2QHUA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhuA01
2EJ9A 4HVCA 1YGBA 1ASZA 3QTCA 1WNLA 2J3MA 2DU5A 3RKWA 2QHUA 1B7YA 2ALYB 1QF6A 1J5WA 2DXTA 2ZCEA 4P71A 4HWSA 2E3CA 3L2ZA 4TWAA 4ZTZB 4CS4A 4WJ4A 2CGHA 1GGMA 4E51A 4YP0A 1L0WA 1VQZA 4RQFA 4LNSA 4HWPA 3ERRA 4YRLA 1YB3A 3IKLA 4TVYA 2E10A 3V7SA 3PCOA 3V7CA 4TQDA 1B76A 3RGLA 2I4LA 1X2GA 1W66A 1EQRA 3WQZA 3MF2A 4HWOA 2DQ3A 4Q15A 4H2YA 2CJBA 4UP8A 3TEHB 1X01A 3QO7A 4YRMA 2DU7A 1FYFA 4OP0A 3M4QA 1G5IA 2Q7GA 1KOGA 3HXUA 3A32A 4K87A 5K1XA 4XTXA 3REUA 4H2WA 3HFZA 5F5WA 1C0AA 2PMFA 2DXUA 2CIMA 1EFWA 4P74A 2ZZFA 2ZTGA 3IALA 1EIYB 4H2XA 2DQ0A 1B7YB 2ALYA 3TEGA 1WPYA 1X55A 2QHSA 3M4PA 4CH4A 1BBUA 2IY5B 3HRKA 3HXWA 1G5HA 2EAYA 3RACA 2C8MA 2RHSA 3A7UA 1EVKA 1Z7MA 4J15A 4CH6A 3UH0A 3HXYA 4XTWA 4YROA 3P8VA 3TEHA 1B8AA 1HC7A 2DVEA 1SESA 2E65A 1NJ5A 2CJAA 4XTYA 2ZT6A 2DKGA 5C52B 1KMMA 1NYRA 3PCOB 3L1AA 4L87A 1YFSA 4YCUA 4UP9A 1EVLA 2DTOA 2RHQA 2ZT8A 3RUXA 1JJCA 5C53B 4KR2A 1ATIA 2HNIA 3BJUA 1G51A 12ASA 2FYKA 5C51B 1PYSB 5KNNA 4KR3A 4YPFA 4HWRA 4H2TA 4EO4A 4WJ3M 2ZINA 4BWAA 3ICAA 4P75A 2ARTA 2I4OA 3A5ZA 2ZR2A 2Q7EA 1SERA 3V8JA 4KQEA 4P3PA 3RL6A 4XU3A 4DQ2A 2DEQA 11ASA 1Z7NA 3P8TA 1WU7A 4TVAB 1B70A 3RKYA 4YRRA 2XTIA 4YRKA 1ADJA 3LC0A 1USYC 1IL2A 1NNHA 5K1PA 2E1HA 2EJFA 3LSQA 3MF1A 4NCXA 1BBWA 1WLEA 3I7FA 4PG3A 4RMFA 3L4GB 4DPGA 2EJGA 4EX5A 3UGQA 4YRQA 5ELOA 1YFRA 1BIAA 4YRSA 3CMQA 1H4TA 4X5OA 4O2DA 1E1TA 1BIBA 1HXDA 1WQ7A 1H4QA 2ZNJA 4K88A 3KFUA 3IKMB 4AH6A 3HRIA 3NEMA 4YCWA 4XU1A 3G1ZA 1KMNA 2AMCA 4XEMA 4ZTUB 4CS2A 2ARUA 4BW9A 2Q5IA 2CJ9A 4XEOA 4YRIA 1ADYA 4XU0A 3UGTA 3VQWA 2ZIOA 3A31A 3V8KA 2E64A 2AKWA 4P72A 2RHQB 1NJ8A 2DJZA 3L4GA 3R07A 1LYLA 4H2UA 1SETA 4XTVA 4YDQA 4UP7A 3A7RA 1USYA 2EL9A 4TQFA 4YRJA 4XTZA 4YRNA 2ARSA 3V8LA 4YRCA 5ELNA 2P5IA 2PMEA 3TUPA 3NENA 1WQWA 4TVWA 1NJ6A 2ODRC 1EOVA 4HA8A 5HGQA 4H02A 2ZT5A 2Q5HA 4YRTA 1H4VB 1WYDA 3UFGA 2IY5A 2DTHA 3HY1A 4H2XB 1H4SA 3QNEA 2I4NA 4TTVA 4YRGA 1PYSA 3W3SA 4Q6GA 4XU2A 2EWNA 3REXA 3NELA 3LSSA 4YCVA 3VQYA 4RQEA 2ZGWA 2C7IA 4WI1A 2DZCA 4P73A 2E41A 4CS3A 4YRFA 3E9HA 2QHVA 3DSQA 1HTTA 1E24A 2ZNIA 3VBBA 1SRYA 2ZZEA 2AKWB 2ODRD 2ZT7A 4HWTA 4P71C 4P72C 1ASYA 3HTZA 1X54A 4P74C 1NJ2A 4YYEA 3OD1A 