA 1IZJA 4UWMA 5XINA 3O0KA 3M1ZA 1L8PA 3BZJA 3IUIA 3CIVA 3LB0A 3W7JA 3M0LA 2WHKA 3H2OA 4J57A 3BCJA 4JFVA 2BCPA 2E9MA 4LSBA 1FY6A 1UUMA 3QHNA 3WF0A 3GD3A 3O0HA 4O0KA 4IPJA 2ADAA 1R38A 3A13A 1KV5A 2BGNE 3OVQA 3VNLA 1HKMA 5A6SA 1OABA 2VZVA 3ME3A 2FHCA 4Z1AA 2GGEA 1QXLA 1Y5WA 3TW7A 4LIIA 1UC5A 2RDUA 4P8WA 1HKVA 4PTXA 3E5BA 4IPNB 2WO5A 3MBFA 4JTHA 4QQUA 1V0MA 1X96A 3AU2A 3SRHA 3KCLA 3WLKX 2VGBA 1KD0A 1X6UA 5D8WA 3N1AA 4MYAA 1V0NA 3NFUA 1XC4A 4ZEPA 3BW4A 4AIBA 3QFBA 3WF3A 1GOQA 3AYTA 1DPMA 4IUGA 4JN8A 4K1WA 3M0HA 3SZ8A 5E70A 4DWSC 2PDCA 1A47A 1MFUA 4HNCA 4L5ZA 1Q66A 3UXKA 3CU2A 2DZAA 3W7RA 2V5LA 3PP7A 1DNCA 3W7CA 4D6DA 4QX4A 3TW6A 3RMEA 4NQ1A 4ZE5A 5K3VA 2J7GA 5EBKA 3WDQA 1GRGA 1F05A 2E28A 4H00A 1XUUA 4Z2LA 3U5YA 4YLWA 1VR6A 1UR4A 1E6QM 2Z1SA 4I7WA 3W1AA 3C56A 4RZ4A 2YVJA 3QR0A 2XN0A 1EBDA 4CU6A 1E4LA 3IVUA 5E9XA 1VRDA 2DZUA 3IK2A 4TVCA 5DY2A 4X0NA 3IUDA 9RUBA 1YMYA 5C2GA 4G7EB 1KXHA 4B5VA 4UQAA 3VDAA 4P7RA 4WRHA 2Z24A 3LZ3A 3VC5A 3Q65A 3ZSSA 2B81A 3WQ8A 3W87A 3DGHA 4W87A 3H26A 5FESA 3L4XA 4A3QA 3IJIA 2PZNA 3S6DA 1GORA 3FJNA 1ZTVA 2ZRXA 1TPFA 2IPWA 1VYPX 3VOHA 3W1UA 1G6CA 2RDTA 3NUKA 1K4QA 2QULA 1K4GA 1PEZA 3MCOA 2CITA 1E40A 3WQ6A 3LCWA 5H2ZA 1W1A1 1V6VA 2DQWA 3GNXA 2GQ3A 1EZWA 4PSPA 1XRVA 2WMKA 3VMNA 3OG3A 3B04A 1B54A 2R9ZA 1FH8A 2DP3A 2YCJA 4X9SA 2AL2B 1FOBA 4MZ1A 3CO8A 4XX6A 3KM8A 3BOLA 3SN0A 3NQ8A 3BANA 5DF0A 2WM0A 4XZMX 1Z48A 5HR6A 3G3MA 2D1ZA 4HKPA 3FOKA 2QW5A 5HNUA 1PIIA 5FA5A 1RK5A 2J7EA 3GH7A 5FACA 4HTYA 4PUEA 3A3WA 4HZ8A 5FD0A 4G9PA 1TWIA 3FS2A 3TONA 4B5NA 3WFZA 3UCCA 3CZLA 1JYWA 2ZZBA 2CKSA 3QLDA 1W1B1 4TVDA 2DPEA 3F1QA 1AW2A 3M0KA 3M0IA 4ADSA 2HVMA 5KETA 4AC7C 3QBUA 1JRPA 2GLKA 3SRFA 2J9YA 2POZA 3TTYA 2GSJA 2GUYA 1HGYA 2V5BA 4KIRA 2V67A 3TSMA 5CCZA 1TIMA 2OB3A 2PAJA 4TQTA 1XSKA 4G1KA 2W66A 4XD4A 4C5ZA 1WNOA 2NSXA 3DHDA 1RCQA 2R14A 1NDYA 4WZHA 3PTMA 4GLEA 3OO2A 5LXEA 3GQYA 2WC3A 2ISWA 4HU4A 3DFNA 1K9TA 2WV8A 4ZA0A 3SCSA 1RBLA 3KRZA 3LK6A 1I6NA 3BSHA 2PDBA 3DYOA 4LOCA 1KRCC 3MKKA 4HNLA 4PN2A 4OTKA 2XINA 3B97A 5CAKA 1ISYA 2QJIA 4PC8A 1H50A 4LUIA 2EKCA 1QPQA 5IHSA 1RSCA 1VKFA 4F0HA 2BBFA 1J0JA 4FF5A 3Q58A 3W2NA 2A3BA 3QMRA 2QNEA 3QPYA 2ICSA 3ZJ7A 5EMMA 3SR6B 1QPRA 3TMLA 5G1YA 4HK6A 3N12A 4B3LA 4TVUA 4F0RA 4CU7A 3HG3A 4JKLA 4Z17A 3PF3A 3WQOA 1GJPA 1UWTA 2BOGX 1RR2A 2V8ZA 2ZRUA 2W55A 2CZ5A 4ZMGA 1QCWA 4DJEC 1KWKA 4ZTXA 5BW6A 4HSOA 6CGTA 3WUEA 3WJXA 1PTDA 1KXQA 3B3DA 4GO8A 2ZC8A 3MYPA 7TIMA 4LUJA 5KMYA 3GIPA 3SY5A 5A69A 2YXGA 3RF9A 4CD6A 2OJPA 2RDWA 4XTIA 1PX4A 1NWRA 4D8ZA 1N7KA 3N11A 3UPWA 2VZSA 1JZ7A 4NP7A 2WM1A 3RM9A 4EQSA 2PP3A 3URNA 4KWOA 5FJIA 