2QHUA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhuA01
1X54A 3L2ZA 3REUA 4RDXA 1WQWA 2PMEA 2P5IA 4P74A 2ARSA 4YROA 3W3SA 2RHSB 3PZCA 1WU7A 3TUPA 1W66A 2CJBA 3TEGA 1YB3A 1BBUA 4XU0A 1WNLA 2C8MA 2CJ9A 1YFRA 2J3LA 1ATIA 1NNHA 2AKWB 3REXA 4YRKA 3VQVA 1G5IA 3ICAA 1ADYA 4K88A 3V8LA 3NELA 4UP7A 3PCOB 5K1PA 1X2GA 2ZINA 4HWPA 3KFUA 3E9HA 2ZT8A 4K86A 2ZGWA 4ZTZB 3MF2A 3HFZA 1QF6A 2QHSA 4H2VA 3HXWA 2ALYB 3RGLA 1B70A 4HA8A 1B76A 1WYDA 2EJFA 1SRYA 3TEHA 1NYQA 4YCVA 4YDQA 1X2HA 2ZT6A 4H2WA 3UH0A 2ZNIA 1NJ6A 2EAYA 4P71A 3WQZA 2EJ9A 2E65A 4BW9A 1H4QA 4ZIBA 2AMCB 3IG2A 1QE0A 3NENA 4TWAA 3EFSA 2E1HA 1JJCA 4P75C 4H02A 3G1ZA 1NJ1A 3RL6A 1GGMA 3R07A 2PMFA 1G5HA 3RKXA 4P71C 2QHUA 2ZZEA 2RHSA 2ODRD 1JJCB 3MEYA 2EWNA 4ZTUB 4UPAA 4RQEA 1EIYA 4TVAA 1E1OA 4CH4A 2AMCA 3BFMA 4EO4A 3L4GA 1HXDA 2E41A 4HWOA 3QO7A 4PHCA 4XU1A 1FYFA 4P72C 1PYSA 2P0LA 2ZZFA 4E51A 5F5WA 2DTHA 3VQYA 4TQFA 3M4PA 4HWSA 2ARUA 4YRNA 4YRLA 4H2XB 4WJ3M 4J15A 1H4TA 2ARTA 4YRCA 3HRIA 1B70B 11ASA 4WJ4A 3VBBA 1SESA 4YRRA 4LNSA 4XTZA 1N9WA 3EFRA 4BWAA 4XTXA 3V8KA 1G51A 1KMNA 3UGQA 3A31A 4TVAB 1EVKA 2Q5HA 4HVCA 4P3NA 1KMMA 4DPGA 4YYEA 2IY5A 3RUXA 3QTCA 3PCOA 4P73C 3OD1A 2E64A 1BIBA 3IALA 4P3PA 2E3CA 2ZNJA 3QNEA 4CS3A 3V8JA 3HFVA 4YRFA 2XTIA 3UGTA 4XU3A 1YFSA 1BIAA 2J3MA 3I7FA 4X5OA 4P75A 2I4LA 2XGTA 4EX5A 1BBWA 3HXVA 3RACA 3CMQA 4Q6GA 4RMFA 3E9IA 3A74A 3ERRA 2IY5B 4KR2A 4K87A 4H2UA 1WPYA 3HY1A 4CH3A 3P8TA 2Q7GA 1E24A 1Z7NA 1H4VB 2DXUA 1SETA 3BJUA 1L0WA 3RIRA 1X56A 4DQ2A 4YP0A 2DKGA 3MF1A 2DEQA 2ZR2A 1EQRA 3LSQA 1X01A 1PYSB 2I4OA 1LYLA 1USYA 4WF2A 2QHVA 4XTUA 2ZXFA 3RKWA 4HWRA 2ZIOA 2ALYA 3A5ZA 3IKMB 1ASYA 4G84A 3LSSA 5ELOA 2ZZGA 1B7YB 3HFZB 1ASZA 4H2SA 3V7SA 4YRGA 1EIYB 2RHQB 2QHTA 2DTIA 2I4MA 2DU5A 2Q5IA 3L4GB 3VQXA 2DTOA 2EJGA 2DZ9A 5ELNA 1NJ2A 4KQEA 3LC0A 3HTZA 4YPFA 2ZTGA 3IKLA 4AH6A 2FYKA 3FJPA 2AKWA 3V7RA 1B8AA 4G85A 2DU7A 2E10A 3A5YA 4XTVA 2DZCA 4YRPA 3HY0A 4O2DA 3VQWA 3A32A 3QO5A 4KR3A 4H2TA 2DVEA 2DJZA 1X55A 2C7IA 2CJAA 3A7AA 4XEOA 4XTYA 2DXTA 4PG3A 3L1AA 2Q7HA 1H4SA 4TTVA 4YCUA 4YRMA 4P73A 4P74C 2DQ0A 1J5WA 4OP0A 2CIMA 2DDZA 2RHQA 3HRKA 4H2XA 3RKYA 1RIQA 4CH6A 1HC7A 4XTWA 3RF1A 1NYRA 4TVWA 2ZT5A 5E3IA 3HXUA 3UFGA 2ZIMA 5KNNA 4YRIA 12ASA 1E22A 3HXXA 2ODRC 4YRSA 1ADJA 2ZT7A 5C51B 4XEMA 2E5AA 4YREA 1HTTA 1EVLA 1C0AA 1NJ8A 5C52B 3NEMA 4CS2A 4HWTA 1IL2A 1USYC 3A7UA 3DSQA 4OLFA 4YRQA 4CH5A 2I4NA 2EL9A 4Q15A 5C53B 1YFTA 4TVYA 4P72A 4P3OA 1WQ7A 4RQFA 1SERA 4WI1A 3HXYA 1WLEA 3A7RA 3NETA 1EFWA 4TQDA 1EOVA 1YGBA 1VQZA 3P8YA 4UP9A 4YCWA 2ZCEA 2ZR3A 4CS4A 1B7YA 3QO8A 2HNIA 3HXZA 2CGHA 1KOGA 3TEHB 5HGQA 1Z7MA 2Q7EA 4YRTA 4L87A 2DQ3A 4YRJA 5K1XA 3P8VA 4NCXA 4UP8A 1NJ5A 3V7CA 4H2YA 3M4QA 1E1TA 4XU2A 2G4CA
