2QHSA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhsA01
4OLFA 4HWRA 2RHSA 4YROA 11ASA 2EAYA 2IY5B 1SESA 4XEOA 2CJ9A 1RIQA 1YFSA 2PMEA 4P73C 4XU3A 4H02A 4X5OA 4XU0A 1JJCA 3NETA 2ODRD 3L4GB 4P74A 4HWSA 4K88A 3REUA 3KFUA 2ZR3A 4HA8A 3G1ZA 2ZIOA 1YB3A 4TQDA 2ODRC 1X56A 4YRTA 4CH3A 1YGBA 3EFRA 3TEHB 3RIRA 4P3NA 4CH5A 4HWTA 4WI1A 1B70B 1EVKA 3L1AA 4P74C 3BFMA 3OD1A 2RHSB 3M4QA 2ZTGA 1SRYA 3LSQA 3HTZA 2Q5HA 3V7SA 12ASA 2ALYA 4CH4A 1GGMA 1EOVA 4TTVA 2E65A 1B7YA 1EIYA 2ZNIA 1WNLA 1G5IA 3A7AA 4OP0A 2DU7A 4YRNA 2DTOA 4YPFA 4RMFA 2E10A 4P3OA 2IY5A 1E1OA 4YCUA 2J3LA 1W66A 3PCOA 4P71C 4P3PA 3VQWA 5K1XA 1NJ6A 4KR2A 3L4GA 2DKGA 3RKWA 4BWAA 2ZNJA 1YFTA 1EVLA 4Q6GA 2ZXFA 3RGLA 2EL9A 3V7RA 1ADJA 1B8AA 3MF1A 3TEHA 3A5YA 1KMNA 1L0WA 4Q15A 3HXYA 2ZGWA 4YREA 2ALYB 3NENA 1Z7NA 4YRMA 1B7YB 3HXXA 2C8MA 1WQWA 4XTXA 1SETA 4YRJA 2DEQA 2E5AA 3HY0A 2XGTA 1PYSB 1WYDA 2QHUA 2XTIA 3PCOB 1HXDA 4YRKA 4YRIA 3L2ZA 4TVAB 1QF6A 3V7CA 1LYLA 3WQZA 3IALA 4UP7A 4CS2A 2EJGA 2I4MA 3A7UA 1H4TA 2EWNA 2QHTA 3ERRA 4AH6A 4LNSA 2ARSA 2CJAA 3P8VA 1Z7MA 4WJ4A 3V8JA 2CGHA 4H2UA 5ELOA 4EX5A 3TUPA 3QO8A 4L87A 4RQFA 2CJBA 3W3SA 2EJFA 4H2VA 4WJ3M 2Q7HA 3VQYA 3NELA 3RUXA 4P72A 3HRIA 2Q5IA 4XEMA 4XTYA 1FYFA 4P71A 1H4VB 3IKLA 2DZCA 1B76A 2DZ9A 1E24A 2Q7EA 3QO7A 4YRGA 3RF1A 2HNIA 2ZINA 1ATIA 1VQZA 1SERA 4PHCA 4G85A 4RDXA 3HFZB 1HTTA 2AMCB 4K86A 4HWOA 1PYSA 4TVWA 1BIAA 1E1TA 4XU2A 2ZIMA 4P72C 2ZZEA 1ADYA 4YYEA 2DXUA 1H4QA 4TVAA 4DPGA 4KQEA 1NJ5A 2ZT6A 1IL2A 2QHVA 4YRSA 3I7FA 4CS4A 1ASZA 4O2DA 2QHSA 2C7IA 4KR3A 4CS3A 4UP9A 4YRQA 4J15A 4XTVA 3V8LA 1NJ8A 4ZTUB 4H2TA 1WLEA 2RHQB 2CIMA 3UGQA 4WF2A 2DTIA 3LC0A 3UFGA 4RQEA 4YRCA 4P75C 1N9WA 3A31A 2E1HA 2DXTA 3QNEA 2ARUA 5C52B 2E64A 4YRFA 4H2WA 4H2SA 4TWAA 4YDQA 3A5ZA 2DU5A 2DVEA 2DQ0A 1KMMA 3UGTA 3HXZA 1QE0A 1ASYA 4UPAA 3HFZA 3HY1A 2G4CA 2AMCA 1C0AA 3VQXA 2ZZFA 4BW9A 3HRKA 4DQ2A 3M4PA 1EQRA 2ZZGA 3FJPA 4NCXA 1KOGA 1NJ1A 4G84A 3EFSA 1NYQA 2ZR2A 5F5WA 5KNNA 2AKWB 1G5HA 4H2XB 3TEGA 4H2YA 4YRRA 4YRPA 3QO5A 1HC7A 4ZIBA 1USYA 1E22A 4TQFA 5C53B 2Q7GA 4XU1A 1WQ7A 3P8TA 2RHQA 2ZT8A 4ZTZB 3VQVA 2P0LA 1X2HA 3CMQA 4PG3A 5E3IA 4YCWA 3RL6A 3R07A 3HXWA 2J3MA 2E3CA 3IKMB 1BIBA 3QTCA 2PMFA 1USYC 3ICAA 3A32A 3HXVA 1EFWA 2ZCEA 4EO4A 1H4SA 2P5IA 3RKYA 1X55A 1JJCB 3LSSA 4TVYA 4P75A 3E9IA 1NJ2A 3BJUA 3RKXA 3HFVA 4YCVA 3A74A 3UH0A 3NEMA 4UP8A 1YFRA 1NYRA 5C51B 2E41A 1NNHA 3A7RA 3MEYA 3MF2A 2I4NA 4CH6A 3PZCA 1X2GA 3E9HA 2DQ3A 4XTUA 2AKWA 4H2XA 2DJZA 2ZT7A 3REXA 5K1PA 1J5WA 4YRLA 4XTZA 4HVCA 4K87A 5ELNA 3VBBA 1BBWA 2FYKA 3V8KA 4E51A 3RACA 2ARTA 4P73A 2DTHA 3HXUA 1X01A 5HGQA 3DSQA 1X54A 1WPYA 2DDZA 3P8YA 1BBUA 4YP0A 2ZT5A 4HWPA 3IG2A 2EJ9A 1B70A 2I4LA 1WU7A 1EIYB 2I4OA 4XTWA 1G51A
