2QHSA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 68
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhsA01
4AH6A 1FYFA 4CH6A 2C7IA 2QHSA 3V8LA 2ZT7A 3HY0A 4H2SA 5C53B 2PMFA 1ATIA 2EL9A 2CGHA 1B7YA 3P8YA 2EJ9A 1X2GA 4KQEA 1JJCA 2ALYA 4YRPA 2RHSB 4YRKA 1EVLA 3DSQA 1X54A 4YRQA 3VBBA 3QNEA 2QHVA 2I4OA 1E24A 2DXUA 5KNNA 4YRJA 3NETA 4P71A 1WQ7A 4PHCA 4UP9A 4YRSA 3A7UA 1E1OA 2ARTA 1EFWA 2DTIA 4CH3A 1QF6A 3A5YA 2IY5A 3PCOA 4TVAA 3PZCA 2E10A 4EO4A 2Q5HA 2ZNJA 4LNSA 3R07A 3HXVA 1GGMA 4P73C 2ZIOA 4CS2A 4YRRA 1X55A 1NYRA 1YFTA 3V7RA 4XEMA 3PCOB 4TVAB 4TQDA 2ARSA 4YYEA 3RKWA 1H4VB 4K88A 4EX5A 1WNLA 4HA8A 1USYC 2DQ3A 1WYDA 3E9HA 3HFZA 4HWRA 3UFGA 1B76A 3L4GB 1RIQA 2Q5IA 5E3IA 3VQVA 3HXUA 2J3LA 2RHQA 1L0WA 4O2DA 3G1ZA 2Q7EA 3P8TA 2ZTGA 4P71C 4XU0A 3RF1A 4H2XA 2CJ9A 1BBWA 3IG2A 4G85A 4L87A 2EAYA 1ADYA 3QO5A 2E41A 1EIYB 2DXTA 3VQXA 1WLEA 2CIMA 3BJUA 3RKXA 4DPGA 4XTWA 4P73A 3L1AA 1B7YB 3I7FA 4OP0A 1VQZA 3RUXA 4YRIA 4HWSA 4RQEA 2I4MA 1YFSA 4TQFA 3MF2A 4K87A 2EJFA 3KFUA 1H4TA 4G84A 2DEQA 2ODRD 2DKGA 4OLFA 4RDXA 1PYSA 2ZZEA 3MEYA 1NJ8A 4H2WA 2DU5A 4RMFA 4TWAA 3VQWA 3A7AA 1ADJA 4HWOA 3RKYA 4YRNA 4KR3A 1JJCB 4P74C 1HC7A 2DZ9A 3A32A 3W3SA 3NELA 4YPFA 3L2ZA 2EJGA 4YDQA 4XTZA 1H4SA 1X2HA 1LYLA 2ZXFA 3HRKA 1YGBA 1B70B 2DTHA 4H2XB 1WU7A 2CJBA 1EOVA 1BIAA 4CS3A 4E51A 4HWTA 1EQRA 3A5ZA 4PG3A 4P3OA 3L4GA 2EWNA 4XU2A 1NJ5A 4P3PA 3HRIA 2ZT6A 1YFRA 4XTXA 1SRYA 2HNIA 3MF1A 1G5IA 4CS4A 4P75C 3TEGA 4BWAA 3UGQA 3VQYA 3BFMA 4XTUA 4YCWA 2ZINA 2Q7GA 3OD1A 2E64A 2ZR2A 5C51B 4P74A 2ZT5A 2DTOA 3RIRA 3HXXA 1ASZA 2QHUA 2E3CA 4WF2A 1USYA 1Z7NA 4XTYA 3V8JA 4XU1A 2J3MA 4TVYA 4P72A 2DZCA 4HVCA 3WQZA 4YROA 3ICAA 4P75A 5K1XA 3HY1A 1YB3A 2ALYB 3IALA 2DU7A 2ZT8A 3TEHA 2AMCB 4KR2A 1BIBA 3RGLA 2XGTA 4XEOA 2ZGWA 11ASA 1X56A 2Q7HA 2RHSA 3REUA 1G5HA 3HXWA 4H2VA 1E22A 4P3NA 1NYQA 2P5IA 3M4QA 2ZZFA 3M4PA 4Q6GA 3QO7A 2G4CA 3IKMB 2QHTA 4YRLA 4YP0A 4CH4A 3LSQA 2ZIMA 4K86A 1Z7MA 4YREA 2P0LA 1B70A 4DQ2A 2DVEA 1KOGA 1J5WA 4P72C 3TEHB 4H2TA 3IKLA 4HWPA 2FYKA 5F5WA 5K1PA 1C0AA 3UGTA 3TUPA 1ASYA 1NJ1A 4XTVA 1HTTA 2E5AA 2DQ0A 4YRCA 4XU3A 1IL2A 3NENA 1KMMA 1G51A 2I4LA 3EFRA 3HXYA 3REXA 5ELNA 1WPYA 5C52B 2ARUA 1HXDA 1NJ6A 4Q15A 3HFVA 3QTCA 3ERRA 4YRTA 2AMCA 3UH0A 3V7SA 1EIYA 3V7CA 4ZTZB 4ZIBA 4X5OA 2E1HA 12ASA 4ZTUB 4UP8A 2I4NA 3RACA 1N9WA 2E65A 3NEMA 4WI1A 4TVWA 3QO8A 2AKWB 1W66A 3HTZA 4WJ3M 1SETA 4BW9A 1PYSB 3LSSA 4H02A 2ZCEA 3A74A 1X01A 4NCXA 4RQFA 4J15A 1KMNA 3A7RA 1BBUA 2ZZGA 2ZR3A 4UP7A 3HXZA 2ZNIA 2CJAA 2DDZA 1NJ2A 4H2YA 2PMEA 1QE0A 3HFZB 3LC0A 1NNHA 1B8AA 4H2UA 4YRGA 1SERA 3FJPA 4YCUA 2RHQB 1SESA 1WQWA 3RL6A 5ELOA 3E9IA 3CMQA 2DJZA 3P8VA 4TTVA 5HGQA 1E1TA 3EFSA 3V8KA 1H4QA 2AKWA 2C8MA 4YRMA 4WJ4A 2ODRC 4UPAA 2IY5B 2XTIA 3A31A 4CH5A 4YCVA 4YRFA 1EVKA
