2QHUA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhuA01
1WPYA 4H2SA 1NNHA 4UP9A 1SRYA 4P71A 2Q7HA 3P8YA 2ZIMA 3PCOA 1X55A 4YRIA 1X54A 4P71C 4P75A 2ARUA 3RIRA 3VBBA 3A32A 2C7IA 12ASA 3REXA 4G84A 3NENA 3L4GB 3HY0A 4Q15A 4YRNA 3HXUA 3UGTA 3P8TA 3E9IA 4P75C 2PMEA 4DPGA 2J3LA 4XEOA 3HXWA 2DZCA 4HWTA 4AH6A 3V7CA 4CH4A 4ZTUB 1EIYB 5K1XA 2DTHA 3M4PA 2Q7GA 3HFVA 5C53B 4DQ2A 4HWRA 4YRPA 1YFRA 4UPAA 4P72A 4P73A 1SERA 3V8KA 2CJAA 4H2TA 2AKWB 1GGMA 3ICAA 5KNNA 2E65A 3VQVA 3HXVA 4P73C 1YFSA 2HNIA 2ZXFA 3RKXA 3NELA 2EJ9A 4XTVA 2ODRD 1E22A 4YRLA 4K88A 4HVCA 3HFZB 4RQEA 1ASZA 4YRJA 2ZGWA 3RACA 2E10A 3RKYA 1BBUA 4YP0A 1WNLA 1JJCA 3WQZA 1L0WA 4YYEA 1WYDA 2EJGA 3QO7A 1WU7A 1ADYA 1B70B 2XTIA 2E64A 3UFGA 4XEMA 4YRGA 1NJ1A 3PZCA 2J3MA 2ZT8A 2ZZEA 4H2WA 4O2DA 4TVWA 4H02A 2PMFA 2ZINA 5ELNA 3IALA 4YRCA 4XU2A 4WJ4A 4ZTZB 1E1TA 2DU7A 1B7YA 1HTTA 1X2GA 2IY5A 1NJ6A 3IG2A 3V7SA 4YCUA 2DJZA 1BIBA 2QHTA 4UP7A 4YRQA 1IL2A 1W66A 2ZIOA 3VQWA 2CJBA 4XTWA 2RHQA 2RHSB 1X01A 3UGQA 1X2HA 1ADJA 3KFUA 2ZZGA 1C0AA 4RDXA 1H4TA 4EO4A 3MF2A 4J15A 3IKLA 3G1ZA 4TQDA 3EFRA 4G85A 1B7YB 2IY5B 3MEYA 1G51A 4HA8A 3QO5A 4K86A 1NYRA 4WJ3M 3PCOB 3A5ZA 1NJ2A 1E24A 4XU0A 1B8AA 3E9HA 3RKWA 4HWPA 1EQRA 2DQ0A 2QHSA 1KMMA 3MF1A 1RIQA 1SESA 3HY1A 4H2UA 3VQYA 5HGQA 4CH6A 4YREA 3W3SA 2ZR2A 4TVAA 1Z7NA 1WQ7A 1E1OA 1BBWA 2DTOA 4UP8A 5ELOA 4H2VA 2ALYA 4YRSA 3RGLA 4CH5A 3TUPA 4YDQA 1NYQA 1PYSA 2Q5HA 2P0LA 3LSQA 4BWAA 3REUA 3QO8A 4H2XA 4XTYA 4PG3A 3TEHA 3M4QA 4TQFA 4XTUA 4L87A 3BJUA 1H4VB 3VQXA 3V8JA 2ZT7A 4TVYA 4H2YA 4XU3A 3TEGA 4ZIBA 3QTCA 3R07A 2C8MA 1QE0A 3CMQA 1VQZA 3DSQA 3L4GA 4KR2A 3A5YA 3HXXA 2DU5A 2FYKA 4HWSA 3UH0A 1BIAA 2ALYB 1JJCB 3HXZA 4XTXA 4YRMA 1EVKA 1NJ5A 2QHVA 4E51A 4WI1A 1ASYA 2E3CA 2XGTA 1EIYA 5C52B 4H2XB 4OLFA 4XTZA 3NETA 4BW9A 3TEHB 2Q7EA 4YRRA 1J5WA 2E5AA 4YCVA 2DTIA 2DDZA 11ASA 4EX5A 1QF6A 2QHUA 2ZR3A 3RUXA 4LNSA 3NEMA 4X5OA 4RMFA 2ZTGA 4K87A 2AKWA 1NJ8A 2DQ3A 1FYFA 2CIMA 4YRKA 3HRKA 3QNEA 4P3OA 3I7FA 2CJ9A 3LSSA 2ODRC 4YRFA 1EVLA 1WLEA 5E3IA 1HC7A 3HFZA 1USYA 2DXUA 5K1PA 3P8VA 4RQFA 4CH3A 4PHCA 4P3NA 2RHQB 3HXYA 2I4LA 2ZZFA 2AMCA 2ARSA 2EWNA 3V8LA 4TTVA 1USYC 3IKMB 3RF1A 2ZNJA 1X56A 4P3PA 2I4OA 3FJPA 2ZCEA 1KOGA 1WQWA 2I4MA 1H4SA 1B70A 3RL6A 4CS4A 2E1HA 1G5HA 4YPFA 4WF2A 2DKGA 2ZNIA 4HWOA 2Q5IA 2ZT6A 1Z7MA 2ARTA 3ERRA 1YB3A 3HTZA 4P72C 4Q6GA 3A31A 3OD1A 4NCXA 4XU1A 1EOVA 1HXDA 2DZ9A 3A74A 4OP0A 2I4NA 1YGBA 3L1AA 1YFTA 4YRTA 1H4QA 4P74A 3EFSA 2EAYA 3L2ZA 2EL9A 2AMCB 1EFWA 1ATIA 5F5WA 2DXTA 2ZT5A 3A7RA 1N9WA 4P74C 4CS3A 2EJFA 4TVAB 4KR3A 3A7UA 5C51B 2CGHA 2RHSA 3LC0A 2P5IA 1SETA 2DVEA 4KQEA 3BFMA 2DEQA 4YCWA 2E41A 2G4CA 1G5IA 4YROA 4CS2A 1B76A 4TWAA 1LYLA 1PYSB 3A7AA 3V7RA 1KMNA 3HRIA