chains in the Genus database with same CATH superfamily
4OLFA 4HWRA 2RHSA 4YROA 4LVIA 11ASA 2EAYA 2IY5B 1SESA 4XEOA 2CJ9A 1RIQA 1YFSA 2PMEA 4P73C 4XU3A 4H02A 4X5OA 4XU0A 1JJCA 3NETA 2ODRD 3L4GB 4P74A 4HWSA 4K88A 3REUA 3KFUA 2ZR3A 4HA8A 3G1ZA 2ZIOA 1YB3A 4TQDA 2ODRC 1X56A 4YRTA 4CH3A 1YGBA 3EFRA 3TEHB 3RIRA 4P3NA 4CH5A 4HWTA 4WI1A 1B70B 1EVKA 3L1AA 4P74C 3BFMA 3OD1A 2RHSB 3M4QA 2ZTGA 1SRYA 3LSQA 3HTZA 3MQZA 2Q5HA 3V7SA 12ASA 2ALYA 4CH4A 1GGMA 1EOVA 4TTVA 4LVJA 2E65A 1B7YA 1EIYA 2ZNIA 1WNLA 1G5IA 3A7AA 4OP0A 2DU7A 4YRNA 2DTOA 4YPFA 4RMFA 2E10A 4P3OA 2IY5A 1E1OA 4YCUA 2J3LA 1W66A 3PCOA 4P71C 4P3PA 3VQWA 5K1XA 1NJ6A 4KR2A 3L4GA 2DKGA 3RKWA 4BWAA 2ZNJA 1YFTA 1EVLA 4HT4A 4Q6GA 2ZXFA 3RGLA 2EL9A 3V7RA 1ADJA 1B8AA 3MF1A 3TEHA 3A5YA 1KMNA 1L0WA 4Q15A 3HXYA 2ZGWA 4YREA 2ALYB 3NENA 1Z7NA 4YRMA 1B7YB 3HXXA 2C8MA 1WQWA 4XTXA 1SETA 4YRJA 2DEQA 2E5AA 3HY0A 2XGTA 1PYSB 1WYDA 2QHUA 2XTIA 3PCOB 1HXDA 4YRKA 4YRIA 3L2ZA 4TVAB 1QF6A 3V7CA 1LYLA 3WQZA 3IALA 4UP7A 4CS2A 2EJGA 2I4MA 3A7UA 1H4TA 2EWNA 2QHTA 3ERRA 4AH6A 4LNSA 2ARSA 2CJAA 3P8VA 1Z7MA 4WJ4A 3V8JA 2CGHA 4H2UA 5ELOA 4EX5A 3TUPA 3QO8A 4L87A 4RQFA 2CJBA 3W3SA 2EJFA 4H2VA 4WJ3M 2Q7HA 3VQYA 3NELA 3RUXA 4P72A 3HRIA 2Q5IA 4XEMA 4XTYA 1FYFA 4P71A 2A8EA 1H4VB 3IKLA 2DZCA 1B76A 2DZ9A 1E24A 2Q7EA 3QO7A 4YRGA 3RF1A 2HNIA 2ZINA 1ATIA 1VQZA 1SERA 4PHCA 4G85A 4RDXA 3HFZB 1HTTA 2AMCB 4K86A 4HWOA 1PYSA 4TVWA 1BIAA 1E1TA 4XU2A 2ZIMA 4P72C 2ZZEA 1ADYA 4YYEA 2DXUA 1H4QA 4TVAA 4DPGA 4KQEA 1NJ5A 2ZT6A 1IL2A 2QHVA 4YRSA 3I7FA 4CS4A 1ASZA 4O2DA 2QHSA 2C7IA 4KR3A 4CS3A 4UP9A 4YRQA 4J15A 4XTVA 3V8LA 1NJ8A 4ZTUB 4H2TA 1WLEA 2RHQB 2CIMA 3UGQA 4WF2A 2DTIA 3LC0A 3UFGA 4RQEA 4YRCA 4P75C 1N9WA 3A31A 2E1HA 2DXTA 3QNEA 2ARUA 5C52B 2E64A 4YRFA 4H2WA 4H2SA 2NS6A 4TWAA 4LVMA 4YDQA 3A5ZA 2DU5A 2DVEA 2DQ0A 1KMMA 4LVLA 3UGTA 3HXZA 1QE0A 1ASYA 4UPAA 3HFZA 3HY1A 2G4CA 2AMCA 1C0AA 3VQXA 2ZZFA 4BW9A 3HRKA 4DQ2A 3M4PA 1EQRA 2ZZGA 3FJPA 4NCXA 1KOGA 1NJ1A 4G84A 3EFSA 1NYQA 2ZR2A 5F5WA 4LVKA 2AKWB 5KNNA 1G5HA 4H2XB 3TEGA 4H2YA 4YRRA 4YRPA 3QO5A 1HC7A 4ZIBA 1USYA 1E22A 4TQFA 5C53B 2Q7GA 4XU1A 1WQ7A 3P8TA 2RHQA 2ZT8A 4ZTZB 3VQVA 2P0LA 1X2HA 3CMQA 4PG3A 5E3IA 4YCWA 3RL6A 3R07A 3HXWA 2J3MA 2E3CA 3IKMB 1BIBA 3QTCA 2PMFA 1USYC 3ICAA 3A32A 3HXVA 1EFWA 2ZCEA 4EO4A 1H4SA 2P5IA 3RKYA 1X55A 1JJCB 3LSSA 4TVYA 4P75A 3E9IA 1NJ2A 3BJUA 3RKXA 3HFVA 4YCVA 3A74A 3UH0A 3NEMA 4UP8A 1YFRA 1NYRA 5C51B 2E41A 1NNHA 3A7RA 3MEYA 3MF2A 2I4NA 4CH6A 3PZCA 1X2GA 3E9HA 2DQ3A 4XTUA 2AKWA 4H2XA 2DJZA 2ZT7A 3REXA 5K1PA 1J5WA 4YRLA 4XTZA 4HVCA 4K87A 5ELNA 3VBBA 1BBWA 2FYKA 3V8KA 4E51A 3RACA 2ARTA 4P73A 2DTHA 3HXUA 1X01A 5HGQA 3DSQA 1X54A 1WPYA 2DDZA 3P8YA 1BBUA 4YP0A 2ZT5A 4HWPA 3IG2A 2EJ9A 1B70A 2I4LA 1WU7A 1EIYB 2I4OA 4XTWA 1G51A
