2QHSA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
b'MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhsA01
4ZIBA 1X01A 1SESA 3PZCA 3HRIA 4HWSA 3ERRA 4NCXA 2ZNJA 2ODRD 2QHVA 3EFSA 5K1PA 4WF2A 4YCUA 2C8MA 2E41A 1WU7A 1BBWA 2CJBA 2ZIMA 2AMCB 3WQZA 2QHSA 2E10A 3QO5A 3V7RA 1X55A 2ZR3A 4TVYA 3RKYA 3A5YA 3V7CA 3A7RA 4XEOA 2E1HA 4YRCA 2ARSA 2I4LA 2DXTA 1HC7A 1BIAA 2FYKA 4YRGA 2PMFA 1WNLA 3NETA 3UH0A 4PG3A 4YP0A 3A31A 2I4OA 4P71A 4UP8A 4DQ2A 3V8LA 2AKWA 3A32A 2J3LA 3CMQA 4RQEA 2DJZA 3V8KA 3M4QA 1WLEA 2AKWB 3V7SA 1Z7MA 3IG2A 4K87A 3RKWA 4G85A 2DZCA 5C51B 4UP7A 2ZT6A 1E1TA 1YFRA 1ATIA 1E24A 1GGMA 3DSQA 2ZT5A 2RHSA 4CH4A 4UP9A 2RHSB 3A5ZA 2EL9A 3VQXA 2EJ9A 3R07A 2Q7EA 4OP0A 1YFTA 4XTUA 1ADJA 3HXUA 2ZXFA 4P75A 4ZTZB 2XTIA 1B76A 4YRTA 2DTIA 2EAYA 1BBUA 2ZZEA 1X2HA 4YRKA 4G84A 3VQVA 2ALYB 4P3NA 3E9IA 2ARUA 2CIMA 4YRMA 3P8VA 1WYDA 3G1ZA 3EFRA 1E1OA 4YRJA 2Q5HA 3HXXA 3RKXA 4YRIA 2DXUA 5ELNA 2AMCA 4P73A 4P72C 1BIBA 4H2UA 3E9HA 4XTZA 4P74C 2Q5IA 3NEMA 4WJ4A 4YROA 2DU5A 2CJ9A 5E3IA 2QHUA 3UGQA 5KNNA 4TWAA 2J3MA 4EX5A 3QO8A 4Q15A 1EIYA 3HTZA 4CS4A 4TQFA 2EJGA 4XU2A 1EIYB 2HNIA 1USYC 3LSSA 1ADYA 3ICAA 1SETA 4Q6GA 3TEHA 1NNHA 2EJFA 1X56A 4TVAA 3UFGA 4PHCA 4TQDA 3QTCA 2E5AA 2ZT7A 1B7YB 1W66A 3BJUA 3TEHB 1KMNA 3UGTA 2DQ0A 4P3PA 4TVAB 4H2YA 1NYQA 3L4GA 3M4PA 1ASYA 4WJ3M 3RIRA 2CGHA 3HXZA 3FJPA 3L4GB 5K1XA 2I4NA 3KFUA 4YREA 1HTTA 3NENA 4L87A 3QNEA 1PYSA 4DPGA 12ASA 2ZTGA 4TTVA 2Q7HA 4YRFA 1NJ6A 3HFZA 4YPFA 4YRPA 5C52B 2P0LA 1EQRA 1PYSB 2ZGWA 2ZCEA 3NELA 2E3CA 3HY1A 3HFZB 4J15A 3PCOA 2DEQA 1LYLA 2DU7A 2ZZFA 1EOVA 1E22A 3PCOB 3VQWA 4XTWA 4BWAA 1H4SA 1FYFA 1H4TA 4CH5A 1JJCA 2E65A 3BFMA 2ZR2A 1WQWA 2ALYA 1X2GA 2XGTA 3HXWA 4CH6A 4XTYA 3L2ZA 5HGQA 1JJCB 4YRRA 4YYEA 5ELOA 4WI1A 2DQ3A 1EVLA 2ZT8A 4P73C 4HA8A 4RDXA 2ARTA 4H02A 1NJ8A 4CH3A 1ASZA 1EFWA 1J5WA 3OD1A 4TVWA 4YCWA 3HFVA 2ZZGA 2E64A 4CS2A 3A74A 4H2SA 4HWPA 4BW9A 4KR3A 3IALA 1H4VB 2DTHA 3TEGA 2DDZA 3HXVA 3A7UA 4XTVA 4ZTUB 2I4MA 3RUXA 3VQYA 1HXDA 1YGBA 4RMFA 4YRLA 4YRQA 3HRKA 2DVEA 4AH6A 4XTXA 4P3OA 1EVKA 1VQZA 11ASA 4RQFA 4XU3A 4K86A 2ODRC 2DZ9A 3RGLA 5F5WA 4P71C 4KR2A 4P72A 3IKMB 4X5OA 1NYRA 2PMEA 1B7YA 4P74A 4K88A 4H2VA 3LC0A 3RACA 3REUA 3REXA 1NJ2A 1H4QA 3MF1A 1X54A 2QHTA 3LSQA 3HY0A 3W3SA 1QF6A 1SRYA 1IL2A 1Z7NA 4OLFA 1G5HA 4O2DA 2ZNIA 3TUPA 1USYA 1QE0A 2IY5A 4H2WA 2DKGA 3HXYA 1YB3A 4YCVA 4HVCA 4KQEA 4H2XA 4XEMA 2ZIOA 1G51A 4H2TA 1NJ5A 3V8JA 2IY5B 4H2XB 2RHQA 4YRNA 1L0WA 3MF2A 1RIQA 3RF1A 4P75C 1YFSA 2RHQB 1B70A 4YRSA 2P5IA 3L1AA 4CS3A 2EWNA 3A7AA 1B70B 4LNSA 2Q7GA 3QO7A 1WPYA 2ZINA 4XU1A 2G4CA 4XU0A 1N9WA 3VBBA 4E51A 1KMMA 2DTOA 4YDQA 1SERA 3P8YA 4UPAA 3IKLA 2CJAA 4HWOA 3P8TA 3MEYA 4EO4A 3RL6A 1KOGA 3I7FA 1C0AA 1WQ7A 1B8AA 1NJ1A 5C53B 1G5IA 4HWTA 4HWRA 2C7IA
