2QHUA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhuA01
3HY1A 2QHUA 3RIRA 2P5IA 3P8YA 4KR3A 2PMEA 2Q7GA 2E10A 4TQFA 4YPFA 4WJ3M 2ZZFA 2I4MA 4YCWA 1H4SA 3RF1A 4H2XB 2ODRD 1X55A 4XTUA 3IKMB 3BJUA 1NJ8A 3E9IA 1ASYA 4BWAA 4XU2A 4CH5A 4YROA 4ZIBA 3V8KA 1ADJA 4YRNA 4P74C 1NJ6A 2EJ9A 4XU1A 3HXUA 3QO8A 2DXUA 3REXA 4H2SA 4E51A 4P74A 2IY5A 4EO4A 1WYDA 1BIAA 2DTHA 4TVAA 3MF1A 3DSQA 1IL2A 1G5HA 4UPAA 3TUPA 2XTIA 1ATIA 3IG2A 3VBBA 4YRLA 1KMMA 1USYC 4YYEA 2ZINA 1E1TA 3CMQA 2ZT8A 3P8TA 4XU3A 1WU7A 3HRIA 2I4NA 1J5WA 2RHSB 3V7SA 1USYA 4BW9A 4YCUA 3PCOA 4XEMA 2CIMA 4P71C 3MF2A 4YRIA 4TQDA 3RL6A 1SESA 4CH4A 4YRTA 2ZZGA 3A5ZA 2ZNIA 4P71A 1X01A 3IALA 1WPYA 1LYLA 3HXVA 3HXWA 3R07A 1KMNA 1YB3A 1X2HA 4Q15A 4P3NA 4UP8A 2DU5A 1B70B 4YP0A 3NEMA 2E64A 2Q5IA 4YRPA 3LC0A 1W66A 3BFMA 1B7YB 4H2XA 1NJ1A 4CH3A 2E41A 4DPGA 1E24A 2E1HA 2E5AA 3RACA 5HGQA 1SERA 2DQ3A 2RHQB 2Q7EA 1ASZA 4TTVA 5E3IA 2ZNJA 3HXYA 4YRKA 4P3PA 2ARTA 2QHVA 4HWPA 3PZCA 4UP9A 1RIQA 4YDQA 2AMCB 2DJZA 2EWNA 2J3MA 4XTXA 1ADYA 3ERRA 2CJAA 1Z7NA 3HFZA 4TVWA 3L4GB 5C51B 3VQYA 4YRFA 3A7UA 11ASA 3G1ZA 4H2WA 4K88A 4TWAA 2DEQA 4XU0A 2EL9A 3HFZB 4X5OA 3TEHB 3UH0A 4PHCA 1WLEA 2ZGWA 3NETA 2RHSA 1GGMA 1PYSB 5C53B 1NJ5A 3LSSA 2ZT5A 1YFRA 4J15A 4WF2A 2ALYB 2Q5HA 3RKXA 4RQFA 3UFGA 2C7IA 1QE0A 1EIYB 2ZXFA 4P72C 1FYFA 2AKWB 2DTIA 4RDXA 1EQRA 1SETA 1NYQA 2EJFA 1NNHA 2DZCA 4P72A 4P3OA 3UGQA 4YRMA 2ZIMA 5KNNA 4KQEA 3QO7A 4P73C 1EVKA 4YRRA 2ARUA 4HWOA 4LNSA 3VQVA 4H2YA 4P73A 2ZT7A 3I7FA 1YFTA 1B70A 4YRJA 1JJCB 3EFRA 3HTZA 4WI1A 3HXXA 4WJ4A 1B7YA 3QO5A 4XTZA 4CH6A 2I4OA 3WQZA 2CGHA 3A32A 2I4LA 2ZR2A 12ASA 4PG3A 3A5YA 2E65A 3RGLA 1B8AA 3HY0A 3UGTA 5F5WA 4EX5A 4XTWA 2RHQA 1Z7MA 2XGTA 3HRKA 2ZT6A 4XTYA 1HXDA 2E3CA 1HTTA 3ICAA 4H2UA 3RKYA 2J3LA 4L87A 1H4VB 2DKGA 4P75C 4CS3A 2FYKA 2AMCA 4YCVA 1G5IA 4YRQA 2EJGA 3A74A 1G51A 1E22A 4YRCA 3EFSA 3FJPA 4XTVA 2P0LA 3V8LA 3TEGA 4P75A 2CJ9A 1H4QA 3KFUA 3L4GA 1E1OA 1C0AA 4O2DA 1H4TA 4YREA 3HXZA 2DVEA 2PMFA 4UP7A 1B76A 3QNEA 4OLFA 2DQ0A 3REUA 2EAYA 3TEHA 4DQ2A 4CS4A 3A7AA 2Q7HA 1PYSA 2ODRC 4AH6A 4RMFA 2DU7A 2ALYA 1SRYA 3OD1A 1YGBA 3HFVA 4HWSA 2ZZEA 1EIYA 4YRGA 1BBUA 1EVLA 2AKWA 4H2VA 4NCXA 4CS2A 1KOGA 2HNIA 3E9HA 2G4CA 4HWTA 2DZ9A 3LSQA 4ZTUB 5ELOA 1EFWA 1BBWA 2QHTA 1BIBA 4HVCA 1EOVA 1X56A 2C8MA 3VQWA 1JJCA 2ZTGA 1L0WA 2ZR3A 1WNLA 1X54A 1VQZA 1YFSA 4K87A 2ZCEA 4Q6GA 2IY5B 2DDZA 1N9WA 5K1PA 3VQXA 4ZTZB 4TVAB 4H2TA 4HA8A 3NELA 4K86A 1WQWA 4KR2A 3P8VA 4H02A 2DXTA 3IKLA 3V7RA 4TVYA 1NYRA 3MEYA 5ELNA 1X2GA 3A7RA 3M4PA 1WQ7A 3A31A 4YRSA 5K1XA 4HWRA 4XEOA 1QF6A 1NJ2A 3M4QA 3PCOB 3NENA 3V8JA 3QTCA 3L2ZA 3L1AA 2DTOA 2ZIOA 4RQEA 3RKWA 4G84A 2ARSA 1HC7A 2QHSA 3W3SA 2CJBA 3RUXA 3V7CA 5C52B 4OP0A 4G85A