chains in the Genus database with same CATH superfamily
1X54A 3L2ZA 3REUA 4RDXA 1WQWA 2PMEA 2P5IA 4P74A 2ARSA 4YROA 3W3SA 2RHSB 3PZCA 1WU7A 3TUPA 1W66A 2CJBA 3TEGA 1YB3A 1BBUA 4XU0A 1WNLA 2C8MA 2CJ9A 1YFRA 2J3LA 1ATIA 1NNHA 2AKWB 3REXA 4YRKA 3VQVA 1G5IA 3ICAA 1ADYA 4K88A 3V8LA 3NELA 4UP7A 3PCOB 5K1PA 4LVKA 1X2GA 2ZINA 4HWPA 3KFUA 3E9HA 2ZT8A 4K86A 2ZGWA 4ZTZB 3MF2A 3HFZA 1QF6A 2QHSA 4H2VA 3HXWA 2ALYB 3RGLA 1B70A 4HA8A 1B76A 1WYDA 2EJFA 1SRYA 3TEHA 1NYQA 4YCVA 4YDQA 1X2HA 2ZT6A 4H2WA 3UH0A 2ZNIA 1NJ6A 2EAYA 4P71A 3WQZA 2EJ9A 2E65A 4BW9A 4LVLA 1H4QA 4ZIBA 2AMCB 3IG2A 1QE0A 3NENA 4TWAA 3EFSA 2E1HA 1JJCA 4P75C 4H02A 3G1ZA 1NJ1A 3RL6A 1GGMA 3R07A 2PMFA 1G5HA 3RKXA 4P71C 2QHUA 2ZZEA 2RHSA 2ODRD 1JJCB 3MEYA 2EWNA 4ZTUB 4UPAA 2A8EA 4RQEA 1EIYA 4TVAA 1E1OA 4CH4A 2AMCA 3BFMA 4EO4A 3L4GA 1HXDA 2E41A 4HWOA 3QO7A 4PHCA 4XU1A 1FYFA 4P72C 1PYSA 2P0LA 2ZZFA 4E51A 5F5WA 2DTHA 3VQYA 4TQFA 3M4PA 4HWSA 2ARUA 4YRNA 4YRLA 4H2XB 4WJ3M 4J15A 1H4TA 2ARTA 4YRCA 3HRIA 1B70B 11ASA 2NS6A 4WJ4A 3VBBA 1SESA 4YRRA 4LNSA 4XTZA 1N9WA 3EFRA 4LVMA 4BWAA 4XTXA 3V8KA 1G51A 1KMNA 3UGQA 3A31A 4TVAB 1EVKA 2Q5HA 4HVCA 4P3NA 1KMMA 4DPGA 4YYEA 2IY5A 3RUXA 4HT4A 3QTCA 3PCOA 4P73C 3OD1A 2E64A 1BIBA 3IALA 4P3PA 2E3CA 2ZNJA 3QNEA 4CS3A 3V8JA 3HFVA 4YRFA 2XTIA 3UGTA 4XU3A 1YFSA 1BIAA 2J3MA 3I7FA 4X5OA 4P75A 2I4LA 2XGTA 4EX5A 1BBWA 3HXVA 3RACA 3CMQA 4Q6GA 4RMFA 3E9IA 3A74A 3ERRA 2IY5B 4KR2A 4K87A 4H2UA 1WPYA 3HY1A 4LVIA 4CH3A 3P8TA 2Q7GA 1E24A 1Z7NA 1H4VB 2DXUA 1SETA 3BJUA 1L0WA 3RIRA 1X56A 4DQ2A 4YP0A 2DKGA 3MF1A 2DEQA 2ZR2A 1EQRA 3LSQA 1X01A 1PYSB 2I4OA 1LYLA 1USYA 4WF2A 2QHVA 4XTUA 2ZXFA 3RKWA 4HWRA 4LVJA 2ZIOA 2ALYA 3A5ZA 3IKMB 1ASYA 4G84A 3LSSA 5ELOA 2ZZGA 1B7YB 3HFZB 1ASZA 4H2SA 3V7SA 4YRGA 1EIYB 2RHQB 2QHTA 2DTIA 2I4MA 2DU5A 2Q5IA 3L4GB 3VQXA 2DTOA 2EJGA 2DZ9A 5ELNA 1NJ2A 4KQEA 3LC0A 3HTZA 4YPFA 2ZTGA 3IKLA 4AH6A 2FYKA 3FJPA 3MQZA 2AKWA 3V7RA 1B8AA 4G85A 2DU7A 2E10A 3A5YA 4XTVA 2DZCA 4YRPA 3HY0A 4O2DA 3VQWA 3A32A 3QO5A 4KR3A 4H2TA 2DVEA 2DJZA 1X55A 2C7IA 2CJAA 3A7AA 4XEOA 4XTYA 2DXTA 4PG3A 3L1AA 2Q7HA 1H4SA 4TTVA 4YCUA 4YRMA 4P73A 4P74C 2DQ0A 1J5WA 4OP0A 2CIMA 2DDZA 2RHQA 3HRKA 4H2XA 3RKYA 1RIQA 4CH6A 1HC7A 4XTWA 3RF1A 1NYRA 4TVWA 2ZT5A 5E3IA 3HXUA 3UFGA 2ZIMA 5KNNA 4YRIA 12ASA 1E22A 3HXXA 2ODRC 4YRSA 1ADJA 2ZT7A 5C51B 4XEMA 2E5AA 4YREA 1HTTA 1EVLA 1C0AA 1NJ8A 5C52B 3NEMA 4CS2A 4HWTA 1IL2A 1USYC 3A7UA 3DSQA 4OLFA 4YRQA 4CH5A 2I4NA 2EL9A 4Q15A 5C53B 1YFTA 4TVYA 4P72A 4P3OA 1WQ7A 4RQFA 1SERA 4WI1A 3HXYA 1WLEA 3A7RA 3NETA 1EFWA 4TQDA 1EOVA 1YGBA 1VQZA 3P8YA 4UP9A 4YCWA 2ZCEA 2ZR3A 4CS4A 1B7YA 3QO8A 2HNIA 3HXZA 2CGHA 1KOGA 3TEHB 5HGQA 1Z7MA 2Q7EA 4YRTA 4L87A 2DQ3A 4YRJA 5K1XA 3P8VA 4NCXA 4UP8A 1NJ5A 3V7CA 4H2YA 3M4QA 1E1TA 4XU2A 2G4CA
