2QH7A

Mitoneet is a uniquely folded 2fe-2s outer mitochondrial membrane protein stabilized by pioglitazone
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
KAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MitoNEET is a uniquely folded 2Fe 2S outer mitochondrial membrane protein stabilized by pioglitazone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Zinc finger CDGSH-type domain 1
total genus 11
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09360 zf-CDGSH Iron-binding zinc finger CDGSH type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.5.90 Alpha Beta 3-Layer(aba) Sandwich Ribosomal Protein L9; domain 1 Ribosomal Protein L9; domain 1 2qh7A01
3FNVA 3S2QA 3TBOA 3LPQA 4OO7A 2QH7A 4EZFA 4F2CA 3S2RA 2QD0A 3TBNA 4F1EA 2R13A 3EW0A 4F28A 3REEA 4OOAA
chains in the Genus database with same CATH superfamily
3S2QA 2QH7A 5GHSC 2OUTA 1CQUA 5EG5A 3TBNA 4UY8H 4FR0A 1DIVA 2HBAA 2HBBA 3FNVA 2EHOC 3LPQA 4FS8A 3J7ZH 2R13A 3ANWA 2X49A 3TBOA 3REEA 3FNDA 2LSMA 3S2RA 2QD0A 4F1EA 4RSRA 2X4AA 3EW0A 2E9XB 4F28A 4OOAA 5GHRB 2HVFA 4EZFA 2E9XD 2HJQA 4OO7A 4F2CA 2Q9QA 4FSDA 2Q9QB 4KW7A 3CO4A
chains in the Genus database with same CATH topology
3S2QA 2QH7A 5GHSC 2OUTA 5EG5A 3TBNA 4FR0A 3FNVA 2EHOC 3LPQA 4FS8A 2R13A 3ANWA 2X49A 3TBOA 3REEA 2LSMA 3S2RA 2QD0A 4F1EA 4RSRA 2X4AA 3EW0A 2E9XB 4F28A 4OOAA 5GHRB 4EZFA 2E9XD 4OO7A 4F2CA 2Q9QA 4FSDA 2Q9QB 4KW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNV A;  3S2Q A;  3TBO A;  3LPQ A;  4OO7 A;  2QH7 A;  4EZF A;  4F2C A;  3S2R A;  2QD0 A;  3TBN A;  4F1E A;  2R13 A;  3EW0 A;  4F28 A;  3REE A;  4OOA A; 
#chains in the Genus database with same CATH topology
 3S2Q A;  2QH7 A;  5GHS C;  2OUT A;  1CQU A;  5EG5 A;  3TBN A;  4UY8 H;  4FR0 A;  1DIV A;  2HBA A;  2HBB A;  3FNV A;  2EHO C;  3LPQ A;  4FS8 A;  3J7Z H;  2R13 A;  3ANW A;  2X49 A;  3TBO A;  3REE A;  3FND A;  2LSM A;  3S2R A;  2QD0 A;  4F1E A;  4RSR A;  2X4A A;  3EW0 A;  2E9X B;  4F28 A;  4OOA A;  5GHR B;  2HVF A;  4EZF A;  2E9X D;  2HJQ A;  4OO7 A;  4F2C A;  2Q9Q A;  4FSD A;  2Q9Q B;  4KW7 A;  3CO4 A; 
#chains in the Genus database with same CATH homology
 3S2Q A;  2QH7 A;  5GHS C;  2OUT A;  5EG5 A;  3TBN A;  4FR0 A;  3FNV A;  2EHO C;  3LPQ A;  4FS8 A;  2R13 A;  3ANW A;  2X49 A;  3TBO A;  3REE A;  2LSM A;  3S2R A;  2QD0 A;  4F1E A;  4RSR A;  2X4A A;  3EW0 A;  2E9X B;  4F28 A;  4OOA A;  5GHR B;  4EZF A;  2E9X D;  4OO7 A;  4F2C A;  2Q9Q A;  4FSD A;  2Q9Q B;  4KW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...