chains in the Genus database with same CATH superfamily
4ZIBA 1X01A 1SESA 3PZCA 3HRIA 4HWSA 3ERRA 4NCXA 2ZNJA 2ODRD 2QHVA 3EFSA 5K1PA 4WF2A 4YCUA 2C8MA 2E41A 1WU7A 1BBWA 2CJBA 2ZIMA 2AMCB 3WQZA 2QHSA 2E10A 3QO5A 3V7RA 1X55A 2ZR3A 4TVYA 3RKYA 3A5YA 3V7CA 3A7RA 4XEOA 2E1HA 4HT4A 4YRCA 2ARSA 2I4LA 2DXTA 1HC7A 1BIAA 2FYKA 4YRGA 2PMFA 1WNLA 3NETA 3UH0A 4PG3A 4YP0A 3A31A 2I4OA 4P71A 4UP8A 4DQ2A 3V8LA 2AKWA 3A32A 2J3LA 3CMQA 4RQEA 2DJZA 3V8KA 3M4QA 1WLEA 2AKWB 3V7SA 1Z7MA 3IG2A 4K87A 3RKWA 4G85A 2DZCA 5C51B 4UP7A 2ZT6A 1E1TA 1YFRA 1ATIA 1E24A 1GGMA 3DSQA 2ZT5A 2RHSA 4CH4A 4LVKA 4UP9A 2RHSB 3A5ZA 2EL9A 3VQXA 2EJ9A 3R07A 2Q7EA 4OP0A 1YFTA 4XTUA 1ADJA 3HXUA 2ZXFA 4P75A 4ZTZB 2XTIA 1B76A 4YRTA 2DTIA 2EAYA 1BBUA 2ZZEA 1X2HA 4LVLA 4YRKA 4G84A 3VQVA 2ALYB 4P3NA 3E9IA 2ARUA 2CIMA 4YRMA 3P8VA 1WYDA 3G1ZA 3EFRA 1E1OA 4YRJA 2Q5HA 3HXXA 3RKXA 4YRIA 2DXUA 5ELNA 2AMCA 4P73A 4P72C 1BIBA 4H2UA 3E9HA 4XTZA 4P74C 2Q5IA 3NEMA 4WJ4A 4YROA 2DU5A 2CJ9A 5E3IA 2QHUA 3UGQA 5KNNA 4TWAA 2J3MA 4EX5A 3QO8A 4Q15A 1EIYA 3HTZA 4CS4A 4TQFA 2EJGA 4XU2A 1EIYB 2HNIA 1USYC 3LSSA 1ADYA 3ICAA 1SETA 4Q6GA 3TEHA 1NNHA 2EJFA 1X56A 4TVAA 3UFGA 4PHCA 4TQDA 3QTCA 2E5AA 2ZT7A 1B7YB 1W66A 3BJUA 3TEHB 1KMNA 3UGTA 2DQ0A 4P3PA 4TVAB 4H2YA 1NYQA 3L4GA 3M4PA 1ASYA 4WJ3M 3RIRA 2CGHA 3HXZA 3FJPA 3L4GB 5K1XA 2I4NA 3KFUA 4YREA 1HTTA 3NENA 4L87A 3QNEA 1PYSA 4DPGA 12ASA 2ZTGA 4TTVA 2Q7HA 4YRFA 1NJ6A 3HFZA 4YPFA 4YRPA 5C52B 2P0LA 1EQRA 1PYSB 2ZGWA 2ZCEA 3NELA 2E3CA 3HY1A 3HFZB 4J15A 3PCOA 2DEQA 1LYLA 2DU7A 2ZZFA 1EOVA 1E22A 3PCOB 3VQWA 4XTWA 4BWAA 1H4SA 1FYFA 1H4TA 4CH5A 1JJCA 2E65A 3BFMA 2ZR2A 1WQWA 2ALYA 1X2GA 2XGTA 3HXWA 2NS6A 4XTYA 4CH6A 3L2ZA 5HGQA 1JJCB 4YRRA 4YYEA 5ELOA 4WI1A 2DQ3A 1EVLA 4LVMA 2ZT8A 4P73C 4HA8A 4RDXA 2ARTA 4H02A 1NJ8A 4CH3A 1ASZA 1EFWA 1J5WA 3OD1A 4TVWA 4YCWA 3HFVA 2ZZGA 2E64A 4CS2A 3A74A 4H2SA 4HWPA 4BW9A 4KR3A 3IALA 1H4VB 2DTHA 3TEGA 2DDZA 3HXVA 3A7UA 4XTVA 4ZTUB 2I4MA 3RUXA 3VQYA 1HXDA 1YGBA 4RMFA 4YRLA 4YRQA 3HRKA 2DVEA 4AH6A 4XTXA 4P3OA 1EVKA 1VQZA 11ASA 4RQFA 4XU3A 4K86A 2ODRC 2DZ9A 3RGLA 5F5WA 4P71C 4KR2A 4P72A 3IKMB 4X5OA 1NYRA 2PMEA 1B7YA 4P74A 4K88A 4H2VA 3LC0A 4LVJA 3RACA 3REUA 3REXA 1NJ2A 1H4QA 3MF1A 1X54A 2QHTA 3LSQA 3HY0A 3W3SA 1QF6A 1SRYA 1IL2A 1Z7NA 3MQZA 1G5HA 4OLFA 4O2DA 2ZNIA 3TUPA 1USYA 1QE0A 2IY5A 4H2WA 2DKGA 3HXYA 1YB3A 4YCVA 4HVCA 4KQEA 4H2XA 