2QHSA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhsA01
1W66A 3M4PA 4Q15A 2ZIMA 5K1PA 2AKWA 1ASYA 4X5OA 2QHTA 2XGTA 4P71C 4YRMA 3CMQA 4ZTUB 2E65A 4BWAA 1WLEA 4YRRA 3PCOB 4K88A 3BFMA 3ERRA 3IG2A 3UH0A 4H2XA 4P73A 3TEHA 4WJ3M 3QO8A 4YPFA 3DSQA 1E1TA 1QE0A 4G84A 2Q5IA 1G5HA 3HRIA 3RGLA 3IALA 4OLFA 1X55A 2C8MA 2EJGA 4TQFA 4YRFA 2ZTGA 3V7RA 4CH3A 2I4NA 4WI1A 1Z7MA 4XTXA 3I7FA 4P74C 1USYC 3PCOA 2ARTA 4EO4A 4TWAA 3VQVA 1YFSA 4YYEA 4RQEA 2E64A 2ARSA 2J3MA 2Q5HA 4H2WA 1WQWA 3MF1A 2I4LA 3MF2A 4PG3A 4YRQA 4YDQA 1ADJA 4PHCA 3E9HA 2RHSB 1WQ7A 3KFUA 3IKLA 3MEYA 4XTYA 2E1HA 4H2TA 3HXZA 3LC0A 4WJ4A 3L4GB 1EFWA 2ZCEA 4E51A 2ZT6A 1SESA 3V7CA 3REUA 1EIYB 2DXTA 2ZT7A 3RKXA 3UGQA 2EJ9A 4ZTZB 4TTVA 5KNNA 1PYSB 1E24A 2IY5B 3QNEA 2DDZA 4H2VA 2RHSA 2FYKA 3V8JA 4H2YA 4YRSA 2AMCB 2DZCA 1N9WA 3A7UA 4HWRA 3L4GA 11ASA 4HWSA 4OP0A 1L0WA 3RIRA 1NJ1A 2RHQA 4XTVA 1EIYA 1BBUA 1QF6A 4Q6GA 4J15A 4TVYA 1E1OA 1VQZA 1PYSA 1SERA 4TVAB 1NJ5A 2IY5A 1KOGA 2ZZGA 4UP8A 4BW9A 4YROA 2DTHA 2AMCA 2ARUA 4CS2A 2DEQA 1B70B 3G1ZA 3L1AA 2DU5A 2DZ9A 4YCVA 4YCUA 3IKMB 3FJPA 1X54A 1HTTA 1JJCB 4HWOA 1YFTA 3NEMA 1X2GA 1NNHA 3UFGA 4P3OA 4DPGA 4KQEA 1NYRA 4TVAA 2Q7GA 2DJZA 3A7AA 3VBBA 5HGQA 4LNSA 1GGMA 2J3LA 1B70A 4YRTA 2CIMA 1E22A 3NETA 2EAYA 4TQDA 3ICAA 4KR3A 4XU1A 4P71A 4CS3A 3NENA 1ADYA 1HXDA 2ZT8A 2DTOA 3HXYA 1JJCA 3BJUA 4YRLA 2QHVA 4P75C 2HNIA 1B7YB 4P72A 5F5WA 3L2ZA 1Z7NA 2CGHA 3RKYA 2C7IA 3HXXA 1BIAA 5C51B 3LSQA 1EQRA 3HXVA 4O2DA 1HC7A 4XU0A 3A5YA 3RKWA 3W3SA 1EVLA 2E3CA 4YRKA 4YRIA 2ODRC 4AH6A 2ZR3A 1USYA 4XTZA 5C52B 1B7YA 4H2SA 1KMNA 4H2UA 1YGBA 3QTCA 3P8YA 4CH6A 4P73C 3P8TA 2ZT5A 2QHUA 4KR2A 3EFSA 4L87A 4HVCA 3HTZA 3A5ZA 4YRJA 4YCWA 2ZZFA 3NELA 4UPAA 3V7SA 3HFZB 3VQWA 5E3IA 4H2XB 2ZGWA 2ODRD 1WNLA 2CJAA 2DTIA 1C0AA 2E41A 3RF1A 3VQXA 4CH4A 1J5WA 1X56A 1B76A 1WPYA 4WF2A 3V8KA 1ASZA 2ZNIA 2ZNJA 2ZR2A 1B8AA 3RL6A 4XEOA 4TVWA 4P3NA 3HFZA 4K87A 3RUXA 4K86A 2DQ3A 1WU7A 1H4VB 4HA8A 4P72C 3TUPA 3WQZA 3OD1A 4RQFA 3TEGA 1ATIA 3PZCA 5C53B 2CJ9A 2I4OA 3V8LA 4P3PA 5ELOA 1NYQA 2Q7HA 1NJ2A 2EL9A 4RDXA 4G85A 4CS4A 1EOVA 4HWPA 1NJ6A 1H4SA 1G51A 3A74A 1X01A 4UP7A 4YRGA 2EWNA 2QHSA 4EX5A 1SETA 2ZIOA 1SRYA 2ZXFA 4XTWA 2Q7EA 1EVKA 3A32A 5K1XA 3REXA 2PMEA 4YRPA 1IL2A 3HXUA 1NJ8A 3HFVA 2ALYB 1H4QA 2DU7A 2XTIA 3R07A 2EJFA 4YREA 2P5IA 4YP0A 4HWTA 3E9IA 2DKGA 1H4TA 3HRKA 1X2HA 4DQ2A 2E10A 1KMMA 4P74A 4XU3A 3P8VA 4H02A 4YRCA 3M4QA 3UGTA 4UP9A 4ZIBA 3RACA 2CJBA 3A31A 4NCXA 2RHQB 2DQ0A 3VQYA 1BBWA 2ALYA 1LYLA 2DVEA 2AKWB 2G4CA 3A7RA 1G5IA 4RMFA 5ELNA 4XU2A 3HXWA 3HY1A 4P75A 4XEMA 1RIQA 2PMFA 3LSSA 1YFRA 4YRNA 1WYDA 1BIBA 3EFRA 2I4MA 3TEHB 3QO7A 2ZZEA 4CH5A 3QO5A 1FYFA 3HY0A 12ASA 4XTUA 2DXUA 2ZINA 1YB3A 2P0LA 2E5AA