chains in the Genus database with same CATH superfamily
4AH6A 1FYFA 4CH6A 2C7IA 2QHSA 3V8LA 2ZT7A 3HY0A 4H2SA 5C53B 2PMFA 1ATIA 2EL9A 2CGHA 1B7YA 3P8YA 2EJ9A 1X2GA 4KQEA 1JJCA 2ALYA 4YRPA 2RHSB 4YRKA 1EVLA 3DSQA 1X54A 4YRQA 3VBBA 3QNEA 2QHVA 2I4OA 1E24A 2DXUA 5KNNA 4YRJA 3NETA 4P71A 1WQ7A 4PHCA 4UP9A 4YRSA 3A7UA 1E1OA 2ARTA 1EFWA 2DTIA 4CH3A 4LVJA 1QF6A 3A5YA 2A8EA 2IY5A 3PCOA 4TVAA 3PZCA 2E10A 4EO4A 4LVMA 2Q5HA 2ZNJA 4LNSA 3R07A 3HXVA 1GGMA 4P73C 2ZIOA 4CS2A 4YRRA 1X55A 1NYRA 1YFTA 3V7RA 4XEMA 3PCOB 4TVAB 4TQDA 2ARSA 4YYEA 3RKWA 1H4VB 4K88A 4EX5A 1WNLA 4HA8A 1USYC 2DQ3A 1WYDA 3E9HA 3HFZA 4HWRA 3UFGA 1B76A 3L4GB 1RIQA 2Q5IA 5E3IA 3VQVA 3HXUA 2J3LA 2RHQA 1L0WA 4O2DA 3G1ZA 2Q7EA 3P8TA 2ZTGA 4P71C 4XU0A 3RF1A 4H2XA 2CJ9A 1BBWA 3IG2A 4G85A 4L87A 2EAYA 1ADYA 3QO5A 2E41A 1EIYB 2DXTA 3VQXA 1WLEA 2CIMA 3BJUA 3RKXA 4DPGA 4XTWA 4P73A 3L1AA 1B7YB 3I7FA 4OP0A 1VQZA 3RUXA 4YRIA 4HWSA 4RQEA 2I4MA 1YFSA 4TQFA 3MF2A 4K87A 2EJFA 3KFUA 1H4TA 4G84A 2DEQA 2ODRD 2DKGA 4OLFA 4RDXA 1PYSA 2ZZEA 3MEYA 1NJ8A 4H2WA 2DU5A 4RMFA 4TWAA 3VQWA 3A7AA 1ADJA 4HWOA 3RKYA 4YRNA 4KR3A 1JJCB 4P74C 1HC7A 2DZ9A 3A32A 3W3SA 3NELA 4YPFA 3L2ZA 4HT4A 2EJGA 4YDQA 4XTZA 1H4SA 1X2HA 1LYLA 2ZXFA 3HRKA 1YGBA 1B70B 2DTHA 4H2XB 1WU7A 2CJBA 1EOVA 1BIAA 4CS3A 4E51A 4HWTA 1EQRA 3A5ZA 4PG3A 4P3OA 3L4GA 2EWNA 4XU2A 1NJ5A 4P3PA 3HRIA 4LVKA 2ZT6A 1YFRA 4XTXA 1SRYA 2HNIA 3MF1A 1G5IA 4CS4A 4P75C 3TEGA 4BWAA 3UGQA 3VQYA 3BFMA 4XTUA 4YCWA 2ZINA 2Q7GA 3OD1A 2E64A 2ZR2A 5C51B 4P74A 2ZT5A 2DTOA 3RIRA 3HXXA 1ASZA 2QHUA 4LVIA 2E3CA 4WF2A 1USYA 1Z7NA 4XTYA 3V8JA 4XU1A 2J3MA 4TVYA 4P72A 2DZCA 4HVCA 3WQZA 4YROA 3ICAA 4P75A 5K1XA 3HY1A 1YB3A 4LVLA 2ALYB 3IALA 2DU7A 2ZT8A 3TEHA 2AMCB 4KR2A 1BIBA 3RGLA 2XGTA 4XEOA 2ZGWA 11ASA 1X56A 2Q7HA 2RHSA 3REUA 1G5HA 3HXWA 4H2VA 1E22A 4P3NA 1NYQA 2P5IA 3M4QA 2ZZFA 3M4PA 4Q6GA 3QO7A 2G4CA 3IKMB 2QHTA 4YRLA 4YP0A 4CH4A 3LSQA 2ZIMA 4K86A 1Z7MA 4YREA 2P0LA 1B70A 4DQ2A 2DVEA 1KOGA 1J5WA 4P72C 3TEHB 4H2TA 3IKLA 4HWPA 2FYKA 5F5WA 5K1PA 1C0AA 3UGTA 3TUPA 1ASYA 1NJ1A 4XTVA 1HTTA 2E5AA 2DQ0A 4YRCA 4XU3A 1IL2A 3NENA 1KMMA 1G51A 2I4LA 2NS6A 3EFRA 3HXYA 3REXA 5ELNA 1WPYA 5C52B 2ARUA 1HXDA 1NJ6A 4Q15A 3HFVA 3QTCA 3ERRA 4YRTA 2AMCA 3UH0A 3V7SA 1EIYA 3V7CA 4ZTZB 4ZIBA 4X5OA 2E1HA 12ASA 4ZTUB 4UP8A 2I4NA 3RACA 1N9WA 2E65A 3NEMA 4WI1A 4TVWA 3QO8A 2AKWB 3MQZA 1W66A 3HTZA 4WJ3M 