chains in the Genus database with same CATH topology
4OLFA 4HWRA 2RHSA 4YROA 4LVIA 11ASA 2EAYA 2IY5B 1SESA 4XEOA 2CJ9A 1RIQA 1YFSA 2PMEA 4P73C 4XU3A 4H02A 4X5OA 4XU0A 1JJCA 3NETA 2ODRD 3L4GB 4P74A 4HWSA 4K88A 3REUA 3KFUA 2ZR3A 4HA8A 3G1ZA 2ZIOA 1YB3A 4TQDA 2ODRC 1X56A 4YRTA 4CH3A 1YGBA 3EFRA 3TEHB 3RIRA 4P3NA 4CH5A 4HWTA 4WI1A 1B70B 1EVKA 3L1AA 4P74C 3BFMA 3OD1A 2RHSB 3M4QA 2ZTGA 1SRYA 3LSQA 3HTZA 3MQZA 2Q5HA 3V7SA 12ASA 2ALYA 4CH4A 1GGMA 1EOVA 4TTVA 4LVJA 2E65A 1B7YA 1EIYA 2ZNIA 1WNLA 1G5IA 3A7AA 4OP0A 2DU7A 4YRNA 2DTOA 4YPFA 4RMFA 2E10A 4P3OA 2IY5A 1E1OA 4YCUA 2J3LA 1W66A 3PCOA 4P71C 4P3PA 3VQWA 5K1XA 1NJ6A 4KR2A 3L4GA 2DKGA 3RKWA 4BWAA 2ZNJA 1YFTA 1EVLA 4HT4A 4Q6GA 2ZXFA 3RGLA 2EL9A 3V7RA 1ADJA 1B8AA 3MF1A 3TEHA 3A5YA 1KMNA 1L0WA 4Q15A 3HXYA 2ZGWA 4YREA 2ALYB 3NENA 1Z7NA 4YRMA 1B7YB 3HXXA 2C8MA 1WQWA 4XTXA 1SETA 4YRJA 2DEQA 2E5AA 3HY0A 2XGTA 1PYSB 1WYDA 2QHUA 2XTIA 3PCOB 1HXDA 4YRKA 4YRIA 3L2ZA 4TVAB 1QF6A 3V7CA 1LYLA 3WQZA 3IALA 4UP7A 4CS2A 2EJGA 2I4MA 3A7UA 1H4TA 2EWNA 2QHTA 3ERRA 4AH6A 4LNSA 2ARSA 2CJAA 3P8VA 1Z7MA 4WJ4A 3V8JA 2CGHA 4H2UA 5ELOA 4EX5A 3TUPA 3QO8A 4L87A 4RQFA 2CJBA 3W3SA 2EJFA 4H2VA 4WJ3M 2Q7HA 3VQYA 3NELA 3RUXA 4P72A 3HRIA 2Q5IA 4XEMA 4XTYA 1FYFA 4P71A 2A8EA 1H4VB 3IKLA 2DZCA 1B76A 2DZ9A 1E24A 2Q7EA 3QO7A 4YRGA 3RF1A 2HNIA 2ZINA 1ATIA 1VQZA 1SERA 4PHCA 4G85A 4RDXA 3HFZB 1HTTA 2AMCB 4K86A 4HWOA 1PYSA 4TVWA 1BIAA 1E1TA 4XU2A 2ZIMA 4P72C 2ZZEA 1ADYA 4YYEA 2DXUA 1H4QA 4TVAA 4DPGA 4KQEA 1NJ5A 2ZT6A 1IL2A 2QHVA 4YRSA 3I7FA 4CS4A 1ASZA 4O2DA 2QHSA 2C7IA 4KR3A 4CS3A 4UP9A 4YRQA 4J15A 4XTVA 3V8LA 1NJ8A 4ZTUB 4H2TA 1WLEA 2RHQB 2CIMA 3UGQA 4WF2A 2DTIA 3LC0A 3UFGA 4RQEA 4YRCA 4P75C 1N9WA 3A31A 2E1HA 2DXTA 3QNEA 2ARUA 5C52B 2E64A 4YRFA 4H2WA 4H2SA 2NS6A 4TWAA 4LVMA 4YDQA 3A5ZA 2DU5A 2DVEA 2DQ0A 1KMMA 4LVLA 3UGTA 3HXZA 1QE0A 1ASYA 4UPAA 3HFZA 3HY1A 2G4CA 2AMCA 1C0AA 3VQXA 2ZZFA 4BW9A 3HRKA 4DQ2A 3M4PA 1EQRA 2ZZGA 3FJPA 4NCXA 1KOGA 1NJ1A 4G84A 3EFSA 1NYQA 2ZR2A 5F5WA 4LVKA 2AKWB 5KNNA 1G5HA 4H2XB 3TEGA 4H2YA 4YRRA 4YRPA 3QO5A 1HC7A 4ZIBA 1USYA 1E22A 4TQFA 5C53B 2Q7GA 4XU1A 1WQ7A 3P8TA 2RHQA 2ZT8A 4ZTZB 3VQVA 2P0LA 1X2HA 3CMQA 4PG3A 5E3IA 4YCWA 3RL6A 3R07A 3HXWA 2J3MA 2E3CA 3IKMB 