chains in the Genus database with same CATH superfamily
1W66A 3M4PA 4Q15A 2ZIMA 5K1PA 2AKWA 1ASYA 4X5OA 2QHTA 2XGTA 4P71C 4YRMA 3CMQA 4ZTUB 2E65A 4BWAA 1WLEA 4YRRA 3PCOB 4K88A 3BFMA 3ERRA 3IG2A 3UH0A 4H2XA 4P73A 3TEHA 4WJ3M 3QO8A 4YPFA 3DSQA 1E1TA 1QE0A 4G84A 2Q5IA 1G5HA 3HRIA 3RGLA 3IALA 4OLFA 1X55A 2C8MA 2EJGA 4TQFA 4YRFA 2ZTGA 3V7RA 4CH3A 2I4NA 4WI1A 1Z7MA 4XTXA 3I7FA 4P74C 1USYC 3PCOA 2ARTA 4EO4A 4TWAA 4LVIA 3VQVA 1YFSA 4YYEA 4RQEA 2E64A 2ARSA 2J3MA 2Q5HA 4H2WA 1WQWA 3MF1A 4HT4A 2I4LA 3MF2A 4PG3A 4YRQA 4YDQA 1ADJA 4PHCA 3E9HA 2RHSB 1WQ7A 3KFUA 4XTYA 3IKLA 3MEYA 2E1HA 2A8EA 4H2TA 3HXZA 3LC0A 4WJ4A 3L4GB 1EFWA 2ZCEA 4E51A 2ZT6A 1SESA 3V7CA 3REUA 1EIYB 2DXTA 2ZT7A 3RKXA 3UGQA 2EJ9A 4LVJA 4ZTZB 4TTVA 5KNNA 1PYSB 1E24A 2IY5B 3QNEA 2DDZA 4H2VA 2RHSA 2FYKA 3V8JA 4H2YA 4YRSA 2AMCB 2DZCA 1N9WA 3A7UA 4HWRA 3L4GA 11ASA 3MQZA 4HWSA 4OP0A 1L0WA 3RIRA 1NJ1A 2RHQA 4XTVA 1EIYA 1BBUA 1QF6A 4Q6GA 4J15A 4TVYA 1E1OA 1VQZA 1PYSA 1SERA 4TVAB 1NJ5A 2IY5A 1KOGA 2ZZGA 4UP8A 4BW9A 4LVLA 4YROA 2DTHA 2AMCA 2ARUA 4CS2A 2DEQA 1B70B 3G1ZA 3L1AA 2DU5A 2DZ9A 4YCVA 4YCUA 3IKMB 3FJPA 1X54A 1HTTA 1JJCB 4HWOA 1YFTA 3NEMA 1X2GA 1NNHA 3UFGA 4P3OA 4DPGA 4KQEA 1NYRA 4TVAA 2Q7GA 2DJZA 3A7AA 3VBBA 5HGQA 4LNSA 1GGMA 2J3LA 1B70A 4YRTA 2CIMA 1E22A 3NETA 2EAYA 4TQDA 3ICAA 4KR3A 4XU1A 4P71A 4CS3A 3NENA 1ADYA 1HXDA 2ZT8A 2DTOA 3HXYA 1JJCA 3BJUA 4YRLA 2QHVA 4P75C 2HNIA 1B7YB 4P72A 5F5WA 3L2ZA 1Z7NA 2CGHA 3RKYA 2C7IA 3HXXA 1BIAA 5C51B 3LSQA 1EQRA 3HXVA 4O2DA 1HC7A 4XU0A 3A5YA 3RKWA 3W3SA 1EVLA 2E3CA 4YRKA 4YRIA 2ODRC 4AH6A 2ZR3A 1USYA 4XTZA 5C52B 1B7YA 4H2SA 1KMNA 4H2UA 1YGBA 3QTCA 3P8YA 4CH6A 4P73C 3P8TA 2ZT5A 2QHUA 4KR2A 3EFSA 2NS6A 4L87A 4HVCA 3HTZA 3A5ZA 4YRJA 4YCWA 2ZZFA 3NELA 4UPAA 3V7SA 3HFZB 3VQWA 5E3IA 4H2XB 2ZGWA 2ODRD 1WNLA 2CJAA 2DTIA 4LVMA 1C0AA 4LVKA 2E41A 3RF1A 3VQXA 4CH4A 1J5WA 1X56A 1B76A 1WPYA 4WF2A 3V8KA 1ASZA 2ZNIA 2ZNJA 2ZR2A 1B8AA 3RL6A 4XEOA 4TVWA 4P3NA 3HFZA 4K87A 3RUXA 4K86A 2DQ3A 1WU7A 1H4VB 4HA8A 4P72C 3TUPA 3WQZA 3OD1A 4RQFA 3TEGA 1ATIA 3PZCA 5C53B 2CJ9A 2I4OA 3V8LA 4P3PA 5ELOA 1NYQA 2Q7HA 1NJ2A 2EL9A 4RDXA 4G85A 4CS4A 1EOVA 4HWPA 1NJ6A 1H4SA 1G51A 3A74A 1X01A 4UP7A 4YRGA 2EWNA 2QHSA 4EX5A 1SETA 2ZIOA 1SRYA 2ZXFA 4XTWA 2Q7EA 1EVKA 3A32A 5K1XA 3REXA 2PMEA 4YRPA 1IL2A 3HXUA 1NJ8A 3HFVA 2ALYB 1H4QA 2DU7A 2XTIA 3R07A 2EJFA 4YREA 2P5IA 4YP0A 4HWTA 3E9IA 2DKGA 1H4TA 3HRKA 1X2HA 4DQ2A 2E10A 1KMMA 4P74A 4XU3A 3P8VA 4H02A 4YRCA 3M4QA 3UGTA 4UP9A 4ZIBA 3RACA 2CJBA 3A31A 4NCXA 2RHQB 2DQ0A 3VQYA 1BBWA 2ALYA 1LYLA 2DVEA 2AKWB 2G4CA 3A7RA 1G5IA 4RMFA 5ELNA 4XU2A 3HXWA 3HY1A 4P75A 4XEMA 1RIQA 2PMFA 3LSSA 1YFRA 4YRNA 1WYDA 1BIBA 3EFRA 2I4MA 3TEHB 3QO7A 2ZZEA 4CH5A 3QO5A 1FYFA 3HY0A 12ASA 4XTUA 2DXUA 2ZINA 1YB3A 2P0LA 2E5AA