4G85A 3QO8A 4OLFA 4P3OA 4CH5A 1NYQA 2ZIMA 3MEYA 1RIQA 2E5AA 3HFVA 3NETA 2RHSB 4UPAA 4P73C 2ZR3A 2AMCB 4H2VA 2XGTA 2QHTA 2DDZA 4K86A 3HY0A 3FJPA 3A5YA 4P75C 1EIYA 3EFRA 1E22A 3A7AA 4P3NA 1X56A 3RF1A 3E9IA 5E3IA 1JJCB 3HXVA 4H2SA 2ZXFA 3HFZB 3VQVA 1QE0A 4RDXA 3RKXA 2DTIA 1X2HA 2P0LA 3P8YA 1E1OA 1NJ1A 4YRPA 1N9WA 3PZCA 4CH3A 2DZ9A 2ZZGA 4WF2A 3HXZA 3VQXA 3HXXA 3A74A 3RIRA 3IG2A 1B70B 1YFTA 4TVAA 4YREA 4PHCA 3V7RA 4ZIBA 2Q7HA 2J3LA 2I4MA 3QO5A 3EFSA 4G84A 4XTUA 2G4CA 3BFMA
chains in the Genus database with same CATH superfamily
2EJ9A 4HVCA 1YGBA 1ASZA 3QTCA 1WNLA 2J3MA 2DU5A 3RKWA 2QHUA 1B7YA 2ALYB 1QF6A 1J5WA 2DXTA 2ZCEA 4P71A 4HWSA 2E3CA 3L2ZA 4TWAA 3MQZA 4CS4A 4ZTZB 4WJ4A 2CGHA 1GGMA 4E51A 4YP0A 1L0WA 1VQZA 4RQFA 4LNSA 4HWPA 3ERRA 4YRLA 1YB3A 3IKLA 4TVYA 2E10A 3V7SA 3PCOA 2A8EA 3V7CA 4TQDA 1B76A 3RGLA 2I4LA 1X2GA 1W66A 1EQRA 3WQZA 3MF2A 4HWOA 2DQ3A 4Q15A 4H2YA 2CJBA 4UP8A 3TEHB 1X01A 3QO7A 4YRMA 2DU7A 1FYFA 4OP0A 3M4QA 4HT4A 1G5IA 2Q7GA 1KOGA 3HXUA 4LVLA 3A32A 4K87A 5K1XA 4LVMA 4XTXA 3REUA 4H2WA 3HFZA 5F5WA 1C0AA 2PMFA 2DXUA 2CIMA 1EFWA 4P74A 2ZZFA 2ZTGA 3IALA 1EIYB 4H2XA 2DQ0A 1B7YB 2ALYA 3TEGA 1WPYA 1X55A 2QHSA 3M4PA 4CH4A 4LVKA 1BBUA 2IY5B 3HRKA 3HXWA 1G5HA 2EAYA 3RACA 2C8MA 2RHSA 3A7UA 1EVKA 1Z7MA 4J15A 4CH6A 3UH0A 3HXYA 4XTWA 4YROA 3P8VA 3TEHA 1B8AA 1HC7A 2DVEA 1SESA 2E65A 1NJ5A 2CJAA 4XTYA 2ZT6A 2DKGA 5C52B 1KMMA 1NYRA 3PCOB 3L1AA 4L87A 1YFSA 4YCUA 4UP9A 1EVLA 2DTOA 2RHQA 2ZT8A 3RUXA 1JJCA 5C53B 4KR2A 1ATIA 2HNIA 3BJUA 1G51A 12ASA 2FYKA 5C51B 1PYSB 5KNNA 4KR3A 4YPFA 4HWRA 4H2TA 4EO4A 4WJ3M 2ZINA 4BWAA 3ICAA 4P75A 2ARTA 2I4OA 3A5ZA 2ZR2A 2Q7EA 1SERA 3V8JA 4KQEA 4P3PA 3RL6A 4XU3A 4DQ2A 2DEQA 11ASA 1Z7NA 3P8TA 1WU7A 4TVAB 1B70A 3RKYA 4YRRA 2XTIA 4YRKA 1ADJA 3LC0A 1USYC 1IL2A 1NNHA 5K1PA 2E1HA 2EJFA 3LSQA 3MF1A 4NCXA 1BBWA 1WLEA 3I7FA 4PG3A 4RMFA 3L4GB 4DPGA 2EJGA 4EX5A 3UGQA 4YRQA 5ELOA 1YFRA 1BIAA 4YRSA 3CMQA 1H4TA 4X5OA 4O2DA 1E1TA 1BIBA 1HXDA 1WQ7A 1H4QA 2ZNJA 4K88A 3KFUA 3IKMB 4AH6A 3HRIA 3NEMA 4YCWA 4XU1A 3G1ZA 1KMNA 2AMCA 4XEMA 4ZTUB 4CS2A 2ARUA 4BW9A 2Q5IA 2CJ9A 4XEOA 4YRIA 4LVJA 1ADYA 4XU0A 3UGTA 3VQWA 2ZIOA 3A31A 3V8KA 2E64A 2AKWA 4P72A 2RHQB 1NJ8A 2DJZA 3L4GA 3R07A 1LYLA 4H2UA 1SETA 4XTVA 4YDQA 4UP7A 3A7RA 1USYA 2EL9A 4TQFA 4YRJA 4XTZA 4YRNA 2ARSA 3V8LA 4YRCA 5ELNA 2P5IA 2PMEA 4LVIA 3TUPA 3NENA 1WQWA 4TVWA 1NJ6A 2ODRC 1EOVA 4HA8A 5HGQA 4H02A 2ZT5A 2Q5HA 4YRTA 1H4VB 1WYDA 3UFGA 2IY5A 2DTHA 3HY1A 4H2XB 1H4SA 3QNEA 2I4NA 4TTVA 4YRGA 1PYSA 3W3SA 4Q6GA 4XU2A 2EWNA 3REXA 3NELA 3LSSA 4YCVA 3VQYA 4RQEA 2ZGWA 2C7IA 4WI1A 2DZCA 4P73A 2E41A 4CS3A 4YRFA 3E9HA 2QHVA 3DSQA 1HTTA 1E24A 2ZNIA 3VBBA 1SRYA 2ZZEA 2AKWB 2ODRD 2ZT7A 4HWTA 4P71C 4P72C 1ASYA 3HTZA 1X54A 4P74C 1NJ2A 4YYEA 3OD1A 4G85A 3QO8A 4OLFA 4P3OA 4CH5A 1NYQA 2ZIMA 3MEYA 1RIQA 2E5AA 3HFVA 3NETA 2RHSB 4UPAA 4P73C 2ZR3A 2AMCB 4H2VA 2XGTA 2QHTA 2DDZA 2NS6A 4K86A 3HY0A 3FJPA 3A5YA 4P75C 1EIYA 3EFRA 1E22A 3A7AA 4P3NA 1X56A 3RF1A 3E9IA 5E3IA 1JJCB 3HXVA 4H2SA 2ZXFA 3HFZB 3VQVA 1QE0A 4RDXA 3RKXA 2DTIA 1X2HA 2P0LA 3P8YA 1E1OA 1NJ1A 4YRPA 1N9WA 3PZCA 4CH3A 2DZ9A 2ZZGA 4WF2A 3HXZA 3VQXA 3HXXA 3A74A 3RIRA 3IG2A 1B70B 1YFTA 4TVAA 4YREA 4PHCA 3V7RA 4ZIBA 2Q7HA 2J3LA 2I4MA 3QO5A 3EFSA 4G84A 4XTUA 2G4CA 3BFMA
chains in the Genus database with same CATH topology
2EJ9A 4HVCA 1YGBA 1ASZA 3QTCA 1WNLA 2J3MA 2DU5A 3RKWA 2QHUA 1B7YA 2ALYB 1QF6A 1J5WA 2DXTA 2ZCEA 4P71A 4HWSA 2E3CA 3L2ZA 4TWAA 3MQZA 4CS4A 4ZTZB 4WJ4A 2CGHA 1GGMA 4E51A 4YP0A 1L0WA 1VQZA 4RQFA 4LNSA 4HWPA 3ERRA 4YRLA 1YB3A 3IKLA 4TVYA 2E10A 3V7SA 3PCOA 2A8EA 3V7CA 4TQDA 1B76A 3RGLA 2I4LA 1X2GA 1W66A 1EQRA 3WQZA 3MF2A 4HWOA 2DQ3A 4Q15A 4H2YA 2CJBA 4UP8A 3TEHB 1X01A 3QO7A 4YRMA 2DU7A 1FYFA 4OP0A 3M4QA 4HT4A 1G5IA 2Q7GA 1KOGA 3HXUA 4LVLA 3A32A 4K87A 5K1XA 4LVMA 4XTXA 3REUA 4H2WA 3HFZA 5F5WA 1C0AA 2PMFA 2DXUA 2CIMA 1EFWA 4P74A 2ZZFA 2ZTGA 3IALA 1EIYB 4H2XA 2DQ0A 1B7YB 2ALYA 3TEGA 1WPYA 1X55A 2QHSA 3M4PA 4CH4A 4LVKA 1BBUA 2IY5B 3HRKA 3HXWA 1G5HA 2EAYA 3RACA 2C8MA 2RHSA 3A7UA 1EVKA 1Z7MA 4J15A 4CH6A 3UH0A 3HXYA 4XTWA 4YROA 3P8VA 3TEHA 1B8AA 1HC7A 2DVEA 1SESA 2E65A 1NJ5A 2CJAA 4XTYA 2ZT6A 2DKGA 5C52B 1KMMA 1NYRA 3PCOB 3L1AA 4L87A 1YFSA 4YCUA 4UP9A 1EVLA 2DTOA 2RHQA 2ZT8A 3RUXA 1JJCA 5C53B 4KR2A 1ATIA 2HNIA 3BJUA 1G51A 12ASA 2FYKA 5C51B 1PYSB 5KNNA 4KR3A 4YPFA 4HWRA 4H2TA 4EO4A 4WJ3M 2ZINA 4BWAA 3ICAA 4P75A 2ARTA 2I4OA 3A5ZA 2ZR2A 2Q7EA 1SERA 3V8JA 4KQEA 