1BIBA 3QTCA 2PMFA 1USYC 3ICAA 3A32A 3HXVA 1EFWA 2ZCEA 4EO4A 1H4SA 2P5IA 3RKYA 1X55A 1JJCB 3LSSA 4TVYA 4P75A 3E9IA 1NJ2A 3BJUA 3RKXA 3HFVA 4YCVA 3A74A 3UH0A 3NEMA 4UP8A 1YFRA 1NYRA 5C51B 2E41A 1NNHA 3A7RA 3MEYA 3MF2A 2I4NA 4CH6A 3PZCA 1X2GA 3E9HA 2DQ3A 4XTUA 2AKWA 4H2XA 2DJZA 2ZT7A 3REXA 5K1PA 1J5WA 4YRLA 4XTZA 4HVCA 4K87A 5ELNA 3VBBA 1BBWA 2FYKA 3V8KA 4E51A 3RACA 2ARTA 4P73A 2DTHA 3HXUA 1X01A 5HGQA 3DSQA 1X54A 1WPYA 2DDZA 3P8YA 1BBUA 4YP0A 2ZT5A 4HWPA 3IG2A 2EJ9A 1B70A 2I4LA 1WU7A 1EIYB 2I4OA 4XTWA 1G51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLF A;  4HWR A;  2RHS A;  4YRO A;  11AS A;  2EAY A;  2IY5 B;  1SES A;  4XEO A;  2CJ9 A;  1RIQ A;  1YFS A;  2PME A;  4P73 C;  4XU3 A;  4H02 A;  4X5O A;  4XU0 A;  1JJC A;  3NET A;  2ODR D;  3L4G B;  4P74 A;  4HWS A;  4K88 A;  3REU A;  3KFU A;  2ZR3 A;  4HA8 A;  3G1Z A;  2ZIO A;  1YB3 A;  4TQD A;  2ODR C;  1X56 A;  4YRT A;  4CH3 A;  1YGB A;  3EFR A;  3TEH B;  3RIR A;  4P3N A;  4CH5 A;  4HWT A;  4WI1 A;  1B70 B;  1EVK A;  3L1A A;  4P74 C;  3BFM A;  3OD1 A;  2RHS B;  3M4Q A;  2ZTG A;  1SRY A;  3LSQ A;  3HTZ A;  2Q5H A;  3V7S A;  12AS A;  2ALY A;  4CH4 A;  1GGM A;  1EOV A;  4TTV A;  2E65 A;  1B7Y A;  1EIY A;  2ZNI A;  1WNL A;  1G5I A;  3A7A A;  4OP0 A;  2DU7 A;  4YRN A;  2DTO A;  4YPF A;  4RMF A;  2E10 A;  4P3O A;  2IY5 A;  1E1O A;  4YCU A;  2J3L A;  1W66 A;  3PCO A;  4P71 C;  4P3P A;  3VQW A;  5K1X A;  1NJ6 A;  4KR2 A;  3L4G A;  2DKG A;  3RKW A;  4BWA A;  2ZNJ A;  1YFT A;  1EVL A;  4Q6G A;  2ZXF A;  3RGL A;  2EL9 A;  3V7R A;  1ADJ A;  1B8A A;  3MF1 A;  3TEH A;  3A5Y A;  1KMN A;  1L0W A;  4Q15 A;  3HXY A;  2ZGW A;  4YRE A;  2ALY B;  3NEN A;  1Z7N A;  4YRM A;  1B7Y B;  3HXX A;  2C8M A;  1WQW A;  4XTX A;  1SET A;  4YRJ A;  2DEQ A;  2E5A A;  3HY0 A;  2XGT A;  1PYS B;  1WYD A;  2QHU A;  2XTI A;  3PCO B;  1HXD A;  4YRK A;  4YRI A;  3L2Z A;  4TVA B;  1QF6 A;  3V7C A;  1LYL A;  3WQZ A;  3IAL A;  4UP7 A;  4CS2 A;  2EJG A;  2I4M A;  3A7U A;  1H4T A;  2EWN A;  2QHT A;  3ERR A;  4AH6 A;  4LNS A;  2ARS A;  2CJA A;  3P8V A;  1Z7M A;  4WJ4 A;  3V8J A;  2CGH A;  4H2U A;  5ELO A;  4EX5 A;  3TUP A;  3QO8 A;  4L87 A;  4RQF A;  2CJB A;  3W3S A;  2EJF A;  4H2V A;  4WJ3 M;  2Q7H A;  3VQY A;  3NEL A;  3RUX A;  4P72 A;  3HRI A;  2Q5I A;  4XEM A;  4XTY A;  1FYF A;  4P71 A;  1H4V B;  3IKL A;  2DZC A;  1B76 A;  2DZ9 A;  1E24 A;  2Q7E A;  3QO7 A;  4YRG A;  3RF1 A;  2HNI A;  2ZIN A;  1ATI A;  1VQZ A;  1SER A;  4PHC A;  4G85 A;  4RDX A;  3HFZ B;  1HTT A;  2AMC B;  4K86 A;  4HWO A;  1PYS A;  