chains in the Genus database with same CATH topology
1W66A 3M4PA 4Q15A 2ZIMA 5K1PA 2AKWA 1ASYA 4X5OA 2QHTA 2XGTA 4P71C 4YRMA 3CMQA 4ZTUB 2E65A 4BWAA 1WLEA 4YRRA 3PCOB 4K88A 3BFMA 3ERRA 3IG2A 3UH0A 4H2XA 4P73A 3TEHA 4WJ3M 3QO8A 4YPFA 3DSQA 1E1TA 1QE0A 4G84A 2Q5IA 1G5HA 3HRIA 3RGLA 3IALA 4OLFA 1X55A 2C8MA 2EJGA 4TQFA 4YRFA 2ZTGA 3V7RA 4CH3A 2I4NA 4WI1A 1Z7MA 4XTXA 3I7FA 4P74C 1USYC 3PCOA 2ARTA 4EO4A 4TWAA 4LVIA 3VQVA 1YFSA 4YYEA 4RQEA 2E64A 2ARSA 2J3MA 2Q5HA 4H2WA 1WQWA 3MF1A 4HT4A 2I4LA 3MF2A 4PG3A 4YRQA 4YDQA 1ADJA 4PHCA 3E9HA 2RHSB 1WQ7A 3KFUA 4XTYA 3IKLA 3MEYA 2E1HA 2A8EA 4H2TA 3HXZA 3LC0A 4WJ4A 3L4GB 1EFWA 2ZCEA 4E51A 2ZT6A 1SESA 3V7CA 3REUA 1EIYB 2DXTA 2ZT7A 3RKXA 3UGQA 2EJ9A 4LVJA 4ZTZB 4TTVA 5KNNA 1PYSB 1E24A 2IY5B 3QNEA 2DDZA 4H2VA 2RHSA 2FYKA 3V8JA 4H2YA 4YRSA 2AMCB 2DZCA 1N9WA 3A7UA 4HWRA 3L4GA 11ASA 3MQZA 4HWSA 4OP0A 1L0WA 3RIRA 1NJ1A 2RHQA 4XTVA 1EIYA 1BBUA 1QF6A 4Q6GA 4J15A 4TVYA 1E1OA 1VQZA 1PYSA 1SERA 4TVAB 1NJ5A 2IY5A 1KOGA 2ZZGA 4UP8A 4BW9A 4LVLA 4YROA 2DTHA 2AMCA 2ARUA 4CS2A 2DEQA 1B70B 3G1ZA 3L1AA 2DU5A 2DZ9A 4YCVA 4YCUA 3IKMB 3FJPA 1X54A 1HTTA 1JJCB 4HWOA 1YFTA 3NEMA 1X2GA 1NNHA 3UFGA 4P3OA 4DPGA 4KQEA 1NYRA 4TVAA 2Q7GA 2DJZA 3A7AA 3VBBA 5HGQA 4LNSA 1GGMA 2J3LA 1B70A 4YRTA 2CIMA 1E22A 3NETA 2EAYA 4TQDA 3ICAA 4KR3A 4XU1A 4P71A 4CS3A 3NENA 1ADYA 1HXDA 2ZT8A 2DTOA 3HXYA 1JJCA 3BJUA 4YRLA 2QHVA 4P75C 2HNIA 1B7YB 4P72A 5F5WA 3L2ZA 1Z7NA 2CGHA 3RKYA 2C7IA 3HXXA 1BIAA 5C51B 3LSQA 1EQRA 3HXVA 4O2DA 1HC7A 4XU0A 3A5YA 3RKWA 3W3SA 1EVLA 2E3CA 4YRKA 4YRIA 2ODRC 4AH6A 2ZR3A 1USYA 4XTZA 5C52B 1B7YA 4H2SA 1KMNA 4H2UA 1YGBA 3QTCA 3P8YA 4CH6A 4P73C 3P8TA 2ZT5A 2QHUA 4KR2A 3EFSA 2NS6A 4L87A 4HVCA 3HTZA 3A5ZA 4YRJA 4YCWA 2ZZFA 3NELA 4UPAA 3V7SA 3HFZB 3VQWA 5E3IA 4H2XB 2ZGWA 2ODRD 1WNLA 2CJAA 2DTIA 4LVMA 1C0AA 4LVKA 2E41A 3RF1A 3VQXA 4CH4A 1J5WA 1X56A 1B76A 1WPYA 4WF2A 3V8KA 1ASZA 2ZNIA 2ZNJA 2ZR2A 1B8AA 3RL6A 4XEOA 4TVWA 4P3NA 3HFZA 4K87A 3RUXA 4K86A 2DQ3A 1WU7A 1H4VB 4HA8A 4P72C 3TUPA 3WQZA 3OD1A 4RQFA 3TEGA 1ATIA 3PZCA 5C53B 2CJ9A 2I4OA 3V8LA 4P3PA 5ELOA 1NYQA 2Q7HA 1NJ2A 2EL9A 4RDXA 4G85A 4CS4A 1EOVA 4HWPA 1NJ6A 1H4SA 1G51A 3A74A 1X01A 4UP7A 4YRGA 2EWNA 2QHSA 4EX5A 1SETA 2ZIOA 1SRYA 