4P3PA 3RL6A 4XU3A 4DQ2A 2DEQA 11ASA 1Z7NA 3P8TA 1WU7A 4TVAB 1B70A 3RKYA 4YRRA 2XTIA 4YRKA 1ADJA 3LC0A 1USYC 1IL2A 1NNHA 5K1PA 2E1HA 2EJFA 3LSQA 3MF1A 4NCXA 1BBWA 1WLEA 3I7FA 4PG3A 4RMFA 3L4GB 4DPGA 2EJGA 4EX5A 3UGQA 4YRQA 5ELOA 1YFRA 1BIAA 4YRSA 3CMQA 1H4TA 4X5OA 4O2DA 1E1TA 1BIBA 1HXDA 1WQ7A 1H4QA 2ZNJA 4K88A 3KFUA 3IKMB 4AH6A 3HRIA 3NEMA 4YCWA 4XU1A 3G1ZA 1KMNA 2AMCA 4XEMA 4ZTUB 4CS2A 2ARUA 4BW9A 2Q5IA 2CJ9A 4XEOA 4YRIA 4LVJA 1ADYA 4XU0A 3UGTA 3VQWA 2ZIOA 3A31A 3V8KA 2E64A 2AKWA 4P72A 2RHQB 1NJ8A 2DJZA 3L4GA 3R07A 1LYLA 4H2UA 1SETA 4XTVA 4YDQA 4UP7A 3A7RA 1USYA 2EL9A 4TQFA 4YRJA 4XTZA 4YRNA 2ARSA 3V8LA 4YRCA 5ELNA 2P5IA 2PMEA 4LVIA 3TUPA 3NENA 1WQWA 4TVWA 1NJ6A 2ODRC 1EOVA 4HA8A 5HGQA 4H02A 2ZT5A 2Q5HA 4YRTA 1H4VB 1WYDA 3UFGA 2IY5A 2DTHA 3HY1A 4H2XB 1H4SA 3QNEA 2I4NA 4TTVA 4YRGA 1PYSA 3W3SA 4Q6GA 4XU2A 2EWNA 3REXA 3NELA 3LSSA 4YCVA 3VQYA 4RQEA 2ZGWA 2C7IA 4WI1A 2DZCA 4P73A 2E41A 4CS3A 4YRFA 3E9HA 2QHVA 3DSQA 1HTTA 1E24A 2ZNIA 3VBBA 1SRYA 2ZZEA 2AKWB 2ODRD 2ZT7A 4HWTA 4P71C 4P72C 1ASYA 3HTZA 1X54A 4P74C 1NJ2A 4YYEA 3OD1A 4G85A 3QO8A 4OLFA 4P3OA 4CH5A 1NYQA 2ZIMA 3MEYA 1RIQA 2E5AA 3HFVA 3NETA 2RHSB 4UPAA 4P73C 2ZR3A 2AMCB 4H2VA 2XGTA 2QHTA 2DDZA 2NS6A 4K86A 3HY0A 3FJPA 3A5YA 4P75C 1EIYA 3EFRA 1E22A 3A7AA 4P3NA 1X56A 3RF1A 3E9IA 5E3IA 1JJCB 3HXVA 4H2SA 2ZXFA 3HFZB 3VQVA 1QE0A 4RDXA 3RKXA 2DTIA 1X2HA 2P0LA 3P8YA 1E1OA 1NJ1A 4YRPA 1N9WA 3PZCA 4CH3A 2DZ9A 2ZZGA 4WF2A 3HXZA 3VQXA 3HXXA 3A74A 3RIRA 3IG2A 1B70B 1YFTA 4TVAA 4YREA 4PHCA 3V7RA 4ZIBA 2Q7HA 2J3LA 2I4MA 3QO5A 3EFSA 4G84A 4XTUA 2G4CA 3BFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ9 A;  4HVC A;  1YGB A;  1ASZ A;  3QTC A;  1WNL A;  2J3M A;  2DU5 A;  3RKW A;  2QHU A;  1B7Y A;  2ALY B;  1QF6 A;  1J5W A;  2DXT A;  2ZCE A;  4P71 A;  4HWS A;  2E3C A;  3L2Z A;  4TWA A;  4ZTZ B;  4CS4 A;  4WJ4 A;  2CGH A;  1GGM A;  4E51 A;  4YP0 A;  1L0W A;  1VQZ A;  4RQF A;  4LNS A;  4HWP A;  3ERR A;  4YRL A;  1YB3 A;  3IKL A;  4TVY A;  2E10 A;  3V7S A;  3PCO A;  3V7C A;  4TQD A;  1B76 A;  3RGL A;  2I4L A;  1X2G A;  1W66 A;  1EQR A;  3WQZ A;  3MF2 A;  4HWO A;  2DQ3 A;  4Q15 A;  4H2Y A;  2CJB A;  4UP8 A;  3TEH B;  1X01 A;  3QO7 A;  4YRM