chains in the Genus database with same CATH topology
1X54A 3L2ZA 3REUA 4RDXA 1WQWA 2PMEA 2P5IA 4P74A 2ARSA 4YROA 3W3SA 2RHSB 3PZCA 1WU7A 3TUPA 1W66A 2CJBA 3TEGA 1YB3A 1BBUA 4XU0A 1WNLA 2C8MA 2CJ9A 1YFRA 2J3LA 1ATIA 1NNHA 2AKWB 3REXA 4YRKA 3VQVA 1G5IA 3ICAA 1ADYA 4K88A 3V8LA 3NELA 4UP7A 3PCOB 5K1PA 4LVKA 1X2GA 2ZINA 4HWPA 3KFUA 3E9HA 2ZT8A 4K86A 2ZGWA 4ZTZB 3MF2A 3HFZA 1QF6A 2QHSA 4H2VA 3HXWA 2ALYB 3RGLA 1B70A 4HA8A 1B76A 1WYDA 2EJFA 1SRYA 3TEHA 1NYQA 4YCVA 4YDQA 1X2HA 2ZT6A 4H2WA 3UH0A 2ZNIA 1NJ6A 2EAYA 4P71A 3WQZA 2EJ9A 2E65A 4BW9A 4LVLA 1H4QA 4ZIBA 2AMCB 3IG2A 1QE0A 3NENA 4TWAA 3EFSA 2E1HA 1JJCA 4P75C 4H02A 3G1ZA 1NJ1A 3RL6A 1GGMA 3R07A 2PMFA 1G5HA 3RKXA 4P71C 2QHUA 2ZZEA 2RHSA 2ODRD 1JJCB 3MEYA 2EWNA 4ZTUB 4UPAA 2A8EA 4RQEA 1EIYA 4TVAA 1E1OA 4CH4A 2AMCA 3BFMA 4EO4A 3L4GA 1HXDA 2E41A 4HWOA 3QO7A 4PHCA 4XU1A 1FYFA 4P72C 1PYSA 2P0LA 2ZZFA 4E51A 5F5WA 2DTHA 3VQYA 4TQFA 3M4PA 4HWSA 2ARUA 4YRNA 4YRLA 4H2XB 4WJ3M 4J15A 1H4TA 2ARTA 4YRCA 3HRIA 1B70B 11ASA 2NS6A 4WJ4A 3VBBA 1SESA 4YRRA 4LNSA 4XTZA 1N9WA 3EFRA 4LVMA 4BWAA 4XTXA 3V8KA 1G51A 1KMNA 3UGQA 3A31A 4TVAB 1EVKA 2Q5HA 4HVCA 4P3NA 1KMMA 4DPGA 4YYEA 2IY5A 3RUXA 4HT4A 3QTCA 3PCOA 4P73C 3OD1A 2E64A 1BIBA 3IALA 4P3PA 2E3CA 2ZNJA 3QNEA 4CS3A 3V8JA 3HFVA 4YRFA 2XTIA 3UGTA 4XU3A 1YFSA 1BIAA 2J3MA 3I7FA 4X5OA 4P75A 2I4LA 2XGTA 4EX5A 1BBWA 3HXVA 3RACA 3CMQA 4Q6GA 4RMFA 3E9IA 3A74A 3ERRA 2IY5B 4KR2A 4K87A 4H2UA 1WPYA 3HY1A 4LVIA 4CH3A 3P8TA 2Q7GA 1E24A 1Z7NA 1H4VB 2DXUA 1SETA 3BJUA 1L0WA 3RIRA 1X56A 4DQ2A 4YP0A 2DKGA 3MF1A 2DEQA 2ZR2A 1EQRA 3LSQA 1X01A 1PYSB 2I4OA 1LYLA 1USYA 4WF2A 2QHVA 4XTUA 2ZXFA 3RKWA 4HWRA 4LVJA 2ZIOA 2ALYA 3A5ZA 3IKMB 1ASYA 4G84A 3LSSA 5ELOA 2ZZGA 1B7YB 3HFZB 1ASZA 4H2SA 3V7SA 4YRGA 1EIYB 2RHQB 2QHTA 2DTIA 2I4MA 2DU5A 2Q5IA 3L4GB 3VQXA 2DTOA 2EJGA 2DZ9A 5ELNA 1NJ2A 4KQEA 3LC0A 3HTZA 4YPFA 2ZTGA 3IKLA 4AH6A 2FYKA 3FJPA 3MQZA 2AKWA 3V7RA 1B8AA 4G85A 2DU7A 2E10A 3A5YA 4XTVA 2DZCA 4YRPA 3HY0A 4O2DA 3VQWA 3A32A 3QO5A 4KR3A 4H2TA 2DVEA 2DJZA 1X55A 2C7IA 2CJAA 3A7AA 4XEOA 4XTYA 2DXTA 4PG3A 3L1AA 2Q7HA 1H4SA 4TTVA 4YCUA 4YRMA 4P73A 4P74C 2DQ0A 1J5WA 4OP0A 2CIMA 2DDZA 2RHQA 3HRKA 4H2XA 3RKYA 1RIQA 4CH6A 1HC7A 4XTWA 3RF1A 1NYRA 4TVWA 