chains in the Genus database with same CATH superfamily
3HY1A 2QHUA 3RIRA 2P5IA 3P8YA 4KR3A 2A8EA 2PMEA 2Q7GA 2E10A 4TQFA 4YPFA 4WJ3M 2ZZFA 2I4MA 4YCWA 1H4SA 3RF1A 4H2XB 2ODRD 1X55A 4XTUA 3IKMB 3BJUA 1NJ8A 3E9IA 1ASYA 4BWAA 4XU2A 4CH5A 4YROA 4ZIBA 3V8KA 1ADJA 4YRNA 4P74C 1NJ6A 2EJ9A 4XU1A 3HXUA 3QO8A 2DXUA 3REXA 4H2SA 4E51A 4P74A 2IY5A 4EO4A 1WYDA 1BIAA 2DTHA 4TVAA 3MF1A 3DSQA 1IL2A 1G5HA 4UPAA 3TUPA 2XTIA 1ATIA 3IG2A 3VBBA 4YRLA 1KMMA 1USYC 4YYEA 2ZINA 1E1TA 3CMQA 2ZT8A 3P8TA 4XU3A 1WU7A 3HRIA 2I4NA 1J5WA 2RHSB 3V7SA 1USYA 4BW9A 4YCUA 4HT4A 3PCOA 4XEMA 2CIMA 4P71C 3MF2A 4YRIA 4TQDA 3RL6A 1SESA 4CH4A 4YRTA 2ZZGA 3A5ZA 2ZNIA 4P71A 1X01A 3IALA 1WPYA 1LYLA 3HXVA 3HXWA 3R07A 1KMNA 1YB3A 1X2HA 4Q15A 4P3NA 4UP8A 2DU5A 1B70B 4YP0A 3NEMA 2E64A 2Q5IA 4YRPA 3LC0A 1W66A 3BFMA 1B7YB 4H2XA 1NJ1A 4CH3A 2E41A 4DPGA 1E24A 2E1HA 2E5AA 3RACA 5HGQA 1SERA 2DQ3A 2RHQB 2Q7EA 1ASZA 4TTVA 5E3IA 2ZNJA 3HXYA 4YRKA 4P3PA 2ARTA 2QHVA 4HWPA 3PZCA 4UP9A 1RIQA 4YDQA 2AMCB 2DJZA 2EWNA 2J3MA 4XTXA 1ADYA 3ERRA 2CJAA 1Z7NA 3HFZA 4TVWA 3L4GB 5C51B 3VQYA 4YRFA 3A7UA 11ASA 3G1ZA 4H2WA 4K88A 4TWAA 2DEQA 4LVJA 4XU0A 2EL9A 3HFZB 4X5OA 3TEHB 3UH0A 4PHCA 1WLEA 2ZGWA 3NETA 2RHSA 1GGMA 1PYSB 5C53B 1NJ5A 3LSSA 2ZT5A 1YFRA 4J15A 4WF2A 2ALYB 2Q5HA 3RKXA 4RQFA 3UFGA 2C7IA 1QE0A 1EIYB 2ZXFA 4P72C 1FYFA 2AKWB 2DTIA 4RDXA 1EQRA 1SETA 1NYQA 2EJFA 1NNHA 2DZCA 4P72A 4P3OA 3UGQA 4YRMA 2ZIMA 5KNNA 4KQEA 3QO7A 4P73C 1EVKA 4YRRA 2ARUA 4HWOA 4LNSA 3VQVA 4H2YA 4P73A 2ZT7A 3I7FA 1YFTA 1B70A 4YRJA 1JJCB 3EFRA 3HTZA 4WI1A 3HXXA 4WJ4A 1B7YA 3QO5A 4XTZA 4CH6A 2I4OA 3WQZA 2CGHA 3A32A 2I4LA 2ZR2A 12ASA 4PG3A 3A5YA 2E65A 3RGLA 1B8AA 3HY0A 3UGTA 5F5WA 4LVKA 4EX5A 4XTWA 2RHQA 1Z7MA 2XGTA 3HRKA 2ZT6A 4XTYA 1HXDA 2E3CA 1HTTA 3ICAA 4H2UA 3RKYA 2J3LA 4L87A 1H4VB 2DKGA 4P75C 4CS3A 2FYKA 2AMCA 4YCVA 1G5IA 4YRQA 2EJGA 3A74A 1G51A 1E22A 4YRCA 3EFSA 3FJPA 4XTVA 2P0LA 3V8LA 3TEGA 3MQZA 2CJ9A 4P75A 1H4QA 3KFUA 3L4GA 1E1OA 1C0AA 4O2DA 1H4TA 4YREA 3HXZA 2DVEA 2PMFA 4UP7A 1B76A 3QNEA 4OLFA 2DQ0A 3REUA 2EAYA 3TEHA 4DQ2A 4CS4A 3A7AA 2Q7HA 1PYSA 2ODRC 4AH6A 4RMFA 2DU7A 2ALYA 1SRYA 3OD1A 1YGBA 3HFVA 4HWSA 2ZZEA 1EIYA 4YRGA 1BBUA 1EVLA 2AKWA 4H2VA 4NCXA 4CS2A 4LVMA 1KOGA 2HNIA 3E9HA 2G4CA 4HWTA 2DZ9A 3LSQA 4ZTUB 5ELOA 1EFWA 1BBWA 2QHTA 1BIBA 4HVCA 1EOVA 1X56A 2C8MA 3VQWA 1JJCA 2ZTGA 4LVIA 1L0WA 2ZR3A 1WNLA 1X54A 1VQZA 1YFSA 4K87A 2ZCEA 4Q6GA 2IY5B 2DDZA 1N9WA 5K1PA 3VQXA 4ZTZB 4LVLA 4TVAB 4H2TA 4HA8A 3NELA 4K86A 1WQWA 4KR2A 3P8VA 4H02A 2DXTA 3IKLA 3V7RA 4TVYA 1NYRA 3MEYA 5ELNA 1X2GA 3A7RA 3M4PA 1WQ7A 3A31A 4YRSA 5K1XA 4HWRA 4XEOA 1QF6A 1NJ2A 3M4QA 3PCOB 3NENA 2NS6A 3V8JA 3QTCA 3L2ZA 3L1AA 2DTOA 2ZIOA 4RQEA 3RKWA 4G84A 2ARSA 1HC7A 2QHSA 3W3SA 2CJBA 3RUXA 3V7CA 5C52B 4OP0A 4G85A