4XEMA 2ZIOA 1G51A 4H2TA 1NJ5A 3V8JA 2IY5B 4H2XB 2RHQA 4YRNA 1L0WA 3MF2A 1RIQA 3RF1A 4P75C 1YFSA 2RHQB 1B70A 4YRSA 2P5IA 3L1AA 4CS3A 2EWNA 3A7AA 1B70B 4LNSA 2Q7GA 2A8EA 3QO7A 4LVIA 1WPYA 2ZINA 4XU1A 2G4CA 4XU0A 1N9WA 3VBBA 4E51A 1KMMA 2DTOA 4YDQA 1SERA 3P8YA 4UPAA 3IKLA 2CJAA 4HWOA 3P8TA 3MEYA 4EO4A 3RL6A 1KOGA 3I7FA 1C0AA 1WQ7A 1B8AA 1NJ1A 5C53B 1G5IA 4HWTA 4HWRA 2C7IA
chains in the Genus database with same CATH topology
4ZIBA 1X01A 1SESA 3PZCA 3HRIA 4HWSA 3ERRA 4NCXA 2ZNJA 2ODRD 2QHVA 3EFSA 5K1PA 4WF2A 4YCUA 2C8MA 2E41A 1WU7A 1BBWA 2CJBA 2ZIMA 2AMCB 3WQZA 2QHSA 2E10A 3QO5A 3V7RA 1X55A 2ZR3A 4TVYA 3RKYA 3A5YA 3V7CA 3A7RA 4XEOA 2E1HA 4HT4A 4YRCA 2ARSA 2I4LA 2DXTA 1HC7A 1BIAA 2FYKA 4YRGA 2PMFA 1WNLA 3NETA 3UH0A 4PG3A 4YP0A 3A31A 2I4OA 4P71A 4UP8A 4DQ2A 3V8LA 2AKWA 3A32A 2J3LA 3CMQA 4RQEA 2DJZA 3V8KA 3M4QA 1WLEA 2AKWB 3V7SA 1Z7MA 3IG2A 4K87A 3RKWA 4G85A 2DZCA 5C51B 4UP7A 2ZT6A 1E1TA 1YFRA 1ATIA 1E24A 1GGMA 3DSQA 2ZT5A 2RHSA 4CH4A 4LVKA 4UP9A 2RHSB 3A5ZA 2EL9A 3VQXA 2EJ9A 3R07A 2Q7EA 4OP0A 1YFTA 4XTUA 1ADJA 3HXUA 2ZXFA 4P75A 4ZTZB 2XTIA 1B76A 4YRTA 2DTIA 2EAYA 1BBUA 2ZZEA 1X2HA 4LVLA 4YRKA 4G84A 3VQVA 2ALYB 4P3NA 3E9IA 2ARUA 2CIMA 4YRMA 3P8VA 1WYDA 3G1ZA 3EFRA 1E1OA 4YRJA 2Q5HA 3HXXA 3RKXA 4YRIA 2DXUA 5ELNA 2AMCA 4P73A 4P72C 1BIBA 4H2UA 3E9HA 4XTZA 4P74C 2Q5IA 3NEMA 4WJ4A 4YROA 2DU5A 2CJ9A 5E3IA 2QHUA 3UGQA 5KNNA 4TWAA 2J3MA 4EX5A 3QO8A 4Q15A 1EIYA 3HTZA 4CS4A 4TQFA 2EJGA 4XU2A 1EIYB 2HNIA 1USYC 3LSSA 1ADYA 3ICAA 1SETA 4Q6GA 3TEHA 1NNHA 2EJFA 1X56A 4TVAA 3UFGA 4PHCA 4TQDA 3QTCA 2E5AA 2ZT7A 1B7YB 1W66A 3BJUA 3TEHB 1KMNA 3UGTA 2DQ0A 4P3PA 4TVAB 4H2YA 1NYQA 3L4GA 3M4PA 1ASYA 4WJ3M 3RIRA 2CGHA 3HXZA 3FJPA 3L4GB 5K1XA 2I4NA 3KFUA 4YREA 1HTTA 3NENA 4L87A 3QNEA 1PYSA 4DPGA 12ASA 2ZTGA 4TTVA 2Q7HA 4YRFA 1NJ6A 3HFZA 4YPFA 4YRPA 5C52B 2P0LA 1EQRA 1PYSB 2ZGWA 2ZCEA 3NELA 2E3CA 3HY1A 3HFZB 4J15A 3PCOA 2DEQA 1LYLA 2DU7A 2ZZFA 1EOVA 1E22A 3PCOB 3VQWA 4XTWA 4BWAA 1H4SA 1FYFA 1H4TA 4CH5A 1JJCA 2E65A 3BFMA 2ZR2A 1WQWA 2ALYA 1X2GA 2XGTA 3HXWA 2NS6A 4XTYA 4CH6A 3L2ZA 5HGQA 1JJCB 4YRRA 4YYEA 5ELOA 4WI1A 2DQ3A 1EVLA 4LVMA 2ZT8A 4P73C 4HA8A 4RDXA 2ARTA 4H02A 1NJ8A 4CH3A 1ASZA 1EFWA 1J5WA 3OD1A 4TVWA 4YCWA 3HFVA 2ZZGA 2E64A 4CS2A 3A74A 4H2SA 4HWPA 4BW9A 4KR3A 3IALA 1H4VB 2DTHA 3TEGA 2DDZA 3HXVA 3A7UA 4XTVA 4ZTUB 2I4MA 3RUXA 3VQYA 1HXDA 1YGBA 4RMFA 4YRLA 4YRQA 3HRKA 2DVEA 4AH6A 4XTXA 4P3OA 1EVKA 1VQZA 11ASA 4RQFA 4XU3A 4K86A 2ODRC 2DZ9A 3RGLA 5F5WA 4P71C 4KR2A 4P72A 3IKMB 4X5OA 1NYRA 2PMEA 1B7YA 4P74A 4K88A 4H2VA 3LC0A 4LVJA 3RACA 3REUA 3REXA 