2ZT5A 5E3IA 3HXUA 3UFGA 2ZIMA 5KNNA 4YRIA 12ASA 1E22A 3HXXA 2ODRC 4YRSA 1ADJA 2ZT7A 5C51B 4XEMA 2E5AA 4YREA 1HTTA 1EVLA 1C0AA 1NJ8A 5C52B 3NEMA 4CS2A 4HWTA 1IL2A 1USYC 3A7UA 3DSQA 4OLFA 4YRQA 4CH5A 2I4NA 2EL9A 4Q15A 5C53B 1YFTA 4TVYA 4P72A 4P3OA 1WQ7A 4RQFA 1SERA 4WI1A 3HXYA 1WLEA 3A7RA 3NETA 1EFWA 4TQDA 1EOVA 1YGBA 1VQZA 3P8YA 4UP9A 4YCWA 2ZCEA 2ZR3A 4CS4A 1B7YA 3QO8A 2HNIA 3HXZA 2CGHA 1KOGA 3TEHB 5HGQA 1Z7MA 2Q7EA 4YRTA 4L87A 2DQ3A 4YRJA 5K1XA 3P8VA 4NCXA 4UP8A 1NJ5A 3V7CA 4H2YA 3M4QA 1E1TA 4XU2A 2G4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X54 A;  3L2Z A;  3REU A;  4RDX A;  1WQW A;  2PME A;  2P5I A;  4P74 A;  2ARS A;  4YRO A;  3W3S A;  2RHS B;  3PZC A;  1WU7 A;  3TUP A;  1W66 A;  2CJB A;  3TEG A;  1YB3 A;  1BBU A;  4XU0 A;  1WNL A;  2C8M A;  2CJ9 A;  1YFR A;  2J3L A;  1ATI A;  1NNH A;  2AKW B;  3REX A;  4YRK A;  3VQV A;  1G5I A;  3ICA A;  1ADY A;  4K88 A;  3V8L A;  3NEL A;  4UP7 A;  3PCO B;  5K1P A;  1X2G A;  2ZIN A;  4HWP A;  3KFU A;  3E9H A;  2ZT8 A;  4K86 A;  2ZGW A;  4ZTZ B;  3MF2 A;  3HFZ A;  1QF6 A;  2QHS A;  4H2V A;  3HXW A;  2ALY B;  3RGL A;  1B70 A;  4HA8 A;  1B76 A;  1WYD A;  2EJF A;  1SRY A;  3TEH A;  1NYQ A;  4YCV A;  4YDQ A;  1X2H A;  2ZT6 A;  4H2W A;  3UH0 A;  2ZNI A;  1NJ6 A;  2EAY A;  4P71 A;  3WQZ A;  2EJ9 A;  2E65 A;  4BW9 A;  1H4Q A;  4ZIB A;  2AMC B;  3IG2 A;  1QE0 A;  3NEN A;  4TWA A;  3EFS A;  2E1H A;  1JJC A;  4P75 C;  4H02 A;  3G1Z A;  1NJ1 A;  3RL6 A;  1GGM A;  3R07 A;  2PMF A;  1G5H A;  3RKX A;  4P71 C;  2QHU A;  2ZZE A;  2RHS A;  2ODR D;  1JJC B;  3MEY A;  2EWN A;  4ZTU B;  4UPA A;  4RQE A;  1EIY A;  4TVA A;  1E1O A;  4CH4 A;  2AMC A;  3BFM A;  4EO4 A;  3L4G A;  1HXD A;  2E41 A;  4HWO A;  3QO7 A;  4PHC A;  4XU1 A;  1FYF A;  4P72 C;  1PYS A;  2P0L A;  2ZZF A;  4E51 A;  5F5W A;  2DTH A;  3VQY A;  4TQF A;  3M4P A;  4HWS A;  2ARU A;  4YRN A;  4YRL A;  4H2X B;  4WJ3 M;  4J15 A;  1H4T A;  2ART A;  4YRC A;  3HRI A;  1B70 B;  11AS A;  4WJ4 A;  3VBB A;  1SES A;  4YRR A;  4LNS A;  4XTZ A;  1N9W A;  3EFR A;  4BWA A;  4XTX A;  3V8K A;  1G51 A;  1KMN A;  3UGQ A;  3A31 A;  4TVA B;  1EVK A;  2Q5H A;  4HVC A;  4P3N A;  1KMM A;  4DPG A;  4YYE A;  2IY5 A;  3RUX A;  3QTC A;  3PCO A;  4P73 C;  3OD1 A;  2E64 A;  1BIB A;  3IAL A;  4P3P A;  2E3C A;  2ZNJ A;  3QNE A;  4CS3 A;  3V8J A;  3HFV A;  4YRF A;  2XTI A;  3UGT A;  4XU3 A;  1YFS A;  1BIA A;  2J3M A;  3I7F A;  4X5O A;  4P75 A;  2I4L A;  2XGT A;  4EX5 A;  1BBW A;  3HXV A;  3RAC A;  3CMQ A;  4Q6G A;  4RMF A;  3E9I A;  3A74 A;  3ERR A;  