3ABXA 2QKFA 1Q1RA 3VIPA 4C1KA 4B9YA 1BTCA 1Q6RA 1UKSA 3WD0A 3QR3A 1QPOA 1JAEA 4JKKA 1W3IA 4FLSA 4FALA 1UUQA 1XRSA 1ZUAX 2P8BA 2C3DA 4Y9MA 3O9NA 4GIEA 3VIOA 2DZWA 4W93A 2C1GA 3GVWA 4OGZA 1GOIA 2R94A 4JEJA 2VX6A 4E0CA 3UG3A 5BROA 3KTCA 2ABBA 2FIQA 1LT7A 4L80A 3TR9A 3J7HA 1XIEA 2EJ1A 1XLHA 1XSJA 4NI8A 2VI0A 3STGA 5CZJA 3A4XA 1ZFJA 3TZNA 4FPSA 4AX6A 3IIVA 4QE1A 5AYIA 2WOIA 3W7PA 1PDZA 3AU6A 3O8AA 3OLEA 4RNJA 3B8VA 1IEIA 4NSBA 3QTPA 1AJ0A 1EUAA 3B8IA 4GYJA 1OBAA 1ONWA 2XN2A 5DBUA 2OXNA 3E96A 3UVIA 3DFSA 1LL6A 3GW3A 2PRHA 1EPVA 1AA1B 5HMEA 3WD4A 4JYDA 4MHBA 1EP3A 4IXXA 4P7OA 1BRLB 5LA1A 1KGUA 3F4NA 4APNA 2FB3A 1J0ZA 3MHFA 1QI0A 2BSLA 2QMKA 3DU0A 2X8RA 4UR9A 4BA0A 3L21A 4ES4A 4GBUA 3DCPA 4KEMA 1PX3A 3PNUA 5LGXA 1M7OA 2C6QA 4KRTA 4PSRA 1TVNA 2CWNA 2J25A 1GOXA 2NX9A 1V8EA 3E2SA 1ITUA 1F5ZA 5FEPA 4Q8QA 7ENLA 3L5OA 5FJUA 3GE7A 1V51A 4AZCB 1T5AA 4YHGA 4PCSA 2XN1A 4LEFA 4AZ7A 4BR1A 4H4IA 5CLWA 1VJZA 4HYWA 4CCCA 3VA8A 3MU7A 1ZJHA 4K2SA 4QLLA 2DW7A 1MW0A 3USZA 4OBRA 1XR2A 4M56A 3UCQA 4M24A 4UFIA 4ML4A 4I5XA 1UZDA 3AC0A 2PF0A 4PMYA 4S2CA 1QW9A 5I3FA 4ZB5A 1JCLA 3RR1A 3STCA 4Q22A 2DVXA 4O57A 2I56A 3UW6A 1MZHA 4F0SA 3PBGA 1GZJA 4UC5A 1B4EA 3TN6A 3QKZA 4EXBA 2AGKA 3C2RA 2NUWA 2QGYA 3MUAA 1JGMA 4C5YA 4TXEA 5LKYA 4DYKA 2POTA 4AZ5A 2XFRA 4O14A 4HZ6A 3CTTA 3N2MA 5H8UA 2G4FA 2OELA 2PODA 5K7JA 5BZAA 1BWLA 3LCLA 4H4XA 1H1ZA 2V2CA 2WBAA 3MDUA 4L6HA 3IIOA 2J24A 3AAMA 1P0EA 3PHAA 4AYGA 2YAUA 2DZPA 4CKQA 1E4IA 1KFLA 4HMDA 4XAGA 2WKJA 1GYMA 3OYXA 5J5DA 1O5XA 3DUGA 4GUIA 4W5ZA 4AEEA 3W2UA 3GXIA 1K7XA 4GVFA 4IHCA 2P53A 4UFKA 4UTWC 3WDPP 1TQXA 1Q7ZA 3T6CA 3EWZA 4ZO7A 2O9PA 2VD9A 1ALDA 1Q6CA 3LHTA 2ZA3A 3KP0A 3MW7A 3EOOA 4FNTA 1BRLA 3W7HA 1UZ4A 1PKNA 1GVEA 2E3ZA 3GXFA 2WWCA 1WE5A 5K4ZA 4FNQA 4E8CA 4R3UA 1XBVA 1Y7VA 1FBAA 5E6YA 2XU2A 1DWGM 1JAKA 2XGBA 1FWSA 5T91A 2ACSA 4Y9NA 3N19B 4KERA 4M3PA 3BGJA 4Z2IA 2NVKX 3LB8A 4PE8A 1P43A 4QS6A 3UFYA 2ZXDA 1IQ8A 2V0TA 3WBAA 4M1BA 5C7VA 2PURA 2TPRA 3AIUA 4L65A 2Z1XA 4AUBA 2VP8A 1D8CA 4TMBA 2QIIA 4AVFA 3DFQA 5I6SA 1VQTA 3MDWA 4FHAA 4MNMA 1ZXIC 4YS1A 3TC7A 3CIWA 1AJZA 2R6OA 2A3CA 4Y96A 1HVXA 3LN3A 3CHVA 3NVYB 4HA4A 5ER0A 3BJSA 4JN6A 4QEEA 3VGFA 2QR6A 2WVSA 3NQFA 2OWXA 4WDUA 1XLDA 3MCMA 4IIGA 1T40A 2QF8A 1QU4A 4RKAA 2JBMA 3UZYA 3ZVIA 1L8NA 2AAMA 3CV6A 3HO8A 3L4WA 4WK9A 4C6OA 1L0PA 2QEZA 3W84A 1ZAHA 3CQIA 4Q4RA 1DIDA 1UR0A 1WKEA 2X40A 4C6LA 3PZMA 2NXHA 3E49A 3HRDC 4QE5A 1A3WA 5LIKX 2CXGA 2CBIA 1JGIA 2X1UA 3DERA 1KBKA 3OU8A 1MVYA 3IVTA 5JH1A 3H2NA 1XUZA 1XFCA 3GK0A 3GU2A 4IP4A 3EX4A 1U1UA 2F7FA 4RE4A 4GZIA 1DJHA 2PCQA 2QPUA 3AI0A 3EAOA 1T7LA 3UGRA 