chains in the Genus database with same CATH superfamily
1WPYA 4H2SA 1NNHA 4UP9A 1SRYA 4P71A 2Q7HA 3P8YA 2ZIMA 3PCOA 1X55A 4YRIA 1X54A 4P71C 4P75A 2ARUA 3RIRA 3VBBA 3A32A 2C7IA 12ASA 3REXA 4G84A 3NENA 3L4GB 3HY0A 4Q15A 4YRNA 3HXUA 3UGTA 3P8TA 3E9IA 4P75C 2PMEA 4DPGA 2J3LA 4XEOA 4LVLA 3HXWA 2DZCA 4HWTA 4AH6A 3V7CA 4CH4A 4ZTUB 1EIYB 5K1XA 2DTHA 4LVIA 3M4PA 2Q7GA 3HFVA 5C53B 4DQ2A 4HWRA 4YRPA 1YFRA 4UPAA 4P72A 4P73A 1SERA 3V8KA 2CJAA 4H2TA 2AKWB 1GGMA 3ICAA 5KNNA 2E65A 3VQVA 3HXVA 4P73C 1YFSA 2HNIA 2ZXFA 3RKXA 3NELA 2EJ9A 4XTVA 2ODRD 1E22A 4YRLA 4K88A 4HVCA 3HFZB 4RQEA 1ASZA 4YRJA 2ZGWA 3RACA 2E10A 3RKYA 1BBUA 4YP0A 1WNLA 1JJCA 3WQZA 1L0WA 4YYEA 1WYDA 2EJGA 3QO7A 1WU7A 1ADYA 1B70B 2XTIA 2E64A 3UFGA 4XEMA 2A8EA 4YRGA 1NJ1A 3PZCA 2J3MA 2ZT8A 2ZZEA 4H2WA 4O2DA 4TVWA 4H02A 2PMFA 2ZINA 5ELNA 3IALA 4YRCA 4XU2A 4WJ4A 4ZTZB 1E1TA 2DU7A 1B7YA 1HTTA 1X2GA 2IY5A 1NJ6A 3IG2A 3V7SA 4YCUA 2DJZA 1BIBA 2QHTA 4UP7A 4YRQA 1IL2A 1W66A 2ZIOA 3VQWA 2CJBA 4LVKA 4XTWA 2RHQA 2RHSB 1X01A 3UGQA 1X2HA 1ADJA 3KFUA 2ZZGA 1C0AA 4RDXA 4HT4A 1H4TA 4EO4A 3MF2A 4J15A 3IKLA 3G1ZA 4TQDA 3EFRA 4G85A 1B7YB 2IY5B 3MEYA 1G51A 4HA8A 3QO5A 4K86A 1NYRA 4WJ3M 3PCOB 3A5ZA 4LVJA 1NJ2A 1E24A 4XU0A 1B8AA 3E9HA 3RKWA 4HWPA 1EQRA 2DQ0A 2QHSA 1KMMA 3MF1A 1RIQA 1SESA 3HY1A 4H2UA 3VQYA 5HGQA 4CH6A 4YREA 3W3SA 2ZR2A 4TVAA 1Z7NA 1WQ7A 1E1OA 1BBWA 2DTOA 4UP8A 5ELOA 4H2VA 2ALYA 4YRSA 3RGLA 4CH5A 3TUPA 4YDQA 1NYQA 1PYSA 2Q5HA 2P0LA 3LSQA 4BWAA 3REUA 3QO8A 4H2XA 4XTYA 4PG3A 3TEHA 3M4QA 4TQFA 4XTUA 4L87A 3BJUA 1H4VB 3VQXA 3V8JA 2ZT7A 4TVYA 4H2YA 4XU3A 3TEGA 4ZIBA 3QTCA 3R07A 2C8MA 1QE0A 3CMQA 1VQZA 3DSQA 3L4GA 4KR2A 3A5YA 3HXXA 2DU5A 2FYKA 4HWSA 3UH0A 1BIAA 2ALYB 1JJCB 3HXZA 4XTXA 4YRMA 1EVKA 1NJ5A 2QHVA 4E51A 4WI1A 1ASYA 2E3CA 2XGTA 1EIYA 5C52B 4H2XB 4OLFA 4XTZA 3NETA 4BW9A 3TEHB 2Q7EA 4YRRA 1J5WA 2E5AA 4YCVA 2DTIA 2DDZA 11ASA 4EX5A 1QF6A 2QHUA 2ZR3A 3RUXA 4LNSA 3NEMA 4X5OA 4RMFA 2ZTGA 4K87A 2AKWA 1NJ8A 2DQ3A 1FYFA 2CIMA 4YRKA 3HRKA 3QNEA 4P3OA 3I7FA 2CJ9A 3LSSA 2ODRC 4YRFA 1EVLA 1WLEA 5E3IA 1HC7A 3HFZA 1USYA 2DXUA 5K1PA 3P8VA 4RQFA 4CH3A 4PHCA 4P3NA 2RHQB 3HXYA 2I4LA 2ZZFA 2AMCA 2ARSA 2EWNA 3V8LA 4TTVA 1USYC 3IKMB 3RF1A 2ZNJA 1X56A 4P3PA 2I4OA 3FJPA 2ZCEA 1KOGA 1WQWA 2I4MA 1H4SA 1B70A 2NS6A 3RL6A 4CS4A 2E1HA 1G5HA 4YPFA 4WF2A 2DKGA 2ZNIA 4HWOA 2Q5IA 2ZT6A 1Z7MA 2ARTA 3ERRA 1YB3A 3HTZA 4P72C 3MQZA 4Q6GA 3A31A 3OD1A 4NCXA 4XU1A 1EOVA 1HXDA 2DZ9A 3A74A 4OP0A 2I4NA 1YGBA 3L1AA 1YFTA 4YRTA 1H4QA 4P74A 3EFSA 2EAYA 3L2ZA 2EL9A 2AMCB 1EFWA 1ATIA 5F5WA 2DXTA 2ZT5A 3A7RA 1N9WA 4P74C 4CS3A 2EJFA 4TVAB 4KR3A 3A7UA 5C51B 2CGHA 2RHSA 3LC0A 2P5IA 1SETA 2DVEA 4KQEA 3BFMA 2DEQA 4YCWA 2E41A 2G4CA 1G5IA 4YROA 4CS2A 1B76A 4TWAA 1LYLA 1PYSB 4LVMA 3A7AA 3V7RA 1KMNA 3HRIA