1SETA 4BW9A 1PYSB 3LSSA 4H02A 2ZCEA 3A74A 1X01A 4NCXA 4RQFA 4J15A 1KMNA 3A7RA 1BBUA 2ZZGA 2ZR3A 4UP7A 3HXZA 2ZNIA 2CJAA 2DDZA 1NJ2A 4H2YA 2PMEA 1QE0A 3HFZB 3LC0A 1NNHA 1B8AA 4H2UA 4YRGA 1SERA 3FJPA 4YCUA 2RHQB 1SESA 1WQWA 3RL6A 5ELOA 3E9IA 3CMQA 2DJZA 3P8VA 4TTVA 5HGQA 1E1TA 3EFSA 3V8KA 1H4QA 2AKWA 2C8MA 4YRMA 4WJ4A 2ODRC 4UPAA 2IY5B 2XTIA 3A31A 4CH5A 4YCVA 4YRFA 1EVKA
chains in the Genus database with same CATH topology
4AH6A 1FYFA 4CH6A 2C7IA 2QHSA 3V8LA 2ZT7A 3HY0A 4H2SA 5C53B 2PMFA 1ATIA 2EL9A 2CGHA 1B7YA 3P8YA 2EJ9A 1X2GA 4KQEA 1JJCA 2ALYA 4YRPA 2RHSB 4YRKA 1EVLA 3DSQA 1X54A 4YRQA 3VBBA 3QNEA 2QHVA 2I4OA 1E24A 2DXUA 5KNNA 4YRJA 3NETA 4P71A 1WQ7A 4PHCA 4UP9A 4YRSA 3A7UA 1E1OA 2ARTA 1EFWA 2DTIA 4CH3A 4LVJA 1QF6A 3A5YA 2A8EA 2IY5A 3PCOA 4TVAA 3PZCA 2E10A 4EO4A 4LVMA 2Q5HA 2ZNJA 4LNSA 3R07A 3HXVA 1GGMA 4P73C 2ZIOA 4CS2A 4YRRA 1X55A 1NYRA 1YFTA 3V7RA 4XEMA 3PCOB 4TVAB 4TQDA 2ARSA 4YYEA 3RKWA 1H4VB 4K88A 4EX5A 1WNLA 4HA8A 1USYC 2DQ3A 1WYDA 3E9HA 3HFZA 4HWRA 3UFGA 1B76A 3L4GB 1RIQA 2Q5IA 5E3IA 3VQVA 3HXUA 2J3LA 2RHQA 1L0WA 4O2DA 3G1ZA 2Q7EA 3P8TA 2ZTGA 4P71C 4XU0A 3RF1A 4H2XA 2CJ9A 1BBWA 3IG2A 4G85A 4L87A 2EAYA 1ADYA 3QO5A 2E41A 1EIYB 2DXTA 3VQXA 1WLEA 2CIMA 3BJUA 3RKXA 4DPGA 4XTWA 4P73A 3L1AA 1B7YB 3I7FA 4OP0A 1VQZA 3RUXA 4YRIA 4HWSA 4RQEA 2I4MA 1YFSA 4TQFA 3MF2A 4K87A 2EJFA 3KFUA 1H4TA 4G84A 2DEQA 2ODRD 2DKGA 4OLFA 4RDXA 1PYSA 2ZZEA 3MEYA 1NJ8A 4H2WA 2DU5A 4RMFA 4TWAA 3VQWA 3A7AA 1ADJA 4HWOA 3RKYA 4YRNA 4KR3A 1JJCB 4P74C 1HC7A 2DZ9A 3A32A 3W3SA 3NELA 4YPFA 3L2ZA 4HT4A 2EJGA 4YDQA 4XTZA 1H4SA 1X2HA 1LYLA 2ZXFA 3HRKA 1YGBA 1B70B 2DTHA 4H2XB 1WU7A 2CJBA 1EOVA 1BIAA 4CS3A 4E51A 4HWTA 1EQRA 3A5ZA 4PG3A 4P3OA 3L4GA 2EWNA 4XU2A 1NJ5A 4P3PA 3HRIA 4LVKA 2ZT6A 1YFRA 4XTXA 1SRYA 2HNIA 3MF1A 1G5IA 4CS4A 4P75C 3TEGA 4BWAA 3UGQA 3VQYA 3BFMA 4XTUA 4YCWA 2ZINA 2Q7GA 3OD1A 2E64A 2ZR2A 5C51B 4P74A 2ZT5A 2DTOA 3RIRA 3HXXA 1ASZA 2QHUA 4LVIA 2E3CA 4WF2A 1USYA 1Z7NA 4XTYA 3V8JA 4XU1A 2J3MA 4TVYA 4P72A 2DZCA 4HVCA 3WQZA 4YROA 3ICAA 4P75A 5K1XA 3HY1A 1YB3A 4LVLA 2ALYB 3IALA 2DU7A 2ZT8A 3TEHA 2AMCB 4KR2A 1BIBA 3RGLA 2XGTA 4XEOA 2ZGWA 11ASA 1X56A 2Q7HA 2RHSA 3REUA 1G5HA 3HXWA 4H2VA 1E22A 4P3NA 1NYQA 2P5IA 3M4QA 2ZZFA 3M4PA 4Q6GA 3QO7A 2G4CA 3IKMB 2QHTA 4YRLA 4YP0A 4CH4A 3LSQA 2ZIMA 4K86A 1Z7MA 4YREA 2P0LA 1B70A 4DQ2A 2DVEA 1KOGA 1J5WA 4P72C 3TEHB 4H2TA 3IKLA 4HWPA 2FYKA 5F5WA 5K1PA 1C0AA 3UGTA 3TUPA 1ASYA 1NJ1A 4XTVA 1HTTA 2E5AA 2DQ0A 4YRCA 4XU3A 1IL2A 3NENA 1KMMA 1G51A 2I4LA 2NS6A 3EFRA 3HXYA 3REXA 5ELNA 1WPYA 5C52B 2ARUA 1HXDA 1NJ6A 4Q15A 