1UPPA 3DBPA 3TSDA 3FEQA 2PTYA 2W92A 2JALA 4GWEA 1J5SA 2A7PA 4ACZB 3RPDA 2FHFA 4HMCA 4OOZA 1MO9A 3TOYA 3N18A 1KBBA 2V3AA 4AIUA 3ARPA 1DJQA 2ISSA 3LM3A 3WQFA 3HPSA 4RE0A 3S1WA 2A3AA 2VELA 3I6RA 2HVNA 1FFUC 2OG9A 1OADA 4HCLA 2FDSA 3H4XA 3H7RA 4S2BA 2HRWA 2ZUWA 1DIEA 1K6WA 4B9ZA 5E1QA 2IQ0A 3QRHA 2XGIA 3LMYA 3H2MA 1V6YA 1IR1A 4C6FA 1DIOA 2RH9A 4KFPA 2OVLA 2ZX8A 1UOKA 3DK9A 3H55A 2Z7GA 3DFOA 5E0CA 3WYZA 2A79A 3ZOAA 4D8LA 2J77A 2CHRA 3LRKA 5MF5A 1WDSA 4DM1A 2GJLA 4QDWA 3M16A 1WV2A 1MSSA 3LXCA 2H90A 2ZE0A 3SY1A 5AOUA 5FJOA 1PZ2A 3W26A 4OBSA 3N15A 1KTCA 3A7RA 1LOSA 4KEUA 3PBUA 1EJSC 5FAGA 4GGBA 3GHRA 4IMDA 3CGTA 1DEDA 3SCRA 3R2GA 3ZR6A 3RHGA 4KETA 3CO4A 2I5GA 4GC4A 4JS3A 1HQTA 1KR1A 1DJGA 3WIJA 3SADA 5F2LA 4XBSA 1HN1A 4FZIA 2CETA 4CQCA 2HV5A 3U2OA 1DE6A 3E0WA 3NVTA 1OFQA 3LLXA 4DHGA 3HN3A 1UD8A 4L4LA 1W5OA 3MO7A 3B8WA 1MUCA 3BLFA 1XD0A 3M7WA 4MY8A 2ZUNA 3AIEA 1B30A 1V79A 5MKGA 4NAEB 4LVAA 3EANA 1ONFA 3W88A 2GR1A 1NDVA 3ZT6A 2G5WA 3NPVA 2W5FA 2A2IA 1W1VA 2EO7A 3WX7A 2XIOA 1VGAA 1QJWA 3A5FA 1XIHA 2GJXB 3NL6A 3U48A 4DWSA 5CPOA 2VMFA 4BWLA 1XH2A 4G1NA 1BFNA 2WJZA 4ATLA 3TC3A 3S1XA 1X7FA 1WYIA 4GVGA 1XYMA 2EPHA 4IJRA 1VHCA 2YIHA 2Y8KA 4W5UA 2DQXA 5AHEA 2UZ9A 3GRIA 2F38A 1R9XA 2G96A 2XTKA 4NAFB 4FMVA 1AK5A 4GQ0A 2V3EA 1K7EA 4PCFA 1AW5A 1M04A 1S2VA 4UTTA 2DUAA 5HWMA 4Q3MA 3B0YA 1FWFC 5AY7A 3KP1A 3QY6A 3GD4A 2J47A 3LPPA 3RU8X 1AOGA 1PDYA 3WJZA 1B9ZA 1VFLA 1IEQA 2BOFX 4U5KA 2ZRWA 4ZFMA 5HMSA 1Y5VA 3H4GA 5I3DA 1ZGDA 3KDNA 3T78A 3V1HA 1FX6A 5CGMA 2BODX 3N6JA 4JTRA 4UTUA 1YHTA 5D8ZA 1QR7A 1HZYA 4DNHA 1S46A 1YRRA 3PFRA 3SFKA 3VO0A 4DLMA 2BV9A 4IQDA 1RA5A 5E0FA 1TWDA 3OODA 1CGUA 3HMJG 1YTEA 4LS0A 4YMZA 4JTGA 4XZHA 4D6GA 4M7SA 3VM7A 2ZTKA 2WP6A 2FZNA 4QFUA 3RX2A 5A2CA 1XINA 4JN7A 1G1YA 3OGSA 4XKYA 3EX1A 1JL8A 3WLNA 4NJKA 4GRTA 3EWBX 4C6QA 1KA9F 4DI9A 4C7FA 4ZSTA 1K02A 1KCZA 2NWSA 4HJWA 3ABOA 1NQKA 1DP0A 3WMBA 2PDGA 1NP0A 5I7GA 2F6KA 4EP8C 5ABHA 3V1PA 3AHXA 5DRCA 3WG6A 3H21A 1GQNA 2ZWYA 3G0XA 3G6LA 3EB2A 5HNRA 4ZVJA 1ZP3A 2DSKA 1IT0A 3FSTA 4DWSB 2J27A 3GG8A 1RXOB 3L7RA 2FVKA 4O0QA 2Y88A 1I2RA 4F48A 5A8PA 4ML9A 4PMRA 3VFLA 5FI8A 1PWMA 1JQVA 4Q6JA 4L56A 4XVEA 3T08A 3II1A 4IPIA 5EYWA 4MZYA 4IPLA 3QR1A 4OBTA 1XLMA 3EA2A 4MWAA 4QJ5B 2TAAA 3KS6A 5AC6A 3LOTA 1V6UA 1QNSA 3MVIA 3SECA 5A8NA 4D1JA 3AOFA 1PWLA 3QMSA 1XCFA 4WLCA 3HPAA 2VURA 3HGOA 2GUBA 4JFWA 1DJYA 3WLQA 3PUGA 4BQ5A 1EJVC 1PZ0A 3PS7A 2WMFA 4X60A 4DUXA 2IMRA 2J7BA 2O92A 2XHYA 3SO7A 3TJ4A 1EWDA 3K2GA 2QLYA 3O63A 4RNHA 1UWQA 2ZIDA 4AD0A 3RPTA 1Z32X 2G3IA 1EIXA 2PDYA 1JD7A 1F8MA 2YB4A 4NZ3A 1L6YA 1W31A 1O7AA 4WQ6A 1F9CA 5EL1A 