2IY5 B;  4KR2 A;  4K87 A;  4H2U A;  1WPY A;  3HY1 A;  4CH3 A;  3P8T A;  2Q7G A;  1E24 A;  1Z7N A;  1H4V B;  2DXU A;  1SET A;  3BJU A;  1L0W A;  3RIR A;  1X56 A;  4DQ2 A;  4YP0 A;  2DKG A;  3MF1 A;  2DEQ A;  2ZR2 A;  1EQR A;  3LSQ A;  1X01 A;  1PYS B;  2I4O A;  1LYL A;  1USY A;  4WF2 A;  2QHV A;  4XTU A;  2ZXF A;  3RKW A;  4HWR A;  2ZIO A;  2ALY A;  3A5Z A;  3IKM B;  1ASY A;  4G84 A;  3LSS A;  5ELO A;  2ZZG A;  1B7Y B;  3HFZ B;  1ASZ A;  4H2S A;  3V7S A;  4YRG A;  1EIY B;  2RHQ B;  2QHT A;  2DTI A;  2I4M A;  2DU5 A;  2Q5I A;  3L4G B;  3VQX A;  2DTO A;  2EJG A;  2DZ9 A;  5ELN A;  1NJ2 A;  4KQE A;  3LC0 A;  3HTZ A;  4YPF A;  2ZTG A;  3IKL A;  4AH6 A;  2FYK A;  3FJP A;  2AKW A;  3V7R A;  1B8A A;  4G85 A;  2DU7 A;  2E10 A;  3A5Y A;  4XTV A;  2DZC A;  4YRP A;  3HY0 A;  4O2D A;  3VQW A;  3A32 A;  3QO5 A;  4KR3 A;  4H2T A;  2DVE A;  2DJZ A;  1X55 A;  2C7I A;  2CJA A;  3A7A A;  4XEO A;  4XTY A;  2DXT A;  4PG3 A;  3L1A A;  2Q7H A;  1H4S A;  4TTV A;  4YCU A;  4YRM A;  4P73 A;  4P74 C;  2DQ0 A;  1J5W A;  4OP0 A;  2CIM A;  2DDZ A;  2RHQ A;  3HRK A;  4H2X A;  3RKY A;  1RIQ A;  4CH6 A;  1HC7 A;  4XTW A;  3RF1 A;  1NYR A;  4TVW A;  2ZT5 A;  5E3I A;  3HXU A;  3UFG A;  2ZIM A;  5KNN A;  4YRI A;  12AS A;  1E22 A;  3HXX A;  2ODR C;  4YRS A;  1ADJ A;  2ZT7 A;  5C51 B;  4XEM A;  2E5A A;  4YRE A;  1HTT A;  1EVL A;  1C0A A;  1NJ8 A;  5C52 B;  3NEM A;  4CS2 A;  4HWT A;  1IL2 A;  1USY C;  3A7U A;  3DSQ A;  4OLF A;  4YRQ A;  4CH5 A;  2I4N A;  2EL9 A;  4Q15 A;  5C53 B;  1YFT A;  4TVY A;  4P72 A;  4P3O A;  1WQ7 A;  4RQF A;  1SER A;  4WI1 A;  3HXY A;  1WLE A;  3A7R A;  3NET A;  1EFW A;  4TQD A;  1EOV A;  1YGB A;  1VQZ A;  3P8Y A;  4UP9 A;  4YCW A;  2ZCE A;  2ZR3 A;  4CS4 A;  1B7Y A;  3QO8 A;  2HNI A;  3HXZ A;  2CGH A;  1KOG A;  3TEH B;  5HGQ A;  1Z7M A;  2Q7E A;  4YRT A;  4L87 A;  2DQ3 A;  4YRJ A;  5K1X A;  3P8V A;  4NCX A;  4UP8 A;  1NJ5 A;  3V7C A;  4H2Y A;  3M4Q A;  1E1T A;  4XU2 A;  2G4C A; 
#chains in the Genus database with same CATH topology
 1X54 A;  3L2Z A;  3REU A;  4RDX A;  1WQW A;  2PME A;  2P5I A;  4P74 A;  2ARS A;  4YRO A;  3W3S A;  2RHS B;  3PZC A;  1WU7 A;  3TUP A;  1W66 A;  2CJB A;  3TEG A;  1YB3 A;  1BBU A;  4XU0 A;  1WNL A;  2C8M A;  2CJ9 A;  1YFR A;  2J3L A;  1ATI A;  1NNH A;  2AKW B;  3REX A;  4YRK A;  3VQV A;  1G5I A;  3ICA A;  1ADY A;  4K88 A;  3V8L A;  3NEL A;  4UP7 A;  3PCO B;  5K1P A;  4LVK A;  1X2G A;  2ZIN A;  4HWP A;  3KFU A;  3E9H A;  2ZT8 A;  4K86 A;  2ZGW A;  4ZTZ B;  3MF2 A;  3HFZ A;  1QF6 A;  2QHS A;  