3HFVA 3QTCA 3ERRA 4YRTA 2AMCA 3UH0A 3V7SA 1EIYA 3V7CA 4ZTZB 4ZIBA 4X5OA 2E1HA 12ASA 4ZTUB 4UP8A 2I4NA 3RACA 1N9WA 2E65A 3NEMA 4WI1A 4TVWA 3QO8A 2AKWB 3MQZA 1W66A 3HTZA 4WJ3M 1SETA 4BW9A 1PYSB 3LSSA 4H02A 2ZCEA 3A74A 1X01A 4NCXA 4RQFA 4J15A 1KMNA 3A7RA 1BBUA 2ZZGA 2ZR3A 4UP7A 3HXZA 2ZNIA 2CJAA 2DDZA 1NJ2A 4H2YA 2PMEA 1QE0A 3HFZB 3LC0A 1NNHA 1B8AA 4H2UA 4YRGA 1SERA 3FJPA 4YCUA 2RHQB 1SESA 1WQWA 3RL6A 5ELOA 3E9IA 3CMQA 2DJZA 3P8VA 4TTVA 5HGQA 1E1TA 3EFSA 3V8KA 1H4QA 2AKWA 2C8MA 4YRMA 4WJ4A 2ODRC 4UPAA 2IY5B 2XTIA 3A31A 4CH5A 4YCVA 4YRFA 1EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH6 A;  1FYF A;  4CH6 A;  2C7I A;  2QHS A;  3V8L A;  2ZT7 A;  3HY0 A;  4H2S A;  5C53 B;  2PMF A;  1ATI A;  2EL9 A;  2CGH A;  1B7Y A;  3P8Y A;  2EJ9 A;  1X2G A;  4KQE A;  1JJC A;  2ALY A;  4YRP A;  2RHS B;  4YRK A;  1EVL A;  3DSQ A;  1X54 A;  4YRQ A;  3VBB A;  3QNE A;  2QHV A;  2I4O A;  1E24 A;  2DXU A;  5KNN A;  4YRJ A;  3NET A;  4P71 A;  1WQ7 A;  4PHC A;  4UP9 A;  4YRS A;  3A7U A;  1E1O A;  2ART A;  1EFW A;  2DTI A;  4CH3 A;  1QF6 A;  3A5Y A;  2IY5 A;  3PCO A;  4TVA A;  3PZC A;  2E10 A;  4EO4 A;  2Q5H A;  2ZNJ A;  4LNS A;  3R07 A;  3HXV A;  1GGM A;  4P73 C;  2ZIO A;  4CS2 A;  4YRR A;  1X55 A;  1NYR A;  1YFT A;  3V7R A;  4XEM A;  3PCO B;  4TVA B;  4TQD A;  2ARS A;  4YYE A;  3RKW A;  1H4V B;  4K88 A;  4EX5 A;  1WNL A;  4HA8 A;  1USY C;  2DQ3 A;  1WYD A;  3E9H A;  3HFZ A;  4HWR A;  3UFG A;  1B76 A;  3L4G B;  1RIQ A;  2Q5I A;  5E3I A;  3VQV A;  3HXU A;  2J3L A;  2RHQ A;  1L0W A;  4O2D A;  3G1Z A;  2Q7E A;  3P8T A;  2ZTG A;  4P71 C;  4XU0 A;  3RF1 A;  4H2X A;  2CJ9 A;  1BBW A;  3IG2 A;  4G85 A;  4L87 A;  2EAY A;  1ADY A;  3QO5 A;  2E41 A;  1EIY B;  2DXT A;  3VQX A;  1WLE A;  2CIM A;  3BJU A;  3RKX A;  4DPG A;  4XTW A;  4P73 A;  3L1A A;  1B7Y B;  3I7F A;  4OP0 A;  1VQZ A;  3RUX A;  4YRI A;  4HWS A;  4RQE A;  2I4M A;  1YFS A;  4TQF A;  3MF2 A;  4K87 A;  2EJF A;  3KFU A;  1H4T A;  4G84 A;  2DEQ A;  2ODR D;  2DKG A;  4OLF A;  4RDX A;  1PYS A;  2ZZE A;  3MEY A;  1NJ8 A;  4H2W A;  2DU5 A;  4RMF A;  4TWA A;  3VQW A;  3A7A A;  1ADJ A;  4HWO A;  3RKY A;  4YRN A;  4KR3 A;  1JJC B;  4P74 C;  1HC7 A;  2DZ9 A;  3A32 A;  3W3S A;  3NEL A;  4YPF A;  3L2Z A;  2EJG A;  4YDQ A;  4XTZ A;  1H4S A;  1X2H A;  1LYL A;  2ZXF A;  3HRK A;  1YGB A;  1B70 B;  2DTH A;  4H2X B;  1WU7 A;  2CJB A;  1EOV A;  1BIA A;  4CS3 A;  4E51 A;  4HWT A;  1EQR A;  3A5Z A;  4PG3 A;  4P3O A;  3L4G A;  2EWN A;  4XU2 A;  1NJ5 A;  4P3P A;  3HRI A;  2ZT6 A;  1YFR A;  4XTX A;  1SRY A;  