2QHBA

Crystal structure of ngtrf complexed with telomeric dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
86
structure length
86
Chain Sequence
RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complex structure of plant telomere bindig protein, NgTRF and telomere DNA
rcsb
molecule keywords 5'-D(P*TP*TP*TP*AP*GP*GP*G)-3'
molecule tags Dna binding protein/dna
source organism Nicotiana glutinosa
total genus 25
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2qhbA00
2CKXA 2JUHA 2AJEA 2ROHA 2QHBA
chains in the Genus database with same CATH superfamily
4GDXA 1E7AA 4FJCB 5GIOA 2BXGA 4M70B 2Z8JA 2I2ZA 1N5UA 2V36A 1E7GA 1HK2A 3JRYA 1MUSA 2BXNA 2LXSA 2OT3A 2Z8KA 3M99C 2BXBA 4WA6B 5BPKA 1MUHA 4DHXB 4Z69A 4ZC6A 1HK5A 5GHKA 4ZCGA 3WHRA 1E7CA 2OZBB 3NVKA 2BXDA 2LOQA 1HA2A 1LOTA 2BXEA 4L9QA 5IIXA 1NT2B 5GIPA 4LUHA 1MIWA 4ZBKA 1KDXA 2BXFA 3H3AA 5IFOA 2DYOA 2XVUA 2BXOA 1J78A 4GG2A 2XVQA 2XVVA 4ZBRA 3TDLA 4BY9C 2EFCA 2EFDA 2NQOA 2XW0A 2K0NA 4K2CA 2BXCA 4GDLB 5DQFA 3NMUA 2LQIA 1HK3A 2ROHA 4TQ0A 1FOUA 2BXAA 4PO0A 4EMXA 2XMOA 5IJ5A 1MA9A 2BXMA 1E7IA 2JUHA 1UORA 2AJEA 1J7EA 3G9KD 2NNWA 3GA9L 4G04A 4N3ZA 4NAWB 2DYMA 4N0FD 3MHHB 3PLAA 2LQHA 4HGKA 3GQXA 2AGHB 3SIUB 2BXKA 4OT2A 1VZSA 3FWCC 2EFEA 4JK4A 3KIKA 4G03A 4LB2A 4IW1A 3ECPA 2XSIA 2BX8A 4DM0A 2VDBA 4K71A 2VUFA 4TQ1A 1BM0A 4L9KA 4OTTA 1E78A 2CKXA 5IJEA 1MIYA 1GNIA 4ZBQA 1O9XA 2DBWA 2EFHA 4S1YA 2QHBA 4F5TA 3SQJA 4Z9OA 4IW2A 4J2VA 5DBYA 4W4UB 3JQZA 3BPJA 1E7EA 1KW2A 4G01A 1E7FA 1H9ZA 3LU6A 4D7XA 4F5VA 3FWBC 3B9MA 2DBUA 3WHQA 2BXHA 2QM6A 4C31B 2E0XA 4MBEC 4E99A 4FIPB 4ZUXV 2DBXA 5HOZA 2VUEA 3LU8A 3A75A 4LUFA 3VQIA 3V03A 3ICXA 4HGMB 1BJ5A 4LB9A 1MIVA 3CX9A 1TXUA 4F5UA 2BXPA 1H5WA 2BXIA 1MM8A 3V09A 2BXLA 4LA0A 5IIUA 5ID7A 3SIVB 2YDFA 5IJFA 4GDKB 4BKEA 1JNBA 5FUOA 3GQUA 3H37A 5ID9A 4OR0A 2Z8IA 5D7GA 5IIHA 3B9LA 1AO6A 1E7BA 2LXTA 1GNJA 3UIVA 1HK1A 4I9OA 2KWFA 4L8UA 1IJGA 3MHSB 3KJLA 2XW1A 5GINA 1LNSA 3A73A 3LU7A 2DG5A 3V08A 3WHSA 1KXPD 2I30A 4FK5B 3W1SA 1HK4A 3NVIA 3NVMA 5B5TA 2XVWA 4OTUA 4N0UD 1E7HA 1VFIA 2QMCA 2BXQA 1BKEA 2E0YA 4F5SA 1SB0A 2KBZA 2GUTA 3FNMA 1TF0A