4H2V A;  3HXW A;  2ALY B;  3RGL A;  1B70 A;  4HA8 A;  1B76 A;  1WYD A;  2EJF A;  1SRY A;  3TEH A;  1NYQ A;  4YCV A;  4YDQ A;  1X2H A;  2ZT6 A;  4H2W A;  3UH0 A;  2ZNI A;  1NJ6 A;  2EAY A;  4P71 A;  3WQZ A;  2EJ9 A;  2E65 A;  4BW9 A;  4LVL A;  1H4Q A;  4ZIB A;  2AMC B;  3IG2 A;  1QE0 A;  3NEN A;  4TWA A;  3EFS A;  2E1H A;  1JJC A;  4P75 C;  4H02 A;  3G1Z A;  1NJ1 A;  3RL6 A;  1GGM A;  3R07 A;  2PMF A;  1G5H A;  3RKX A;  4P71 C;  2QHU A;  2ZZE A;  2RHS A;  2ODR D;  1JJC B;  3MEY A;  2EWN A;  4ZTU B;  4UPA A;  2A8E A;  4RQE A;  1EIY A;  4TVA A;  1E1O A;  4CH4 A;  2AMC A;  3BFM A;  4EO4 A;  3L4G A;  1HXD A;  2E41 A;  4HWO A;  3QO7 A;  4PHC A;  4XU1 A;  1FYF A;  4P72 C;  1PYS A;  2P0L A;  2ZZF A;  4E51 A;  5F5W A;  2DTH A;  3VQY A;  4TQF A;  3M4P A;  4HWS A;  2ARU A;  4YRN A;  4YRL A;  4H2X B;  4WJ3 M;  4J15 A;  1H4T A;  2ART A;  4YRC A;  3HRI A;  1B70 B;  11AS A;  2NS6 A;  4WJ4 A;  3VBB A;  1SES A;  4YRR A;  4LNS A;  4XTZ A;  1N9W A;  3EFR A;  4LVM A;  4BWA A;  4XTX A;  3V8K A;  1G51 A;  1KMN A;  3UGQ A;  3A31 A;  4TVA B;  1EVK A;  2Q5H A;  4HVC A;  4P3N A;  1KMM A;  4DPG A;  4YYE A;  2IY5 A;  3RUX A;  4HT4 A;  3QTC A;  3PCO A;  4P73 C;  3OD1 A;  2E64 A;  1BIB A;  3IAL A;  4P3P A;  2E3C A;  2ZNJ A;  3QNE A;  4CS3 A;  3V8J A;  3HFV A;  4YRF A;  2XTI A;  3UGT A;  4XU3 A;  1YFS A;  1BIA A;  2J3M A;  3I7F A;  4X5O A;  4P75 A;  2I4L A;  2XGT A;  4EX5 A;  1BBW A;  3HXV A;  3RAC A;  3CMQ A;  4Q6G A;  4RMF A;  3E9I A;  3A74 A;  3ERR A;  2IY5 B;  4KR2 A;  4K87 A;  4H2U A;  1WPY A;  3HY1 A;  4LVI A;  4CH3 A;  3P8T A;  2Q7G A;  1E24 A;  1Z7N A;  1H4V B;  2DXU A;  1SET A;  3BJU A;  1L0W A;  3RIR A;  1X56 A;  4DQ2 A;  4YP0 A;  2DKG A;  3MF1 A;  2DEQ A;  2ZR2 A;  1EQR A;  3LSQ A;  1X01 A;  1PYS B;  2I4O A;  1LYL A;  1USY A;  4WF2 A;  2QHV A;  4XTU A;  2ZXF A;  3RKW A;  4HWR A;  4LVJ A;  2ZIO A;  2ALY A;  3A5Z A;  3IKM B;  1ASY A;  4G84 A;  3LSS A;  5ELO A;  2ZZG A;  1B7Y B;  3HFZ B;  1ASZ A;  4H2S A;  3V7S A;  4YRG A;  1EIY B;  2RHQ B;  2QHT A;  2DTI A;  2I4M A;  2DU5 A;  2Q5I A;  3L4G B;  3VQX A;  2DTO A;  2EJG A;  2DZ9 A;  5ELN A;  1NJ2 A;  4KQE A;  3LC0 A;  3HTZ A;  4YPF A;  2ZTG A;  3IKL A;  4AH6 A;  2FYK A;  3FJP A;  3MQZ A;  2AKW A;  3V7R A;  1B8A A;  4G85 A;  2DU7 A;  2E10 A;  3A5Y A;  4XTV A;  2DZC A;  4YRP A;  3HY0 A;  4O2D A;  3VQW A;  3A32 A;  3QO5 A;  4KR3 A;  4H2T A;  2DVE A;  2DJZ A;  1X55 A;  2C7I A;  2CJA A;  3A7A A;  4XEO A;  4XTY A;  2DXT A;  4PG3 A;  3L1A A;  2Q7H A;  1H4S A;  4TTV A;  4YCU A;  4YRM A;  4P73 