2QHUA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
b'MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
molecule tags Transferase
source organism Thermus thermophilus
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhuA01
3V8LA 1X54A 2DTHA 3ERRA 4YRKA 2DQ0A 3NEMA 4HWSA 2ZT8A 3UFGA 1YB3A 3MF2A 1EVLA 4RDXA 2DVEA 1B70A 3RL6A 4P71A 2ZT6A 1G5HA 4KR2A 3HRIA 4TQFA 3IKLA 2ALYA 3EFSA 4UP9A 3HTZA 2XTIA 4BW9A 1NJ2A 4P3OA 3UGQA 1WQ7A 4XTWA 2I4NA 4YRLA 2J3LA 4P74C 5C51B 4YRMA 4YRSA 3HXVA 4YRPA 3HXYA 1E1TA 3MEYA 1NJ6A 4AH6A 4DPGA 2DQ3A 3LSSA 4KR3A 2ZZEA 3R07A 1WU7A 2ZR2A 2CGHA 3NETA 4NCXA 1B7YA 2ZXFA 4CH4A 11ASA 4OLFA 2RHQA 4H2XB 3VBBA 1EVKA 2ZNJA 3E9HA 2ZZGA 4XEOA 4PG3A 1JJCB 3OD1A 1KMMA 4YRRA 4L87A 2EJFA 3BFMA 3QO5A 3L4GA 4P3NA 1IL2A 4ZTUB 4Q6GA 4K86A 1X55A 4HWOA 3M4PA 4E51A 4WJ4A 2Q5HA 2IY5B 1X01A 3L1AA 1USYC 1B7YB 3NELA 4YYEA 2IY5A 2AKWB 2DJZA 1G51A 4LNSA 2AMCB 2AKWA 2C8MA 3HXWA 3RF1A 4TVYA 1W66A 2PMEA 4UP7A 2ZGWA 3M4QA 3PZCA 1YFRA 4OP0A 3FJPA 3HFZB 3A7AA 4TVAB 1NYQA 3V8JA 1B76A 2ZTGA 1E1OA 1PYSA 1FYFA 1NJ8A 2ZT7A 2DU5A 2QHSA 2CIMA 1H4TA 1NJ1A 2XGTA 2DDZA 4H2UA 2CJ9A 4H02A 1H4SA 3A5YA 4CH5A 1EOVA 3KFUA 2RHSB 2HNIA 1BIAA 3IKMB 3LSQA 4WJ3M 4XEMA 2E65A 3L2ZA 5ELNA 1G5IA 2DXUA 3P8TA 4J15A 2DZCA 1BIBA 4CH3A 3A31A 1HXDA 1WLEA 3MF1A 1SESA 4HVCA 3TUPA 2I4LA 4WF2A 2DTIA 3V8KA 1WYDA 1YFSA 1KMNA 3HRKA 1WNLA 2EAYA 2ZT5A 2ZNIA 1C0AA 4BWAA 4H2WA 4ZTZB 1EIYA 4CH6A 4K87A 3QNEA 2QHTA 1EIYB 2E10A 3RGLA 4H2SA 3HFVA 4EX5A 4YP0A 5HGQA 1HTTA 2DTOA 2Q5IA 3TEHB 3TEHA 4P3PA 4H2YA 5KNNA 1USYA 4ZIBA 4RQEA 2DZ9A 3VQXA 3G1ZA 1YGBA 2I4MA 4P74A 1KOGA 4H2VA 2RHQB 4H2XA 2PMFA 3LC0A 3W3SA 1ADJA 3PCOA 4YRIA 1NYRA 3HXZA 2DEQA 4YCUA 3HY1A 1BBWA 1E24A 3CMQA 3REUA 4XU1A 1NNHA 3A32A 2P0LA 3VQWA 3L4GB 4O2DA 3QTCA 1B70B 4G85A 1E22A 4HA8A 1EQRA 4RMFA 4YDQA 5K1PA 4TVWA 2DXTA 4P75A 3A74A 2E5AA 4YRQA 3IG2A 1H4VB 1Z7MA 2Q7GA 2ZZFA 3I7FA 3A7RA 3RACA 3PCOB 4K88A 2EJGA 3A5ZA 3V7CA 4Q15A 4P75C 1NJ5A 4YRCA 5ELOA 1H4QA 2EJ9A 1J5WA 2P5IA 1N9WA 3RUXA 1ASZA 3WQZA 4WI1A 2G4CA 3ICAA 4YROA 2E3CA 1HC7A 5E3IA 4P72A 3HY0A 3E9IA 2J3MA 5F5WA 1ATIA 4XTZA 1ASYA 2ZIMA 1WQWA 2CJAA 2E64A 3TEGA 2ODRC 2Q7EA 4YRTA 4YRFA 3RKWA 3DSQA 1B8AA 4HWPA 2FYKA 1SRYA 4HWRA 3HFZA 3HXUA 3UGTA 1X56A 4P71C 1X2HA 4TQDA 4XU2A 4EO4A 1LYLA 5C52B 4YRJA 3UH0A 4CS4A 4YRGA 2ARTA 2QHUA 2ARUA 1ADYA 3V7RA 3VQYA 2I4OA 4H2TA 3NENA 3RKXA 1VQZA 3A7UA 2ZIOA 4P72C 1JJCA 4YREA 3BJUA 1Z7NA 2EWNA 2CJBA 4YRNA 1X2GA 4TTVA 2DKGA 4XTUA 4YPFA 3V7SA 4YCVA 4P73A 3RKYA 4TVAA 3HXXA 4P73C 2C7IA 2E1HA 4UP8A 4DQ2A 1EFWA 1SETA 3IALA 4CS2A 3EFRA 1BBUA 2RHSA 2AMCA 4RQFA 1QE0A 3QO7A 1SERA 4G84A 1L0WA 1GGMA 4X5OA 3QO8A 4TWAA 5K1XA 2EL9A 2QHVA 2ZINA 1WPYA 4UPAA 3REXA 3P8VA 4HWTA 1RIQA 2E41A 2Q7HA 4XTYA 2ZCEA 4YCWA 1PYSB 5C53B 1QF6A 4XU3A 2ARSA 3RIRA 4KQEA 4XTXA 4XU0A 4PHCA 3P8YA 2ALYB 1YFTA 2DU7A 2ODRD 12ASA 3VQVA 2ZR3A 4XTVA 4CS3A