chains in the Genus database with same CATH topology
4GDXA 1E7AA 4FJCB 5GIOA 2BXGA 4M70B 2Z8JA 2I2ZA 1N5UA 2V36A 1E7GA 1HK2A 3JRYA 2BXNA 5BPKA 2OT3A 2Z8KA 3M99C 2BXBA 4WA6B 4DHXB 4Z69A 4ZC6A 1HK5A 5GHKA 4ZCGA 3WHRA 1E7CA 2OZBB 3NVKA 2BXDA 2LOQA 1HA2A 1LOTA 2BXEA 4L9QA 5IIXA 1NT2B 5GIPA 4LUHA 1MIWA 4ZBKA 2BXFA 3H3AA 5IFOA 2DYOA 2XVUA 2BXOA 1J78A 4GG2A 2XVQA 2XVVA 4ZBRA 3TDLA 4BY9C 2EFCA 2EFDA 2NQOA 2XW0A 4K2CA 2BXCA 4GDLB 5DQFA 3NMUA 1HK3A 2ROHA 4TQ0A 1FOUA 2BXAA 4PO0A 4EMXA 2XMOA 5IJ5A 1MA9A 2BXMA 1E7IA 2JUHA 1UORA 2AJEA 1J7EA 3G9KD 2NNWA 3GA9L 4G04A 4N3ZA 4NAWB 2DYMA 4N0FD 3MHHB 3PLAA 4HGKA 3GQXA 3SIUB 2BXKA 4OT2A 1VZSA 3FWCC 2EFEA 4JK4A 3KIKA 4G03A 4LB2A 4IW1A 2XSIA 2BX8A 2VDBA 4K71A 2VUFA 4TQ1A 1BM0A 4L9KA 4OTTA 1E78A 2CKXA 5IJEA 1MIYA 1GNIA 4ZBQA 1O9XA 2DBWA 2EFHA 4S1YA 2QHBA 4F5TA 3SQJA 4Z9OA 4IW2A 4J2VA 5DBYA 4W4UB 3JQZA 1E7EA 1KW2A 4G01A 1E7FA 1H9ZA 3LU6A 4F5VA 3FWBC 3B9MA 2DBUA 3WHQA 2BXHA 2QM6A 4C31B 2E0XA 4MBEC 4E99A 4FIPB 4ZUXV 2DBXA 5HOZA 2VUEA 3LU8A 3A75A 4LUFA 3VQIA 3V03A 3ICXA 4HGMB 1BJ5A 4LB9A 1MIVA 3CX9A 1TXUA 4F5UA 2BXPA 1H5WA 2BXIA 3V09A 2BXLA 4LA0A 5IIUA 5ID7A 3SIVB 2YDFA 5IJFA 4GDKB 4BKEA 1JNBA 5FUOA 3GQUA 3H37A 5ID9A 4OR0A 2Z8IA 5D7GA 5IIHA 3B9LA 1AO6A 1E7BA 1GNJA 3UIVA 1HK1A 4L8UA 1IJGA 3MHSB 3KJLA 2XW1A 5GINA 1LNSA 3A73A 3LU7A 2DG5A 3V08A 3WHSA 1KXPD 2I30A 4FK5B 3W1SA 1HK4A 3NVIA 3NVMA 5B5TA 2XVWA 4OTUA 4N0UD 1E7HA 1VFIA 2QMCA 2BXQA 1BKEA 2E0YA 4F5SA 2KBZA 3FNMA 1TF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKX A;  2JUH A;  2AJE A;  2ROH A;  2QHB A; 
#chains in the Genus database with same CATH topology
 4GDX A;  1E7A A;  4FJC B;  5GIO A;  2BXG A;  4M70 B;  2Z8J A;  2I2Z A;  1N5U A;  2V36 A;  1E7G A;  1HK2 A;  3JRY A;  1MUS A;  2BXN A;  2LXS A;  2OT3 A;  2Z8K A;  3M99 C;  2BXB A;  4WA6 B;  5BPK A;  1MUH A;  4DHX B;  4Z69 A;  4ZC6 A;  1HK5 A;  5GHK A;  4ZCG A;  3WHR A;  1E7C A;  2OZB B;  3NVK A;  2BXD A;  2LOQ A;  1HA2 A;  1LOT A;  2BXE A;  4L9Q A;  5IIX A;  1NT2 B;  5GIP