A;  4P74 C;  2DQ0 A;  1J5W A;  4OP0 A;  2CIM A;  2DDZ A;  2RHQ A;  3HRK A;  4H2X A;  3RKY A;  1RIQ A;  4CH6 A;  1HC7 A;  4XTW A;  3RF1 A;  1NYR A;  4TVW A;  2ZT5 A;  5E3I A;  3HXU A;  3UFG A;  2ZIM A;  5KNN A;  4YRI A;  12AS A;  1E22 A;  3HXX A;  2ODR C;  4YRS A;  1ADJ A;  2ZT7 A;  5C51 B;  4XEM A;  2E5A A;  4YRE A;  1HTT A;  1EVL A;  1C0A A;  1NJ8 A;  5C52 B;  3NEM A;  4CS2 A;  4HWT A;  1IL2 A;  1USY C;  3A7U A;  3DSQ A;  4OLF A;  4YRQ A;  4CH5 A;  2I4N A;  2EL9 A;  4Q15 A;  5C53 B;  1YFT A;  4TVY A;  4P72 A;  4P3O A;  1WQ7 A;  4RQF A;  1SER A;  4WI1 A;  3HXY A;  1WLE A;  3A7R A;  3NET A;  1EFW A;  4TQD A;  1EOV A;  1YGB A;  1VQZ A;  3P8Y A;  4UP9 A;  4YCW A;  2ZCE A;  2ZR3 A;  4CS4 A;  1B7Y A;  3QO8 A;  2HNI A;  3HXZ A;  2CGH A;  1KOG A;  3TEH B;  5HGQ A;  1Z7M A;  2Q7E A;  4YRT A;  4L87 A;  2DQ3 A;  4YRJ A;  5K1X A;  3P8V A;  4NCX A;  4UP8 A;  1NJ5 A;  3V7C A;  4H2Y A;  3M4Q A;  1E1T A;  4XU2 A;  2G4C A; 
#chains in the Genus database with same CATH homology
 1X54 A;  3L2Z A;  3REU A;  4RDX A;  1WQW A;  2PME A;  2P5I A;  4P74 A;  2ARS A;  4YRO A;  3W3S A;  2RHS B;  3PZC A;  1WU7 A;  3TUP A;  1W66 A;  2CJB A;  3TEG A;  1YB3 A;  1BBU A;  4XU0 A;  1WNL A;  2C8M A;  2CJ9 A;  1YFR A;  2J3L A;  1ATI A;  1NNH A;  2AKW B;  3REX A;  4YRK A;  3VQV A;  1G5I A;  3ICA A;  1ADY A;  4K88 A;  3V8L A;  3NEL A;  4UP7 A;  3PCO B;  5K1P A;  4LVK A;  1X2G A;  2ZIN A;  4HWP A;  3KFU A;  3E9H A;  2ZT8 A;  4K86 A;  2ZGW A;  4ZTZ B;  3MF2 A;  3HFZ A;  1QF6 A;  2QHS A;  4H2V A;  3HXW A;  2ALY B;  3RGL A;  1B70 A;  4HA8 A;  1B76 A;  1WYD A;  2EJF A;  1SRY A;  3TEH A;  1NYQ A;  4YCV A;  4YDQ A;  1X2H A;  2ZT6 A;  4H2W A;  3UH0 A;  2ZNI A;  1NJ6 A;  2EAY A;  4P71 A;  3WQZ A;  2EJ9 A;  2E65 A;  4BW9 A;  4LVL A;  1H4Q A;  4ZIB A;  2AMC B;  3IG2 A;  1QE0 A;  3NEN A;  4TWA A;  3EFS A;  2E1H A;  1JJC A;  4P75 C;  4H02 A;  3G1Z A;  1NJ1 A;  3RL6 A;  1GGM A;  3R07 A;  2PMF A;  1G5H A;  3RKX A;  4P71 C;  2QHU A;  2ZZE A;  2RHS A;  2ODR D;  1JJC B;  3MEY A;  2EWN A;  4ZTU B;  4UPA A;  2A8E A;  4RQE A;  1EIY A;  4TVA A;  1E1O A;  4CH4 A;  2AMC A;  3BFM A;  4EO4 A;  3L4G A;  1HXD A;  2E41 A;  4HWO A;  3QO7 A;  4PHC A;  4XU1 A;  1FYF A;  4P72 C;  1PYS A;  2P0L A;  2ZZF A;  4E51 A;  5F5W A;  2DTH A;  3VQY A;  4TQF A;  3M4P A;  4HWS A;  2ARU A;  4YRN A;  4YRL A;  4H2X B;  4WJ3 M;  4J15 A;  1H4T A;  2ART A;  4YRC A;  3HRI A;  1B70 B;  11AS A;  2NS6 A;  4WJ4 A;  3VBB A;  1SES A;  4YRR A;  4LNS A;  4XTZ A;  1N9W A;  3EFR A;  4LVM A;  4BWA A;  4XTX