4RUBA 3FHQA 5ECUA 2FDMA 5HA7A 2E9LA 1QHPA 3KX6A 4UTIA 3UU0A 3UJFA 4UQBA 3LXBA 3E74A 4FIQA 3B40A 3PZUA 5I02A 5IBXA 4Q8PA 3QVQA 3R7MA 1KKRA 2Y6ZA 2OWWA 2H3BA 2WSYA 4B4FA 1LWHA 1SFJA 1GNXA 4M6UA 4C1NB 5KTLA 4ZE4A 3UERA 5IOBA 5C2CA 1CXKA 3AISA 3CYVA 4LU0A 3CUZA 3FKRA 3GAYA 1ZP4A 5HMDA 4P7QA 3SI9A 1BF6A 1FWGC 3R25A 1KM0A 2FPVA 3WNOA 3O0FA 4B90A 2G50A 1Q7QA 4O1CA 4D9PA 5FJRA 3AZTA 3OGRA 4LFYA 1CGWA 4I6KA 3THAA 3KL3A 4WHBA 2YDQA 1B90A 1TWSA 5EMUA 1OK6A 1JCMP 3ITOA 3T09A 3W7GA 4RZ6A 1FUYA 1NM9A 3NGFA 3CZKA 3U4AA 2WVTA 4KRUA 2HK0A 3UNDA 4RE2A 1SW7A 3RJYA 1HO4A 3AXKA 5FJTA 4Z2GA 3E9AA 2C1IA 4QEHA 1MXSA 2GGIA 1DQXA 1E9YB 3MJMA 1N60C 3NG3A 1YW1A 1X2HA 4K39A 3VK5A 1GZGA 1D2KA 1WOAA 4U5IA 1E6NA 3DDMA 1OFAA 5DELA 2GH5A 1TREA 1OX4B 1U5HA 5I78A 1G94A 5J5RA 1NHQA 1G01A 3GIYA 4J4KA 1OQFA 2GGJA 1YBQA 1K8CA 2F8QA 4JOMA 1KQYA 2A6LA 3H2AA 5IXEA 3W6LA 2ZZ2A 3E2QA 4KWUA 1VYRA 1VIWA 2C16A 3GXTA 1TPWA 4UFLA 3PZNA 1NSJA 4CNTA 2TMDA 2DZXA 1V93A 4QDMA 3W2LA 7REQB 3PZOA 3N73A 1RK6A 1ZY9A 4YN5A 4LYQA 4ZCWA 2E8ZA 2WNNA 4ZOEA 4G6CA 4DPQA 4R53A 1U1HA 4FX6M 3ZQ9A 1GREA 5CPMA 2PPGA 4A22A 3WLTA 5AC7A 3G77A 3VFCA 3MSDA 2E6YA 2XUCA 1IF2A 2ZXAA 3TKFA 3ITYA 1S2AA 1UKTA 3T4CA 1I45A 4ZL1A 3HZ3A 3C3UA 4CNPA 1B3VA 2ZZ4A 3BC9A 2B7NA 3Q45A 3VMOA 1B0IA 3LSCA 3M5VA 2YL6A 5D33A 1R87A 1UR9A 1I0DA 3CAWA 3P67A 3V4BA 2H9AA 4CD7A 4WY0A 2GVEA 2YXOA 4JNMA 1BQGA 4NZFA 8XIAA 3MWAA 1HL9A 4IXHA 1FVPA 3BOXA 1JDDA 1GCYA 3LS9A 3KBWA 3MP4A 3PSWA 1N8IA 4PMUA 2XGZA 2PCEA 3MWCA 5G2IA 4LPCA 2BVTA 2W67A 4OVXA 1IGWA 4GNVA 2Y70A 1UQYA 2PDUA 4P8VA 4A8RA 1GERA 3VOCA 1BVZA 3IGUA 3QW4B 2CU0A 1MMFA 1QI3A 3KZSA 3QPEA 3SCNA 4PZVA 2KX9A 4GG9A 2C71A 2W4XA 2CLIA 1R30A 2DIKA 3AYRA 4JDBA 1FKWA 3QM3A 2GGGA 2ISVA 4O19A 3KBNA 1XICA 1RLCL 5U7SA 4HPHA 3S1UA 3WNNA 3KVJA 1F73A 4LF1A 5FMHA 4RE3A 3EAUA 4QJ3B 3VD7A 4F2TA 3A3XA 4QROA 3H2EA 3W53A 1JDCA 3FSUA 1YDVA 3C3NA 4R85A 4AVNA 4R9XA 3VOIA 3MUXA 1J2BA 1SPQA 3APGA 4QITA 2Y0FA 3CB3A 4KT2A 1JRBA 4N9BA 2H8XA 1KFEA 2PZ0A 3NO1A 4GYPA 2YR1A 4FSAA 1XGEA 3ZLGA 4JTCA 3SGGA 2I9EA 2XVNA 3VUSA 1ZPTA 2HNHA 3UZ5A 3W7NA 4K8GA 1YDYA 3RIKA 3C61A 4LCQA 3NQ7A 4Q7NA 4IFOA 3KBSA 3COTA 1WYGA 1LLOA 4INFA 4PBFA 1VCFA 1XD1A 1H7PA 1IIGA 2WC4A 2I9UA 2PGWA 1MEIA 1EC8A 1KWGA 1VP5A 1TG7A 4J56A 1LBFA 3LADA 3GZAA 3GWQA 1J96A 4NZCA 3RITA 1M9HA 1WAUA 1H7XA 3W82A 5FEXA 3SN1A 2FH6A 3LI0A 3H53A 1OT1A 4Y9PA 2XJ7A 4FOJA 1Y0EA 3C86A 3A4JA 4IFRA 1E9LA 4GX8A 4GABA 1GJWA 1K1DA 1B3XA 2NXIA 4ZQRA 1NJJA 2VX5A 1F8IA 3W1QA 4B5UA 1ZBVA 3SCVA 2IQTA 3S46A 3FLUA 3EDEA 4ZBCA 1AH4A 4PODA 5FL0A 3AFBA 2JQXA 1J10A 3FV9A 3GRTA 4H4VA 1WUFA 2V68A 