2ZXFA 4XTWA 2Q7EA 1EVKA 3A32A 5K1XA 3REXA 2PMEA 4YRPA 1IL2A 3HXUA 1NJ8A 3HFVA 2ALYB 1H4QA 2DU7A 2XTIA 3R07A 2EJFA 4YREA 2P5IA 4YP0A 4HWTA 3E9IA 2DKGA 1H4TA 3HRKA 1X2HA 4DQ2A 2E10A 1KMMA 4P74A 4XU3A 3P8VA 4H02A 4YRCA 3M4QA 3UGTA 4UP9A 4ZIBA 3RACA 2CJBA 3A31A 4NCXA 2RHQB 2DQ0A 3VQYA 1BBWA 2ALYA 1LYLA 2DVEA 2AKWB 2G4CA 3A7RA 1G5IA 4RMFA 5ELNA 4XU2A 3HXWA 3HY1A 4P75A 4XEMA 1RIQA 2PMFA 3LSSA 1YFRA 4YRNA 1WYDA 1BIBA 3EFRA 2I4MA 3TEHB 3QO7A 2ZZEA 4CH5A 3QO5A 1FYFA 3HY0A 12ASA 4XTUA 2DXUA 2ZINA 1YB3A 2P0LA 2E5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W66 A;  3M4P A;  4Q15 A;  2ZIM A;  5K1P A;  2AKW A;  1ASY A;  4X5O A;  2QHT A;  2XGT A;  4P71 C;  4YRM A;  3CMQ A;  4ZTU B;  2E65 A;  4BWA A;  1WLE A;  4YRR A;  3PCO B;  4K88 A;  3BFM A;  3ERR A;  3IG2 A;  3UH0 A;  4H2X A;  4P73 A;  3TEH A;  4WJ3 M;  3QO8 A;  4YPF A;  3DSQ A;  1E1T A;  1QE0 A;  4G84 A;  2Q5I A;  1G5H A;  3HRI A;  3RGL A;  3IAL A;  4OLF A;  1X55 A;  2C8M A;  2EJG A;  4TQF A;  4YRF A;  2ZTG A;  3V7R A;  4CH3 A;  2I4N A;  4WI1 A;  1Z7M A;  4XTX A;  3I7F A;  4P74 C;  1USY C;  3PCO A;  2ART A;  4EO4 A;  4TWA A;  3VQV A;  1YFS A;  4YYE A;  4RQE A;  2E64 A;  2ARS A;  2J3M A;  2Q5H A;  4H2W A;  1WQW A;  3MF1 A;  2I4L A;  3MF2 A;  4PG3 A;  4YRQ A;  4YDQ A;  1ADJ A;  4PHC A;  3E9H A;  2RHS B;  1WQ7 A;  3KFU A;  3IKL A;  3MEY A;  4XTY A;  2E1H A;  4H2T A;  3HXZ A;  3LC0 A;  4WJ4 A;  3L4G B;  1EFW A;  2ZCE A;  4E51 A;  2ZT6 A;  1SES A;  3V7C A;  3REU A;  1EIY B;  2DXT A;  2ZT7 A;  3RKX A;  3UGQ A;  2EJ9 A;  4ZTZ B;  4TTV A;  5KNN A;  1PYS B;  1E24 A;  2IY5 B;  3QNE A;  2DDZ A;  4H2V A;  2RHS A;  2FYK A;  3V8J A;  4H2Y A;  4YRS A;  2AMC B;  2DZC A;  1N9W A;  3A7U A;  4HWR A;  3L4G A;  11AS A;  4HWS A;  4OP0 A;  1L0W A;  3RIR A;  1NJ1 A;  2RHQ A;  4XTV A;  1EIY A;  1BBU A;  1QF6 A;  4Q6G A;  4J15 A;  4TVY A;  1E1O A;  1VQZ A;  1PYS A;  1SER A;  4TVA B;  1NJ5 A;  2IY5 A;  1KOG A;  2ZZG A;  4UP8 A;  4BW9 A;  4YRO A;  2DTH A;  2AMC A;  2ARU A;  4CS2 A;  2DEQ A;  1B70 B;  3G1Z A;  3L1A A;  2DU5 A;  2DZ9 A;  4YCV A;  4YCU A;  3IKM B;  3FJP A;  1X54 A;  1HTT A;  1JJC B;  4HWO A;  1YFT A;  3NEM A;  1X2G A;  1NNH A;  3UFG A;  4P3O A;  4DPG A;  4KQE A;  1NYR A;  4TVA A;  2Q7G A;  2DJZ A;  3A7A A;  3VBB A;  5HGQ A;  4LNS A;  1GGM A;  2J3L A;  1B70 A;  4YRT A;  2CIM A;  1E22 A;  3NET A;  2EAY A;  4TQD A;  3ICA A;  4KR3 A;  4XU1 A;  4P71 A;  4CS3 A;  3NEN A;  1ADY A;  1HXD A;  2ZT8 A;  2DTO A;  3HXY A;  1JJC A;  3BJU A;  4YRL A;  2QHV A;  4P75 C;  2HNI A;  1B7Y B;  