A;  3V8K A;  1G51 A;  1KMN A;  3UGQ A;  3A31 A;  4TVA B;  1EVK A;  2Q5H A;  4HVC A;  4P3N A;  1KMM A;  4DPG A;  4YYE A;  2IY5 A;  3RUX A;  4HT4 A;  3QTC A;  3PCO A;  4P73 C;  3OD1 A;  2E64 A;  1BIB A;  3IAL A;  4P3P A;  2E3C A;  2ZNJ A;  3QNE A;  4CS3 A;  3V8J A;  3HFV A;  4YRF A;  2XTI A;  3UGT A;  4XU3 A;  1YFS A;  1BIA A;  2J3M A;  3I7F A;  4X5O A;  4P75 A;  2I4L A;  2XGT A;  4EX5 A;  1BBW A;  3HXV A;  3RAC A;  3CMQ A;  4Q6G A;  4RMF A;  3E9I A;  3A74 A;  3ERR A;  2IY5 B;  4KR2 A;  4K87 A;  4H2U A;  1WPY A;  3HY1 A;  4LVI A;  4CH3 A;  3P8T A;  2Q7G A;  1E24 A;  1Z7N A;  1H4V B;  2DXU A;  1SET A;  3BJU A;  1L0W A;  3RIR A;  1X56 A;  4DQ2 A;  4YP0 A;  2DKG A;  3MF1 A;  2DEQ A;  2ZR2 A;  1EQR A;  3LSQ A;  1X01 A;  1PYS B;  2I4O A;  1LYL A;  1USY A;  4WF2 A;  2QHV A;  4XTU A;  2ZXF A;  3RKW A;  4HWR A;  4LVJ A;  2ZIO A;  2ALY A;  3A5Z A;  3IKM B;  1ASY A;  4G84 A;  3LSS A;  5ELO A;  2ZZG A;  1B7Y B;  3HFZ B;  1ASZ A;  4H2S A;  3V7S A;  4YRG A;  1EIY B;  2RHQ B;  2QHT A;  2DTI A;  2I4M A;  2DU5 A;  2Q5I A;  3L4G B;  3VQX A;  2DTO A;  2EJG A;  2DZ9 A;  5ELN A;  1NJ2 A;  4KQE A;  3LC0 A;  3HTZ A;  4YPF A;  2ZTG A;  3IKL A;  4AH6 A;  2FYK A;  3FJP A;  3MQZ A;  2AKW A;  3V7R A;  1B8A A;  4G85 A;  2DU7 A;  2E10 A;  3A5Y A;  4XTV A;  2DZC A;  4YRP A;  3HY0 A;  4O2D A;  3VQW A;  3A32 A;  3QO5 A;  4KR3 A;  4H2T A;  2DVE A;  2DJZ A;  1X55 A;  2C7I A;  2CJA A;  3A7A A;  4XEO A;  4XTY A;  2DXT A;  4PG3 A;  3L1A A;  2Q7H A;  1H4S A;  4TTV A;  4YCU A;  4YRM A;  4P73 A;  4P74 C;  2DQ0 A;  1J5W A;  4OP0 A;  2CIM A;  2DDZ A;  2RHQ A;  3HRK A;  4H2X A;  3RKY A;  1RIQ A;  4CH6 A;  1HC7 A;  4XTW A;  3RF1 A;  1NYR A;  4TVW A;  2ZT5 A;  5E3I A;  3HXU A;  3UFG A;  2ZIM A;  5KNN A;  4YRI A;  12AS A;  1E22 A;  3HXX A;  2ODR C;  4YRS A;  1ADJ A;  2ZT7 A;  5C51 B;  4XEM A;  2E5A A;  4YRE A;  1HTT A;  1EVL A;  1C0A A;  1NJ8 A;  5C52 B;  3NEM A;  4CS2 A;  4HWT A;  1IL2 A;  1USY C;  3A7U A;  3DSQ A;  4OLF A;  4YRQ A;  4CH5 A;  2I4N A;  2EL9 A;  4Q15 A;  5C53 B;  1YFT A;  4TVY A;  4P72 A;  4P3O A;  1WQ7 A;  4RQF A;  1SER A;  4WI1 A;  3HXY A;  1WLE A;  3A7R A;  3NET A;  1EFW A;  4TQD A;  1EOV A;  1YGB A;  1VQZ A;  3P8Y A;  4UP9 A;  4YCW A;  2ZCE A;  2ZR3 A;  4CS4 A;  1B7Y A;  3QO8 A;  2HNI A;  3HXZ A;  2CGH A;  1KOG A;  3TEH B;  5HGQ A;  1Z7M A;  2Q7E A;  4YRT A;  4L87 A;  2DQ3 A;  4YRJ A;  5K1X A;  3P8V A;  4NCX A;  4UP8 A;  1NJ5 A;  3V7C A;  4H2Y A;  3M4Q A;  1E1T A;  4XU2 A;  2G4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...