chains in the Genus database with same CATH topology
3HY1A 2QHUA 3RIRA 2P5IA 3P8YA 4KR3A 2A8EA 2PMEA 2Q7GA 2E10A 4TQFA 4YPFA 4WJ3M 2ZZFA 2I4MA 4YCWA 1H4SA 3RF1A 4H2XB 2ODRD 1X55A 4XTUA 3IKMB 3BJUA 1NJ8A 3E9IA 1ASYA 4BWAA 4XU2A 4CH5A 4YROA 4ZIBA 3V8KA 1ADJA 4YRNA 4P74C 1NJ6A 2EJ9A 4XU1A 3HXUA 3QO8A 2DXUA 3REXA 4H2SA 4E51A 4P74A 2IY5A 4EO4A 1WYDA 1BIAA 2DTHA 4TVAA 3MF1A 3DSQA 1IL2A 1G5HA 4UPAA 3TUPA 2XTIA 1ATIA 3IG2A 3VBBA 4YRLA 1KMMA 1USYC 4YYEA 2ZINA 1E1TA 3CMQA 2ZT8A 3P8TA 4XU3A 1WU7A 3HRIA 2I4NA 1J5WA 2RHSB 3V7SA 1USYA 4BW9A 4YCUA 4HT4A 3PCOA 4XEMA 2CIMA 4P71C 3MF2A 4YRIA 4TQDA 3RL6A 1SESA 4CH4A 4YRTA 2ZZGA 3A5ZA 2ZNIA 4P71A 1X01A 3IALA 1WPYA 1LYLA 3HXVA 3HXWA 3R07A 1KMNA 1YB3A 1X2HA 4Q15A 4P3NA 4UP8A 2DU5A 1B70B 4YP0A 3NEMA 2E64A 2Q5IA 4YRPA 3LC0A 1W66A 3BFMA 1B7YB 4H2XA 1NJ1A 4CH3A 2E41A 4DPGA 1E24A 2E1HA 2E5AA 3RACA 5HGQA 1SERA 2DQ3A 2RHQB 2Q7EA 1ASZA 4TTVA 5E3IA 2ZNJA 3HXYA 4YRKA 4P3PA 2ARTA 2QHVA 4HWPA 3PZCA 4UP9A 1RIQA 4YDQA 2AMCB 2DJZA 2EWNA 2J3MA 4XTXA 1ADYA 3ERRA 2CJAA 1Z7NA 3HFZA 4TVWA 3L4GB 5C51B 3VQYA 4YRFA 3A7UA 11ASA 3G1ZA 4H2WA 4K88A 4TWAA 2DEQA 4LVJA 4XU0A 2EL9A 3HFZB 4X5OA 3TEHB 3UH0A 4PHCA 1WLEA 2ZGWA 3NETA 2RHSA 1GGMA 1PYSB 5C53B 1NJ5A 3LSSA 2ZT5A 1YFRA 4J15A 4WF2A 2ALYB 2Q5HA 3RKXA 4RQFA 3UFGA 2C7IA 1QE0A 1EIYB 2ZXFA 4P72C 1FYFA 2AKWB 2DTIA 4RDXA 1EQRA 1SETA 1NYQA 2EJFA 1NNHA 2DZCA 4P72A 4P3OA 3UGQA 4YRMA 2ZIMA 5KNNA 4KQEA 3QO7A 4P73C 1EVKA 4YRRA 2ARUA 4HWOA 4LNSA 3VQVA 4H2YA 4P73A 2ZT7A 3I7FA 1YFTA 1B70A 4YRJA 1JJCB 3EFRA 3HTZA 4WI1A 3HXXA 4WJ4A 1B7YA 3QO5A 4XTZA 4CH6A 2I4OA 3WQZA 2CGHA 3A32A 2I4LA 2ZR2A 12ASA 4PG3A 3A5YA 2E65A 3RGLA 1B8AA 3HY0A 3UGTA 5F5WA 4LVKA 4EX5A 4XTWA 2RHQA 1Z7MA 2XGTA 3HRKA 2ZT6A 4XTYA 1HXDA 2E3CA 1HTTA 3ICAA 4H2UA 3RKYA 2J3LA 4L87A 1H4VB 2DKGA 4P75C 4CS3A 2FYKA 2AMCA 4YCVA 1G5IA 4YRQA 2EJGA 3A74A 1G51A 1E22A 4YRCA 3EFSA 3FJPA 4XTVA 2P0LA 3V8LA 3TEGA 3MQZA 2CJ9A 4P75A 1H4QA 3KFUA 3L4GA 1E1OA 1C0AA 4O2DA 1H4TA 4YREA 3HXZA 2DVEA 2PMFA 4UP7A 1B76A 3QNEA 4OLFA 2DQ0A 3REUA 2EAYA 3TEHA 4DQ2A 4CS4A 3A7AA 2Q7HA 1PYSA 2ODRC 4AH6A 4RMFA 2DU7A 2ALYA 1SRYA 3OD1A 1YGBA 3HFVA 4HWSA 2ZZEA 1EIYA 4YRGA 1BBUA 1EVLA 2AKWA 4H2VA 4NCXA 4CS2A 4LVMA 1KOGA 2HNIA 