chains in the Genus database with same CATH superfamily
3V8LA 1X54A 2DTHA 3ERRA 4YRKA 2DQ0A 3NEMA 4HWSA 2ZT8A 3UFGA 1YB3A 3MF2A 1EVLA 4RDXA 2DVEA 1B70A 3RL6A 4P71A 2ZT6A 1G5HA 4KR2A 3HRIA 4TQFA 3IKLA 2ALYA 3EFSA 4UP9A 3HTZA 2XTIA 4BW9A 1NJ2A 4P3OA 3UGQA 1WQ7A 4XTWA 2I4NA 4YRLA 2J3LA 4P74C 5C51B 4YRMA 4YRSA 3HXVA 4YRPA 3HXYA 1E1TA 3MEYA 1NJ6A 4AH6A 4DPGA 2DQ3A 3LSSA 4KR3A 2ZZEA 3R07A 1WU7A 2ZR2A 2CGHA 3NETA 4NCXA 1B7YA 2ZXFA 4CH4A 11ASA 4OLFA 2RHQA 4H2XB 4HT4A 3VBBA 1EVKA 2ZNJA 3E9HA 2ZZGA 4XEOA 4PG3A 2A8EA 1JJCB 3OD1A 1KMMA 4YRRA 4L87A 2EJFA 3BFMA 3QO5A 3L4GA 4P3NA 1IL2A 4ZTUB 4Q6GA 4K86A 1X55A 4HWOA 3M4PA 4E51A 4WJ4A 4LVLA 2Q5HA 2IY5B 1X01A 3L1AA 1USYC 1B7YB 3NELA 4YYEA 2IY5A 2AKWB 3MQZA 2DJZA 1G51A 4LNSA 2AMCB 2AKWA 2C8MA 3HXWA 3RF1A 4TVYA 1W66A 2PMEA 4UP7A 2ZGWA 3M4QA 3PZCA 1YFRA 4OP0A 3FJPA 3HFZB 3A7AA 4TVAB 1NYQA 3V8JA 1B76A 2ZTGA 1E1OA 1PYSA 1FYFA 1NJ8A 2ZT7A 2DU5A 2QHSA 2CIMA 1H4TA 1NJ1A 2XGTA 2DDZA 4H2UA 2CJ9A 4H02A 1H4SA 3A5YA 4CH5A 1EOVA 3KFUA 2RHSB 2HNIA 1BIAA 3IKMB 3LSQA 4WJ3M 4XEMA 2E65A 3L2ZA 5ELNA 1G5IA 2DXUA 3P8TA 4J15A 2DZCA 1BIBA 4CH3A 3A31A 1HXDA 1WLEA 3MF1A 1SESA 4HVCA 3TUPA 2I4LA 4WF2A 2DTIA 3V8KA 1WYDA 1YFSA 1KMNA 3HRKA 1WNLA 2EAYA 2ZT5A 2ZNIA 1C0AA 4BWAA 4H2WA 4ZTZB 1EIYA 4CH6A 4K87A 3QNEA 2QHTA 1EIYB 2E10A 3RGLA 4H2SA 3HFVA 4EX5A 4YP0A 5HGQA 1HTTA 2DTOA 2Q5IA 3TEHB 3TEHA 4P3PA 4H2YA 5KNNA 1USYA 4ZIBA 4RQEA 2DZ9A 3VQXA 3G1ZA 2NS6A 1YGBA 2I4MA 4P74A 1KOGA 4H2VA 2RHQB 4H2XA 2PMFA 3LC0A 3W3SA 1ADJA 3PCOA 4YRIA 1NYRA 3HXZA 2DEQA 4YCUA 3HY1A 1BBWA 1E24A 3CMQA 3REUA 4XU1A 1NNHA 3A32A 2P0LA 3VQWA 3L4GB 4O2DA 3QTCA 1B70B 4G85A 1E22A 4HA8A 1EQRA 4RMFA 4YDQA 5K1PA 4TVWA 2DXTA 4P75A 3A74A 2E5AA 4YRQA 3IG2A 1H4VB 1Z7MA 2Q7GA 2ZZFA 3I7FA 3A7RA 3RACA 3PCOB 4K88A 2EJGA 3A5ZA 3V7CA 4Q15A 4P75C 1NJ5A 4YRCA 5ELOA 1H4QA 2EJ9A 1J5WA 2P5IA 1N9WA 3RUXA 1ASZA 3WQZA 4WI1A 2G4CA 3ICAA 4YROA 2E3CA 1HC7A 5E3IA 4P72A 3HY0A 4LVKA 3E9IA 2J3MA 4LVIA 5F5WA 1ATIA 4XTZA 1ASYA 2ZIMA 1WQWA 2CJAA 2E64A 3TEGA 2ODRC 2Q7EA 4YRTA 4YRFA 3RKWA 3DSQA 1B8AA 4HWPA 2FYKA 1SRYA 4HWRA 3HFZA 3HXUA 3UGTA 1X56A 4P71C 4LVMA 1X2HA 4TQDA 4XU2A 4EO4A 1LYLA 5C52B 4YRJA 3UH0A 4CS4A 4YRGA 2ARTA 2QHUA 2ARUA 1ADYA 3V7RA 3VQYA 2I4OA 4H2TA 3NENA 3RKXA 1VQZA 3A7UA 2ZIOA 4P72C 1JJCA 