4TVW A;  1BIA A;  1E1T A;  4XU2 A;  2ZIM A;  4P72 C;  2ZZE A;  1ADY A;  4YYE A;  2DXU A;  1H4Q A;  4TVA A;  4DPG A;  4KQE A;  1NJ5 A;  2ZT6 A;  1IL2 A;  2QHV A;  4YRS A;  3I7F A;  4CS4 A;  1ASZ A;  4O2D A;  2QHS A;  2C7I A;  4KR3 A;  4CS3 A;  4UP9 A;  4YRQ A;  4J15 A;  4XTV A;  3V8L A;  1NJ8 A;  4ZTU B;  4H2T A;  1WLE A;  2RHQ B;  2CIM A;  3UGQ A;  4WF2 A;  2DTI A;  3LC0 A;  3UFG A;  4RQE A;  4YRC A;  4P75 C;  1N9W A;  3A31 A;  2E1H A;  2DXT A;  3QNE A;  2ARU A;  5C52 B;  2E64 A;  4YRF A;  4H2W A;  4H2S A;  4TWA A;  4YDQ A;  3A5Z A;  2DU5 A;  2DVE A;  2DQ0 A;  1KMM A;  3UGT A;  3HXZ A;  1QE0 A;  1ASY A;  4UPA A;  3HFZ A;  3HY1 A;  2G4C A;  2AMC A;  1C0A A;  3VQX A;  2ZZF A;  4BW9 A;  3HRK A;  4DQ2 A;  3M4P A;  1EQR A;  2ZZG A;  3FJP A;  4NCX A;  1KOG A;  1NJ1 A;  4G84 A;  3EFS A;  1NYQ A;  2ZR2 A;  5F5W A;  5KNN A;  2AKW B;  1G5H A;  4H2X B;  3TEG A;  4H2Y A;  4YRR A;  4YRP A;  3QO5 A;  1HC7 A;  4ZIB A;  1USY A;  1E22 A;  4TQF A;  5C53 B;  2Q7G A;  4XU1 A;  1WQ7 A;  3P8T A;  2RHQ A;  2ZT8 A;  4ZTZ B;  3VQV A;  2P0L A;  1X2H A;  3CMQ A;  4PG3 A;  5E3I A;  4YCW A;  3RL6 A;  3R07 A;  3HXW A;  2J3M A;  2E3C A;  3IKM B;  1BIB A;  3QTC A;  2PMF A;  1USY C;  3ICA A;  3A32 A;  3HXV A;  1EFW A;  2ZCE A;  4EO4 A;  1H4S A;  2P5I A;  3RKY A;  1X55 A;  1JJC B;  3LSS A;  4TVY A;  4P75 A;  3E9I A;  1NJ2 A;  3BJU A;  3RKX A;  3HFV A;  4YCV A;  3A74 A;  3UH0 A;  3NEM A;  4UP8 A;  1YFR A;  1NYR A;  5C51 B;  2E41 A;  1NNH A;  3A7R A;  3MEY A;  3MF2 A;  2I4N A;  4CH6 A;  3PZC A;  1X2G A;  3E9H A;  2DQ3 A;  4XTU A;  2AKW A;  4H2X A;  2DJZ A;  2ZT7 A;  3REX A;  5K1P A;  1J5W A;  4YRL A;  4XTZ A;  4HVC A;  4K87 A;  5ELN A;  3VBB A;  1BBW A;  2FYK A;  3V8K A;  4E51 A;  3RAC A;  2ART A;  4P73 A;  2DTH A;  3HXU A;  1X01 A;  5HGQ A;  3DSQ A;  1X54 A;  1WPY A;  2DDZ A;  3P8Y A;  1BBU A;  4YP0 A;  2ZT5 A;  4HWP A;  3IG2 A;  2EJ9 A;  1B70 A;  2I4L A;  1WU7 A;  1EIY B;  2I4O A;  4XTW A;  1G51 A; 
#chains in the Genus database with same CATH topology
 4OLF A;  4HWR A;  2RHS A;  4YRO A;  4LVI A;  11AS A;  2EAY A;  2IY5 B;  1SES A;  4XEO A;  2CJ9 A;  1RIQ A;  1YFS A;  2PME A;  4P73 C;  4XU3 A;  4H02 A;  4X5O A;  4XU0 A;  1JJC A;  3NET A;  2ODR D;  3L4G B;  4P74 A;  4HWS A;  4K88 A;  3REU A;  3KFU A;  2ZR3 A;  4HA8 A;  3G1Z A;  2ZIO A;  1YB3 A;  4TQD A;  2ODR C;  1X56 A;  4YRT A;  4CH3 A;  1YGB A;  3EFR A;  3TEH B;  3RIR A;  4P3N A;  4CH5 A;  4HWT A;  4WI1 A;  1B70 B;  1EVK A;  3L1A A;  4P74 C;  3BFM A;  3OD1 A;  2RHS B;  3M4Q A;  2ZTG A;  