4DYJA 1TRIA 1S2UA 2QIWA 2DVUA 3P0XA 1W1YA 5CC5A 1G5AA 4KQNA 3D6NA 3BURA 3NPUA 5FIPA 2PDPA 1LYXA 2EJAA 4LVBA 1CX9A 5H91A 3VIHA 1QHOA 4H7VA 2V3GA 3W85A 5I3KA 5CPLA 1NEYA 1RZMA 1R3SA 5G2HA 4CN4A 3CZGA 4YTUA 3DX5A 3KCJA 4CNNA 4Z08A 2ZA1A 1UJPA 4MKSA 3A4AA 3EPMA 3FG2P 3FW6A 3U5UA 3XINA 3UCDA 4AD4A 4ZODA 3R8HA 3TJIA 1N8FA 3BAWA 4UNKA 4LBUA 3H22A 4ZSUA 4O13A 5JIWA 5AYXA 2DZSA 1XYCA 3ZT5A 4FK9A 1W5QA 1HKKA 1K8XA 4PCPA 1JCXA 4E4FA 4JTUA 4YWIA 2J75A 2X99A 4DEFA 3NSXA 1XIJA 1Q6FA 1E72M 5BOEA 2W0HA 4LB4A 3LV6A 5H8PA 5JRBA 1O95A 4MB1A 1WO2A 2OT0A 3VIGA 2NVDA 3OYZA 1GONA 3N6QA 2QCNA 3GDMA 2ISDA 1T99A 1OG6A 3LENA 9XIAA 3W24A 2HTMA 2I16A 4Z1BA 2V3FA 4ZQMA 4BK9A 1YXYA 3DBNA 3WLPA 4NKCA 4M80A 3UGVA 4PUJA 1R3QA 2V30A 3K8KA 2QAFA 3PJXA 4HNNA 5BXRA 3G2GA 3L4ZA 3UWZA 4K7VA 1DXFA 3CLWA 1DTUA 1GOKA 3WY1A 1T0OA 2B4GA 3BZGA 1LDCA 4OKDA 3SEPA 2IXVA 2Z7KA 1O5KA 3KLLA 4J2PA 2F6XA 1O94A 5D09A 2INZA 1V5XA 2PE4A 3JW7A 1F3WA 4E2VA 5SWUA 1UB3A 3NL3A 1E43A 1XLIA 5GVJA 2CLEA 1W56A 4JTJA 2BVWA 4GZEA 1UD3A 3LHUA 1TJ2A 2HXUA 4L6OA 3LG3A 2F84A 4Q7IA 1W0MA 2AGTA 4PUDA 2HDJA 4QSHA 5EU9A 1UP0A 4UTKA 4Z2JA 2ESCA 4WJEA 3GFYA 4PUMA 1JPIA 1XG4A 3LUTA 4K7ZA 1SJBA 4GYPC 3TAOA 4D6HA 1W2VA 5CLTA 4BCEA 2EG6A 3HU7A 2HPMA 1P5BA 4HOXA 3G0UA 2WVVA 2XIJA 4L6DA 4XBKA 1VH7A 4P8XA 2PDKA 2IW0A 3B9AA 3IJ6A 3LCGA 5A2AA 1Y65A 1EBHA 2AMXA 2VYOA 3VUPA 3LCIA 1UWIA 4JTKA 4DO7A 3NTYA 4QAIA 4WD0A 3WLHA 3HQPA 1CECA 1VFUA 1KGWA 1V02E 3KOXA 3MKCA 3RCMA 4ADTA 2H3DA 3D3FA 4N4PA 3M5ZA 4HOZA 2NV1A 4DJED 1HL8A 4NILA 2OQHA 4CVUA 2O55A 2XFYA 3QHOA 3PWGA 3UF9A 1KLYA 1QK0A 1F6KA 4LVGA 3W7QA 2XPKA 1W32A 4GCXA 3DFHA 1ME8A 3TJXA 3ARQA 1E5NA 3L0GA 1I0BA 2ZC1A 2E7FA 4PMNA 4MAVA 3T2OA 3WNKA 1XJBA 2PI6A 4J1OA 1K6AA 3OZPA 3FKKA 1JUKA 5M03A 3QZEA 1YYAA 3HG4A 5AKQA 1ZY8A 4MDPA 3F03K 3LTPA 4GE8A 1EIBA 3M07A 1W5MA 5REQA 3QGKC 1IHIA 2R1PA 1QK2A 2XIMA 4JZ5A 4N9CA 3F2BA 4B5SA 4OECA 2O4MA 1H7WA 2WMIA 5EY5A 2NT1A 3HG5A 2PLMA 3MKVA 3NIYA 4BEQA 1ITCA 1VEMA 4NIRA 1WUEA 3PZVA 4LJ3A 3R94A 1GOMA 3M44A 5I79A 2J4GA 3W23A 3WDIA 2HS6A 1B2YA 3B05A 3NVDA 6A3HA 1TJRA 1X1ZA 3GB6A 8TIMA 2CZDA 3UPBA 3U2CA 2CPUA 4C60A 2Z1BA 1XYAA 4JR5A 6REQA 2W0UA 3R13A 2V9DA 1IGSA 3FCPA 4NRRA 4AWUA 2X50A 5A6LA 1E15A 1EHAA 3W01A 5CBJA 4MIMA 1TELA 2RHGA 4I90A 2FZ8A 3PM6A 4YVPA 2R82A 3N3MA 2CLPA 1NF0A 5I0DA 2ZZ6A 1UA3A 4W7WA 2VUNA 3RU6A 3WD3A 5AYZA 5E0KA 4NJHA 1FH7A 5M2FX 4U2YA 2FH8A 2NLIA 5AHLA 4DNMA 5I3HA 1TTIA 3WF4A 7ODCA 1GXFA 3QFWA 3GYCA 3HURA 4NASA 3VE9A 4XZ9A 3RG6A 1G69A 3VGBA 1XH1A 1E0TA 1XKYA 4O11A 3G22A 5RUBA 1K8ZA 4ICCX 4S39A 3KS5A 2WKGA 3DHPA 2OODA 4MOZA 2ZUVA 3M0JA 4U3AA 