A;  4LUH A;  1MIW A;  4ZBK A;  1KDX A;  2BXF A;  3H3A A;  5IFO A;  2DYO A;  2XVU A;  2BXO A;  1J78 A;  4GG2 A;  2XVQ A;  2XVV A;  4ZBR A;  3TDL A;  4BY9 C;  2EFC A;  2EFD A;  2NQO A;  2XW0 A;  2K0N A;  4K2C A;  2BXC A;  4GDL B;  5DQF A;  3NMU A;  2LQI A;  1HK3 A;  2ROH A;  4TQ0 A;  1FOU A;  2BXA A;  4PO0 A;  4EMX A;  2XMO A;  5IJ5 A;  1MA9 A;  2BXM A;  1E7I A;  2JUH A;  1UOR A;  2AJE A;  1J7E A;  3G9K D;  2NNW A;  3GA9 L;  4G04 A;  4N3Z A;  4NAW B;  2DYM A;  4N0F D;  3MHH B;  3PLA A;  2LQH A;  4HGK A;  3GQX A;  2AGH B;  3SIU B;  2BXK A;  4OT2 A;  1VZS A;  3FWC C;  2EFE A;  4JK4 A;  3KIK A;  4G03 A;  4LB2 A;  4IW1 A;  3ECP A;  2XSI A;  2BX8 A;  4DM0 A;  2VDB A;  4K71 A;  2VUF A;  4TQ1 A;  1BM0 A;  4L9K A;  4OTT A;  1E78 A;  2CKX A;  5IJE A;  1MIY A;  1GNI A;  4ZBQ A;  1O9X A;  2DBW A;  2EFH A;  4S1Y A;  2QHB A;  4F5T A;  3SQJ A;  4Z9O A;  4IW2 A;  4J2V A;  5DBY A;  4W4U B;  3JQZ A;  3BPJ A;  1E7E A;  1KW2 A;  4G01 A;  1E7F A;  1H9Z A;  3LU6 A;  4D7X A;  4F5V A;  3FWB C;  3B9M A;  2DBU A;  3WHQ A;  2BXH A;  2QM6 A;  4C31 B;  2E0X A;  4MBE C;  4E99 A;  4FIP B;  4ZUX V;  2DBX A;  5HOZ A;  2VUE A;  3LU8 A;  3A75 A;  4LUF A;  3VQI A;  3V03 A;  3ICX A;  4HGM B;  1BJ5 A;  4LB9 A;  1MIV A;  3CX9 A;  1TXU A;  4F5U A;  2BXP A;  1H5W A;  2BXI A;  1MM8 A;  3V09 A;  2BXL A;  4LA0 A;  5IIU A;  5ID7 A;  3SIV B;  2YDF A;  5IJF A;  4GDK B;  4BKE A;  1JNB A;  5FUO A;  3GQU A;  3H37 A;  5ID9 A;  4OR0 A;  2Z8I A;  5D7G A;  5IIH A;  3B9L A;  1AO6 A;  1E7B A;  2LXT A;  1GNJ A;  3UIV A;  1HK1 A;  4I9O A;  2KWF A;  4L8U A;  1IJG A;  3MHS B;  3KJL A;  2XW1 A;  5GIN A;  1LNS A;  3A73 A;  3LU7 A;  2DG5 A;  3V08 A;  3WHS A;  1KXP D;  2I30 A;  4FK5 B;  3W1S A;  1HK4 A;  3NVI A;  3NVM A;  5B5T A;  2XVW A;  4OTU A;  4N0U D;  1E7H A;  1VFI A;  2QMC A;  2BXQ A;  1BKE A;  2E0Y A;  4F5S A;  1SB0 A;  2KBZ A;  2GUT A;  3FNM A;  1TF0 A; 
#chains in the Genus database with same CATH homology