1NJ2A 1H4QA 3MF1A 1X54A 2QHTA 3LSQA 3HY0A 3W3SA 1QF6A 1SRYA 1IL2A 1Z7NA 3MQZA 1G5HA 4OLFA 4O2DA 2ZNIA 3TUPA 1USYA 1QE0A 2IY5A 4H2WA 2DKGA 3HXYA 1YB3A 4YCVA 4HVCA 4KQEA 4H2XA 4XEMA 2ZIOA 1G51A 4H2TA 1NJ5A 3V8JA 2IY5B 4H2XB 2RHQA 4YRNA 1L0WA 3MF2A 1RIQA 3RF1A 4P75C 1YFSA 2RHQB 1B70A 4YRSA 2P5IA 3L1AA 4CS3A 2EWNA 3A7AA 1B70B 4LNSA 2Q7GA 2A8EA 3QO7A 4LVIA 1WPYA 2ZINA 4XU1A 2G4CA 4XU0A 1N9WA 3VBBA 4E51A 1KMMA 2DTOA 4YDQA 1SERA 3P8YA 4UPAA 3IKLA 2CJAA 4HWOA 3P8TA 3MEYA 4EO4A 3RL6A 1KOGA 3I7FA 1C0AA 1WQ7A 1B8AA 1NJ1A 5C53B 1G5IA 4HWTA 4HWRA 2C7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIB A;  1X01 A;  1SES A;  3PZC A;  3HRI A;  4HWS A;  3ERR A;  4NCX A;  2ZNJ A;  2ODR D;  2QHV A;  3EFS A;  5K1P A;  4WF2 A;  4YCU A;  2C8M A;  2E41 A;  1WU7 A;  1BBW A;  2CJB A;  2ZIM A;  2AMC B;  3WQZ A;  2QHS A;  2E10 A;  3QO5 A;  3V7R A;  1X55 A;  2ZR3 A;  4TVY A;  3RKY A;  3A5Y A;  3V7C A;  3A7R A;  4XEO A;  2E1H A;  4YRC A;  2ARS A;  2I4L A;  2DXT A;  1HC7 A;  1BIA A;  2FYK A;  4YRG A;  2PMF A;  1WNL A;  3NET A;  3UH0 A;  4PG3 A;  4YP0 A;  3A31 A;  2I4O A;  4P71 A;  4UP8 A;  4DQ2 A;  3V8L A;  2AKW A;  3A32 A;  2J3L A;  3CMQ A;  4RQE A;  2DJZ A;  3V8K A;  3M4Q A;  1WLE A;  2AKW B;  3V7S A;  1Z7M A;  3IG2 A;  4K87 A;  3RKW A;  4G85 A;  2DZC A;  5C51 B;  4UP7 A;  2ZT6 A;  1E1T A;  1YFR A;  1ATI A;  1E24 A;  1GGM A;  3DSQ A;  2ZT5 A;  2RHS A;  4CH4 A;  4UP9 A;  2RHS B;  3A5Z A;  2EL9 A;  3VQX A;  2EJ9 A;  3R07 A;  2Q7E A;  4OP0 A;  1YFT A;  4XTU A;  1ADJ A;  3HXU A;  2ZXF A;  4P75 A;  4ZTZ B;  2XTI A;  1B76 A;  4YRT A;  2DTI A;  2EAY A;  1BBU A;  2ZZE A;  1X2H A;  4YRK A;  4G84 A;  3VQV A;  2ALY B;  4P3N A;  3E9I A;  2ARU A;  2CIM A;  4YRM A;  3P8V A;  1WYD A;  3G1Z A;  3EFR A;  1E1O A;  4YRJ A;  2Q5H A;  3HXX A;  3RKX A;  4YRI A;  2DXU A;  5ELN A;  2AMC A;  4P73 A;  4P72 C;  1BIB A;  4H2U A;  3E9H A;  4XTZ A;  4P74 C;  2Q5I A;  3NEM A;  4WJ4 A;  4YRO A;  2DU5 A;  2CJ9 A;  5E3I A;  2QHU A;  3UGQ A;  5KNN A;  4TWA A;  2J3M A;  4EX5 A;  3QO8 A;  4Q15 A;  1EIY A;  3HTZ A;  4CS4 A;  4TQF A;  2EJG A;  4XU2 A;  1EIY B;  2HNI A;  1USY C;  3LSS A;  1ADY A;  3ICA A;  1SET A;  4Q6G A;  3TEH A;  1NNH A;  2EJF A;  1X56 A;  4TVA A;  3UFG A;  4PHC A;  4TQD A;  3QTC A;  2E5A A;  2ZT7 A;  1B7Y B;  1W66 A;  3BJU A;  3TEH B;  1KMN A;  3UGT A;  2DQ0 A;  4P3P A;  4TVA B;  4H2Y A;  1NYQ A;  3L4G A;  3M4P A;  1ASY A;  4WJ3 M;  3RIR A;  2CGH A;  3HXZ A;  3FJP A;  3L4G B;  5K1X A;  2I4N A;  3KFU A;  4YRE A;  1HTT A;  3NEN A;  4L87 A;  3QNE A;  1PYS A;  