A;  2DU7 A;  1FYF A;  4OP0 A;  3M4Q A;  1G5I A;  2Q7G A;  1KOG A;  3HXU A;  3A32 A;  4K87 A;  5K1X A;  4XTX A;  3REU A;  4H2W A;  3HFZ A;  5F5W A;  1C0A A;  2PMF A;  2DXU A;  2CIM A;  1EFW A;  4P74 A;  2ZZF A;  2ZTG A;  3IAL A;  1EIY B;  4H2X A;  2DQ0 A;  1B7Y B;  2ALY A;  3TEG A;  1WPY A;  1X55 A;  2QHS A;  3M4P A;  4CH4 A;  1BBU A;  2IY5 B;  3HRK A;  3HXW A;  1G5H A;  2EAY A;  3RAC A;  2C8M A;  2RHS A;  3A7U A;  1EVK A;  1Z7M A;  4J15 A;  4CH6 A;  3UH0 A;  3HXY A;  4XTW A;  4YRO A;  3P8V A;  3TEH A;  1B8A A;  1HC7 A;  2DVE A;  1SES A;  2E65 A;  1NJ5 A;  2CJA A;  4XTY A;  2ZT6 A;  2DKG A;  5C52 B;  1KMM A;  1NYR A;  3PCO B;  3L1A A;  4L87 A;  1YFS A;  4YCU A;  4UP9 A;  1EVL A;  2DTO A;  2RHQ A;  2ZT8 A;  3RUX A;  1JJC A;  5C53 B;  4KR2 A;  1ATI A;  2HNI A;  3BJU A;  1G51 A;  12AS A;  2FYK A;  5C51 B;  1PYS B;  5KNN A;  4KR3 A;  4YPF A;  4HWR A;  4H2T A;  4EO4 A;  4WJ3 M;  2ZIN A;  4BWA A;  3ICA A;  4P75 A;  2ART A;  2I4O A;  3A5Z A;  2ZR2 A;  2Q7E A;  1SER A;  3V8J A;  4KQE A;  4P3P A;  3RL6 A;  4XU3 A;  4DQ2 A;  2DEQ A;  11AS A;  1Z7N A;  3P8T A;  1WU7 A;  4TVA B;  1B70 A;  3RKY A;  4YRR A;  2XTI A;  4YRK A;  1ADJ A;  3LC0 A;  1USY C;  1IL2 A;  1NNH A;  5K1P A;  2E1H A;  2EJF A;  3LSQ A;  3MF1 A;  4NCX A;  1BBW A;  1WLE A;  3I7F A;  4PG3 A;  4RMF A;  3L4G B;  4DPG A;  2EJG A;  4EX5 A;  3UGQ A;  4YRQ A;  5ELO A;  1YFR A;  1BIA A;  4YRS A;  3CMQ A;  1H4T A;  4X5O A;  4O2D A;  1E1T A;  1BIB A;  1HXD A;  1WQ7 A;  1H4Q A;  2ZNJ A;  4K88 A;  3KFU A;  3IKM B;  4AH6 A;  3HRI A;  3NEM A;  4YCW A;  4XU1 A;  3G1Z A;  1KMN A;  2AMC A;  4XEM A;  4ZTU B;  4CS2 A;  2ARU A;  4BW9 A;  2Q5I A;  2CJ9 A;  4XEO A;  4YRI A;  1ADY A;  4XU0 A;  3UGT A;  3VQW A;  2ZIO A;  3A31 A;  3V8K A;  2E64 A;  2AKW A;  4P72 A;  2RHQ B;  1NJ8 A;  2DJZ A;  3L4G A;  3R07 A;  1LYL A;  4H2U A;  1SET A;  4XTV A;  4YDQ A;  4UP7 A;  3A7R A;  1USY A;  2EL9 A;  4TQF A;  4YRJ A;  4XTZ A;  4YRN A;  2ARS A;  3V8L A;  4YRC A;  5ELN A;  2P5I A;  2PME A;  3TUP A;  3NEN A;  1WQW A;  4TVW A;  1NJ6 A;  2ODR C;  1EOV A;  4HA8 A;  5HGQ A;  4H02 A;  2ZT5 A;  2Q5H A;  4YRT A;  1H4V B;  1WYD A;  3UFG A;  2IY5 A;  2DTH A;  3HY1 A;  4H2X