 4GDX A;  1E7A A;  4FJC B;  5GIO A;  2BXG A;  4M70 B;  2Z8J A;  2I2Z A;  1N5U A;  2V36 A;  1E7G A;  1HK2 A;  3JRY A;  2BXN A;  5BPK A;  2OT3 A;  2Z8K A;  3M99 C;  2BXB A;  4WA6 B;  4DHX B;  4Z69 A;  4ZC6 A;  1HK5 A;  5GHK A;  4ZCG A;  3WHR A;  1E7C A;  2OZB B;  3NVK A;  2BXD A;  2LOQ A;  1HA2 A;  1LOT A;  2BXE A;  4L9Q A;  5IIX A;  1NT2 B;  5GIP A;  4LUH A;  1MIW A;  4ZBK A;  2BXF A;  3H3A A;  5IFO A;  2DYO A;  2XVU A;  2BXO A;  1J78 A;  4GG2 A;  2XVQ A;  2XVV A;  4ZBR A;  3TDL A;  4BY9 C;  2EFC A;  2EFD A;  2NQO A;  2XW0 A;  4K2C A;  2BXC A;  4GDL B;  5DQF A;  3NMU A;  1HK3 A;  2ROH A;  4TQ0 A;  1FOU A;  2BXA A;  4PO0 A;  4EMX A;  2XMO A;  5IJ5 A;  1MA9 A;  2BXM A;  1E7I A;  2JUH A;  1UOR A;  2AJE A;  1J7E A;  3G9K D;  2NNW A;  3GA9 L;  4G04 A;  4N3Z A;  4NAW B;  2DYM A;  4N0F D;  3MHH B;  3PLA A;  4HGK A;  3GQX A;  3SIU B;  2BXK A;  4OT2 A;  1VZS A;  3FWC C;  2EFE A;  4JK4 A;  3KIK A;  4G03 A;  4LB2 A;  4IW1 A;  2XSI A;  2BX8 A;  2VDB A;  4K71 A;  2VUF A;  4TQ1 A;  1BM0 A;  4L9K A;  4OTT A;  1E78 A;  2CKX A;  5IJE A;  1MIY A;  1GNI A;  4ZBQ A;  1O9X A;  2DBW A;  2EFH A;  4S1Y A;  2QHB A;  4F5T A;  3SQJ A;  4Z9O A;  4IW2 A;  4J2V A;  5DBY A;  4W4U B;  3JQZ A;  1E7E A;  1KW2 A;  4G01 A;  1E7F A;  1H9Z A;  3LU6 A;  4F5V A;  3FWB C;  3B9M A;  2DBU A;  3WHQ A;  2BXH A;  2QM6 A;  4C31 B;  2E0X A;  4MBE C;  4E99 A;  4FIP B;  4ZUX V;  2DBX A;  5HOZ A;  2VUE A;  3LU8 A;  3A75 A;  4LUF A;  3VQI A;  3V03 A;  3ICX A;  4HGM B;  1BJ5 A;  4LB9 A;  1MIV A;  3CX9 A;  1TXU A;  4F5U A;  2BXP A;  1H5W A;  2BXI A;  3V09 A;  2BXL A;  4LA0 A;  5IIU A;  5ID7 A;  3SIV B;  2YDF A;  5IJF A;  4GDK B;  4BKE A;  1JNB A;  5FUO A;  3GQU A;  3H37 A;  5ID9 A;  4OR0 A;  2Z8I A;  5D7G A;  5IIH A;  3B9L A;  1AO6 A;  1E7B A;  1GNJ A;  3UIV A;  1HK1 A;  4L8U A;  1IJG A;  3MHS B;  3KJL A;  2XW1 A;  5GIN A;  1LNS A;  3A73 A;  3LU7 A;  2DG5 A;  3V08 A;  3WHS A;  1KXP D;  2I30 A;  4FK5 B;  3W1S A;  1HK4 A;  3NVI A;  3NVM A;  5B5T A;  2XVW A;  4OTU A;  4N0U D;  1E7H A;  1VFI A;  2QMC A;  2BXQ A;  1BKE A;  2E0Y A;  4F5S A;  2KBZ A;  3FNM A;  1TF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...