4DPG A;  12AS A;  2ZTG A;  4TTV A;  2Q7H A;  4YRF A;  1NJ6 A;  3HFZ A;  4YPF A;  4YRP A;  5C52 B;  2P0L A;  1EQR A;  1PYS B;  2ZGW A;  2ZCE A;  3NEL A;  2E3C A;  3HY1 A;  3HFZ B;  4J15 A;  3PCO A;  2DEQ A;  1LYL A;  2DU7 A;  2ZZF A;  1EOV A;  1E22 A;  3PCO B;  3VQW A;  4XTW A;  4BWA A;  1H4S A;  1FYF A;  1H4T A;  4CH5 A;  1JJC A;  2E65 A;  3BFM A;  2ZR2 A;  1WQW A;  2ALY A;  1X2G A;  2XGT A;  3HXW A;  4CH6 A;  4XTY A;  3L2Z A;  5HGQ A;  1JJC B;  4YRR A;  4YYE A;  5ELO A;  4WI1 A;  2DQ3 A;  1EVL A;  2ZT8 A;  4P73 C;  4HA8 A;  4RDX A;  2ART A;  4H02 A;  1NJ8 A;  4CH3 A;  1ASZ A;  1EFW A;  1J5W A;  3OD1 A;  4TVW A;  4YCW A;  3HFV A;  2ZZG A;  2E64 A;  4CS2 A;  3A74 A;  4H2S A;  4HWP A;  4BW9 A;  4KR3 A;  3IAL A;  1H4V B;  2DTH A;  3TEG A;  2DDZ A;  3HXV A;  3A7U A;  4XTV A;  4ZTU B;  2I4M A;  3RUX A;  3VQY A;  1HXD A;  1YGB A;  4RMF A;  4YRL A;  4YRQ A;  3HRK A;  2DVE A;  4AH6 A;  4XTX A;  4P3O A;  1EVK A;  1VQZ A;  11AS A;  4RQF A;  4XU3 A;  4K86 A;  2ODR C;  2DZ9 A;  3RGL A;  5F5W A;  4P71 C;  4KR2 A;  4P72 A;  3IKM B;  4X5O A;  1NYR A;  2PME A;  1B7Y A;  4P74 A;  4K88 A;  4H2V A;  3LC0 A;  3RAC A;  3REU A;  3REX A;  1NJ2 A;  1H4Q A;  3MF1 A;  1X54 A;  2QHT A;  3LSQ A;  3HY0 A;  3W3S A;  1QF6 A;  1SRY A;  1IL2 A;  1Z7N A;  4OLF A;  1G5H A;  4O2D A;  2ZNI A;  3TUP A;  1USY A;  1QE0 A;  2IY5 A;  4H2W A;  2DKG A;  3HXY A;  1YB3 A;  4YCV A;  4HVC A;  4KQE A;  4H2X A;  4XEM A;  2ZIO A;  1G51 A;  4H2T A;  1NJ5 A;  3V8J A;  2IY5 B;  4H2X B;  2RHQ A;  4YRN A;  1L0W A;  3MF2 A;  1RIQ A;  3RF1 A;  4P75 C;  1YFS A;  2RHQ B;  1B70 A;  4YRS A;  2P5I A;  3L1A A;  4CS3 A;  2EWN A;  3A7A A;  1B70 B;  4LNS A;  2Q7G A;  3QO7 A;  1WPY A;  2ZIN A;  4XU1 A;  2G4C A;  4XU0 A;  1N9W A;  3VBB A;  4E51 A;  1KMM A;  2DTO A;  4YDQ A;  1SER A;  3P8Y A;  4UPA A;  3IKL A;  2CJA A;  4HWO A;  3P8T A;  3MEY A;  4EO4 A;  3RL6 A;  1KOG A;  3I7F A;  1C0A A;  1WQ7 A;  1B8A A;  1NJ1 A;  5C53 B;  1G5I A;  4HWT A;  4HWR A;  2C7I A; 
#chains in the Genus database with same CATH topology
 4ZIB A;  1X01 A;  1SES A;  3PZC A;  3HRI A;  4HWS A;  3ERR A;  4NCX A;  2ZNJ A;  2ODR D;  2QHV A;  3EFS A;  5K1P A;  4WF2 A;  4YCU A;  2C8M A;  2E41 A;  1WU7 A;  1BBW A;  2CJB A;  2ZIM A;  2AMC B;  3WQZ A;  2QHS A;  2E10 A;  3QO5 A;  3V7R A;  1X55 A;  2ZR3 A;  4TVY A;  3RKY A;  3A5Y A;  3V7C A;  3A7R A;  4XEO A;  2E1H A;  4HT4 A;  4YRC A;  2ARS A;  2I4L A;  2DXT A;  1HC7 A;  1BIA A;  2FYK A;  4YRG A;  2PMF A;  1WNL A;  3NET A;  3UH0 A;  4PG3 A;  4YP0 A;  3A31 A;  2I4O A;  