2HNI A;  3MF1 A;  1G5I A;  4CS4 A;  4P75 C;  3TEG A;  4BWA A;  3UGQ A;  3VQY A;  3BFM A;  4XTU A;  4YCW A;  2ZIN A;  2Q7G A;  3OD1 A;  2E64 A;  2ZR2 A;  5C51 B;  4P74 A;  2ZT5 A;  2DTO A;  3RIR A;  3HXX A;  1ASZ A;  2QHU A;  2E3C A;  4WF2 A;  1USY A;  1Z7N A;  4XTY A;  3V8J A;  4XU1 A;  2J3M A;  4TVY A;  4P72 A;  2DZC A;  4HVC A;  3WQZ A;  4YRO A;  3ICA A;  4P75 A;  5K1X A;  3HY1 A;  1YB3 A;  2ALY B;  3IAL A;  2DU7 A;  2ZT8 A;  3TEH A;  2AMC B;  4KR2 A;  1BIB A;  3RGL A;  2XGT A;  4XEO A;  2ZGW A;  11AS A;  1X56 A;  2Q7H A;  2RHS A;  3REU A;  1G5H A;  3HXW A;  4H2V A;  1E22 A;  4P3N A;  1NYQ A;  2P5I A;  3M4Q A;  2ZZF A;  3M4P A;  4Q6G A;  3QO7 A;  2G4C A;  3IKM B;  2QHT A;  4YRL A;  4YP0 A;  4CH4 A;  3LSQ A;  2ZIM A;  4K86 A;  1Z7M A;  4YRE A;  2P0L A;  1B70 A;  4DQ2 A;  2DVE A;  1KOG A;  1J5W A;  4P72 C;  3TEH B;  4H2T A;  3IKL A;  4HWP A;  2FYK A;  5F5W A;  5K1P A;  1C0A A;  3UGT A;  3TUP A;  1ASY A;  1NJ1 A;  4XTV A;  1HTT A;  2E5A A;  2DQ0 A;  4YRC A;  4XU3 A;  1IL2 A;  3NEN A;  1KMM A;  1G51 A;  2I4L A;  3EFR A;  3HXY A;  3REX A;  5ELN A;  1WPY A;  5C52 B;  2ARU A;  1HXD A;  1NJ6 A;  4Q15 A;  3HFV A;  3QTC A;  3ERR A;  4YRT A;  2AMC A;  3UH0 A;  3V7S A;  1EIY A;  3V7C A;  4ZTZ B;  4ZIB A;  4X5O A;  2E1H A;  12AS A;  4ZTU B;  4UP8 A;  2I4N A;  3RAC A;  1N9W A;  2E65 A;  3NEM A;  4WI1 A;  4TVW A;  3QO8 A;  2AKW B;  1W66 A;  3HTZ A;  4WJ3 M;  1SET A;  4BW9 A;  1PYS B;  3LSS A;  4H02 A;  2ZCE A;  3A74 A;  1X01 A;  4NCX A;  4RQF A;  4J15 A;  1KMN A;  3A7R A;  1BBU A;  2ZZG A;  2ZR3 A;  4UP7 A;  3HXZ A;  2ZNI A;  2CJA A;  2DDZ A;  1NJ2 A;  4H2Y A;  2PME A;  1QE0 A;  3HFZ B;  3LC0 A;  1NNH A;  1B8A A;  4H2U A;  4YRG A;  1SER A;  3FJP A;  4YCU A;  2RHQ B;  1SES A;  1WQW A;  3RL6 A;  5ELO A;  3E9I A;  3CMQ A;  2DJZ A;  3P8V A;  4TTV A;  5HGQ A;  1E1T A;  3EFS A;  3V8K A;  1H4Q A;  2AKW A;  2C8M A;  4YRM A;  4WJ4 A;  2ODR C;  4UPA A;  2IY5 B;  2XTI A;  3A31 A;  4CH5 A;  4YCV A;  4YRF A;  1EVK A; 
#chains in the Genus database with same CATH topology
 4AH6 A;  1FYF A;  4CH6 A;  2C7I A;  2QHS A;  3V8L A;  2ZT7 A;  3HY0 A;  4H2S A;  5C53 B;  2PMF A;  1ATI A;  2EL9 A;  2CGH A;  1B7Y A;  3P8Y A;  2EJ9 A;  1X2G A;  4KQE A;  1JJC A;  2ALY A;  4YRP A;  2RHS B;  4YRK A;  1EVL A;  3DSQ A;  1X54 A;  4YRQ A;  3VBB A;  3QNE A;  2QHV A;  2I4O A;  1E24 A;  2DXU A;  5KNN A;  4YRJ A;  3NET A;  4P71 A;  1WQ7 A;  4PHC A;  4UP9 A;  4YRS A;  3A7U A;  1E1O A;  2ART A;  1EFW A;  2DTI A;  4CH3 A;  4LVJ A;  1QF6 A;  3A5Y A;  2A8E A;  2IY5 