4P72 A;  5F5W A;  3L2Z A;  1Z7N A;  2CGH A;  3RKY A;  2C7I A;  3HXX A;  1BIA A;  5C51 B;  3LSQ A;  1EQR A;  3HXV A;  4O2D A;  1HC7 A;  4XU0 A;  3A5Y A;  3RKW A;  3W3S A;  1EVL A;  2E3C A;  4YRK A;  4YRI A;  2ODR C;  4AH6 A;  2ZR3 A;  1USY A;  4XTZ A;  5C52 B;  1B7Y A;  4H2S A;  1KMN A;  4H2U A;  1YGB A;  3QTC A;  3P8Y A;  4CH6 A;  4P73 C;  3P8T A;  2ZT5 A;  2QHU A;  4KR2 A;  3EFS A;  4L87 A;  4HVC A;  3HTZ A;  3A5Z A;  4YRJ A;  4YCW A;  2ZZF A;  3NEL A;  4UPA A;  3V7S A;  3HFZ B;  3VQW A;  5E3I A;  4H2X B;  2ZGW A;  2ODR D;  1WNL A;  2CJA A;  2DTI A;  1C0A A;  2E41 A;  3RF1 A;  3VQX A;  4CH4 A;  1J5W A;  1X56 A;  1B76 A;  1WPY A;  4WF2 A;  3V8K A;  1ASZ A;  2ZNI A;  2ZNJ A;  2ZR2 A;  1B8A A;  3RL6 A;  4XEO A;  4TVW A;  4P3N A;  3HFZ A;  4K87 A;  3RUX A;  4K86 A;  2DQ3 A;  1WU7 A;  1H4V B;  4HA8 A;  4P72 C;  3TUP A;  3WQZ A;  3OD1 A;  4RQF A;  3TEG A;  1ATI A;  3PZC A;  5C53 B;  2CJ9 A;  2I4O A;  3V8L A;  4P3P A;  5ELO A;  1NYQ A;  2Q7H A;  1NJ2 A;  2EL9 A;  4RDX A;  4G85 A;  4CS4 A;  1EOV A;  4HWP A;  1NJ6 A;  1H4S A;  1G51 A;  3A74 A;  1X01 A;  4UP7 A;  4YRG A;  2EWN A;  2QHS A;  4EX5 A;  1SET A;  2ZIO A;  1SRY A;  2ZXF A;  4XTW A;  2Q7E A;  1EVK A;  3A32 A;  5K1X A;  3REX A;  2PME A;  4YRP A;  1IL2 A;  3HXU A;  1NJ8 A;  3HFV A;  2ALY B;  1H4Q A;  2DU7 A;  2XTI A;  3R07 A;  2EJF A;  4YRE A;  2P5I A;  4YP0 A;  4HWT A;  3E9I A;  2DKG A;  1H4T A;  3HRK A;  1X2H A;  4DQ2 A;  2E10 A;  1KMM A;  4P74 A;  4XU3 A;  3P8V A;  4H02 A;  4YRC A;  3M4Q A;  3UGT A;  4UP9 A;  4ZIB A;  3RAC A;  2CJB A;  3A31 A;  4NCX A;  2RHQ B;  2DQ0 A;  3VQY A;  1BBW A;  2ALY A;  1LYL A;  2DVE A;  2AKW B;  2G4C A;  3A7R A;  1G5I A;  4RMF A;  5ELN A;  4XU2 A;  3HXW A;  3HY1 A;  4P75 A;  4XEM A;  1RIQ A;  2PMF A;  3LSS A;  1YFR A;  4YRN A;  1WYD A;  1BIB A;  3EFR A;  2I4M A;  3TEH B;  3QO7 A;  2ZZE A;  4CH5 A;  3QO5 A;  1FYF A;  3HY0 A;  12AS A;  4XTU A;  2DXU A;  2ZIN A;  1YB3 A;  2P0L A;  2E5A A; 
#chains in the Genus database with same CATH topology
 1W66 A;  3M4P A;  4Q15 A;  2ZIM A;  5K1P A;  2AKW A;  1ASY A;  4X5O A;  2QHT A;  2XGT A;  4P71 C;  4YRM A;  3CMQ A;  4ZTU B;  2E65 A;  4BWA A;  1WLE A;  4YRR A;  3PCO B;  4K88 A;  3BFM A;  3ERR A;  3IG2 A;  3UH0 A;  4H2X A;  4P73 A;  3TEH A;  4WJ3 M;  3QO8 A;  4YPF A;  3DSQ A;  1E1T A;  1QE0 A;  4G84 A;  2Q5I A;  1G5H A;  3HRI A;  3RGL A;  3IAL A;  4OLF A;  1X55 A;  2C8M A;  2EJG A;  4TQF A;  4YRF A;  2ZTG A;  3V7R A;  4CH3 A;  2I4N A;  4WI1 A;  1Z7M A;  4XTX A;  3I7F A;  4P74 C;  1USY C;  