B;  1H4S A;  3QNE A;  2I4N A;  4TTV A;  4YRG A;  1PYS A;  3W3S A;  4Q6G A;  4XU2 A;  2EWN A;  3REX A;  3NEL A;  3LSS A;  4YCV A;  3VQY A;  4RQE A;  2ZGW A;  2C7I A;  4WI1 A;  2DZC A;  4P73 A;  2E41 A;  4CS3 A;  4YRF A;  3E9H A;  2QHV A;  3DSQ A;  1HTT A;  1E24 A;  2ZNI A;  3VBB A;  1SRY A;  2ZZE A;  2AKW B;  2ODR D;  2ZT7 A;  4HWT A;  4P71 C;  4P72 C;  1ASY A;  3HTZ A;  1X54 A;  4P74 C;  1NJ2 A;  4YYE A;  3OD1 A;  4G85 A;  3QO8 A;  4OLF A;  4P3O A;  4CH5 A;  1NYQ A;  2ZIM A;  3MEY A;  1RIQ A;  2E5A A;  3HFV A;  3NET A;  2RHS B;  4UPA A;  4P73 C;  2ZR3 A;  2AMC B;  4H2V A;  2XGT A;  2QHT A;  2DDZ A;  4K86 A;  3HY0 A;  3FJP A;  3A5Y A;  4P75 C;  1EIY A;  3EFR A;  1E22 A;  3A7A A;  4P3N A;  1X56 A;  3RF1 A;  3E9I A;  5E3I A;  1JJC B;  3HXV A;  4H2S A;  2ZXF A;  3HFZ B;  3VQV A;  1QE0 A;  4RDX A;  3RKX A;  2DTI A;  1X2H A;  2P0L A;  3P8Y A;  1E1O A;  1NJ1 A;  4YRP A;  1N9W A;  3PZC A;  4CH3 A;  2DZ9 A;  2ZZG A;  4WF2 A;  3HXZ A;  3VQX A;  3HXX A;  3A74 A;  3RIR A;  3IG2 A;  1B70 B;  1YFT A;  4TVA A;  4YRE A;  4PHC A;  3V7R A;  4ZIB A;  2Q7H A;  2J3L A;  2I4M A;  3QO5 A;  3EFS A;  4G84 A;  4XTU A;  2G4C A;  3BFM A; 
#chains in the Genus database with same CATH topology
 2EJ9 A;  4HVC A;  1YGB A;  1ASZ A;  3QTC A;  1WNL A;  2J3M A;  2DU5 A;  3RKW A;  2QHU A;  1B7Y A;  2ALY B;  1QF6 A;  1J5W A;  2DXT A;  2ZCE A;  4P71 A;  4HWS A;  2E3C A;  3L2Z A;  4TWA A;  3MQZ A;  4CS4 A;  4ZTZ B;  4WJ4 A;  2CGH A;  1GGM A;  4E51 A;  4YP0 A;  1L0W A;  1VQZ A;  4RQF A;  4LNS A;  4HWP A;  3ERR A;  4YRL A;  1YB3 A;  3IKL A;  4TVY A;  2E10 A;  3V7S A;  3PCO A;  2A8E A;  3V7C A;  4TQD A;  1B76 A;  3RGL A;  2I4L A;  1X2G A;  1W66 A;  1EQR A;  3WQZ A;  3MF2 A;  4HWO A;  2DQ3 A;  4Q15 A;  4H2Y A;  2CJB A;  4UP8 A;  3TEH B;  1X01 A;  3QO7 A;  4YRM A;  2DU7 A;  1FYF A;  4OP0 A;  3M4Q A;  4HT4 A;  1G5I A;  2Q7G A;  1KOG A;  3HXU A;  4LVL A;  3A32 A;  4K87 A;  5K1X A;  4LVM A;  4XTX A;  3REU A;  4H2W A;  3HFZ A;  5F5W A;  1C0A A;  2PMF A;  2DXU A;  2CIM A;  1EFW A;  4P74 A;  2ZZF A;  2ZTG A;  3IAL A;  1EIY B;  4H2X A;  2DQ0 A;  1B7Y B;  2ALY A;  3TEG A;  1WPY A;  1X55 A;  2QHS A;  3M4P A;  4CH4 A;  4LVK A;  