4P71 A;  4UP8 A;  4DQ2 A;  3V8L A;  2AKW A;  3A32 A;  2J3L A;  3CMQ A;  4RQE A;  2DJZ A;  3V8K A;  3M4Q A;  1WLE A;  2AKW B;  3V7S A;  1Z7M A;  3IG2 A;  4K87 A;  3RKW A;  4G85 A;  2DZC A;  5C51 B;  4UP7 A;  2ZT6 A;  1E1T A;  1YFR A;  1ATI A;  1E24 A;  1GGM A;  3DSQ A;  2ZT5 A;  2RHS A;  4CH4 A;  4LVK A;  4UP9 A;  2RHS B;  3A5Z A;  2EL9 A;  3VQX A;  2EJ9 A;  3R07 A;  2Q7E A;  4OP0 A;  1YFT A;  4XTU A;  1ADJ A;  3HXU A;  2ZXF A;  4P75 A;  4ZTZ B;  2XTI A;  1B76 A;  4YRT A;  2DTI A;  2EAY A;  1BBU A;  2ZZE A;  1X2H A;  4LVL A;  4YRK A;  4G84 A;  3VQV A;  2ALY B;  4P3N A;  3E9I A;  2ARU A;  2CIM A;  4YRM A;  3P8V A;  1WYD A;  3G1Z A;  3EFR A;  1E1O A;  4YRJ A;  2Q5H A;  3HXX A;  3RKX A;  4YRI A;  2DXU A;  5ELN A;  2AMC A;  4P73 A;  4P72 C;  1BIB A;  4H2U A;  3E9H A;  4XTZ A;  4P74 C;  2Q5I A;  3NEM A;  4WJ4 A;  4YRO A;  2DU5 A;  2CJ9 A;  5E3I A;  2QHU A;  3UGQ A;  5KNN A;  4TWA A;  2J3M A;  4EX5 A;  3QO8 A;  4Q15 A;  1EIY A;  3HTZ A;  4CS4 A;  4TQF A;  2EJG A;  4XU2 A;  1EIY B;  2HNI A;  1USY C;  3LSS A;  1ADY A;  3ICA A;  1SET A;  4Q6G A;  3TEH A;  1NNH A;  2EJF A;  1X56 A;  4TVA A;  3UFG A;  4PHC A;  4TQD A;  3QTC A;  2E5A A;  2ZT7 A;  1B7Y B;  1W66 A;  3BJU A;  3TEH B;  1KMN A;  3UGT A;  2DQ0 A;  4P3P A;  4TVA B;  4H2Y A;  1NYQ A;  3L4G A;  3M4P A;  1ASY A;  4WJ3 M;  3RIR A;  2CGH A;  3HXZ A;  3FJP A;  3L4G B;  5K1X A;  2I4N A;  3KFU A;  4YRE A;  1HTT A;  3NEN A;  4L87 A;  3QNE A;  1PYS A;  4DPG A;  12AS A;  2ZTG A;  4TTV A;  2Q7H A;  4YRF A;  1NJ6 A;  3HFZ A;  4YPF A;  4YRP A;  5C52 B;  2P0L A;  1EQR A;  1PYS B;  2ZGW A;  2ZCE A;  3NEL A;  2E3C A;  3HY1 A;  3HFZ B;  4J15 A;  3PCO A;  2DEQ A;  1LYL A;  2DU7 A;  2ZZF A;  1EOV A;  1E22 A;  3PCO B;  3VQW A;  4XTW A;  4BWA A;  1H4S A;  1FYF A;  1H4T A;  4CH5 A;  1JJC A;  2E65 A;  3BFM A;  2ZR2 A;  1WQW A;  2ALY A;  1X2G A;  2XGT A;  3HXW A;  2NS6 A;  4XTY A;  4CH6 A;  3L2Z A;  5HGQ A;  1JJC B;  4YRR A;  4YYE A;  5ELO A;  4WI1 A;  2DQ3 A;  1EVL A;  4LVM A;  2ZT8 A;  4P73 C;  4HA8 A;  4RDX A;  2ART A;  4H02 A;  1NJ8 A;  4CH3 A;  1ASZ A;  1EFW A;  1J5W A;  3OD1 A;  4TVW A;  4YCW A;  3HFV A;  2ZZG A;  2E64 A;  4CS2 A;  3A74 A;  4H2S A;  4HWP A;  4BW9 A;  4KR3 A;  3IAL A;  1H4V B;  2DTH A;  3TEG A;  2DDZ A;  3HXV A;  3A7U A;  4XTV A;  4ZTU B;  2I4M A;  3RUX A;  3VQY A;  1HXD A;  1YGB A;  4RMF A;  4YRL A;  4YRQ A;  3HRK A;  2DVE A;  4AH6 A;  4XTX A;  4P3O A;  1EVK A;  1VQZ A;  11AS A;  4RQF A;  4XU3 A;  4K86 A;  2ODR C;  2DZ9 A;  3RGL A;  5F5W A;  4P71 C;  4KR2 A;  4P72 