A;  3PCO A;  4TVA A;  3PZC A;  2E10 A;  4EO4 A;  4LVM A;  2Q5H A;  2ZNJ A;  4LNS A;  3R07 A;  3HXV A;  1GGM A;  4P73 C;  2ZIO A;  4CS2 A;  4YRR A;  1X55 A;  1NYR A;  1YFT A;  3V7R A;  4XEM A;  3PCO B;  4TVA B;  4TQD A;  2ARS A;  4YYE A;  3RKW A;  1H4V B;  4K88 A;  4EX5 A;  1WNL A;  4HA8 A;  1USY C;  2DQ3 A;  1WYD A;  3E9H A;  3HFZ A;  4HWR A;  3UFG A;  1B76 A;  3L4G B;  1RIQ A;  2Q5I A;  5E3I A;  3VQV A;  3HXU A;  2J3L A;  2RHQ A;  1L0W A;  4O2D A;  3G1Z A;  2Q7E A;  3P8T A;  2ZTG A;  4P71 C;  4XU0 A;  3RF1 A;  4H2X A;  2CJ9 A;  1BBW A;  3IG2 A;  4G85 A;  4L87 A;  2EAY A;  1ADY A;  3QO5 A;  2E41 A;  1EIY B;  2DXT A;  3VQX A;  1WLE A;  2CIM A;  3BJU A;  3RKX A;  4DPG A;  4XTW A;  4P73 A;  3L1A A;  1B7Y B;  3I7F A;  4OP0 A;  1VQZ A;  3RUX A;  4YRI A;  4HWS A;  4RQE A;  2I4M A;  1YFS A;  4TQF A;  3MF2 A;  4K87 A;  2EJF A;  3KFU A;  1H4T A;  4G84 A;  2DEQ A;  2ODR D;  2DKG A;  4OLF A;  4RDX A;  1PYS A;  2ZZE A;  3MEY A;  1NJ8 A;  4H2W A;  2DU5 A;  4RMF A;  4TWA A;  3VQW A;  3A7A A;  1ADJ A;  4HWO A;  3RKY A;  4YRN A;  4KR3 A;  1JJC B;  4P74 C;  1HC7 A;  2DZ9 A;  3A32 A;  3W3S A;  3NEL A;  4YPF A;  3L2Z A;  4HT4 A;  2EJG A;  4YDQ A;  4XTZ A;  1H4S A;  1X2H A;  1LYL A;  2ZXF A;  3HRK A;  1YGB A;  1B70 B;  2DTH A;  4H2X B;  1WU7 A;  2CJB A;  1EOV A;  1BIA A;  4CS3 A;  4E51 A;  4HWT A;  1EQR A;  3A5Z A;  4PG3 A;  4P3O A;  3L4G A;  2EWN A;  4XU2 A;  1NJ5 A;  4P3P A;  3HRI A;  4LVK A;  2ZT6 A;  1YFR A;  4XTX A;  1SRY A;  2HNI A;  3MF1 A;  1G5I A;  4CS4 A;  4P75 C;  3TEG A;  4BWA A;  3UGQ A;  3VQY A;  3BFM A;  4XTU A;  4YCW A;  2ZIN A;  2Q7G A;  3OD1 A;  2E64 A;  2ZR2 A;  5C51 B;  4P74 A;  2ZT5 A;  2DTO A;  3RIR A;  3HXX A;  1ASZ A;  2QHU A;  4LVI A;  2E3C A;  4WF2 A;  1USY A;  1Z7N A;  4XTY A;  3V8J A;  4XU1 A;  2J3M A;  4TVY A;  4P72 A;  2DZC A;  4HVC A;  3WQZ A;  4YRO A;  3ICA A;  4P75 A;  5K1X A;  3HY1 A;  1YB3 A;  4LVL A;  2ALY B;  3IAL A;  2DU7 A;  2ZT8 A;  3TEH A;  2AMC B;  4KR2 A;  1BIB A;  3RGL A;  2XGT A;  4XEO A;  2ZGW A;  11AS A;  1X56 A;  2Q7H A;  2RHS A;  3REU A;  1G5H A;  3HXW A;  4H2V A;  1E22 A;  4P3N A;  1NYQ A;  2P5I A;  3M4Q A;  2ZZF A;  3M4P A;  4Q6G A;  3QO7 A;  2G4C A;  3IKM B;  2QHT A;  4YRL A;  4YP0 A;  4CH4 A;  3LSQ A;  2ZIM A;  4K86 A;  1Z7M A;  4YRE A;  2P0L A;  1B70 A;  4DQ2 A;  2DVE A;  1KOG A;  1J5W A;  4P72 C;  3TEH B;  4H2T A;  3IKL A;  4HWP A;  2FYK A;  5F5W A;  5K1P A;  1C0A A;  3UGT A;  3TUP A;  1ASY A;  1NJ1 A;  4XTV A;  1HTT A;  2E5A A;  2DQ0 A;  4YRC A;  4XU3 A;  1IL2 A;  3NEN A;  1KMM