1TR9A 4M1RA 4L1XA 3LNPA 3E3HA 1RBAA 3OVGA 4IQLA 2EPMX 3VIJA 4HU0A 4POCA 3FDKA 5AECA 4W88A 1ME9A 3W71A 4MSSA 2WSKA 1XRTA 2G41A 2PU1A 5FOOA 2PSNA 2YGYA 4DBWA 2XDFA 3YPIA 1OX5A 1F3XA 3ZJ8A 2ZX9A 4NI3A 1VBUA 3KBVA 5G5HB 2PD9A 1OVDA 1BQCA 3FJ6A 3VCNA 5JVLA 1WXJA 2J8GA 5B80A 3TYZA 2QVHA 4LB3A 4IM4A 1QNVA 3FK4A 3RLGA 2ZRYA 3RM8A 4IISA 4EQRA 1ZSXA 2WSQA 3CAQA 2V82A 3W7DA 4AZIA 5EMLA 3NYDA 4PFMA 4P2VA 1WA3A 3KOWA 4KBXA 3UXIA 1GESA 3NNTA 1POKA 2BHUA 4QGCA 3ZS4A 3UWYA 3W76A 1KM5A 1UKQA 3H6OA 4JYFA 3S0CA 3G1FA 1K77A 3M6DA 1LLZA 3QQ0A 4IIFA 3VI2A 1FEBA 1C9DA 4PEEA 2E6AA 3S2LA 1Q4NX 2Z6JA 4M0XA 2MUCA 4GH1A 1WZAA 3STPA 2DIJA 2DEPA 3LZ5A 3U2ZA 4UFHA 1I2PA 4JTSA 2B0MA 2BDQA 2B31A 3DH9A 3EKLA 1F74A 1FO4A 1FA2A 1MEHA 1L6WA 1JDFA 5JBDA 2CZFA 4L1WA 3EYPA 1EJTC 1VENA 1UD2A 3I7RA 3G24A 3NO5A 4LVDA 2QF7A 3NVZB 3PPFA 1OB0A 3TUUA 3BLEA 1ENUA 4M5PA 1FFQA 2MANA 4RV8A 5HWNA 2CLHA 3VKBA 1K4HA 1VFMA 1J12A 1EHNA 1XLCA 4DBDA 4N4QA 4W4QA 3FJ4A 1IXQA 1TFVA 1LQ2A 1RD6A 3L0KA 5M1TA 3LSBA 3SJ3A 3KLJA 3BOFA 1XLJA 4MB5A 4S3KA 3GZ3A 1L9WA 1VBHA 1QPKA 1VCGA 2ONEA 1YE6A 3VIMA 3ALFA 4HB7A 1TMQA 1ZALA 4YU1A 1PBGA 3TTEA 4H4WA 5IBXC 2X1TA 4H19A 1R2TA 3DK4A 2HNEA 4DI8A 1GKQA 1X1NA 1D7FA 2NQ5A 2PA6A 3T8LA 2GK1B 3EMZA 4S3BA 4E4UA 3WLLA 3BW2A 1E0WA 1I2OA 5F2MA 3ZLHA 4XWUA 4UTJA 2WW5A 3WN6A 1T8XA 4NXSA 2J7DA 3ONBA 3ABSA 3S47A 3WEZA 4QLJA 1GEHA 2FTYA 2AKZA 5CZSA 4Z42C 1ZAJA 5KITA 1NFGA 4XAPA 1EOKA 3GTNA 3CB8A 3BW3A 4DELA 4UUIA 1MW2A 4EPDC 1EPXA 4OE7A 3ZM8A 4GFIA 4Q4QA 1RY0A 1EZ2A 1JPHA 1LM1A 1JOAA 2YL9A 1N82A 3ARZA 4WY0B 4Q8MA 4B4HA 3LPOA 3ZVHB 3N4AA 3DZ1A 4UCFA 4RPPA 4DJDD 1ZMDA 2NVAA 4HK5A 4NEVA 3DYPA 4PB4A 3BLPX 3EKZA 1KR0A 4KCVA 5CSYA 2AMGA 3UG5A 3IJ8A 3F5KA 1YIXA 5GPRA 1QW7A 1OIFA 1OSEA 4HP5A 4ZOCA 4XBJA 2HMCA 3GKAA 3EWXA 2RDXA 1FFVC 4GUFA 1TV5A 5EB8A 3KL5A 4Z2HA 4G8TA 3VGHA 1E56A 4A8LA 4H4PA 3URHA 2ZZ7A 1AVAA 1D9EA 2NX3A 3WBEA 1G4SA 1TVPA 1GETA 4F2BA 6XIMA 4TIMA 4LAMA 2OO6A 2ZOXA 2BNJA 3IWPA 3R89A 3PB2A 3SRKA 1JDAA 2QQ6A 4Y6GA 4WXYA 2VC5A 4P7LA 5A6BD 3NDYA 1UMLA 4ZOBA 4KS0A 2OLHA 4EM3A 3OB8A 1C92A 1ZENA 4IG2B 4YL2A 4RW5A 3ZT7A 1OWQA 3IIPA 3IAPA 4OT7A 5J8LA 3GM8A 4F3HA 1GVSA 3L2IA 4D71A 1SFSA 4AW7A 3FFSA 1PPIA 5K9DA 3ANVA 3M7SA 1FQ0A 4MM1A 3F5LA 2QJHA 1R3VA 3W37A 3M6YA 1UH4A 4EVZA 1DXEA 3BLOA 3UYCA 2BASA 1TPVA 1ZJIA 5FAJA 3MBDA 3GR4A 1M03A 2D22A 2DZTA 2VC6A 2WC7A 4QISA 3BDKA 2PDFA 2D3NA 4IMFA 3A24A 3ITLA 4GQRA 3FYPA 4TVYA 1UG6A 2J3NA 3W1MA 2PRLA 3VD4A 3WUBA 4ZO9A 2CCRA 1E3XA 3VKCA 4MPQA 4HOWA 1PVNA 1Z6KA 2PLCA 4E2DA 4MYXA 1LCOA 2WVUA 1CT5A 1WCGA 6REQB 4RCXA 4GYFA 4PL1A 3AIBA 1IZCA 2V2HA 4EWJA 