1SRY A;  3LSQ A;  3HTZ A;  3MQZ A;  2Q5H A;  3V7S A;  12AS A;  2ALY A;  4CH4 A;  1GGM A;  1EOV A;  4TTV A;  4LVJ A;  2E65 A;  1B7Y A;  1EIY A;  2ZNI A;  1WNL A;  1G5I A;  3A7A A;  4OP0 A;  2DU7 A;  4YRN A;  2DTO A;  4YPF A;  4RMF A;  2E10 A;  4P3O A;  2IY5 A;  1E1O A;  4YCU A;  2J3L A;  1W66 A;  3PCO A;  4P71 C;  4P3P A;  3VQW A;  5K1X A;  1NJ6 A;  4KR2 A;  3L4G A;  2DKG A;  3RKW A;  4BWA A;  2ZNJ A;  1YFT A;  1EVL A;  4HT4 A;  4Q6G A;  2ZXF A;  3RGL A;  2EL9 A;  3V7R A;  1ADJ A;  1B8A A;  3MF1 A;  3TEH A;  3A5Y A;  1KMN A;  1L0W A;  4Q15 A;  3HXY A;  2ZGW A;  4YRE A;  2ALY B;  3NEN A;  1Z7N A;  4YRM A;  1B7Y B;  3HXX A;  2C8M A;  1WQW A;  4XTX A;  1SET A;  4YRJ A;  2DEQ A;  2E5A A;  3HY0 A;  2XGT A;  1PYS B;  1WYD A;  2QHU A;  2XTI A;  3PCO B;  1HXD A;  4YRK A;  4YRI A;  3L2Z A;  4TVA B;  1QF6 A;  3V7C A;  1LYL A;  3WQZ A;  3IAL A;  4UP7 A;  4CS2 A;  2EJG A;  2I4M A;  3A7U A;  1H4T A;  2EWN A;  2QHT A;  3ERR A;  4AH6 A;  4LNS A;  2ARS A;  2CJA A;  3P8V A;  1Z7M A;  4WJ4 A;  3V8J A;  2CGH A;  4H2U A;  5ELO A;  4EX5 A;  3TUP A;  3QO8 A;  4L87 A;  4RQF A;  2CJB A;  3W3S A;  2EJF A;  4H2V A;  4WJ3 M;  2Q7H A;  3VQY A;  3NEL A;  3RUX A;  4P72 A;  3HRI A;  2Q5I A;  4XEM A;  4XTY A;  1FYF A;  4P71 A;  2A8E A;  1H4V B;  3IKL A;  2DZC A;  1B76 A;  2DZ9 A;  1E24 A;  2Q7E A;  3QO7 A;  4YRG A;  3RF1 A;  2HNI A;  2ZIN A;  1ATI A;  1VQZ A;  1SER A;  4PHC A;  4G85 A;  4RDX A;  3HFZ B;  1HTT A;  2AMC B;  4K86 A;  4HWO A;  1PYS A;  4TVW A;  1BIA A;  1E1T A;  4XU2 A;  2ZIM A;  4P72 C;  2ZZE A;  1ADY A;  4YYE A;  2DXU A;  1H4Q A;  4TVA A;  4DPG A;  4KQE A;  1NJ5 A;  2ZT6 A;  1IL2 A;  2QHV A;  4YRS A;  3I7F A;  4CS4 A;  1ASZ A;  4O2D A;  2QHS A;  2C7I A;  4KR3 A;  4CS3 A;  4UP9 A;  4YRQ A;  4J15 A;  4XTV A;  3V8L A;  1NJ8 A;  4ZTU B;  4H2T A;  1WLE A;  2RHQ B;  2CIM A;  3UGQ A;  4WF2 A;  2DTI A;  3LC0 A;  3UFG A;  4RQE A;  4YRC A;  4P75 C;  1N9W A;  3A31 A;  2E1H A;  2DXT A;  3QNE A;  2ARU A;  5C52 B;  2E64 A;  4YRF A;  4H2W A;  4H2S A;  2NS6 A;  4TWA A;  4LVM A;  4YDQ A;  3A5Z A;  2DU5 A;  2DVE A;  2DQ0 A;  1KMM A;  4LVL A;  3UGT A;  3HXZ A;  1QE0 A;  1ASY A;  4UPA A;  3HFZ A;  3HY1 A;  2G4C A;  2AMC A;  1C0A A;  3VQX A;  2ZZF A;  4BW9 A;  3HRK A;  4DQ2 A;  3M4P A;  1EQR A;  2ZZG A;  3FJP A;  4NCX A;  1KOG A;  1NJ1 A;  4G84 A;  3EFS A;  1NYQ A;  2ZR2 A;  5F5W A;  4LVK A;  2AKW B;  5KNN A;  1G5H A;  4H2X B;  3TEG A;  4H2Y A;  4YRR A;  4YRP A;  3QO5 A;  1HC7 A;  4ZIB A;  1USY A;  1E22 A;  4TQF A;  5C53 B;  2Q7G A;  4XU1 A;  1WQ7 