chains in the Genus database with same CATH topology
1WPYA 4H2SA 1NNHA 4UP9A 1SRYA 4P71A 2Q7HA 3P8YA 2ZIMA 3PCOA 1X55A 4YRIA 1X54A 4P71C 4P75A 2ARUA 3RIRA 3VBBA 3A32A 2C7IA 12ASA 3REXA 4G84A 3NENA 3L4GB 3HY0A 4Q15A 4YRNA 3HXUA 3UGTA 3P8TA 3E9IA 4P75C 2PMEA 4DPGA 2J3LA 4XEOA 4LVLA 3HXWA 2DZCA 4HWTA 4AH6A 3V7CA 4CH4A 4ZTUB 1EIYB 5K1XA 2DTHA 4LVIA 3M4PA 2Q7GA 3HFVA 5C53B 4DQ2A 4HWRA 4YRPA 1YFRA 4UPAA 4P72A 4P73A 1SERA 3V8KA 2CJAA 4H2TA 2AKWB 1GGMA 3ICAA 5KNNA 2E65A 3VQVA 3HXVA 4P73C 1YFSA 2HNIA 2ZXFA 3RKXA 3NELA 2EJ9A 4XTVA 2ODRD 1E22A 4YRLA 4K88A 4HVCA 3HFZB 4RQEA 1ASZA 4YRJA 2ZGWA 3RACA 2E10A 3RKYA 1BBUA 4YP0A 1WNLA 1JJCA 3WQZA 1L0WA 4YYEA 1WYDA 2EJGA 3QO7A 1WU7A 1ADYA 1B70B 2XTIA 2E64A 3UFGA 4XEMA 2A8EA 4YRGA 1NJ1A 3PZCA 2J3MA 2ZT8A 2ZZEA 4H2WA 4O2DA 4TVWA 4H02A 2PMFA 2ZINA 5ELNA 3IALA 4YRCA 4XU2A 4WJ4A 4ZTZB 1E1TA 2DU7A 1B7YA 1HTTA 1X2GA 2IY5A 1NJ6A 3IG2A 3V7SA 4YCUA 2DJZA 1BIBA 2QHTA 4UP7A 4YRQA 1IL2A 1W66A 2ZIOA 3VQWA 2CJBA 4LVKA 4XTWA 2RHQA 2RHSB 1X01A 3UGQA 1X2HA 1ADJA 3KFUA 2ZZGA 1C0AA 4RDXA 4HT4A 1H4TA 4EO4A 3MF2A 4J15A 3IKLA 3G1ZA 4TQDA 3EFRA 4G85A 1B7YB 2IY5B 3MEYA 1G51A 4HA8A 3QO5A 4K86A 1NYRA 4WJ3M 3PCOB 3A5ZA 4LVJA 1NJ2A 1E24A 4XU0A 1B8AA 3E9HA 3RKWA 4HWPA 1EQRA 2DQ0A 2QHSA 1KMMA 3MF1A 1RIQA 1SESA 3HY1A 4H2UA 3VQYA 5HGQA 4CH6A 4YREA 3W3SA 2ZR2A 4TVAA 1Z7NA 1WQ7A 1E1OA 1BBWA 2DTOA 4UP8A 5ELOA 4H2VA 2ALYA 4YRSA 3RGLA 4CH5A 3TUPA 4YDQA 1NYQA 1PYSA 2Q5HA 2P0LA 3LSQA 4BWAA 3REUA 3QO8A 4H2XA 4XTYA 4PG3A 3TEHA 3M4QA 4TQFA 4XTUA 4L87A 3BJUA 1H4VB 3VQXA 3V8JA 2ZT7A 4TVYA 4H2YA 4XU3A 3TEGA 4ZIBA 3QTCA 3R07A 2C8MA 1QE0A 3CMQA 1VQZA 3DSQA 3L4GA 4KR2A 3A5YA 3HXXA 2DU5A 2FYKA 4HWSA 3UH0A 1BIAA 2ALYB 1JJCB 3HXZA 4XTXA 4YRMA 1EVKA 1NJ5A 2QHVA 4E51A 4WI1A 1ASYA 2E3CA 2XGTA 1EIYA 5C52B 4H2XB 4OLFA 4XTZA 3NETA 4BW9A 3TEHB 2Q7EA 4YRRA 1J5WA 2E5AA 4YCVA 2DTIA 2DDZA 11ASA 4EX5A 1QF6A 2QHUA 2ZR3A 3RUXA 4LNSA 3NEMA 4X5OA 4RMFA 2ZTGA 4K87A 2AKWA 1NJ8A 2DQ3A 1FYFA 2CIMA 4YRKA 3HRKA 3QNEA 4P3OA 3I7FA 2CJ9A 3LSSA 2ODRC 4YRFA 1EVLA 1WLEA 5E3IA 1HC7A 3HFZA 1USYA 2DXUA 5K1PA 3P8VA 4RQFA 4CH3A 4PHCA 4P3NA 2RHQB 3HXYA 2I4LA 2ZZFA 2AMCA 2ARSA 2EWNA 3V8LA 4TTVA 1USYC 3IKMB 3RF1A 2ZNJA 1X56A 4P3PA 2I4OA 3FJPA 