1FCUA 2VXNA 3GRSA 3NR0A 4MMWA 3BH4A 3MTWA 2EPOA 4AWEA 4W89A 1LRQA 5G5IA 2RGLA 3RGTA 4NXKA 3WDHA 2V5DA 5K9CA 3BG5A 2YBUA 4YYFA 1GOWA 1X6NA 4H9MA 1SO6A 2PWGA 2HK1A 2P0OA 4R5EA 1IXOA 1BG9A 4XQ6A 1XBXA 5AB3A 4W86A 4D6EA 4JTIA 1PYFA 3ZO9A 1YXCA 2J66A 4QG9A 1GRAA 2NT0A 5MKGB 1XIDA 2GJNA 1NU5A 4V1YA 2X0YA 3IJ9A 1AH0A 2W6RA 1DOSA 3HGSA 1JZ4A 1ITXA 3VZYA 2C0HA 2OKOA 1YLVA 3G8EA 1S5NA 3LHVA 1UW9A 2VWSA 4PUKA 3ARWA 1C91A 1CZ1A 3NZRA 4GRSA 2E68A 2FMNA 1TV4A 2J78A 2PS2A 3HFTA 4NY2A 3I3BA 3CTLA 3LGDA 3P80A 1SSDA 3W1NA 4IGMA 3DJGX 1BEUA 3FA5A 3N17A 2ZX7A 1UD6A 4WJXA 3LD5A 1JJKA 1W54A 2C79A 4CQAA 3TA9A 1C8QA 1Q6OA 3WBYA 4S3DA 4O52A 1XS2A 1NQ6A 1GW9A 2R24A 1EYWA 2WZTA 2BXZA 2GR2A 4DLFA 3AN1A 3WH9A 1MQQA 3LCXA 2OCZA 1DWJM 3I7SA 3TXVA 2W3RA 1EP1A 1B3WA 1QNOA 3V7PA 4C6EA 3NOEA 2OPJA 2VVNA 3DXIA 2QV5A 1RD5A 4NYYA 4MVAA 1OD0A 4IZGA 2BWGA 3MI2A 2XIQA 1MI3A 2QUTA 4HU3A 2PDJA 2GYIA 4NUWA 1HFBA 1G4PA 1NOFA 2DV0A 4GGHA 4A35A 4C6BA 1G7VA 1XDJA 1GVIA 1EQCA 2PDMA 3DH7A 4GUHA 1XLKA 4TUFA 3P3BA 2GVYA 4ROQA 1V3LA 1NDZA 4M7TA 2J9ZA 3KL0A 5KZ6A 2XFFA 4TMCA 3DFYA 2ATSA 4L1GA 3TJLA 4IOTA 2QGHA 1QNQA 2ALDA 1A49A 3VVGA 2JKAA 5DMLA 5EFFA 2PMQA 3RCNA 1TB3A 4BFAA 3UWVA 1W3LA 4FA3A 2PTDA 4HHHA 2X8GA 2BX7A 2CERA 1A5AA 1F4HA 5T26A 5F4SA 3NXLA 1UWSA 5EMJA 3UY7A 4Q4PA 1N61C 4QJ4B 3KOZA 4I8YA 1TYPA 3AXXA 5A6JA 3C6CA 3TROA 1ZU8A 3W75A 1SW0A 2QV4A 4RDVA 2ZFAA 5DBTA 1HVQA 2CLFA 2EAWA 3NZPA 1TPH1 1ZKQA 1VYSX 3NQ2A 2GRTA 4FX9A 4C6MA 1MNSA 5FS8A 3GLCA 3BARA 1FCQA 3CGCA 5DN1A 1XDIA 3O7UA 1CGVA 1VFTA 2G3MA 3QEZA 1DWIM 4DJDA 1B4KA 2CXEA 2YA0A 3ARUA 3L2LA 1R8LA 4LXFA 2ZX6A 3OC4A 4JHMA 4KWVA 4WVXA 4DJDC 3CIXA 2DVTA 1TYTA 1TUXA 1L6SA 3ITTA 3VE7A 1GT8A 3N2CA 4ZFCA 3MPGA 3WBXA 1DTNA 1SR0A 5C6MA 4CCEA 2VC7A 2J8TA 2QJNA 4ZOHB 1SR9A 3WQ5A 2EF9A 4GOAA 2VQTA 4M8UA 3BQ6A 4DO5A 2I7GA 1EUNA 3CT7A 1JYXA 1NDWA 3E2RA 3R8GA 1U2YA 2UY4A 3GU1A 2GOUA 4YVVA 4S3FA 4FB7A 1DKWA 1DYSA 2QCLA 3STEA 4W8BA 2H6RA 1CB7B 4J28A 3S6OA 4EOUA 4ERAA 2W63A 4YIWA 2X42A 1C8XA 1ICQA 5F2GA 4B5TA 3W74A 3CC1A 2WAGA 5FS7A 2P5NA 1UYQA 4GQBA 8RUCA 4CQ8A 1Q1WA 4WXZA 2BGQA 2R1MA 3TWAA 5DCDA 4MKNA 2TODA 3UWWA 3K8LA 4A3RA 5LXXA 4QBXA 5HNTA 1XSIA 3TN3A 4ZO6A 2OKTA 3QN3A 4FXFA 4C1LA 4H4SA 1BVWA 3MB9A 3CZ8A 2WJFA 4Z1CA 2C15A 3ATYA 3NEHA 3IK4A 3ORWA 1FWDC 1OG0A 4DBUA 3W3OA 4M52A 2V69A 1HO1A 1R47A 1LG2A 2VDHA 1V97A 3UT0A 3REQA 3CUJA 4H8NA 4ASTA 2E67A 4HD5A 5H1WA 4UFMA 3GTHA 4GXMA 1QBBA 2Z0IA 4AIEA 3SUVA 4H4TA 1Q4WA 3AALA 2BHZA 3JVAA 4S3AA 4YWSA 1W9PA 2A6NA 2AOSA 1UROA 4DF0A 4H9VA 3AWOA 3DHFA 4FXRA 4K8EA 3RJXA 1MW1A 2VD8A 4UQCA 5LIUX 1KCXA 1IT7A 3HG2A 3DI1A 