3E9HA 2G4CA 4HWTA 2DZ9A 3LSQA 4ZTUB 5ELOA 1EFWA 1BBWA 2QHTA 1BIBA 4HVCA 1EOVA 1X56A 2C8MA 3VQWA 1JJCA 2ZTGA 4LVIA 1L0WA 2ZR3A 1WNLA 1X54A 1VQZA 1YFSA 4K87A 2ZCEA 4Q6GA 2IY5B 2DDZA 1N9WA 5K1PA 3VQXA 4ZTZB 4LVLA 4TVAB 4H2TA 4HA8A 3NELA 4K86A 1WQWA 4KR2A 3P8VA 4H02A 2DXTA 3IKLA 3V7RA 4TVYA 1NYRA 3MEYA 5ELNA 1X2GA 3A7RA 3M4PA 1WQ7A 3A31A 4YRSA 5K1XA 4HWRA 4XEOA 1QF6A 1NJ2A 3M4QA 3PCOB 3NENA 2NS6A 3V8JA 3QTCA 3L2ZA 3L1AA 2DTOA 2ZIOA 4RQEA 3RKWA 4G84A 2ARSA 1HC7A 2QHSA 3W3SA 2CJBA 3RUXA 3V7CA 5C52B 4OP0A 4G85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HY1 A;  2QHU A;  3RIR A;  2P5I A;  3P8Y A;  4KR3 A;  2PME A;  2Q7G A;  2E10 A;  4TQF A;  4YPF A;  4WJ3 M;  2ZZF A;  2I4M A;  4YCW A;  1H4S A;  3RF1 A;  4H2X B;  2ODR D;  1X55 A;  4XTU A;  3IKM B;  3BJU A;  1NJ8 A;  3E9I A;  1ASY A;  4BWA A;  4XU2 A;  4CH5 A;  4YRO A;  4ZIB A;  3V8K A;  1ADJ A;  4YRN A;  4P74 C;  1NJ6 A;  2EJ9 A;  4XU1 A;  3HXU A;  3QO8 A;  2DXU A;  3REX A;  4H2S A;  4E51 A;  4P74 A;  2IY5 A;  4EO4 A;  1WYD A;  1BIA A;  2DTH A;  4TVA A;  3MF1 A;  3DSQ A;  1IL2 A;  1G5H A;  4UPA A;  3TUP A;  2XTI A;  1ATI A;  3IG2 A;  3VBB A;  4YRL A;  1KMM A;  1USY C;  4YYE A;  2ZIN A;  1E1T A;  3CMQ A;  2ZT8 A;  3P8T A;  4XU3 A;  1WU7 A;  3HRI A;  2I4N A;  1J5W A;  2RHS B;  3V7S A;  1USY A;  4BW9 A;  4YCU A;  3PCO A;  4XEM A;  2CIM A;  4P71 C;  3MF2 A;  4YRI A;  4TQD A;  3RL6 A;  1SES A;  4CH4 A;  4YRT A;  2ZZG A;  3A5Z A;  2ZNI A;  4P71 A;  1X01 A;  3IAL A;  1WPY A;  1LYL A;  3HXV A;  3HXW A;  3R07 A;  1KMN A;  1YB3 A;  1X2H A;  4Q15 A;  4P3N A;  4UP8 A;  2DU5 A;  1B70 B;  4YP0 A;  3NEM A;  2E64 A;  2Q5I A;  4YRP A;  3LC0 A;  1W66 A;  3BFM A;  1B7Y B;  4H2X A;  1NJ1 A;  4CH3 A;  2E41 A;  4DPG A;  1E24 A;  2E1H A;  2E5A A;  3RAC A;  5HGQ A;  1SER A;  2DQ3 A;  2RHQ B;  2Q7E A;  1ASZ A;  4TTV A;  5E3I A;  2ZNJ A;  3HXY A;  4YRK A;  4P3P A;  2ART A;  2QHV A;  4HWP A;  3PZC A;  4UP9 A;  1RIQ A;  4YDQ A;  2AMC B;  2DJZ A;  2EWN A;  2J3M A;  4XTX A;  1ADY A;  3ERR A;  2CJA A;  1Z7N A;  3HFZ A;  4TVW A;  3L4G B;  5C51 B;  3VQY A;  4YRF A;  3A7U A;  11AS A;  3G1Z A;  4H2W A;  4K88 A;  4TWA A;  2DEQ A;  4XU0 A;  2EL9 A;  3HFZ B;  4X5O A;  3TEH B;  3UH0 A;  4PHC A;  1WLE A;  2ZGW A;  3NET A;  2RHS A;  1GGM A;  1PYS B;  5C53 B;  1NJ5 A;  3LSS A;  2ZT5 A;  1YFR A;  4J15 A;  4WF2 A;  2ALY B;  2Q5H A;  3RKX A;  4RQF A;  3UFG A;  2C7I A;  1QE0 A;  1EIY B;  2ZXF A;  4P72 C;  1FYF A;  2AKW B;  2DTI A;  4RDX A;  1EQR A;  1SET A;  1NYQ A;  2EJF A;  1NNH A;  2DZC A;  4P72 A;  