2ZCEA 1KOGA 1WQWA 2I4MA 1H4SA 1B70A 2NS6A 3RL6A 4CS4A 2E1HA 1G5HA 4YPFA 4WF2A 2DKGA 2ZNIA 4HWOA 2Q5IA 2ZT6A 1Z7MA 2ARTA 3ERRA 1YB3A 3HTZA 4P72C 3MQZA 4Q6GA 3A31A 3OD1A 4NCXA 4XU1A 1EOVA 1HXDA 2DZ9A 3A74A 4OP0A 2I4NA 1YGBA 3L1AA 1YFTA 4YRTA 1H4QA 4P74A 3EFSA 2EAYA 3L2ZA 2EL9A 2AMCB 1EFWA 1ATIA 5F5WA 2DXTA 2ZT5A 3A7RA 1N9WA 4P74C 4CS3A 2EJFA 4TVAB 4KR3A 3A7UA 5C51B 2CGHA 2RHSA 3LC0A 2P5IA 1SETA 2DVEA 4KQEA 3BFMA 2DEQA 4YCWA 2E41A 2G4CA 1G5IA 4YROA 4CS2A 1B76A 4TWAA 1LYLA 1PYSB 4LVMA 3A7AA 3V7RA 1KMNA 3HRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPY A;  4H2S A;  1NNH A;  4UP9 A;  1SRY A;  4P71 A;  2Q7H A;  3P8Y A;  2ZIM A;  3PCO A;  1X55 A;  4YRI A;  1X54 A;  4P71 C;  4P75 A;  2ARU A;  3RIR A;  3VBB A;  3A32 A;  2C7I A;  12AS A;  3REX A;  4G84 A;  3NEN A;  3L4G B;  3HY0 A;  4Q15 A;  4YRN A;  3HXU A;  3UGT A;  3P8T A;  3E9I A;  4P75 C;  2PME A;  4DPG A;  2J3L A;  4XEO A;  3HXW A;  2DZC A;  4HWT A;  4AH6 A;  3V7C A;  4CH4 A;  4ZTU B;  1EIY B;  5K1X A;  2DTH A;  3M4P A;  2Q7G A;  3HFV A;  5C53 B;  4DQ2 A;  4HWR A;  4YRP A;  1YFR A;  4UPA A;  4P72 A;  4P73 A;  1SER A;  3V8K A;  2CJA A;  4H2T A;  2AKW B;  1GGM A;  3ICA A;  5KNN A;  2E65 A;  3VQV A;  3HXV A;  4P73 C;  1YFS A;  2HNI A;  2ZXF A;  3RKX A;  3NEL A;  2EJ9 A;  4XTV A;  2ODR D;  1E22 A;  4YRL A;  4K88 A;  4HVC A;  3HFZ B;  4RQE A;  1ASZ A;  4YRJ A;  2ZGW A;  3RAC A;  2E10 A;  3RKY A;  1BBU A;  4YP0 A;  1WNL A;  1JJC A;  3WQZ A;  1L0W A;  4YYE A;  1WYD A;  2EJG A;  3QO7 A;  1WU7 A;  1ADY A;  1B70 B;  2XTI A;  2E64 A;  3UFG A;  4XEM A;  4YRG A;  1NJ1 A;  3PZC A;  2J3M A;  2ZT8 A;  2ZZE A;  4H2W A;  4O2D A;  4TVW A;  4H02 A;  2PMF A;  2ZIN A;  5ELN A;  3IAL A;  4YRC A;  4XU2 A;  4WJ4 A;  4ZTZ B;  1E1T A;  2DU7 A;  1B7Y A;  1HTT A;  1X2G A;  2IY5 A;  1NJ6 A;  3IG2 A;  3V7S A;  4YCU A;  2DJZ A;  1BIB A;  2QHT A;  4UP7 A;  4YRQ A;  1IL2 A;  1W66 A;  2ZIO A;  3VQW A;  2CJB A;  4XTW A;  2RHQ A;  2RHS B;  1X01 A;  3UGQ A;  1X2H A;  1ADJ A;  3KFU A;  2ZZG A;  1C0A A;  4RDX A;  1H4T A;  4EO4 A;  3MF2 A;  4J15 A;  3IKL A;  3G1Z A;  4TQD A;  3EFR A;  4G85 A;  1B7Y B;  2IY5 B;  3MEY A;  1G51 A;  4HA8 A;  3QO5 A;  4K86 A;  1NYR A;  4WJ3 M;  3PCO B;  3A5Z A;  1NJ2 A;  1E24 A;  4XU0 A;  1B8A A;  3E9H A;  3RKW A;  4HWP A;  1EQR A;  2DQ0 A;  2QHS A;  1KMM A;  3MF1 A;  1RIQ A;  1SES A;  3HY1 A;  4H2U A;  3VQY A;  5HGQ A;  4CH6 A;  4YRE A;  3W3S A;  2ZR2 A;  4TVA A;  1Z7N A;  1WQ7 A;  1E1O A;  1BBW A;  2DTO A;  4UP8 A;  5ELO A;  4H2V A;  2ALY A;  4YRS A;  3RGL A;  