A;  3IKM B;  4X5O A;  1NYR A;  2PME A;  1B7Y A;  4P74 A;  4K88 A;  4H2V A;  3LC0 A;  4LVJ A;  3RAC A;  3REU A;  3REX A;  1NJ2 A;  1H4Q A;  3MF1 A;  1X54 A;  2QHT A;  3LSQ A;  3HY0 A;  3W3S A;  1QF6 A;  1SRY A;  1IL2 A;  1Z7N A;  3MQZ A;  1G5H A;  4OLF A;  4O2D A;  2ZNI A;  3TUP A;  1USY A;  1QE0 A;  2IY5 A;  4H2W A;  2DKG A;  3HXY A;  1YB3 A;  4YCV A;  4HVC A;  4KQE A;  4H2X A;  4XEM A;  2ZIO A;  1G51 A;  4H2T A;  1NJ5 A;  3V8J A;  2IY5 B;  4H2X B;  2RHQ A;  4YRN A;  1L0W A;  3MF2 A;  1RIQ A;  3RF1 A;  4P75 C;  1YFS A;  2RHQ B;  1B70 A;  4YRS A;  2P5I A;  3L1A A;  4CS3 A;  2EWN A;  3A7A A;  1B70 B;  4LNS A;  2Q7G A;  2A8E A;  3QO7 A;  4LVI A;  1WPY A;  2ZIN A;  4XU1 A;  2G4C A;  4XU0 A;  1N9W A;  3VBB A;  4E51 A;  1KMM A;  2DTO A;  4YDQ A;  1SER A;  3P8Y A;  4UPA A;  3IKL A;  2CJA A;  4HWO A;  3P8T A;  3MEY A;  4EO4 A;  3RL6 A;  1KOG A;  3I7F A;  1C0A A;  1WQ7 A;  1B8A A;  1NJ1 A;  5C53 B;  1G5I A;  4HWT A;  4HWR A;  2C7I A; 
#chains in the Genus database with same CATH homology
 4ZIB A;  1X01 A;  1SES A;  3PZC A;  3HRI A;  4HWS A;  3ERR A;  4NCX A;  2ZNJ A;  2ODR D;  2QHV A;  3EFS A;  5K1P A;  4WF2 A;  4YCU A;  2C8M A;  2E41 A;  1WU7 A;  1BBW A;  2CJB A;  2ZIM A;  2AMC B;  3WQZ A;  2QHS A;  2E10 A;  3QO5 A;  3V7R A;  1X55 A;  2ZR3 A;  4TVY A;  3RKY A;  3A5Y A;  3V7C A;  3A7R A;  4XEO A;  2E1H A;  4HT4 A;  4YRC A;  2ARS A;  2I4L A;  2DXT A;  1HC7 A;  1BIA A;  2FYK A;  4YRG A;  2PMF A;  1WNL A;  3NET A;  3UH0 A;  4PG3 A;  4YP0 A;  3A31 A;  2I4O A;  4P71 A;  4UP8 A;  4DQ2 A;  3V8L A;  2AKW A;  3A32 A;  2J3L A;  3CMQ A;  4RQE A;  2DJZ A;  3V8K A;  3M4Q A;  1WLE A;  2AKW B;  3V7S A;  1Z7M A;  3IG2 A;  4K87 A;  3RKW A;  4G85 A;  2DZC A;  5C51 B;  4UP7 A;  2ZT6 A;  1E1T A;  1YFR A;  1ATI A;  1E24 A;  1GGM A;  3DSQ A;  2ZT5 A;  2RHS A;  4CH4 A;  4LVK A;  4UP9 A;  2RHS B;  3A5Z A;  2EL9 A;  3VQX A;  2EJ9 A;  3R07 A;  2Q7E A;  4OP0 A;  1YFT A;  4XTU A;  1ADJ A;  3HXU A;  2ZXF A;  4P75 A;  4ZTZ B;  2XTI A;  1B76 A;  4YRT A;  2DTI A;  2EAY A;  1BBU A;  2ZZE A;  1X2H A;  4LVL A;  4YRK A;  4G84 A;  3VQV A;  2ALY B;  4P3N A;  3E9I A;  2ARU A;  2CIM A;  4YRM A;  3P8V A;  1WYD A;  3G1Z A;  3EFR A;  1E1O A;  4YRJ A;  2Q5H A;  3HXX A;  3RKX A;  4YRI A;  2DXU A;  5ELN A;  2AMC A;  4P73 A;  4P72 C;  1BIB A;  4H2U A;  3E9H A;  4XTZ A;  4P74 C;  2Q5I A;  3NEM A;  4WJ4 A;  4YRO A;  2DU5 A;  2CJ9 A;  5E3I A;  2QHU A;  3UGQ A;  5KNN A;  4TWA A;  2J3M A;  4EX5 A;  3QO8 A;  4Q15 A;  1EIY A;  3HTZ A;  4CS4 A;  4TQF A;  2EJG A;  4XU2 A;  1EIY