4P3O A;  3UGQ A;  4YRM A;  2ZIM A;  5KNN A;  4KQE A;  3QO7 A;  4P73 C;  1EVK A;  4YRR A;  2ARU A;  4HWO A;  4LNS A;  3VQV A;  4H2Y A;  4P73 A;  2ZT7 A;  3I7F A;  1YFT A;  1B70 A;  4YRJ A;  1JJC B;  3EFR A;  3HTZ A;  4WI1 A;  3HXX A;  4WJ4 A;  1B7Y A;  3QO5 A;  4XTZ A;  4CH6 A;  2I4O A;  3WQZ A;  2CGH A;  3A32 A;  2I4L A;  2ZR2 A;  12AS A;  4PG3 A;  3A5Y A;  2E65 A;  3RGL A;  1B8A A;  3HY0 A;  3UGT A;  5F5W A;  4EX5 A;  4XTW A;  2RHQ A;  1Z7M A;  2XGT A;  3HRK A;  2ZT6 A;  4XTY A;  1HXD A;  2E3C A;  1HTT A;  3ICA A;  4H2U A;  3RKY A;  2J3L A;  4L87 A;  1H4V B;  2DKG A;  4P75 C;  4CS3 A;  2FYK A;  2AMC A;  4YCV A;  1G5I A;  4YRQ A;  2EJG A;  3A74 A;  1G51 A;  1E22 A;  4YRC A;  3EFS A;  3FJP A;  4XTV A;  2P0L A;  3V8L A;  3TEG A;  4P75 A;  2CJ9 A;  1H4Q A;  3KFU A;  3L4G A;  1E1O A;  1C0A A;  4O2D A;  1H4T A;  4YRE A;  3HXZ A;  2DVE A;  2PMF A;  4UP7 A;  1B76 A;  3QNE A;  4OLF A;  2DQ0 A;  3REU A;  2EAY A;  3TEH A;  4DQ2 A;  4CS4 A;  3A7A A;  2Q7H A;  1PYS A;  2ODR C;  4AH6 A;  4RMF A;  2DU7 A;  2ALY A;  1SRY A;  3OD1 A;  1YGB A;  3HFV A;  4HWS A;  2ZZE A;  1EIY A;  4YRG A;  1BBU A;  1EVL A;  2AKW A;  4H2V A;  4NCX A;  4CS2 A;  1KOG A;  2HNI A;  3E9H A;  2G4C A;  4HWT A;  2DZ9 A;  3LSQ A;  4ZTU B;  5ELO A;  1EFW A;  1BBW A;  2QHT A;  1BIB A;  4HVC A;  1EOV A;  1X56 A;  2C8M A;  3VQW A;  1JJC A;  2ZTG A;  1L0W A;  2ZR3 A;  1WNL A;  1X54 A;  1VQZ A;  1YFS A;  4K87 A;  2ZCE A;  4Q6G A;  2IY5 B;  2DDZ A;  1N9W A;  5K1P A;  3VQX A;  4ZTZ B;  4TVA B;  4H2T A;  4HA8 A;  3NEL A;  4K86 A;  1WQW A;  4KR2 A;  3P8V A;  4H02 A;  2DXT A;  3IKL A;  3V7R A;  4TVY A;  1NYR A;  3MEY A;  5ELN A;  1X2G A;  3A7R A;  3M4P A;  1WQ7 A;  3A31 A;  4YRS A;  5K1X A;  4HWR A;  4XEO A;  1QF6 A;  1NJ2 A;  3M4Q A;  3PCO B;  3NEN A;  3V8J A;  3QTC A;  3L2Z A;  3L1A A;  2DTO A;  2ZIO A;  4RQE A;  3RKW A;  4G84 A;  2ARS A;  1HC7 A;  2QHS A;  3W3S A;  2CJB A;  3RUX A;  3V7C A;  5C52 B;  4OP0 A;  4G85 A; 
#chains in the Genus database with same CATH topology
 3HY1 A;  2QHU A;  3RIR A;  2P5I A;  3P8Y A;  4KR3 A;  2A8E A;  2PME A;  2Q7G A;  2E10 A;  4TQF A;  4YPF A;  4WJ3 M;  2ZZF A;  2I4M A;  4YCW A;  1H4S A;  3RF1 A;  4H2X B;  2ODR D;  1X55 A;  4XTU A;  3IKM B;  3BJU A;  1NJ8 A;  3E9I A;  1ASY A;  4BWA A;  4XU2 A;  4CH5 A;  4YRO A;  4ZIB A;  3V8K A;  1ADJ A;  4YRN A;  4P74 C;  1NJ6 A;  2EJ9 A;  4XU1 A;  3HXU A;  3QO8 A;  2DXU A;  3REX A;  4H2S A;  4E51 A;  4P74 A;  2IY5 A;  4EO4 A;  1WYD A;  1BIA A;  2DTH A;  4TVA A;  3MF1 A;  3DSQ A;  1IL2 A;  