3PCO A;  2ART A;  4EO4 A;  4TWA A;  4LVI A;  3VQV A;  1YFS A;  4YYE A;  4RQE A;  2E64 A;  2ARS A;  2J3M A;  2Q5H A;  4H2W A;  1WQW A;  3MF1 A;  4HT4 A;  2I4L A;  3MF2 A;  4PG3 A;  4YRQ A;  4YDQ A;  1ADJ A;  4PHC A;  3E9H A;  2RHS B;  1WQ7 A;  3KFU A;  4XTY A;  3IKL A;  3MEY A;  2E1H A;  2A8E A;  4H2T A;  3HXZ A;  3LC0 A;  4WJ4 A;  3L4G B;  1EFW A;  2ZCE A;  4E51 A;  2ZT6 A;  1SES A;  3V7C A;  3REU A;  1EIY B;  2DXT A;  2ZT7 A;  3RKX A;  3UGQ A;  2EJ9 A;  4LVJ A;  4ZTZ B;  4TTV A;  5KNN A;  1PYS B;  1E24 A;  2IY5 B;  3QNE A;  2DDZ A;  4H2V A;  2RHS A;  2FYK A;  3V8J A;  4H2Y A;  4YRS A;  2AMC B;  2DZC A;  1N9W A;  3A7U A;  4HWR A;  3L4G A;  11AS A;  3MQZ A;  4HWS A;  4OP0 A;  1L0W A;  3RIR A;  1NJ1 A;  2RHQ A;  4XTV A;  1EIY A;  1BBU A;  1QF6 A;  4Q6G A;  4J15 A;  4TVY A;  1E1O A;  1VQZ A;  1PYS A;  1SER A;  4TVA B;  1NJ5 A;  2IY5 A;  1KOG A;  2ZZG A;  4UP8 A;  4BW9 A;  4LVL A;  4YRO A;  2DTH A;  2AMC A;  2ARU A;  4CS2 A;  2DEQ A;  1B70 B;  3G1Z A;  3L1A A;  2DU5 A;  2DZ9 A;  4YCV A;  4YCU A;  3IKM B;  3FJP A;  1X54 A;  1HTT A;  1JJC B;  4HWO A;  1YFT A;  3NEM A;  1X2G A;  1NNH A;  3UFG A;  4P3O A;  4DPG A;  4KQE A;  1NYR A;  4TVA A;  2Q7G A;  2DJZ A;  3A7A A;  3VBB A;  5HGQ A;  4LNS A;  1GGM A;  2J3L A;  1B70 A;  4YRT A;  2CIM A;  1E22 A;  3NET A;  2EAY A;  4TQD A;  3ICA A;  4KR3 A;  4XU1 A;  4P71 A;  4CS3 A;  3NEN A;  1ADY A;  1HXD A;  2ZT8 A;  2DTO A;  3HXY A;  1JJC A;  3BJU A;  4YRL A;  2QHV A;  4P75 C;  2HNI A;  1B7Y B;  4P72 A;  5F5W A;  3L2Z A;  1Z7N A;  2CGH A;  3RKY A;  2C7I A;  3HXX A;  1BIA A;  5C51 B;  3LSQ A;  1EQR A;  3HXV A;  4O2D A;  1HC7 A;  4XU0 A;  3A5Y A;  3RKW A;  3W3S A;  1EVL A;  2E3C A;  4YRK A;  4YRI A;  2ODR C;  4AH6 A;  2ZR3 A;  1USY A;  4XTZ A;  5C52 B;  1B7Y A;  4H2S A;  1KMN A;  4H2U A;  1YGB A;  3QTC A;  3P8Y A;  4CH6 A;  4P73 C;  3P8T A;  2ZT5 A;  2QHU A;  4KR2 A;  3EFS A;  2NS6 A;  4L87 A;  4HVC A;  3HTZ A;  3A5Z A;  4YRJ A;  4YCW A;  2ZZF A;  3NEL A;  4UPA A;  3V7S A;  3HFZ B;  3VQW A;  5E3I A;  4H2X B;  2ZGW A;  2ODR D;  1WNL A;  2CJA A;  2DTI A;  4LVM A;  1C0A A;  4LVK A;  2E41 A;  3RF1 A;  3VQX A;  4CH4 A;  1J5W A;  1X56 A;  1B76 A;  1WPY A;  4WF2 A;  3V8K A;  1ASZ A;  2ZNI A;  2ZNJ A;  2ZR2 A;  1B8A A;  3RL6 A;  4XEO A;  4TVW A;  4P3N A;  3HFZ A;  4K87 A;  3RUX A;  4K86 A;  2DQ3 A;  1WU7 A;  1H4V B;  4HA8 A;  4P72 C;  3TUP A;  3WQZ A;  3OD1 A;  4RQF A;  3TEG A;  1ATI A;  3PZC A;  5C53 B;  2CJ9 A;  2I4O A;  3V8L A;  4P3P A;  5ELO A;  1NYQ A;  2Q7H A;  1NJ2 A;  2EL9 A;  4RDX