4YREA 3BJUA 1Z7NA 2EWNA 2CJBA 4YRNA 1X2GA 4TTVA 2DKGA 4XTUA 4YPFA 3V7SA 4YCVA 4P73A 3RKYA 4TVAA 3HXXA 4P73C 2C7IA 2E1HA 4UP8A 4LVJA 4DQ2A 1EFWA 1SETA 3IALA 4CS2A 3EFRA 1BBUA 2RHSA 2AMCA 4RQFA 1QE0A 3QO7A 1SERA 4G84A 1L0WA 1GGMA 4X5OA 3QO8A 4TWAA 5K1XA 2EL9A 2QHVA 2ZINA 1WPYA 4UPAA 3REXA 3P8VA 4HWTA 1RIQA 2E41A 2Q7HA 4XTYA 2ZCEA 4YCWA 1PYSB 5C53B 1QF6A 4XU3A 2ARSA 3RIRA 4KQEA 4XTXA 4XU0A 4PHCA 3P8YA 2ALYB 1YFTA 2DU7A 2ODRD 12ASA 3VQVA 2ZR3A 4XTVA 4CS3A
chains in the Genus database with same CATH topology
3V8LA 1X54A 2DTHA 3ERRA 4YRKA 2DQ0A 3NEMA 4HWSA 2ZT8A 3UFGA 1YB3A 3MF2A 1EVLA 4RDXA 2DVEA 1B70A 3RL6A 4P71A 2ZT6A 1G5HA 4KR2A 3HRIA 4TQFA 3IKLA 2ALYA 3EFSA 4UP9A 3HTZA 2XTIA 4BW9A 1NJ2A 4P3OA 3UGQA 1WQ7A 4XTWA 2I4NA 4YRLA 2J3LA 4P74C 5C51B 4YRMA 4YRSA 3HXVA 4YRPA 3HXYA 1E1TA 3MEYA 1NJ6A 4AH6A 4DPGA 2DQ3A 3LSSA 4KR3A 2ZZEA 3R07A 1WU7A 2ZR2A 2CGHA 3NETA 4NCXA 1B7YA 2ZXFA 4CH4A 11ASA 4OLFA 2RHQA 4H2XB 4HT4A 3VBBA 1EVKA 2ZNJA 3E9HA 2ZZGA 4XEOA 4PG3A 2A8EA 1JJCB 3OD1A 1KMMA 4YRRA 4L87A 2EJFA 3BFMA 3QO5A 3L4GA 4P3NA 1IL2A 4ZTUB 4Q6GA 4K86A 1X55A 4HWOA 3M4PA 4E51A 4WJ4A 4LVLA 2Q5HA 2IY5B 1X01A 3L1AA 1USYC 1B7YB 3NELA 4YYEA 2IY5A 2AKWB 3MQZA 2DJZA 1G51A 4LNSA 2AMCB 2AKWA 2C8MA 3HXWA 3RF1A 4TVYA 1W66A 2PMEA 4UP7A 2ZGWA 3M4QA 3PZCA 1YFRA 4OP0A 3FJPA 3HFZB 3A7AA 4TVAB 1NYQA 3V8JA 1B76A 2ZTGA 1E1OA 1PYSA 1FYFA 1NJ8A 2ZT7A 2DU5A 2QHSA 2CIMA 1H4TA 1NJ1A 2XGTA 2DDZA 4H2UA 2CJ9A 4H02A 1H4SA 3A5YA 4CH5A 1EOVA 3KFUA 2RHSB 2HNIA 1BIAA 3IKMB 3LSQA 4WJ3M 4XEMA 2E65A 3L2ZA 5ELNA 1G5IA 2DXUA 3P8TA 4J15A 2DZCA 1BIBA 4CH3A 3A31A 1HXDA 1WLEA 3MF1A 1SESA 4HVCA 3TUPA 2I4LA 4WF2A 2DTIA 3V8KA 1WYDA 1YFSA 1KMNA 3HRKA 1WNLA 2EAYA 2ZT5A 2ZNIA 1C0AA 4BWAA 4H2WA 4ZTZB 1EIYA 4CH6A 4K87A 3QNEA 2QHTA 1EIYB 2E10A 3RGLA 4H2SA 3HFVA 4EX5A 4YP0A 5HGQA 1HTTA 2DTOA 2Q5IA 3TEHB 3TEHA 4P3PA 4H2YA 5KNNA 1USYA 4ZIBA 4RQEA 2DZ9A 3VQXA 3G1ZA 2NS6A 1YGBA 2I4MA 4P74A 1KOGA 4H2VA 2RHQB 4H2XA 2PMFA 3LC0A 3W3SA 1ADJA 3PCOA 4YRIA 1NYRA 3HXZA 2DEQA 4YCUA 3HY1A 1BBWA 1E24A 3CMQA 3REUA 4XU1A 1NNHA 3A32A 2P0LA 3VQWA 3L4GB 4O2DA 3QTCA 1B70B 4G85A 1E22A 4HA8A 1EQRA 4RMFA 4YDQA 5K1PA 4TVWA 2DXTA 4P75A 3A74A 2E5AA 4YRQA 3IG2A 1H4VB 1Z7MA 2Q7GA 2ZZFA 3I7FA 3A7RA 3RACA 3PCOB 4K88A 2EJGA 3A5ZA 3V7CA 4Q15A 4P75C 1NJ5A 4YRCA 5ELOA 1H4QA 2EJ9A 1J5WA 2P5IA 1N9WA 3RUXA 1ASZA 3WQZA 4WI1A 2G4CA 3ICAA 4YROA 2E3CA 1HC7A 5E3IA 4P72A 3HY0A 4LVKA 3E9IA 2J3MA 4LVIA 5F5WA 1ATIA 4XTZA 1ASYA 2ZIMA 1WQWA 2CJAA 2E64A 3TEGA 2ODRC 2Q7EA 4YRTA 4YRFA 3RKWA 3DSQA 1B8AA 4HWPA 2FYKA 1SRYA 4HWRA 3HFZA 3HXUA 3UGTA 1X56A 