1G5H A;  4UPA A;  3TUP A;  2XTI A;  1ATI A;  3IG2 A;  3VBB A;  4YRL A;  1KMM A;  1USY C;  4YYE A;  2ZIN A;  1E1T A;  3CMQ A;  2ZT8 A;  3P8T A;  4XU3 A;  1WU7 A;  3HRI A;  2I4N A;  1J5W A;  2RHS B;  3V7S A;  1USY A;  4BW9 A;  4YCU A;  4HT4 A;  3PCO A;  4XEM A;  2CIM A;  4P71 C;  3MF2 A;  4YRI A;  4TQD A;  3RL6 A;  1SES A;  4CH4 A;  4YRT A;  2ZZG A;  3A5Z A;  2ZNI A;  4P71 A;  1X01 A;  3IAL A;  1WPY A;  1LYL A;  3HXV A;  3HXW A;  3R07 A;  1KMN A;  1YB3 A;  1X2H A;  4Q15 A;  4P3N A;  4UP8 A;  2DU5 A;  1B70 B;  4YP0 A;  3NEM A;  2E64 A;  2Q5I A;  4YRP A;  3LC0 A;  1W66 A;  3BFM A;  1B7Y B;  4H2X A;  1NJ1 A;  4CH3 A;  2E41 A;  4DPG A;  1E24 A;  2E1H A;  2E5A A;  3RAC A;  5HGQ A;  1SER A;  2DQ3 A;  2RHQ B;  2Q7E A;  1ASZ A;  4TTV A;  5E3I A;  2ZNJ A;  3HXY A;  4YRK A;  4P3P A;  2ART A;  2QHV A;  4HWP A;  3PZC A;  4UP9 A;  1RIQ A;  4YDQ A;  2AMC B;  2DJZ A;  2EWN A;  2J3M A;  4XTX A;  1ADY A;  3ERR A;  2CJA A;  1Z7N A;  3HFZ A;  4TVW A;  3L4G B;  5C51 B;  3VQY A;  4YRF A;  3A7U A;  11AS A;  3G1Z A;  4H2W A;  4K88 A;  4TWA A;  2DEQ A;  4LVJ A;  4XU0 A;  2EL9 A;  3HFZ B;  4X5O A;  3TEH B;  3UH0 A;  4PHC A;  1WLE A;  2ZGW A;  3NET A;  2RHS A;  1GGM A;  1PYS B;  5C53 B;  1NJ5 A;  3LSS A;  2ZT5 A;  1YFR A;  4J15 A;  4WF2 A;  2ALY B;  2Q5H A;  3RKX A;  4RQF A;  3UFG A;  2C7I A;  1QE0 A;  1EIY B;  2ZXF A;  4P72 C;  1FYF A;  2AKW B;  2DTI A;  4RDX A;  1EQR A;  1SET A;  1NYQ A;  2EJF A;  1NNH A;  2DZC A;  4P72 A;  4P3O A;  3UGQ A;  4YRM A;  2ZIM A;  5KNN A;  4KQE A;  3QO7 A;  4P73 C;  1EVK A;  4YRR A;  2ARU A;  4HWO A;  4LNS A;  3VQV A;  4H2Y A;  4P73 A;  2ZT7 A;  3I7F A;  1YFT A;  1B70 A;  4YRJ A;  1JJC B;  3EFR A;  3HTZ A;  4WI1 A;  3HXX A;  4WJ4 A;  1B7Y A;  3QO5 A;  4XTZ A;  4CH6 A;  2I4O A;  3WQZ A;  2CGH A;  3A32 A;  2I4L A;  2ZR2 A;  12AS A;  4PG3 A;  3A5Y A;  2E65 A;  3RGL A;  1B8A A;  3HY0 A;  3UGT A;  5F5W A;  4LVK A;  4EX5 A;  4XTW A;  2RHQ A;  1Z7M A;  2XGT A;  3HRK A;  2ZT6 A;  4XTY A;  1HXD A;  2E3C A;  1HTT A;  3ICA A;  4H2U A;  3RKY A;  2J3L A;  4L87 A;  1H4V B;  2DKG A;  4P75 C;  4CS3 A;  2FYK A;  2AMC A;  4YCV A;  1G5I A;  4YRQ A;  2EJG A;  3A74 A;  1G51 A;  1E22 A;  4YRC A;  3EFS A;  3FJP A;  4XTV A;  2P0L A;  3V8L A;  3TEG A;  3MQZ A;  2CJ9 A;  4P75 A;  1H4Q A;  3KFU A;  3L4G A;  1E1O A;  1C0A A;  4O2D A;  1H4T A;  4YRE A;  3HXZ A;  2DVE A;  2PMF A;  4UP7 A;  1B76 A;  3QNE A;  4OLF A;  2DQ0 A;  3REU A;  2EAY A;  3TEH A;  4DQ2 A;  4CS4 A;  3A7A A;  2Q7H A;  1PYS A;  2ODR C;  4AH6 A;  4RMF A;  2DU7 A;  2ALY