A;  4G85 A;  4CS4 A;  1EOV A;  4HWP A;  1NJ6 A;  1H4S A;  1G51 A;  3A74 A;  1X01 A;  4UP7 A;  4YRG A;  2EWN A;  2QHS A;  4EX5 A;  1SET A;  2ZIO A;  1SRY A;  2ZXF A;  4XTW A;  2Q7E A;  1EVK A;  3A32 A;  5K1X A;  3REX A;  2PME A;  4YRP A;  1IL2 A;  3HXU A;  1NJ8 A;  3HFV A;  2ALY B;  1H4Q A;  2DU7 A;  2XTI A;  3R07 A;  2EJF A;  4YRE A;  2P5I A;  4YP0 A;  4HWT A;  3E9I A;  2DKG A;  1H4T A;  3HRK A;  1X2H A;  4DQ2 A;  2E10 A;  1KMM A;  4P74 A;  4XU3 A;  3P8V A;  4H02 A;  4YRC A;  3M4Q A;  3UGT A;  4UP9 A;  4ZIB A;  3RAC A;  2CJB A;  3A31 A;  4NCX A;  2RHQ B;  2DQ0 A;  3VQY A;  1BBW A;  2ALY A;  1LYL A;  2DVE A;  2AKW B;  2G4C A;  3A7R A;  1G5I A;  4RMF A;  5ELN A;  4XU2 A;  3HXW A;  3HY1 A;  4P75 A;  4XEM A;  1RIQ A;  2PMF A;  3LSS A;  1YFR A;  4YRN A;  1WYD A;  1BIB A;  3EFR A;  2I4M A;  3TEH B;  3QO7 A;  2ZZE A;  4CH5 A;  3QO5 A;  1FYF A;  3HY0 A;  12AS A;  4XTU A;  2DXU A;  2ZIN A;  1YB3 A;  2P0L A;  2E5A A; 
#chains in the Genus database with same CATH homology
 1W66 A;  3M4P A;  4Q15 A;  2ZIM A;  5K1P A;  2AKW A;  1ASY A;  4X5O A;  2QHT A;  2XGT A;  4P71 C;  4YRM A;  3CMQ A;  4ZTU B;  2E65 A;  4BWA A;  1WLE A;  4YRR A;  3PCO B;  4K88 A;  3BFM A;  3ERR A;  3IG2 A;  3UH0 A;  4H2X A;  4P73 A;  3TEH A;  4WJ3 M;  3QO8 A;  4YPF A;  3DSQ A;  1E1T A;  1QE0 A;  4G84 A;  2Q5I A;  1G5H A;  3HRI A;  3RGL A;  3IAL A;  4OLF A;  1X55 A;  2C8M A;  2EJG A;  4TQF A;  4YRF A;  2ZTG A;  3V7R A;  4CH3 A;  2I4N A;  4WI1 A;  1Z7M A;  4XTX A;  3I7F A;  4P74 C;  1USY C;  3PCO A;  2ART A;  4EO4 A;  4TWA A;  4LVI A;  3VQV A;  1YFS A;  4YYE A;  4RQE A;  2E64 A;  2ARS A;  2J3M A;  2Q5H A;  4H2W A;  1WQW A;  3MF1 A;  4HT4 A;  2I4L A;  3MF2 A;  4PG3 A;  4YRQ A;  4YDQ A;  1ADJ A;  4PHC A;  3E9H A;  2RHS B;  1WQ7 A;  3KFU A;  4XTY A;  3IKL A;  3MEY A;  2E1H A;  2A8E A;  4H2T A;  3HXZ A;  3LC0 A;  4WJ4 A;  3L4G B;  1EFW A;  2ZCE A;  4E51 A;  2ZT6 A;  1SES A;  3V7C A;  3REU A;  1EIY B;  2DXT A;  2ZT7 A;  3RKX A;  3UGQ A;  2EJ9 A;  4LVJ A;  4ZTZ B;  4TTV A;  5KNN A;  1PYS B;  1E24 A;  2IY5 B;  3QNE A;  2DDZ A;  4H2V A;  2RHS A;  2FYK A;  3V8J A;  4H2Y A;  4YRS A;  2AMC B;  2DZC A;  1N9W A;  3A7U A;  4HWR A;  3L4G A;  11AS A;  3MQZ A;  4HWS A;  4OP0 A;  1L0W A;  3RIR A;  1NJ1 A;  2RHQ A;  4XTV A;  1EIY A;  1BBU A;  1QF6 A;  4Q6G A;  4J15 A;  4TVY A;  1E1O A;  1VQZ A;  1PYS A;  1SER A;  4TVA B;  1NJ5 A;  2IY5 A;  1KOG A;  2ZZG A;  4UP8 A;  4BW9 A;  4LVL A;  4YRO A;  2DTH A;  2AMC A;  2ARU A;  4CS2 A;  2DEQ A;  1B70 B;  3G1Z A;  3L1A A;  2DU5 