A;  1G51 A;  2I4L A;  2NS6 A;  3EFR A;  3HXY A;  3REX A;  5ELN A;  1WPY A;  5C52 B;  2ARU A;  1HXD A;  1NJ6 A;  4Q15 A;  3HFV A;  3QTC A;  3ERR A;  4YRT A;  2AMC A;  3UH0 A;  3V7S A;  1EIY A;  3V7C A;  4ZTZ B;  4ZIB A;  4X5O A;  2E1H A;  12AS A;  4ZTU B;  4UP8 A;  2I4N A;  3RAC A;  1N9W A;  2E65 A;  3NEM A;  4WI1 A;  4TVW A;  3QO8 A;  2AKW B;  3MQZ A;  1W66 A;  3HTZ A;  4WJ3 M;  1SET A;  4BW9 A;  1PYS B;  3LSS A;  4H02 A;  2ZCE A;  3A74 A;  1X01 A;  4NCX A;  4RQF A;  4J15 A;  1KMN A;  3A7R A;  1BBU A;  2ZZG A;  2ZR3 A;  4UP7 A;  3HXZ A;  2ZNI A;  2CJA A;  2DDZ A;  1NJ2 A;  4H2Y A;  2PME A;  1QE0 A;  3HFZ B;  3LC0 A;  1NNH A;  1B8A A;  4H2U A;  4YRG A;  1SER A;  3FJP A;  4YCU A;  2RHQ B;  1SES A;  1WQW A;  3RL6 A;  5ELO A;  3E9I A;  3CMQ A;  2DJZ A;  3P8V A;  4TTV A;  5HGQ A;  1E1T A;  3EFS A;  3V8K A;  1H4Q A;  2AKW A;  2C8M A;  4YRM A;  4WJ4 A;  2ODR C;  4UPA A;  2IY5 B;  2XTI A;  3A31 A;  4CH5 A;  4YCV A;  4YRF A;  1EVK A; 
#chains in the Genus database with same CATH homology
 4AH6 A;  1FYF A;  4CH6 A;  2C7I A;  2QHS A;  3V8L A;  2ZT7 A;  3HY0 A;  4H2S A;  5C53 B;  2PMF A;  1ATI A;  2EL9 A;  2CGH A;  1B7Y A;  3P8Y A;  2EJ9 A;  1X2G A;  4KQE A;  1JJC A;  2ALY A;  4YRP A;  2RHS B;  4YRK A;  1EVL A;  3DSQ A;  1X54 A;  4YRQ A;  3VBB A;  3QNE A;  2QHV A;  2I4O A;  1E24 A;  2DXU A;  5KNN A;  4YRJ A;  3NET A;  4P71 A;  1WQ7 A;  4PHC A;  4UP9 A;  4YRS A;  3A7U A;  1E1O A;  2ART A;  1EFW A;  2DTI A;  4CH3 A;  4LVJ A;  1QF6 A;  3A5Y A;  2A8E A;  2IY5 A;  3PCO A;  4TVA A;  3PZC A;  2E10 A;  4EO4 A;  4LVM A;  2Q5H A;  2ZNJ A;  4LNS A;  3R07 A;  3HXV A;  1GGM A;  4P73 C;  2ZIO A;  4CS2 A;  4YRR A;  1X55 A;  1NYR A;  1YFT A;  3V7R A;  4XEM A;  3PCO B;  4TVA B;  4TQD A;  2ARS A;  4YYE A;  3RKW A;  1H4V B;  4K88 A;  4EX5 A;  1WNL A;  4HA8 A;  1USY C;  2DQ3 A;  1WYD A;  3E9H A;  3HFZ A;  4HWR A;  3UFG A;  1B76 A;  3L4G B;  1RIQ A;  2Q5I A;  5E3I A;  3VQV A;  3HXU A;  2J3L A;  2RHQ A;  1L0W A;  4O2D A;  3G1Z A;  2Q7E A;  3P8T A;  2ZTG A;  4P71 C;  4XU0 A;  3RF1 A;  4H2X A;  2CJ9 A;  1BBW A;  3IG2 A;  4G85 A;  4L87 A;  2EAY A;  1ADY A;  3QO5 A;  2E41 A;  1EIY B;  2DXT A;  3VQX A;  1WLE A;  2CIM A;  3BJU A;  3RKX A;  4DPG A;  4XTW A;  4P73 A;  3L1A A;  1B7Y B;  3I7F A;  4OP0 A;  1VQZ A;  3RUX A;  4YRI A;  4HWS A;  4RQE A;  2I4M A;  1YFS A;  4TQF A;  3MF2 A;  4K87 A;  2EJF A;  3KFU A;  1H4T A;  4G84 A;  2DEQ A;  2ODR D;  2DKG A;  4OLF A;  4RDX A;  1PYS A;  2ZZE A;  3MEY A;  1NJ8 A;  4H2W A;  2DU5 A;  4RMF A;  4TWA A;  3VQW A;  3A7A