B;  2HNI A;  1USY C;  3LSS A;  1ADY A;  3ICA A;  1SET A;  4Q6G A;  3TEH A;  1NNH A;  2EJF A;  1X56 A;  4TVA A;  3UFG A;  4PHC A;  4TQD A;  3QTC A;  2E5A A;  2ZT7 A;  1B7Y B;  1W66 A;  3BJU A;  3TEH B;  1KMN A;  3UGT A;  2DQ0 A;  4P3P A;  4TVA B;  4H2Y A;  1NYQ A;  3L4G A;  3M4P A;  1ASY A;  4WJ3 M;  3RIR A;  2CGH A;  3HXZ A;  3FJP A;  3L4G B;  5K1X A;  2I4N A;  3KFU A;  4YRE A;  1HTT A;  3NEN A;  4L87 A;  3QNE A;  1PYS A;  4DPG A;  12AS A;  2ZTG A;  4TTV A;  2Q7H A;  4YRF A;  1NJ6 A;  3HFZ A;  4YPF A;  4YRP A;  5C52 B;  2P0L A;  1EQR A;  1PYS B;  2ZGW A;  2ZCE A;  3NEL A;  2E3C A;  3HY1 A;  3HFZ B;  4J15 A;  3PCO A;  2DEQ A;  1LYL A;  2DU7 A;  2ZZF A;  1EOV A;  1E22 A;  3PCO B;  3VQW A;  4XTW A;  4BWA A;  1H4S A;  1FYF A;  1H4T A;  4CH5 A;  1JJC A;  2E65 A;  3BFM A;  2ZR2 A;  1WQW A;  2ALY A;  1X2G A;  2XGT A;  3HXW A;  2NS6 A;  4XTY A;  4CH6 A;  3L2Z A;  5HGQ A;  1JJC B;  4YRR A;  4YYE A;  5ELO A;  4WI1 A;  2DQ3 A;  1EVL A;  4LVM A;  2ZT8 A;  4P73 C;  4HA8 A;  4RDX A;  2ART A;  4H02 A;  1NJ8 A;  4CH3 A;  1ASZ A;  1EFW A;  1J5W A;  3OD1 A;  4TVW A;  4YCW A;  3HFV A;  2ZZG A;  2E64 A;  4CS2 A;  3A74 A;  4H2S A;  4HWP A;  4BW9 A;  4KR3 A;  3IAL A;  1H4V B;  2DTH A;  3TEG A;  2DDZ A;  3HXV A;  3A7U A;  4XTV A;  4ZTU B;  2I4M A;  3RUX A;  3VQY A;  1HXD A;  1YGB A;  4RMF A;  4YRL A;  4YRQ A;  3HRK A;  2DVE A;  4AH6 A;  4XTX A;  4P3O A;  1EVK A;  1VQZ A;  11AS A;  4RQF A;  4XU3 A;  4K86 A;  2ODR C;  2DZ9 A;  3RGL A;  5F5W A;  4P71 C;  4KR2 A;  4P72 A;  3IKM B;  4X5O A;  1NYR A;  2PME A;  1B7Y A;  4P74 A;  4K88 A;  4H2V A;  3LC0 A;  4LVJ A;  3RAC A;  3REU A;  3REX A;  1NJ2 A;  1H4Q A;  3MF1 A;  1X54 A;  2QHT A;  3LSQ A;  3HY0 A;  3W3S A;  1QF6 A;  1SRY A;  1IL2 A;  1Z7N A;  3MQZ A;  1G5H A;  4OLF A;  4O2D A;  2ZNI A;  3TUP A;  1USY A;  1QE0 A;  2IY5 A;  4H2W A;  2DKG A;  3HXY A;  1YB3 A;  4YCV A;  4HVC A;  4KQE A;  4H2X A;  4XEM A;  2ZIO A;  1G51 A;  4H2T A;  1NJ5 A;  3V8J A;  2IY5 B;  4H2X B;  2RHQ A;  4YRN A;  1L0W A;  3MF2 A;  1RIQ A;  3RF1 A;  4P75 C;  1YFS A;  2RHQ B;  1B70 A;  4YRS A;  2P5I A;  3L1A A;  4CS3 A;  2EWN A;  3A7A A;  1B70 B;  4LNS A;  2Q7G A;  2A8E A;  3QO7 A;  4LVI A;  1WPY A;  2ZIN A;  4XU1 A;  2G4C A;  4XU0 A;  1N9W A;  3VBB A;  4E51 A;  1KMM A;  2DTO A;  4YDQ A;  1SER A;  3P8Y A;  4UPA A;  3IKL A;  2CJA A;  4HWO A;  3P8T A;  3MEY A;  4EO4 A;  3RL6 A;  1KOG A;  3I7F A;  1C0A A;  1WQ7 A;  1B8A A;  1NJ1 A;  5C53 B;  1G5I A;  4HWT A;  4HWR A;  2C7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...