4P71C 4LVMA 1X2HA 4TQDA 4XU2A 4EO4A 1LYLA 5C52B 4YRJA 3UH0A 4CS4A 4YRGA 2ARTA 2QHUA 2ARUA 1ADYA 3V7RA 3VQYA 2I4OA 4H2TA 3NENA 3RKXA 1VQZA 3A7UA 2ZIOA 4P72C 1JJCA 4YREA 3BJUA 1Z7NA 2EWNA 2CJBA 4YRNA 1X2GA 4TTVA 2DKGA 4XTUA 4YPFA 3V7SA 4YCVA 4P73A 3RKYA 4TVAA 3HXXA 4P73C 2C7IA 2E1HA 4UP8A 4LVJA 4DQ2A 1EFWA 1SETA 3IALA 4CS2A 3EFRA 1BBUA 2RHSA 2AMCA 4RQFA 1QE0A 3QO7A 1SERA 4G84A 1L0WA 1GGMA 4X5OA 3QO8A 4TWAA 5K1XA 2EL9A 2QHVA 2ZINA 1WPYA 4UPAA 3REXA 3P8VA 4HWTA 1RIQA 2E41A 2Q7HA 4XTYA 2ZCEA 4YCWA 1PYSB 5C53B 1QF6A 4XU3A 2ARSA 3RIRA 4KQEA 4XTXA 4XU0A 4PHCA 3P8YA 2ALYB 1YFTA 2DU7A 2ODRD 12ASA 3VQVA 2ZR3A 4XTVA 4CS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8L A;  1X54 A;  2DTH A;  3ERR A;  4YRK A;  2DQ0 A;  3NEM A;  4HWS A;  2ZT8 A;  3UFG A;  1YB3 A;  3MF2 A;  1EVL A;  4RDX A;  2DVE A;  1B70 A;  3RL6 A;  4P71 A;  2ZT6 A;  1G5H A;  4KR2 A;  3HRI A;  4TQF A;  3IKL A;  2ALY A;  3EFS A;  4UP9 A;  3HTZ A;  2XTI A;  4BW9 A;  1NJ2 A;  4P3O A;  3UGQ A;  1WQ7 A;  4XTW A;  2I4N A;  4YRL A;  2J3L A;  4P74 C;  5C51 B;  4YRM A;  4YRS A;  3HXV A;  4YRP A;  3HXY A;  1E1T A;  3MEY A;  1NJ6 A;  4AH6 A;  4DPG A;  2DQ3 A;  3LSS A;  4KR3 A;  2ZZE A;  3R07 A;  1WU7 A;  2ZR2 A;  2CGH A;  3NET A;  4NCX A;  1B7Y A;  2ZXF A;  4CH4 A;  11AS A;  4OLF A;  2RHQ A;  4H2X B;  3VBB A;  1EVK A;  2ZNJ A;  3E9H A;  2ZZG A;  4XEO A;  4PG3 A;  1JJC B;  3OD1 A;  1KMM A;  4YRR A;  4L87 A;  2EJF A;  3BFM A;  3QO5 A;  3L4G A;  4P3N A;  1IL2 A;  4ZTU B;  4Q6G A;  4K86 A;  1X55 A;  4HWO A;  3M4P A;  4E51 A;  4WJ4 A;  2Q5H A;  2IY5 B;  1X01 A;  3L1A A;  1USY C;  1B7Y B;  3NEL A;  4YYE A;  2IY5 A;  2AKW B;  2DJZ A;  1G51 A;  4LNS A;  2AMC B;  2AKW A;  2C8M A;  3HXW A;  3RF1 A;  4TVY A;  1W66 A;  2PME A;  4UP7 A;  2ZGW A;  3M4Q A;  3PZC A;  1YFR A;  4OP0 A;  3FJP A;  3HFZ B;  3A7A A;  4TVA B;  1NYQ A;  3V8J A;  1B76 A;  2ZTG A;  1E1O A;  1PYS A;  1FYF A;  1NJ8 A;  2ZT7 A;  2DU5 A;  2QHS A;  2CIM A;  1H4T A;  1NJ1 A;  2XGT A;  2DDZ A;  4H2U A;  2CJ9 A;  4H02 A;  1H4S A;  3A5Y A;  4CH5 A;  1EOV A;  3KFU A;  2RHS B;  2HNI A;  1BIA A;  3IKM B;  3LSQ A;  4WJ3 M;  4XEM A;  2E65 A;  3L2Z A;  5ELN A;  1G5I A;  2DXU A;  3P8T A;  4J15 A;  2DZC A;  1BIB A;  4CH3 A;  3A31 A;  1HXD A;  1WLE A;  3MF1 A;  1SES A;  4HVC A;  3TUP A;  2I4L A;  4WF2 A;  2DTI A;  3V8K A;  1WYD A;  1YFS A;  1KMN A;  3HRK A;  1WNL A;  2EAY A;  2ZT5 A;  2ZNI A;  1C0A A;  4BWA A;  4H2W A;  4ZTZ B;  1EIY A;  4CH6 A;  4K87 A;  3QNE A;  2QHT A;  1EIY B;  2E10 A;  3RGL A;  4H2S A;  3HFV A;  4EX5 A;  4YP0 A;  5HGQ A;  1HTT A;  2DTO A;  2Q5I A;  3TEH B;  3TEH A;  4P3P A;  4H2Y A;  5KNN A;  1USY A;  4ZIB A;  4RQE A;  2DZ9 A;  3VQX A;  3G1Z A;  1YGB A;  2I4M A;  4P74 A;  1KOG A;  4H2V A;  2RHQ B;  4H2X A;  2PMF A;  3LC0 A;  3W3S A;  1ADJ A;  3PCO A;  4YRI A;  1NYR A;  3HXZ A;  2DEQ A;  4YCU A;  3HY1 A;  1BBW A;  1E24 A;  3CMQ A;  3REU A;  4XU1 A;  1NNH A;  3A32 A;  2P0L A;  3VQW A;  3L4G B;  4O2D A;  3QTC A;  1B70 B;  4G85 A;  1E22 A;  4HA8 A;  1EQR A;  4RMF A;  4YDQ A;  5K1P A;  4TVW A;  2DXT A;  4P75 A;  3A74 A;  2E5A A;  4YRQ A;  3IG2 A;  1H4V B;  1Z7M A;  2Q7G A;  2ZZF A;  3I7F A;  3A7R A;  3RAC A;  3PCO B;  4K88 A;  2EJG A;  3A5Z A;  3V7C A;  4Q15 A;  4P75 C;  1NJ5 A;  4YRC A;  5ELO A;  1H4Q A;  2EJ9 A;  1J5W A;  2P5I A;  1N9W A;  3RUX A;  1ASZ A;  3WQZ A;  4WI1 A;  2G4C A;  3ICA A;  4YRO A;  2E3C A;  1HC7 A;  5E3I A;  4P72 A;  3HY0 A;  3E9I A;  2J3M A;  5F5W A;  1ATI A;  4XTZ A;  1ASY A;  2ZIM A;  1WQW A;  2CJA A;  2E64 A;  3TEG A;  2ODR C;  2Q7E A;  4YRT A;  4YRF A;  3RKW A;  3DSQ A;  1B8A A;  4HWP A;  2FYK A;  1SRY A;  4HWR A;  3HFZ A;  3HXU A;  3UGT A;  1X56 A;  4P71 C;  1X2H A;  4TQD A;  4XU2 A;  4EO4 A;  1LYL A;  5C52 B;  4YRJ A;  3UH0 A;  4CS4 A;  4YRG A;  2ART A;  2QHU A;  2ARU A;  1ADY A;  3V7R A;  3VQY A;  2I4O A;  4H2T A;  3NEN A;  3RKX A;  1VQZ A;  3A7U A;  2ZIO A;  4P72 C;  1JJC A;  4YRE A;  3BJU A;  1Z7N A;  2EWN A;  2CJB A;  4YRN A;  1X2G A;  4TTV A;  2DKG A;  4XTU A;  4YPF A;  3V7S A;  4YCV A;  4P73 A;  3RKY A;  4TVA A;  3HXX A;  4P73 C;  2C7I A;  2E1H A;  4UP8 A;  4DQ2 A;  1EFW A;  1SET A;  3IAL A;  4CS2 A;  3EFR A;  1BBU A;  2RHS A;  2AMC A;  4RQF A;  1QE0 A;  3QO7 A;  1SER A;  4G84 A;  1L0W A;  1GGM A;  4X5O A;  3QO8 A;  4TWA A;  5K1X A;  2EL9 A;  2QHV A;  2ZIN A;  1WPY A;  4UPA A;  3REX A;  3P8V A;  4HWT A;  1RIQ A;  2E41 A;  2Q7H A;  4XTY A;  2ZCE A;  4YCW A;  1PYS B;  5C53 B;  1QF6 A;  4XU3 A;  2ARS A;  3RIR A;  4KQE A;  4XTX A;  4XU0 A;  4PHC A;  3P8Y A;  2ALY B;  1YFT A;  2DU7 A;  2ODR D;  12AS A;  3VQV A;  2ZR3 A;  4XTV A;  4CS3 A; 
#chains in the Genus database with same CATH topology
 3V8L A;  1X54 A;  2DTH A;  3ERR A;  4YRK A;  2DQ0 A;  3NEM A;  4HWS A;  2ZT8 A;  3UFG A;  1YB3 A;  3MF2 A;  1EVL A;  4RDX A;  2DVE A;  1B70 A;  3RL6 A;  4P71 A;  2ZT6 A;  1G5H A;  4KR2 A;  3HRI A;  4TQF A;  3IKL A;  2ALY A;  3EFS A;  4UP9 A;  3HTZ A;  2XTI A;  4BW9 A;  1NJ2 A;  4P3O A;  3UGQ A;  1WQ7 A;  4XTW A;  2I4N A;  4YRL A;  2J3L A;  4P74 C;  5C51 B;  4YRM A;  4YRS A;  3HXV A;  4YRP A;  3HXY A;  1E1T A;  3MEY A;  1NJ6 A;  