A;  1SRY A;  3OD1 A;  1YGB A;  3HFV A;  4HWS A;  2ZZE A;  1EIY A;  4YRG A;  1BBU A;  1EVL A;  2AKW A;  4H2V A;  4NCX A;  4CS2 A;  4LVM A;  1KOG A;  2HNI A;  3E9H A;  2G4C A;  4HWT A;  2DZ9 A;  3LSQ A;  4ZTU B;  5ELO A;  1EFW A;  1BBW A;  2QHT A;  1BIB A;  4HVC A;  1EOV A;  1X56 A;  2C8M A;  3VQW A;  1JJC A;  2ZTG A;  4LVI A;  1L0W A;  2ZR3 A;  1WNL A;  1X54 A;  1VQZ A;  1YFS A;  4K87 A;  2ZCE A;  4Q6G A;  2IY5 B;  2DDZ A;  1N9W A;  5K1P A;  3VQX A;  4ZTZ B;  4LVL A;  4TVA B;  4H2T A;  4HA8 A;  3NEL A;  4K86 A;  1WQW A;  4KR2 A;  3P8V A;  4H02 A;  2DXT A;  3IKL A;  3V7R A;  4TVY A;  1NYR A;  3MEY A;  5ELN A;  1X2G A;  3A7R A;  3M4P A;  1WQ7 A;  3A31 A;  4YRS A;  5K1X A;  4HWR A;  4XEO A;  1QF6 A;  1NJ2 A;  3M4Q A;  3PCO B;  3NEN A;  2NS6 A;  3V8J A;  3QTC A;  3L2Z A;  3L1A A;  2DTO A;  2ZIO A;  4RQE A;  3RKW A;  4G84 A;  2ARS A;  1HC7 A;  2QHS A;  3W3S A;  2CJB A;  3RUX A;  3V7C A;  5C52 B;  4OP0 A;  4G85 A; 
#chains in the Genus database with same CATH homology
 3HY1 A;  2QHU A;  3RIR A;  2P5I A;  3P8Y A;  4KR3 A;  2A8E A;  2PME A;  2Q7G A;  2E10 A;  4TQF A;  4YPF A;  4WJ3 M;  2ZZF A;  2I4M A;  4YCW A;  1H4S A;  3RF1 A;  4H2X B;  2ODR D;  1X55 A;  4XTU A;  3IKM B;  3BJU A;  1NJ8 A;  3E9I A;  1ASY A;  4BWA A;  4XU2 A;  4CH5 A;  4YRO A;  4ZIB A;  3V8K A;  1ADJ A;  4YRN A;  4P74 C;  1NJ6 A;  2EJ9 A;  4XU1 A;  3HXU A;  3QO8 A;  2DXU A;  3REX A;  4H2S A;  4E51 A;  4P74 A;  2IY5 A;  4EO4 A;  1WYD A;  1BIA A;  2DTH A;  4TVA A;  3MF1 A;  3DSQ A;  1IL2 A;  1G5H A;  4UPA A;  3TUP A;  2XTI A;  1ATI A;  3IG2 A;  3VBB A;  4YRL A;  1KMM A;  1USY C;  4YYE A;  2ZIN A;  1E1T A;  3CMQ A;  2ZT8 A;  3P8T A;  4XU3 A;  1WU7 A;  3HRI A;  2I4N A;  1J5W A;  2RHS B;  3V7S A;  1USY A;  4BW9 A;  4YCU A;  4HT4 A;  3PCO A;  4XEM A;  2CIM A;  4P71 C;  3MF2 A;  4YRI A;  4TQD A;  3RL6 A;  1SES A;  4CH4 A;  4YRT A;  2ZZG A;  3A5Z A;  2ZNI A;  4P71 A;  1X01 A;  3IAL A;  1WPY A;  1LYL A;  3HXV A;  3HXW A;  3R07 A;  1KMN A;  1YB3 A;  1X2H A;  4Q15 A;  4P3N A;  4UP8 A;  2DU5 A;  1B70 B;  4YP0 A;  3NEM A;  2E64 A;  2Q5I A;  4YRP A;  3LC0 A;  1W66 A;  3BFM A;  1B7Y B;  4H2X A;  1NJ1 A;  4CH3 A;  2E41 A;  4DPG A;  1E24 A;  2E1H A;  2E5A A;  3RAC A;  5HGQ A;  1SER A;  2DQ3 A;  2RHQ B;  2Q7E A;  1ASZ A;  4TTV A;  5E3I A;  2ZNJ A;  3HXY A;  4YRK A;  4P3P A;  2ART A;  2QHV A;  4HWP A;  3PZC A;  4UP9 A;  1RIQ A;  4YDQ A;  2AMC B;  2DJZ A;  2EWN A;  2J3M A;  4XTX A;  1ADY A;  3ERR A;  2CJA A;  1Z7N A;  3HFZ A;  4TVW A;  3L4G B;  5C51 B;  3VQY A;  4YRF