A;  3P8T A;  2RHQ A;  2ZT8 A;  4ZTZ B;  3VQV A;  2P0L A;  1X2H A;  3CMQ A;  4PG3 A;  5E3I A;  4YCW A;  3RL6 A;  3R07 A;  3HXW A;  2J3M A;  2E3C A;  3IKM B;  1BIB A;  3QTC A;  2PMF A;  1USY C;  3ICA A;  3A32 A;  3HXV A;  1EFW A;  2ZCE A;  4EO4 A;  1H4S A;  2P5I A;  3RKY A;  1X55 A;  1JJC B;  3LSS A;  4TVY A;  4P75 A;  3E9I A;  1NJ2 A;  3BJU A;  3RKX A;  3HFV A;  4YCV A;  3A74 A;  3UH0 A;  3NEM A;  4UP8 A;  1YFR A;  1NYR A;  5C51 B;  2E41 A;  1NNH A;  3A7R A;  3MEY A;  3MF2 A;  2I4N A;  4CH6 A;  3PZC A;  1X2G A;  3E9H A;  2DQ3 A;  4XTU A;  2AKW A;  4H2X A;  2DJZ A;  2ZT7 A;  3REX A;  5K1P A;  1J5W A;  4YRL A;  4XTZ A;  4HVC A;  4K87 A;  5ELN A;  3VBB A;  1BBW A;  2FYK A;  3V8K A;  4E51 A;  3RAC A;  2ART A;  4P73 A;  2DTH A;  3HXU A;  1X01 A;  5HGQ A;  3DSQ A;  1X54 A;  1WPY A;  2DDZ A;  3P8Y A;  1BBU A;  4YP0 A;  2ZT5 A;  4HWP A;  3IG2 A;  2EJ9 A;  1B70 A;  2I4L A;  1WU7 A;  1EIY B;  2I4O A;  4XTW A;  1G51 A; 
#chains in the Genus database with same CATH homology
 4OLF A;  4HWR A;  2RHS A;  4YRO A;  4LVI A;  11AS A;  2EAY A;  2IY5 B;  1SES A;  4XEO A;  2CJ9 A;  1RIQ A;  1YFS A;  2PME A;  4P73 C;  4XU3 A;  4H02 A;  4X5O A;  4XU0 A;  1JJC A;  3NET A;  2ODR D;  3L4G B;  4P74 A;  4HWS A;  4K88 A;  3REU A;  3KFU A;  2ZR3 A;  4HA8 A;  3G1Z A;  2ZIO A;  1YB3 A;  4TQD A;  2ODR C;  1X56 A;  4YRT A;  4CH3 A;  1YGB A;  3EFR A;  3TEH B;  3RIR A;  4P3N A;  4CH5 A;  4HWT A;  4WI1 A;  1B70 B;  1EVK A;  3L1A A;  4P74 C;  3BFM A;  3OD1 A;  2RHS B;  3M4Q A;  2ZTG A;  1SRY A;  3LSQ A;  3HTZ A;  3MQZ A;  2Q5H A;  3V7S A;  12AS A;  2ALY A;  4CH4 A;  1GGM A;  1EOV A;  4TTV A;  4LVJ A;  2E65 A;  1B7Y A;  1EIY A;  2ZNI A;  1WNL A;  1G5I A;  3A7A A;  4OP0 A;  2DU7 A;  4YRN A;  2DTO A;  4YPF A;  4RMF A;  2E10 A;  4P3O A;  2IY5 A;  1E1O A;  4YCU A;  2J3L A;  1W66 A;  3PCO A;  4P71 C;  4P3P A;  3VQW A;  5K1X A;  1NJ6 A;  4KR2 A;  3L4G A;  2DKG A;  3RKW A;  4BWA A;  2ZNJ A;  1YFT A;  1EVL A;  4HT4 A;  4Q6G A;  2ZXF A;  3RGL A;  2EL9 A;  3V7R A;  1ADJ A;  1B8A A;  3MF1 A;  3TEH A;  3A5Y A;  1KMN A;  1L0W A;  4Q15 A;  3HXY A;  2ZGW A;  4YRE A;  2ALY B;  3NEN A;  1Z7N A;  4YRM A;  1B7Y B;  3HXX A;  2C8M A;  1WQW A;  4XTX A;  1SET A;  4YRJ A;  2DEQ A;  2E5A A;  3HY0 A;  2XGT A;  1PYS B;  1WYD A;  2QHU A;  2XTI A;  3PCO B;  1HXD A;  4YRK A;  4YRI A;  3L2Z A;  4TVA B;  1QF6 A;  3V7C A;  1LYL A;  3WQZ A;  3IAL A;  4UP7 A;  4CS2 A;  2EJG A;  2I4M A;  3A7U A;  1H4T A;  2EWN A;  2QHT A;  3ERR A;  4AH6 A;  4LNS A;  2ARS A;  2CJA A;  3P8V A;  1Z7M