4AH6 A;  4DPG A;  2DQ3 A;  3LSS A;  4KR3 A;  2ZZE A;  3R07 A;  1WU7 A;  2ZR2 A;  2CGH A;  3NET A;  4NCX A;  1B7Y A;  2ZXF A;  4CH4 A;  11AS A;  4OLF A;  2RHQ A;  4H2X B;  4HT4 A;  3VBB A;  1EVK A;  2ZNJ A;  3E9H A;  2ZZG A;  4XEO A;  4PG3 A;  2A8E A;  1JJC B;  3OD1 A;  1KMM A;  4YRR A;  4L87 A;  2EJF A;  3BFM A;  3QO5 A;  3L4G A;  4P3N A;  1IL2 A;  4ZTU B;  4Q6G A;  4K86 A;  1X55 A;  4HWO A;  3M4P A;  4E51 A;  4WJ4 A;  4LVL A;  2Q5H A;  2IY5 B;  1X01 A;  3L1A A;  1USY C;  1B7Y B;  3NEL A;  4YYE A;  2IY5 A;  2AKW B;  3MQZ A;  2DJZ A;  1G51 A;  4LNS A;  2AMC B;  2AKW A;  2C8M A;  3HXW A;  3RF1 A;  4TVY A;  1W66 A;  2PME A;  4UP7 A;  2ZGW A;  3M4Q A;  3PZC A;  1YFR A;  4OP0 A;  3FJP A;  3HFZ B;  3A7A A;  4TVA B;  1NYQ A;  3V8J A;  1B76 A;  2ZTG A;  1E1O A;  1PYS A;  1FYF A;  1NJ8 A;  2ZT7 A;  2DU5 A;  2QHS A;  2CIM A;  1H4T A;  1NJ1 A;  2XGT A;  2DDZ A;  4H2U A;  2CJ9 A;  4H02 A;  1H4S A;  3A5Y A;  4CH5 A;  1EOV A;  3KFU A;  2RHS B;  2HNI A;  1BIA A;  3IKM B;  3LSQ A;  4WJ3 M;  4XEM A;  2E65 A;  3L2Z A;  5ELN A;  1G5I A;  2DXU A;  3P8T A;  4J15 A;  2DZC A;  1BIB A;  4CH3 A;  3A31 A;  1HXD A;  1WLE A;  3MF1 A;  1SES A;  4HVC A;  3TUP A;  2I4L A;  4WF2 A;  2DTI A;  3V8K A;  1WYD A;  1YFS A;  1KMN A;  3HRK A;  1WNL A;  2EAY A;  2ZT5 A;  2ZNI A;  1C0A A;  4BWA A;  4H2W A;  4ZTZ B;  1EIY A;  4CH6 A;  4K87 A;  3QNE A;  2QHT A;  1EIY B;  2E10 A;  3RGL A;  4H2S A;  3HFV A;  4EX5 A;  4YP0 A;  5HGQ A;  1HTT A;  2DTO A;  2Q5I A;  3TEH B;  3TEH A;  4P3P A;  4H2Y A;  5KNN A;  1USY A;  4ZIB A;  4RQE A;  2DZ9 A;  3VQX A;  3G1Z A;  2NS6 A;  1YGB A;  2I4M A;  4P74 A;  1KOG A;  4H2V A;  2RHQ B;  4H2X A;  2PMF A;  3LC0 A;  3W3S A;  1ADJ A;  3PCO A;  4YRI A;  1NYR A;  3HXZ A;  2DEQ A;  4YCU A;  3HY1 A;  1BBW A;  1E24 A;  3CMQ A;  3REU A;  4XU1 A;  1NNH A;  3A32 A;  2P0L A;  3VQW A;  3L4G B;  4O2D A;  3QTC A;  1B70 B;  4G85 A;  1E22 A;  4HA8 A;  1EQR A;  4RMF A;  4YDQ A;  5K1P A;  4TVW A;  2DXT A;  4P75 A;  3A74 A;  2E5A A;  4YRQ A;  3IG2 A;  1H4V B;  1Z7M A;  2Q7G A;  2ZZF A;  3I7F A;  3A7R A;  3RAC A;  3PCO B;  4K88 A;  2EJG A;  3A5Z A;  3V7C A;  4Q15 A;  4P75 C;  1NJ5 A;  4YRC A;  5ELO A;  1H4Q A;  2EJ9 A;  1J5W A;  2P5I A;  1N9W A;  3RUX A;  1ASZ A;  3WQZ A;  4WI1 A;  2G4C A;  3ICA A;  4YRO A;  2E3C A;  1HC7 A;  5E3I A;  4P72 A;  3HY0 A;  4LVK A;  3E9I A;  2J3M A;  4LVI A;  5F5W A;  1ATI A;  4XTZ A;  1ASY A;  2ZIM A;  1WQW A;  2CJA A;  2E64 A;  3TEG A;  2ODR C;  2Q7E A;  4YRT A;  4YRF A;  3RKW A;  3DSQ A;  1B8A A;  4HWP A;  2FYK A;  1SRY A;  4HWR