A;  2DZ9 A;  4YCV A;  4YCU A;  3IKM B;  3FJP A;  1X54 A;  1HTT A;  1JJC B;  4HWO A;  1YFT A;  3NEM A;  1X2G A;  1NNH A;  3UFG A;  4P3O A;  4DPG A;  4KQE A;  1NYR A;  4TVA A;  2Q7G A;  2DJZ A;  3A7A A;  3VBB A;  5HGQ A;  4LNS A;  1GGM A;  2J3L A;  1B70 A;  4YRT A;  2CIM A;  1E22 A;  3NET A;  2EAY A;  4TQD A;  3ICA A;  4KR3 A;  4XU1 A;  4P71 A;  4CS3 A;  3NEN A;  1ADY A;  1HXD A;  2ZT8 A;  2DTO A;  3HXY A;  1JJC A;  3BJU A;  4YRL A;  2QHV A;  4P75 C;  2HNI A;  1B7Y B;  4P72 A;  5F5W A;  3L2Z A;  1Z7N A;  2CGH A;  3RKY A;  2C7I A;  3HXX A;  1BIA A;  5C51 B;  3LSQ A;  1EQR A;  3HXV A;  4O2D A;  1HC7 A;  4XU0 A;  3A5Y A;  3RKW A;  3W3S A;  1EVL A;  2E3C A;  4YRK A;  4YRI A;  2ODR C;  4AH6 A;  2ZR3 A;  1USY A;  4XTZ A;  5C52 B;  1B7Y A;  4H2S A;  1KMN A;  4H2U A;  1YGB A;  3QTC A;  3P8Y A;  4CH6 A;  4P73 C;  3P8T A;  2ZT5 A;  2QHU A;  4KR2 A;  3EFS A;  2NS6 A;  4L87 A;  4HVC A;  3HTZ A;  3A5Z A;  4YRJ A;  4YCW A;  2ZZF A;  3NEL A;  4UPA A;  3V7S A;  3HFZ B;  3VQW A;  5E3I A;  4H2X B;  2ZGW A;  2ODR D;  1WNL A;  2CJA A;  2DTI A;  4LVM A;  1C0A A;  4LVK A;  2E41 A;  3RF1 A;  3VQX A;  4CH4 A;  1J5W A;  1X56 A;  1B76 A;  1WPY A;  4WF2 A;  3V8K A;  1ASZ A;  2ZNI A;  2ZNJ A;  2ZR2 A;  1B8A A;  3RL6 A;  4XEO A;  4TVW A;  4P3N A;  3HFZ A;  4K87 A;  3RUX A;  4K86 A;  2DQ3 A;  1WU7 A;  1H4V B;  4HA8 A;  4P72 C;  3TUP A;  3WQZ A;  3OD1 A;  4RQF A;  3TEG A;  1ATI A;  3PZC A;  5C53 B;  2CJ9 A;  2I4O A;  3V8L A;  4P3P A;  5ELO A;  1NYQ A;  2Q7H A;  1NJ2 A;  2EL9 A;  4RDX A;  4G85 A;  4CS4 A;  1EOV A;  4HWP A;  1NJ6 A;  1H4S A;  1G51 A;  3A74 A;  1X01 A;  4UP7 A;  4YRG A;  2EWN A;  2QHS A;  4EX5 A;  1SET A;  2ZIO A;  1SRY A;  2ZXF A;  4XTW A;  2Q7E A;  1EVK A;  3A32 A;  5K1X A;  3REX A;  2PME A;  4YRP A;  1IL2 A;  3HXU A;  1NJ8 A;  3HFV A;  2ALY B;  1H4Q A;  2DU7 A;  2XTI A;  3R07 A;  2EJF A;  4YRE A;  2P5I A;  4YP0 A;  4HWT A;  3E9I A;  2DKG A;  1H4T A;  3HRK A;  1X2H A;  4DQ2 A;  2E10 A;  1KMM A;  4P74 A;  4XU3 A;  3P8V A;  4H02 A;  4YRC A;  3M4Q A;  3UGT A;  4UP9 A;  4ZIB A;  3RAC A;  2CJB A;  3A31 A;  4NCX A;  2RHQ B;  2DQ0 A;  3VQY A;  1BBW A;  2ALY A;  1LYL A;  2DVE A;  2AKW B;  2G4C A;  3A7R A;  1G5I A;  4RMF A;  5ELN A;  4XU2 A;  3HXW A;  3HY1 A;  4P75 A;  4XEM A;  1RIQ A;  2PMF A;  3LSS A;  1YFR A;  4YRN A;  1WYD A;  1BIB A;  3EFR A;  2I4M A;  3TEH B;  3QO7 A;  2ZZE A;  4CH5 A;  3QO5 A;  1FYF A;  3HY0 A;  12AS A;  4XTU A;  2DXU A;  2ZIN A;  1YB3 A;  2P0L A;  2E5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...