A;  4WJ4 A;  3V8J A;  2CGH A;  4H2U A;  5ELO A;  4EX5 A;  3TUP A;  3QO8 A;  4L87 A;  4RQF A;  2CJB A;  3W3S A;  2EJF A;  4H2V A;  4WJ3 M;  2Q7H A;  3VQY A;  3NEL A;  3RUX A;  4P72 A;  3HRI A;  2Q5I A;  4XEM A;  4XTY A;  1FYF A;  4P71 A;  2A8E A;  1H4V B;  3IKL A;  2DZC A;  1B76 A;  2DZ9 A;  1E24 A;  2Q7E A;  3QO7 A;  4YRG A;  3RF1 A;  2HNI A;  2ZIN A;  1ATI A;  1VQZ A;  1SER A;  4PHC A;  4G85 A;  4RDX A;  3HFZ B;  1HTT A;  2AMC B;  4K86 A;  4HWO A;  1PYS A;  4TVW A;  1BIA A;  1E1T A;  4XU2 A;  2ZIM A;  4P72 C;  2ZZE A;  1ADY A;  4YYE A;  2DXU A;  1H4Q A;  4TVA A;  4DPG A;  4KQE A;  1NJ5 A;  2ZT6 A;  1IL2 A;  2QHV A;  4YRS A;  3I7F A;  4CS4 A;  1ASZ A;  4O2D A;  2QHS A;  2C7I A;  4KR3 A;  4CS3 A;  4UP9 A;  4YRQ A;  4J15 A;  4XTV A;  3V8L A;  1NJ8 A;  4ZTU B;  4H2T A;  1WLE A;  2RHQ B;  2CIM A;  3UGQ A;  4WF2 A;  2DTI A;  3LC0 A;  3UFG A;  4RQE A;  4YRC A;  4P75 C;  1N9W A;  3A31 A;  2E1H A;  2DXT A;  3QNE A;  2ARU A;  5C52 B;  2E64 A;  4YRF A;  4H2W A;  4H2S A;  2NS6 A;  4TWA A;  4LVM A;  4YDQ A;  3A5Z A;  2DU5 A;  2DVE A;  2DQ0 A;  1KMM A;  4LVL A;  3UGT A;  3HXZ A;  1QE0 A;  1ASY A;  4UPA A;  3HFZ A;  3HY1 A;  2G4C A;  2AMC A;  1C0A A;  3VQX A;  2ZZF A;  4BW9 A;  3HRK A;  4DQ2 A;  3M4P A;  1EQR A;  2ZZG A;  3FJP A;  4NCX A;  1KOG A;  1NJ1 A;  4G84 A;  3EFS A;  1NYQ A;  2ZR2 A;  5F5W A;  4LVK A;  2AKW B;  5KNN A;  1G5H A;  4H2X B;  3TEG A;  4H2Y A;  4YRR A;  4YRP A;  3QO5 A;  1HC7 A;  4ZIB A;  1USY A;  1E22 A;  4TQF A;  5C53 B;  2Q7G A;  4XU1 A;  1WQ7 A;  3P8T A;  2RHQ A;  2ZT8 A;  4ZTZ B;  3VQV A;  2P0L A;  1X2H A;  3CMQ A;  4PG3 A;  5E3I A;  4YCW A;  3RL6 A;  3R07 A;  3HXW A;  2J3M A;  2E3C A;  3IKM B;  1BIB A;  3QTC A;  2PMF A;  1USY C;  3ICA A;  3A32 A;  3HXV A;  1EFW A;  2ZCE A;  4EO4 A;  1H4S A;  2P5I A;  3RKY A;  1X55 A;  1JJC B;  3LSS A;  4TVY A;  4P75 A;  3E9I A;  1NJ2 A;  3BJU A;  3RKX A;  3HFV A;  4YCV A;  3A74 A;  3UH0 A;  3NEM A;  4UP8 A;  1YFR A;  1NYR A;  5C51 B;  2E41 A;  1NNH A;  3A7R A;  3MEY A;  3MF2 A;  2I4N A;  4CH6 A;  3PZC A;  1X2G A;  3E9H A;  2DQ3 A;  4XTU A;  2AKW A;  4H2X A;  2DJZ A;  2ZT7 A;  3REX A;  5K1P A;  1J5W A;  4YRL A;  4XTZ A;  4HVC A;  4K87 A;  5ELN A;  3VBB A;  1BBW A;  2FYK A;  3V8K A;  4E51 A;  3RAC A;  2ART A;  4P73 A;  2DTH A;  3HXU A;  1X01 A;  5HGQ A;  3DSQ A;  1X54 A;  1WPY A;  2DDZ A;  3P8Y A;  1BBU A;  4YP0 A;  2ZT5 A;  4HWP A;  3IG2 A;  2EJ9 A;  1B70 A;  2I4L A;  1WU7 A;  1EIY B;  2I4O A;  4XTW A;  1G51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...