A;  1ADJ A;  4HWO A;  3RKY A;  4YRN A;  4KR3 A;  1JJC B;  4P74 C;  1HC7 A;  2DZ9 A;  3A32 A;  3W3S A;  3NEL A;  4YPF A;  3L2Z A;  4HT4 A;  2EJG A;  4YDQ A;  4XTZ A;  1H4S A;  1X2H A;  1LYL A;  2ZXF A;  3HRK A;  1YGB A;  1B70 B;  2DTH A;  4H2X B;  1WU7 A;  2CJB A;  1EOV A;  1BIA A;  4CS3 A;  4E51 A;  4HWT A;  1EQR A;  3A5Z A;  4PG3 A;  4P3O A;  3L4G A;  2EWN A;  4XU2 A;  1NJ5 A;  4P3P A;  3HRI A;  4LVK A;  2ZT6 A;  1YFR A;  4XTX A;  1SRY A;  2HNI A;  3MF1 A;  1G5I A;  4CS4 A;  4P75 C;  3TEG A;  4BWA A;  3UGQ A;  3VQY A;  3BFM A;  4XTU A;  4YCW A;  2ZIN A;  2Q7G A;  3OD1 A;  2E64 A;  2ZR2 A;  5C51 B;  4P74 A;  2ZT5 A;  2DTO A;  3RIR A;  3HXX A;  1ASZ A;  2QHU A;  4LVI A;  2E3C A;  4WF2 A;  1USY A;  1Z7N A;  4XTY A;  3V8J A;  4XU1 A;  2J3M A;  4TVY A;  4P72 A;  2DZC A;  4HVC A;  3WQZ A;  4YRO A;  3ICA A;  4P75 A;  5K1X A;  3HY1 A;  1YB3 A;  4LVL A;  2ALY B;  3IAL A;  2DU7 A;  2ZT8 A;  3TEH A;  2AMC B;  4KR2 A;  1BIB A;  3RGL A;  2XGT A;  4XEO A;  2ZGW A;  11AS A;  1X56 A;  2Q7H A;  2RHS A;  3REU A;  1G5H A;  3HXW A;  4H2V A;  1E22 A;  4P3N A;  1NYQ A;  2P5I A;  3M4Q A;  2ZZF A;  3M4P A;  4Q6G A;  3QO7 A;  2G4C A;  3IKM B;  2QHT A;  4YRL A;  4YP0 A;  4CH4 A;  3LSQ A;  2ZIM A;  4K86 A;  1Z7M A;  4YRE A;  2P0L A;  1B70 A;  4DQ2 A;  2DVE A;  1KOG A;  1J5W A;  4P72 C;  3TEH B;  4H2T A;  3IKL A;  4HWP A;  2FYK A;  5F5W A;  5K1P A;  1C0A A;  3UGT A;  3TUP A;  1ASY A;  1NJ1 A;  4XTV A;  1HTT A;  2E5A A;  2DQ0 A;  4YRC A;  4XU3 A;  1IL2 A;  3NEN A;  1KMM A;  1G51 A;  2I4L A;  2NS6 A;  3EFR A;  3HXY A;  3REX A;  5ELN A;  1WPY A;  5C52 B;  2ARU A;  1HXD A;  1NJ6 A;  4Q15 A;  3HFV A;  3QTC A;  3ERR A;  4YRT A;  2AMC A;  3UH0 A;  3V7S A;  1EIY A;  3V7C A;  4ZTZ B;  4ZIB A;  4X5O A;  2E1H A;  12AS A;  4ZTU B;  4UP8 A;  2I4N A;  3RAC A;  1N9W A;  2E65 A;  3NEM A;  4WI1 A;  4TVW A;  3QO8 A;  2AKW B;  3MQZ A;  1W66 A;  3HTZ A;  4WJ3 M;  1SET A;  4BW9 A;  1PYS B;  3LSS A;  4H02 A;  2ZCE A;  3A74 A;  1X01 A;  4NCX A;  4RQF A;  4J15 A;  1KMN A;  3A7R A;  1BBU A;  2ZZG A;  2ZR3 A;  4UP7 A;  3HXZ A;  2ZNI A;  2CJA A;  2DDZ A;  1NJ2 A;  4H2Y A;  2PME A;  1QE0 A;  3HFZ B;  3LC0 A;  1NNH A;  1B8A A;  4H2U A;  4YRG A;  1SER A;  3FJP A;  4YCU A;  2RHQ B;  1SES A;  1WQW A;  3RL6 A;  5ELO A;  3E9I A;  3CMQ A;  2DJZ A;  3P8V A;  4TTV A;  5HGQ A;  1E1T A;  3EFS A;  3V8K A;  1H4Q A;  2AKW A;  2C8M A;  4YRM A;  4WJ4 A;  2ODR C;  4UPA A;  2IY5 B;  2XTI A;  3A31 A;  4CH5 A;  4YCV A;  4YRF A;  1EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...