A;  3HFZ A;  3HXU A;  3UGT A;  1X56 A;  4P71 C;  4LVM A;  1X2H A;  4TQD A;  4XU2 A;  4EO4 A;  1LYL A;  5C52 B;  4YRJ A;  3UH0 A;  4CS4 A;  4YRG A;  2ART A;  2QHU A;  2ARU A;  1ADY A;  3V7R A;  3VQY A;  2I4O A;  4H2T A;  3NEN A;  3RKX A;  1VQZ A;  3A7U A;  2ZIO A;  4P72 C;  1JJC A;  4YRE A;  3BJU A;  1Z7N A;  2EWN A;  2CJB A;  4YRN A;  1X2G A;  4TTV A;  2DKG A;  4XTU A;  4YPF A;  3V7S A;  4YCV A;  4P73 A;  3RKY A;  4TVA A;  3HXX A;  4P73 C;  2C7I A;  2E1H A;  4UP8 A;  4LVJ A;  4DQ2 A;  1EFW A;  1SET A;  3IAL A;  4CS2 A;  3EFR A;  1BBU A;  2RHS A;  2AMC A;  4RQF A;  1QE0 A;  3QO7 A;  1SER A;  4G84 A;  1L0W A;  1GGM A;  4X5O A;  3QO8 A;  4TWA A;  5K1X A;  2EL9 A;  2QHV A;  2ZIN A;  1WPY A;  4UPA A;  3REX A;  3P8V A;  4HWT A;  1RIQ A;  2E41 A;  2Q7H A;  4XTY A;  2ZCE A;  4YCW A;  1PYS B;  5C53 B;  1QF6 A;  4XU3 A;  2ARS A;  3RIR A;  4KQE A;  4XTX A;  4XU0 A;  4PHC A;  3P8Y A;  2ALY B;  1YFT A;  2DU7 A;  2ODR D;  12AS A;  3VQV A;  2ZR3 A;  4XTV A;  4CS3 A; 
#chains in the Genus database with same CATH homology
 3V8L A;  1X54 A;  2DTH A;  3ERR A;  4YRK A;  2DQ0 A;  3NEM A;  4HWS A;  2ZT8 A;  3UFG A;  1YB3 A;  3MF2 A;  1EVL A;  4RDX A;  2DVE A;  1B70 A;  3RL6 A;  4P71 A;  2ZT6 A;  1G5H A;  4KR2 A;  3HRI A;  4TQF A;  3IKL A;  2ALY A;  3EFS A;  4UP9 A;  3HTZ A;  2XTI A;  4BW9 A;  1NJ2 A;  4P3O A;  3UGQ A;  1WQ7 A;  4XTW A;  2I4N A;  4YRL A;  2J3L A;  4P74 C;  5C51 B;  4YRM A;  4YRS A;  3HXV A;  4YRP A;  3HXY A;  1E1T A;  3MEY A;  1NJ6 A;  4AH6 A;  4DPG A;  2DQ3 A;  3LSS A;  4KR3 A;  2ZZE A;  3R07 A;  1WU7 A;  2ZR2 A;  2CGH A;  3NET A;  4NCX A;  1B7Y A;  2ZXF A;  4CH4 A;  11AS A;  4OLF A;  2RHQ A;  4H2X B;  4HT4 A;  3VBB A;  1EVK A;  2ZNJ A;  3E9H A;  2ZZG A;  4XEO A;  4PG3 A;  2A8E A;  1JJC B;  3OD1 A;  1KMM A;  4YRR A;  4L87 A;  2EJF A;  3BFM A;  3QO5 A;  3L4G A;  4P3N A;  1IL2 A;  4ZTU B;  4Q6G A;  4K86 A;  1X55 A;  4HWO A;  3M4P A;  4E51 A;  4WJ4 A;  4LVL A;  2Q5H A;  2IY5 B;  1X01 A;  3L1A A;  1USY C;  1B7Y B;  3NEL A;  4YYE A;  2IY5 A;  2AKW B;  3MQZ A;  2DJZ A;  1G51 A;  4LNS A;  2AMC B;  2AKW A;  2C8M A;  3HXW A;  3RF1 A;  4TVY A;  1W66 A;  2PME A;  4UP7 A;  2ZGW A;  3M4Q A;  3PZC A;  1YFR A;  4OP0 A;  3FJP A;  3HFZ B;  3A7A A;  4TVA B;  1NYQ A;  3V8J A;  1B76 A;  2ZTG A;  1E1O A;  1PYS A;  1FYF A;  1NJ8 A;  2ZT7 A;  2DU5 A;  2QHS A;  2CIM A;  1H4T A;  1NJ1 A;  2XGT A;  2DDZ A;  4H2U A;  2CJ9 A;  4H02 A;  1H4S A;  3A5Y A;  4CH5 A;  1EOV A;  3KFU A;  2RHS B;  2HNI A;  1BIA A;  3IKM B;  3LSQ A;  4WJ3 M;  4XEM A;  2E65 A;  3L2Z A;  