4CH5 A;  3TUP A;  4YDQ A;  1NYQ A;  1PYS A;  2Q5H A;  2P0L A;  3LSQ A;  4BWA A;  3REU A;  3QO8 A;  4H2X A;  4XTY A;  4PG3 A;  3TEH A;  3M4Q A;  4TQF A;  4XTU A;  4L87 A;  3BJU A;  1H4V B;  3VQX A;  3V8J A;  2ZT7 A;  4TVY A;  4H2Y A;  4XU3 A;  3TEG A;  4ZIB A;  3QTC A;  3R07 A;  2C8M A;  1QE0 A;  3CMQ A;  1VQZ A;  3DSQ A;  3L4G A;  4KR2 A;  3A5Y A;  3HXX A;  2DU5 A;  2FYK A;  4HWS A;  3UH0 A;  1BIA A;  2ALY B;  1JJC B;  3HXZ A;  4XTX A;  4YRM A;  1EVK A;  1NJ5 A;  2QHV A;  4E51 A;  4WI1 A;  1ASY A;  2E3C A;  2XGT A;  1EIY A;  5C52 B;  4H2X B;  4OLF A;  4XTZ A;  3NET A;  4BW9 A;  3TEH B;  2Q7E A;  4YRR A;  1J5W A;  2E5A A;  4YCV A;  2DTI A;  2DDZ A;  11AS A;  4EX5 A;  1QF6 A;  2QHU A;  2ZR3 A;  3RUX A;  4LNS A;  3NEM A;  4X5O A;  4RMF A;  2ZTG A;  4K87 A;  2AKW A;  1NJ8 A;  2DQ3 A;  1FYF A;  2CIM A;  4YRK A;  3HRK A;  3QNE A;  4P3O A;  3I7F A;  2CJ9 A;  3LSS A;  2ODR C;  4YRF A;  1EVL A;  1WLE A;  5E3I A;  1HC7 A;  3HFZ A;  1USY A;  2DXU A;  5K1P A;  3P8V A;  4RQF A;  4CH3 A;  4PHC A;  4P3N A;  2RHQ B;  3HXY A;  2I4L A;  2ZZF A;  2AMC A;  2ARS A;  2EWN A;  3V8L A;  4TTV A;  1USY C;  3IKM B;  3RF1 A;  2ZNJ A;  1X56 A;  4P3P A;  2I4O A;  3FJP A;  2ZCE A;  1KOG A;  1WQW A;  2I4M A;  1H4S A;  1B70 A;  3RL6 A;  4CS4 A;  2E1H A;  1G5H A;  4YPF A;  4WF2 A;  2DKG A;  2ZNI A;  4HWO A;  2Q5I A;  2ZT6 A;  1Z7M A;  2ART A;  3ERR A;  1YB3 A;  3HTZ A;  4P72 C;  4Q6G A;  3A31 A;  3OD1 A;  4NCX A;  4XU1 A;  1EOV A;  1HXD A;  2DZ9 A;  3A74 A;  4OP0 A;  2I4N A;  1YGB A;  3L1A A;  1YFT A;  4YRT A;  1H4Q A;  4P74 A;  3EFS A;  2EAY A;  3L2Z A;  2EL9 A;  2AMC B;  1EFW A;  1ATI A;  5F5W A;  2DXT A;  2ZT5 A;  3A7R A;  1N9W A;  4P74 C;  4CS3 A;  2EJF A;  4TVA B;  4KR3 A;  3A7U A;  5C51 B;  2CGH A;  2RHS A;  3LC0 A;  2P5I A;  1SET A;  2DVE A;  4KQE A;  3BFM A;  2DEQ A;  4YCW A;  2E41 A;  2G4C A;  1G5I A;  4YRO A;  4CS2 A;  1B76 A;  4TWA A;  1LYL A;  1PYS B;  3A7A A;  3V7R A;  1KMN A;  3HRI A; 
#chains in the Genus database with same CATH topology
 1WPY A;  4H2S A;  1NNH A;  4UP9 A;  1SRY A;  4P71 A;  2Q7H A;  3P8Y A;  2ZIM A;  3PCO A;  1X55 A;  4YRI A;  1X54 A;  4P71 C;  4P75 A;  2ARU A;  3RIR A;  3VBB A;  3A32 A;  2C7I A;  12AS A;  3REX A;  4G84 A;  3NEN A;  3L4G B;  3HY0 A;  4Q15 A;  4YRN A;  3HXU A;  3UGT A;  3P8T A;  3E9I A;  4P75 C;  2PME A;  4DPG A;  2J3L A;  4XEO A;  4LVL A;  3HXW A;  2DZC A;  4HWT A;  4AH6 A;  3V7C A;  4CH4 A;  4ZTU B;  1EIY B;  5K1X A;  2DTH A;  4LVI A;  3M4P A;  2Q7G A;  3HFV A;  5C53 B;  4DQ2 A;  4HWR A;  