1BBU A;  2IY5 B;  3HRK A;  3HXW A;  1G5H A;  2EAY A;  3RAC A;  2C8M A;  2RHS A;  3A7U A;  1EVK A;  1Z7M A;  4J15 A;  4CH6 A;  3UH0 A;  3HXY A;  4XTW A;  4YRO A;  3P8V A;  3TEH A;  1B8A A;  1HC7 A;  2DVE A;  1SES A;  2E65 A;  1NJ5 A;  2CJA A;  4XTY A;  2ZT6 A;  2DKG A;  5C52 B;  1KMM A;  1NYR A;  3PCO B;  3L1A A;  4L87 A;  1YFS A;  4YCU A;  4UP9 A;  1EVL A;  2DTO A;  2RHQ A;  2ZT8 A;  3RUX A;  1JJC A;  5C53 B;  4KR2 A;  1ATI A;  2HNI A;  3BJU A;  1G51 A;  12AS A;  2FYK A;  5C51 B;  1PYS B;  5KNN A;  4KR3 A;  4YPF A;  4HWR A;  4H2T A;  4EO4 A;  4WJ3 M;  2ZIN A;  4BWA A;  3ICA A;  4P75 A;  2ART A;  2I4O A;  3A5Z A;  2ZR2 A;  2Q7E A;  1SER A;  3V8J A;  4KQE A;  4P3P A;  3RL6 A;  4XU3 A;  4DQ2 A;  2DEQ A;  11AS A;  1Z7N A;  3P8T A;  1WU7 A;  4TVA B;  1B70 A;  3RKY A;  4YRR A;  2XTI A;  4YRK A;  1ADJ A;  3LC0 A;  1USY C;  1IL2 A;  1NNH A;  5K1P A;  2E1H A;  2EJF A;  3LSQ A;  3MF1 A;  4NCX A;  1BBW A;  1WLE A;  3I7F A;  4PG3 A;  4RMF A;  3L4G B;  4DPG A;  2EJG A;  4EX5 A;  3UGQ A;  4YRQ A;  5ELO A;  1YFR A;  1BIA A;  4YRS A;  3CMQ A;  1H4T A;  4X5O A;  4O2D A;  1E1T A;  1BIB A;  1HXD A;  1WQ7 A;  1H4Q A;  2ZNJ A;  4K88 A;  3KFU A;  3IKM B;  4AH6 A;  3HRI A;  3NEM A;  4YCW A;  4XU1 A;  3G1Z A;  1KMN A;  2AMC A;  4XEM A;  4ZTU B;  4CS2 A;  2ARU A;  4BW9 A;  2Q5I A;  2CJ9 A;  4XEO A;  4YRI A;  4LVJ A;  1ADY A;  4XU0 A;  3UGT A;  3VQW A;  2ZIO A;  3A31 A;  3V8K A;  2E64 A;  2AKW A;  4P72 A;  2RHQ B;  1NJ8 A;  2DJZ A;  3L4G A;  3R07 A;  1LYL A;  4H2U A;  1SET A;  4XTV A;  4YDQ A;  4UP7 A;  3A7R A;  1USY A;  2EL9 A;  4TQF A;  4YRJ A;  4XTZ A;  4YRN A;  2ARS A;  3V8L A;  4YRC A;  5ELN A;  2P5I A;  2PME A;  4LVI A;  3TUP A;  3NEN A;  1WQW A;  4TVW A;  1NJ6 A;  2ODR C;  1EOV A;  4HA8 A;  5HGQ A;  4H02 A;  2ZT5 A;  2Q5H A;  4YRT A;  1H4V B;  1WYD A;  3UFG A;  2IY5 A;  2DTH A;  3HY1 A;  4H2X B;  1H4S A;  3QNE A;  2I4N A;  4TTV A;  4YRG A;  1PYS A;  3W3S A;  4Q6G A;  4XU2 A;  2EWN A;  3REX A;  3NEL A;  3LSS A;  4YCV A;  3VQY A;  4RQE A;  2ZGW A;  2C7I A;  4WI1 A;  2DZC A;  4P73 A;  2E41 A;  4CS3 A;  4YRF A;  3E9H A;  2QHV A;  3DSQ A;  1HTT A;  1E24 A;  2ZNI A;  3VBB A;  1SRY A;  2ZZE A;  2AKW B;  