5ELN A;  1G5I A;  2DXU A;  3P8T A;  4J15 A;  2DZC A;  1BIB A;  4CH3 A;  3A31 A;  1HXD A;  1WLE A;  3MF1 A;  1SES A;  4HVC A;  3TUP A;  2I4L A;  4WF2 A;  2DTI A;  3V8K A;  1WYD A;  1YFS A;  1KMN A;  3HRK A;  1WNL A;  2EAY A;  2ZT5 A;  2ZNI A;  1C0A A;  4BWA A;  4H2W A;  4ZTZ B;  1EIY A;  4CH6 A;  4K87 A;  3QNE A;  2QHT A;  1EIY B;  2E10 A;  3RGL A;  4H2S A;  3HFV A;  4EX5 A;  4YP0 A;  5HGQ A;  1HTT A;  2DTO A;  2Q5I A;  3TEH B;  3TEH A;  4P3P A;  4H2Y A;  5KNN A;  1USY A;  4ZIB A;  4RQE A;  2DZ9 A;  3VQX A;  3G1Z A;  2NS6 A;  1YGB A;  2I4M A;  4P74 A;  1KOG A;  4H2V A;  2RHQ B;  4H2X A;  2PMF A;  3LC0 A;  3W3S A;  1ADJ A;  3PCO A;  4YRI A;  1NYR A;  3HXZ A;  2DEQ A;  4YCU A;  3HY1 A;  1BBW A;  1E24 A;  3CMQ A;  3REU A;  4XU1 A;  1NNH A;  3A32 A;  2P0L A;  3VQW A;  3L4G B;  4O2D A;  3QTC A;  1B70 B;  4G85 A;  1E22 A;  4HA8 A;  1EQR A;  4RMF A;  4YDQ A;  5K1P A;  4TVW A;  2DXT A;  4P75 A;  3A74 A;  2E5A A;  4YRQ A;  3IG2 A;  1H4V B;  1Z7M A;  2Q7G A;  2ZZF A;  3I7F A;  3A7R A;  3RAC A;  3PCO B;  4K88 A;  2EJG A;  3A5Z A;  3V7C A;  4Q15 A;  4P75 C;  1NJ5 A;  4YRC A;  5ELO A;  1H4Q A;  2EJ9 A;  1J5W A;  2P5I A;  1N9W A;  3RUX A;  1ASZ A;  3WQZ A;  4WI1 A;  2G4C A;  3ICA A;  4YRO A;  2E3C A;  1HC7 A;  5E3I A;  4P72 A;  3HY0 A;  4LVK A;  3E9I A;  2J3M A;  4LVI A;  5F5W A;  1ATI A;  4XTZ A;  1ASY A;  2ZIM A;  1WQW A;  2CJA A;  2E64 A;  3TEG A;  2ODR C;  2Q7E A;  4YRT A;  4YRF A;  3RKW A;  3DSQ A;  1B8A A;  4HWP A;  2FYK A;  1SRY A;  4HWR A;  3HFZ A;  3HXU A;  3UGT A;  1X56 A;  4P71 C;  4LVM A;  1X2H A;  4TQD A;  4XU2 A;  4EO4 A;  1LYL A;  5C52 B;  4YRJ A;  3UH0 A;  4CS4 A;  4YRG A;  2ART A;  2QHU A;  2ARU A;  1ADY A;  3V7R A;  3VQY A;  2I4O A;  4H2T A;  3NEN A;  3RKX A;  1VQZ A;  3A7U A;  2ZIO A;  4P72 C;  1JJC A;  4YRE A;  3BJU A;  1Z7N A;  2EWN A;  2CJB A;  4YRN A;  1X2G A;  4TTV A;  2DKG A;  4XTU A;  4YPF A;  3V7S A;  4YCV A;  4P73 A;  3RKY A;  4TVA A;  3HXX A;  4P73 C;  2C7I A;  2E1H A;  4UP8 A;  4LVJ A;  4DQ2 A;  1EFW A;  1SET A;  3IAL A;  4CS2 A;  3EFR A;  1BBU A;  2RHS A;  2AMC A;  4RQF A;  1QE0 A;  3QO7 A;  1SER A;  4G84 A;  1L0W A;  1GGM A;  4X5O A;  3QO8 A;  4TWA A;  5K1X A;  2EL9 A;  2QHV A;  2ZIN A;  1WPY A;  4UPA A;  3REX A;  3P8V A;  4HWT A;  1RIQ A;  2E41 A;  2Q7H A;  4XTY A;  2ZCE A;  4YCW A;  1PYS B;  5C53 B;  1QF6 A;  4XU3 A;  2ARS A;  3RIR A;  4KQE A;  4XTX A;  4XU0 A;  4PHC A;  3P8Y A;  2ALY B;  1YFT A;  2DU7 A;  2ODR D;  12AS A;  3VQV A;  2ZR3 A;  4XTV A;  4CS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...