1JNDA 4S3EA 2YA2A 4IP5A 1EL3A 4MWAE 2I1OA 1O66A 4F9JA 1FEAA 4KIEA 3BAYA 1QW8A 1OFPA 4DNAA 3AZSA 3IJDA 2YCKX 1GYLA 1W2PA 3CV1A 5IFTA 1YADA 4GBDA 5AZ0A 4PUNA 4F79A 2RJGA 5CEWA 4YXGA 1W6TA 4PMQA 4R7WA 3P6LA 4XZIA 5BXPA 4CQBA 1XCXA 2O4QA 1XLFA 3F2CA 3H70A 1Q7MA 4HVXA 2FZ9A 3NOYA 4AFYA 3APTA 4H6KA 5KZDA 2GJRA 5JCIA 1FCVA 3F7JA 3MQTA 3T0TA 1CXEA 2TYSA 1UKOA 5TQLA 2YCLA 2VWTA 1UQZA 1X2GA 1ZHAA 5IHRA 1RUSA 4OUEA 5CC3A 3NQCA 5JBFA 2QUUA 2YB1A 1PKYA 3WJSA 2JK6A 1KGXA 3PUDA 7CGTA 2CHNA 1H63A 1YTDA 4JBRA 2VUYA 4RV3A 1TCMA 4DM2A 1BSIA 4M19A 1SO4A 3LDVA 2J7FA 1CGYA 3NQBA 4OU1A 1F61A 1VPQA 1EJ7L 4LTSA 4AAJA 1E0XA 4O17A 4UBPC 3IV8A 4UFJA 4DX3A 4JIHA 4K6AA 3RDKA 2WPEA 2VEPA 1VQZA 1QAPA 3N9KA 2QVNA 5BCAA 1S7MA 3THDA 3W72A 3ARRA 2XISA 3S1VA 2JK2A 4HK7A 4LBRA 3T0CA 3BQ5A 4UOQA 4EPKA 4FS9A 3VNJA 3MSGA 4R33A 3MHGA 2NQHA 2NQ9A 4QRNA 1KFCA 2QPSA 2XVPA 3AIRA 3CH9A 3H7VA 3EDDA 1OIMA 2B7QA 2OMAA 5C7HA 2J74A 1EGMA 4BS0A 4JCMA 2AAQA 1R9YA 1PIGA 2YXXA 1SFTA 1JPKA 3EMCA 4TV5A 4XUGA 4AF0A 4N2YA 3W6YA 4Q4SA 3V0TA 3MSRA 3GTFA 4DYEA 4JICA 1SSGA 3LYEA 3UPMA 4EMWA 1AG1O 4V27A 3IACA 5TBOA 3MZNA 1LL7A 2VR5A 4CQDA 3CZEA 1JRCA 2BB0A 4XO6A 3BUVA 2Q8LA 3T8QA 4ZGYA 1UPMB 3S9YA 1Q13A 1I2QA 4IIEA 3O15A 3UJRA 1EXPA 5F4XA 3ZVHA 4M81A 2ZVRA 3KDOA 3VDHA 3BJFA 2Z29A 1JYNA 2X8HA 4Q8VA 4BV6A 2P88A 3NA8A 4IPPA 4Y90A 3VXGA 2DSVA 1S3HA 2WBKA 4U3CA 1C8VA 4M6QA 4XK2A 3V35A 1GRFA 1J11A 2OO0A 3EOSA 1NY1A 3W0KA 3N4EA 4FAMA 4AEFA 5BU9A 1AMYA 1KCKA 5HPOA 1DXIA 4H9TA 4MB3A 4CNOA 3AHYA 1JZ2A 4H4RA 4YPJA 2PFHA 4J7RA 2PGFA 1X98A 1W1ZA 4FLQA 1C93A 2EEXA 1WXZA 4UTMA 3OIHA 4PFHA 5F1VA 3VDCA 1VPXA 4FO4A 3THQA 2ZQ0A 3W86A 1P0DA 5G2WA 3EDFA 4KWWA 2GUUA 5AVNA 4GVHA 4M29A 5I23A 3GVQA 1KCLA 3UP8A 1OF8A 4XSLA 1UMYA 4QIUA 1JPDX 3B0VC 4K8DA 3F4WA 3S83A 1ZS2A 2QPXA 1FWAC 3UXLA 2A3HA 4NJJA 3T40A 3ZFHA 3BK0A 2XVKA 4PMVA 2Y5SA 3AYVA 4LEQA 4IG2A 4TTGA 1UKPA 3Q94A 5CZKA 1DQUA 1PCWA 1XLEA 3INPA 1IXNA 1UUOA 3IRSA 2ZE3A 4QCFA 5HINA 4ZTYA 3TE9A 4EKJA 2YCEA 1NWSA 3LI1A 4A29A 3WJYA 3AIVA 2JGYA 1TJPA 3EEZA 4TR9A 2ZWZA 4MPKA 4MJ2A 2A3LA 2VOMA 4NZ1A 4CD5A 1ODUA 3IIXA 4Y8FA 3NL2A 2I5QA 3PY2A 1D3HA 1CXLA 3AYSA 3T2PA 1JFXA 1PCKA 2HE8A 4J40A 3DYMA 3T0DA 2RUSA 4X2PA 3QJAA 1GGOA 3W83A 3ANYA 2Y8VA 1BTMA 3K8MA 4IF2A 4XO7A 4RDWA 4I8DA 3G1HA 3K13A 3S2NA 3G1YA 2QXWA 3O07A 4H2HA 3B0PA 4J3UA 2WCGA 1ZDLA 1I75A 1NH6A 5TR3A 1YEYA 4LC6A 3GFZA 4RXFA 2R9RA 4MNJA 2BHYA 5AHFA 5AHIA 1Q6GA 1GVFA 5A6TC 4Z1YA 3I65A 5CPNA 3CNYA 4PTWA 1BF2A 5C9WA 1OJXA 4KF1A 4U31A 3LHWA 4I9TA 2VENA 3HTWA 4DWSD 2ZXQA 4PMXA 1DWHM 1F3EA 2QCDA 4U4MA 4WGHA 1JROA 3MUIA 1K9DA 3PZTA 4F66A 5T9BG