4YRP A;  1YFR A;  4UPA A;  4P72 A;  4P73 A;  1SER A;  3V8K A;  2CJA A;  4H2T A;  2AKW B;  1GGM A;  3ICA A;  5KNN A;  2E65 A;  3VQV A;  3HXV A;  4P73 C;  1YFS A;  2HNI A;  2ZXF A;  3RKX A;  3NEL A;  2EJ9 A;  4XTV A;  2ODR D;  1E22 A;  4YRL A;  4K88 A;  4HVC A;  3HFZ B;  4RQE A;  1ASZ A;  4YRJ A;  2ZGW A;  3RAC A;  2E10 A;  3RKY A;  1BBU A;  4YP0 A;  1WNL A;  1JJC A;  3WQZ A;  1L0W A;  4YYE A;  1WYD A;  2EJG A;  3QO7 A;  1WU7 A;  1ADY A;  1B70 B;  2XTI A;  2E64 A;  3UFG A;  4XEM A;  2A8E A;  4YRG A;  1NJ1 A;  3PZC A;  2J3M A;  2ZT8 A;  2ZZE A;  4H2W A;  4O2D A;  4TVW A;  4H02 A;  2PMF A;  2ZIN A;  5ELN A;  3IAL A;  4YRC A;  4XU2 A;  4WJ4 A;  4ZTZ B;  1E1T A;  2DU7 A;  1B7Y A;  1HTT A;  1X2G A;  2IY5 A;  1NJ6 A;  3IG2 A;  3V7S A;  4YCU A;  2DJZ A;  1BIB A;  2QHT A;  4UP7 A;  4YRQ A;  1IL2 A;  1W66 A;  2ZIO A;  3VQW A;  2CJB A;  4LVK A;  4XTW A;  2RHQ A;  2RHS B;  1X01 A;  3UGQ A;  1X2H A;  1ADJ A;  3KFU A;  2ZZG A;  1C0A A;  4RDX A;  4HT4 A;  1H4T A;  4EO4 A;  3MF2 A;  4J15 A;  3IKL A;  3G1Z A;  4TQD A;  3EFR A;  4G85 A;  1B7Y B;  2IY5 B;  3MEY A;  1G51 A;  4HA8 A;  3QO5 A;  4K86 A;  1NYR A;  4WJ3 M;  3PCO B;  3A5Z A;  4LVJ A;  1NJ2 A;  1E24 A;  4XU0 A;  1B8A A;  3E9H A;  3RKW A;  4HWP A;  1EQR A;  2DQ0 A;  2QHS A;  1KMM A;  3MF1 A;  1RIQ A;  1SES A;  3HY1 A;  4H2U A;  3VQY A;  5HGQ A;  4CH6 A;  4YRE A;  3W3S A;  2ZR2 A;  4TVA A;  1Z7N A;  1WQ7 A;  1E1O A;  1BBW A;  2DTO A;  4UP8 A;  5ELO A;  4H2V A;  2ALY A;  4YRS A;  3RGL A;  4CH5 A;  3TUP A;  4YDQ A;  1NYQ A;  1PYS A;  2Q5H A;  2P0L A;  3LSQ A;  4BWA A;  3REU A;  3QO8 A;  4H2X A;  4XTY A;  4PG3 A;  3TEH A;  3M4Q A;  4TQF A;  4XTU A;  4L87 A;  3BJU A;  1H4V B;  3VQX A;  3V8J A;  2ZT7 A;  4TVY A;  4H2Y A;  4XU3 A;  3TEG A;  4ZIB A;  3QTC A;  3R07 A;  2C8M A;  1QE0 A;  3CMQ A;  1VQZ A;  3DSQ A;  3L4G A;  4KR2 A;  3A5Y A;  3HXX A;  2DU5 A;  2FYK A;  4HWS A;  3UH0 A;  1BIA A;  2ALY B;  1JJC B;  3HXZ A;  4XTX A;  4YRM A;  1EVK A;  1NJ5 A;  2QHV A;  4E51 A;  4WI1 A;  1ASY A;  2E3C A;  2XGT A;  1EIY A;  5C52 B;  4H2X B;  4OLF A;  4XTZ A;  3NET A;  4BW9 A;  3TEH B;  2Q7E A;  4YRR A;  1J5W A;  2E5A A;  4YCV A;  2DTI A;  2DDZ A;  11AS A;  4EX5 A;  1QF6 A;  2QHU A;  2ZR3 A;  3RUX A;  4LNS A;  3NEM A;  4X5O A;  4RMF A;  2ZTG A;  4K87 A;  2AKW A;  1NJ8 A;  2DQ3 A;  1FYF A;  2CIM A;  4YRK A;  3HRK A;  3QNE A;  4P3O A;  3I7F A;  2CJ9 A;  3LSS A;  2ODR C;  4YRF A;  1EVL A;  1WLE A;  5E3I A;  1HC7 A;  3HFZ A;  1USY A;  2DXU A;  5K1P A;  3P8V A;  4RQF A;  4CH3 A;  4PHC A;  4P3N