A;  3A7U A;  11AS A;  3G1Z A;  4H2W A;  4K88 A;  4TWA A;  2DEQ A;  4LVJ A;  4XU0 A;  2EL9 A;  3HFZ B;  4X5O A;  3TEH B;  3UH0 A;  4PHC A;  1WLE A;  2ZGW A;  3NET A;  2RHS A;  1GGM A;  1PYS B;  5C53 B;  1NJ5 A;  3LSS A;  2ZT5 A;  1YFR A;  4J15 A;  4WF2 A;  2ALY B;  2Q5H A;  3RKX A;  4RQF A;  3UFG A;  2C7I A;  1QE0 A;  1EIY B;  2ZXF A;  4P72 C;  1FYF A;  2AKW B;  2DTI A;  4RDX A;  1EQR A;  1SET A;  1NYQ A;  2EJF A;  1NNH A;  2DZC A;  4P72 A;  4P3O A;  3UGQ A;  4YRM A;  2ZIM A;  5KNN A;  4KQE A;  3QO7 A;  4P73 C;  1EVK A;  4YRR A;  2ARU A;  4HWO A;  4LNS A;  3VQV A;  4H2Y A;  4P73 A;  2ZT7 A;  3I7F A;  1YFT A;  1B70 A;  4YRJ A;  1JJC B;  3EFR A;  3HTZ A;  4WI1 A;  3HXX A;  4WJ4 A;  1B7Y A;  3QO5 A;  4XTZ A;  4CH6 A;  2I4O A;  3WQZ A;  2CGH A;  3A32 A;  2I4L A;  2ZR2 A;  12AS A;  4PG3 A;  3A5Y A;  2E65 A;  3RGL A;  1B8A A;  3HY0 A;  3UGT A;  5F5W A;  4LVK A;  4EX5 A;  4XTW A;  2RHQ A;  1Z7M A;  2XGT A;  3HRK A;  2ZT6 A;  4XTY A;  1HXD A;  2E3C A;  1HTT A;  3ICA A;  4H2U A;  3RKY A;  2J3L A;  4L87 A;  1H4V B;  2DKG A;  4P75 C;  4CS3 A;  2FYK A;  2AMC A;  4YCV A;  1G5I A;  4YRQ A;  2EJG A;  3A74 A;  1G51 A;  1E22 A;  4YRC A;  3EFS A;  3FJP A;  4XTV A;  2P0L A;  3V8L A;  3TEG A;  3MQZ A;  2CJ9 A;  4P75 A;  1H4Q A;  3KFU A;  3L4G A;  1E1O A;  1C0A A;  4O2D A;  1H4T A;  4YRE A;  3HXZ A;  2DVE A;  2PMF A;  4UP7 A;  1B76 A;  3QNE A;  4OLF A;  2DQ0 A;  3REU A;  2EAY A;  3TEH A;  4DQ2 A;  4CS4 A;  3A7A A;  2Q7H A;  1PYS A;  2ODR C;  4AH6 A;  4RMF A;  2DU7 A;  2ALY A;  1SRY A;  3OD1 A;  1YGB A;  3HFV A;  4HWS A;  2ZZE A;  1EIY A;  4YRG A;  1BBU A;  1EVL A;  2AKW A;  4H2V A;  4NCX A;  4CS2 A;  4LVM A;  1KOG A;  2HNI A;  3E9H A;  2G4C A;  4HWT A;  2DZ9 A;  3LSQ A;  4ZTU B;  5ELO A;  1EFW A;  1BBW A;  2QHT A;  1BIB A;  4HVC A;  1EOV A;  1X56 A;  2C8M A;  3VQW A;  1JJC A;  2ZTG A;  4LVI A;  1L0W A;  2ZR3 A;  1WNL A;  1X54 A;  1VQZ A;  1YFS A;  4K87 A;  2ZCE A;  4Q6G A;  2IY5 B;  2DDZ A;  1N9W A;  5K1P A;  3VQX A;  4ZTZ B;  4LVL A;  4TVA B;  4H2T A;  4HA8 A;  3NEL A;  4K86 A;  1WQW A;  4KR2 A;  3P8V A;  4H02 A;  2DXT A;  3IKL A;  3V7R A;  4TVY A;  1NYR A;  3MEY A;  5ELN A;  1X2G A;  3A7R A;  3M4P A;  1WQ7 A;  3A31 A;  4YRS A;  5K1X A;  4HWR A;  4XEO A;  1QF6 A;  1NJ2 A;  3M4Q A;  3PCO B;  3NEN A;  2NS6 A;  3V8J A;  3QTC A;  3L2Z A;  3L1A A;  2DTO A;  2ZIO A;  4RQE A;  3RKW A;  4G84 A;  2ARS A;  1HC7 A;  2QHS A;  3W3S A;  2CJB A;  3RUX A;  3V7C A;  5C52 B;  4OP0 A;  4G85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...