A;  2RHQ B;  3HXY A;  2I4L A;  2ZZF A;  2AMC A;  2ARS A;  2EWN A;  3V8L A;  4TTV A;  1USY C;  3IKM B;  3RF1 A;  2ZNJ A;  1X56 A;  4P3P A;  2I4O A;  3FJP A;  2ZCE A;  1KOG A;  1WQW A;  2I4M A;  1H4S A;  1B70 A;  2NS6 A;  3RL6 A;  4CS4 A;  2E1H A;  1G5H A;  4YPF A;  4WF2 A;  2DKG A;  2ZNI A;  4HWO A;  2Q5I A;  2ZT6 A;  1Z7M A;  2ART A;  3ERR A;  1YB3 A;  3HTZ A;  4P72 C;  3MQZ A;  4Q6G A;  3A31 A;  3OD1 A;  4NCX A;  4XU1 A;  1EOV A;  1HXD A;  2DZ9 A;  3A74 A;  4OP0 A;  2I4N A;  1YGB A;  3L1A A;  1YFT A;  4YRT A;  1H4Q A;  4P74 A;  3EFS A;  2EAY A;  3L2Z A;  2EL9 A;  2AMC B;  1EFW A;  1ATI A;  5F5W A;  2DXT A;  2ZT5 A;  3A7R A;  1N9W A;  4P74 C;  4CS3 A;  2EJF A;  4TVA B;  4KR3 A;  3A7U A;  5C51 B;  2CGH A;  2RHS A;  3LC0 A;  2P5I A;  1SET A;  2DVE A;  4KQE A;  3BFM A;  2DEQ A;  4YCW A;  2E41 A;  2G4C A;  1G5I A;  4YRO A;  4CS2 A;  1B76 A;  4TWA A;  1LYL A;  1PYS B;  4LVM A;  3A7A A;  3V7R A;  1KMN A;  3HRI A; 
#chains in the Genus database with same CATH homology
 1WPY A;  4H2S A;  1NNH A;  4UP9 A;  1SRY A;  4P71 A;  2Q7H A;  3P8Y A;  2ZIM A;  3PCO A;  1X55 A;  4YRI A;  1X54 A;  4P71 C;  4P75 A;  2ARU A;  3RIR A;  3VBB A;  3A32 A;  2C7I A;  12AS A;  3REX A;  4G84 A;  3NEN A;  3L4G B;  3HY0 A;  4Q15 A;  4YRN A;  3HXU A;  3UGT A;  3P8T A;  3E9I A;  4P75 C;  2PME A;  4DPG A;  2J3L A;  4XEO A;  4LVL A;  3HXW A;  2DZC A;  4HWT A;  4AH6 A;  3V7C A;  4CH4 A;  4ZTU B;  1EIY B;  5K1X A;  2DTH A;  4LVI A;  3M4P A;  2Q7G A;  3HFV A;  5C53 B;  4DQ2 A;  4HWR A;  4YRP A;  1YFR A;  4UPA A;  4P72 A;  4P73 A;  1SER A;  3V8K A;  2CJA A;  4H2T A;  2AKW B;  1GGM A;  3ICA A;  5KNN A;  2E65 A;  3VQV A;  3HXV A;  4P73 C;  1YFS A;  2HNI A;  2ZXF A;  3RKX A;  3NEL A;  2EJ9 A;  4XTV A;  2ODR D;  1E22 A;  4YRL A;  4K88 A;  4HVC A;  3HFZ B;  4RQE A;  1ASZ A;  4YRJ A;  2ZGW A;  3RAC A;  2E10 A;  3RKY A;  1BBU A;  4YP0 A;  1WNL A;  1JJC A;  3WQZ A;  1L0W A;  4YYE A;  1WYD A;  2EJG A;  3QO7 A;  1WU7 A;  1ADY A;  1B70 B;  2XTI A;  2E64 A;  3UFG A;  4XEM A;  2A8E A;  4YRG A;  1NJ1 A;  3PZC A;  2J3M A;  2ZT8 A;  2ZZE A;  4H2W A;  4O2D A;  4TVW A;  4H02 A;  2PMF A;  2ZIN A;  5ELN A;  3IAL A;  4YRC A;  4XU2 A;  4WJ4 A;  4ZTZ B;  1E1T A;  2DU7 A;  1B7Y A;  1HTT A;  1X2G A;  2IY5 A;  1NJ6 A;  3IG2 A;  3V7S A;  4YCU A;  2DJZ A;  1BIB A;  2QHT A;  4UP7 A;  4YRQ A;  1IL2 A;  1W66 A;  2ZIO A;  3VQW A;  2CJB A;  4LVK A;  4XTW A;  2RHQ A;  2RHS B;  1X01 A;  3UGQ A;  1X2H A;  1ADJ A;  3KFU A;  2ZZG A;  1C0A A;  4RDX A;  4HT4 A;  1H4T A;  4EO4 A;  3MF2 A;  4J15 A;  3IKL A;  3G1Z A;  4TQD A;  3EFR A;  4G85 A;  1B7Y B;  2IY5 B;  3MEY A;  1G51 A;  4HA8 A;  3QO5 A;  4K86 A;  1NYR A;  4WJ3 M;  3PCO B;  3A5Z A;  4LVJ A;  1NJ2 A;  1E24 A;  4XU0 A;  1B8A A;  3E9H A;  3RKW A;  4HWP A;  1EQR A;  2DQ0 A;  2QHS A;  1KMM A;  3MF1 A;  1RIQ A;  1SES A;  3HY1 A;  4H2U A;  3VQY A;  5HGQ A;  4CH6 A;  4YRE A;  3W3S A;  2ZR2 A;  4TVA A;  1Z7N A;  1WQ7 A;  1E1O A;  1BBW A;  2DTO A;  4UP8 A;  5ELO A;  4H2V A;  2ALY A;  4YRS A;  3RGL A;  4CH5 A;  3TUP A;  4YDQ A;  1NYQ A;  1PYS A;  2Q5H A;  2P0L A;  3LSQ A;  4BWA A;  3REU A;  3QO8 A;  4H2X A;  4XTY A;  4PG3 A;  3TEH A;  3M4Q A;  4TQF A;  4XTU A;  4L87 A;  3BJU A;  1H4V B;  3VQX A;  3V8J A;  2ZT7 A;  4TVY A;  4H2Y A;  4XU3 A;  3TEG A;  4ZIB A;  3QTC A;  3R07 A;  2C8M A;  1QE0 A;  3CMQ A;  1VQZ A;  3DSQ A;  3L4G A;  4KR2 A;  3A5Y A;  3HXX A;  2DU5 A;  2FYK A;  4HWS A;  3UH0 A;  1BIA A;  2ALY B;  1JJC B;  3HXZ A;  4XTX A;  4YRM A;  1EVK A;  1NJ5 A;  2QHV A;  4E51 A;  4WI1 A;  1ASY A;  2E3C A;  2XGT A;  1EIY A;  5C52 B;  4H2X B;  4OLF A;  4XTZ A;  3NET A;  4BW9 A;  3TEH B;  2Q7E A;  4YRR A;  1J5W A;  2E5A A;  4YCV A;  2DTI A;  2DDZ A;  11AS A;  4EX5 A;  1QF6 A;  2QHU A;  2ZR3 A;  3RUX A;  4LNS A;  3NEM A;  4X5O A;  4RMF A;  2ZTG A;  4K87 A;  2AKW A;  1NJ8 A;  2DQ3 A;  1FYF A;  2CIM A;  4YRK A;  3HRK A;  3QNE A;  4P3O A;  3I7F A;  2CJ9 A;  3LSS A;  2ODR C;  4YRF A;  1EVL A;  1WLE A;  5E3I A;  1HC7 A;  3HFZ A;  1USY A;  2DXU A;  5K1P A;  3P8V A;  4RQF A;  4CH3 A;  4PHC A;  4P3N A;  2RHQ B;  3HXY A;  2I4L A;  2ZZF A;  2AMC A;  2ARS A;  2EWN A;  3V8L A;  4TTV A;  1USY C;  3IKM B;  3RF1 A;  2ZNJ A;  1X56 A;  4P3P A;  2I4O A;  3FJP A;  2ZCE A;  1KOG A;  1WQW A;  2I4M A;  1H4S A;  1B70 A;  2NS6 A;  3RL6 A;  4CS4 A;  2E1H A;  1G5H A;  4YPF A;  4WF2 A;  2DKG A;  2ZNI A;  4HWO A;  2Q5I A;  2ZT6 A;  1Z7M A;  2ART A;  3ERR A;  1YB3 A;  3HTZ A;  4P72 C;  3MQZ A;  4Q6G A;  3A31 A;  3OD1 A;  4NCX A;  4XU1 A;  1EOV A;  1HXD A;  2DZ9 A;  3A74 A;  4OP0 A;  2I4N A;  1YGB A;  3L1A A;  1YFT A;  4YRT A;  1H4Q A;  4P74 A;  3EFS A;  2EAY A;  3L2Z A;  2EL9 A;  2AMC B;  1EFW A;  1ATI A;  5F5W A;  2DXT A;  2ZT5 A;  3A7R A;  1N9W A;  4P74 C;  4CS3 A;  2EJF A;  4TVA B;  4KR3 A;  3A7U A;  5C51 B;  2CGH A;  2RHS A;  3LC0 A;  2P5I A;  1SET A;  2DVE A;  4KQE A;  3BFM A;  2DEQ A;  4YCW A;  2E41 A;  2G4C A;  1G5I A;  4YRO A;  4CS2 A;  1B76 A;  4TWA A;  1LYL A;  1PYS B;  4LVM A;  3A7A A;  3V7R A;  1KMN A;  3HRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...