2ODR D;  2ZT7 A;  4HWT A;  4P71 C;  4P72 C;  1ASY A;  3HTZ A;  1X54 A;  4P74 C;  1NJ2 A;  4YYE A;  3OD1 A;  4G85 A;  3QO8 A;  4OLF A;  4P3O A;  4CH5 A;  1NYQ A;  2ZIM A;  3MEY A;  1RIQ A;  2E5A A;  3HFV A;  3NET A;  2RHS B;  4UPA A;  4P73 C;  2ZR3 A;  2AMC B;  4H2V A;  2XGT A;  2QHT A;  2DDZ A;  2NS6 A;  4K86 A;  3HY0 A;  3FJP A;  3A5Y A;  4P75 C;  1EIY A;  3EFR A;  1E22 A;  3A7A A;  4P3N A;  1X56 A;  3RF1 A;  3E9I A;  5E3I A;  1JJC B;  3HXV A;  4H2S A;  2ZXF A;  3HFZ B;  3VQV A;  1QE0 A;  4RDX A;  3RKX A;  2DTI A;  1X2H A;  2P0L A;  3P8Y A;  1E1O A;  1NJ1 A;  4YRP A;  1N9W A;  3PZC A;  4CH3 A;  2DZ9 A;  2ZZG A;  4WF2 A;  3HXZ A;  3VQX A;  3HXX A;  3A74 A;  3RIR A;  3IG2 A;  1B70 B;  1YFT A;  4TVA A;  4YRE A;  4PHC A;  3V7R A;  4ZIB A;  2Q7H A;  2J3L A;  2I4M A;  3QO5 A;  3EFS A;  4G84 A;  4XTU A;  2G4C A;  3BFM A; 
#chains in the Genus database with same CATH homology
 2EJ9 A;  4HVC A;  1YGB A;  1ASZ A;  3QTC A;  1WNL A;  2J3M A;  2DU5 A;  3RKW A;  2QHU A;  1B7Y A;  2ALY B;  1QF6 A;  1J5W A;  2DXT A;  2ZCE A;  4P71 A;  4HWS A;  2E3C A;  3L2Z A;  4TWA A;  3MQZ A;  4CS4 A;  4ZTZ B;  4WJ4 A;  2CGH A;  1GGM A;  4E51 A;  4YP0 A;  1L0W A;  1VQZ A;  4RQF A;  4LNS A;  4HWP A;  3ERR A;  4YRL A;  1YB3 A;  3IKL A;  4TVY A;  2E10 A;  3V7S A;  3PCO A;  2A8E A;  3V7C A;  4TQD A;  1B76 A;  3RGL A;  2I4L A;  1X2G A;  1W66 A;  1EQR A;  3WQZ A;  3MF2 A;  4HWO A;  2DQ3 A;  4Q15 A;  4H2Y A;  2CJB A;  4UP8 A;  3TEH B;  1X01 A;  3QO7 A;  4YRM A;  2DU7 A;  1FYF A;  4OP0 A;  3M4Q A;  4HT4 A;  1G5I A;  2Q7G A;  1KOG A;  3HXU A;  4LVL A;  3A32 A;  4K87 A;  5K1X A;  4LVM A;  4XTX A;  3REU A;  4H2W A;  3HFZ A;  5F5W A;  1C0A A;  2PMF A;  2DXU A;  2CIM A;  1EFW A;  4P74 A;  2ZZF A;  2ZTG A;  3IAL A;  1EIY B;  4H2X A;  2DQ0 A;  1B7Y B;  2ALY A;  3TEG A;  1WPY A;  1X55 A;  2QHS A;  3M4P A;  4CH4 A;  4LVK A;  1BBU A;  2IY5 B;  3HRK A;  3HXW A;  1G5H A;  2EAY A;  3RAC A;  2C8M A;  2RHS A;  3A7U A;  1EVK A;  1Z7M A;  4J15 A;  4CH6 A;  3UH0 A;  3HXY A;  4XTW A;  4YRO A;  3P8V A;  3TEH A;  1B8A A;  1HC7 A;  2DVE A;  1SES A;  2E65 A;  1NJ5 A;  2CJA A;  4XTY A;  2ZT6 A;  2DKG A;  5C52 B;  1KMM A;  1NYR A;  3PCO B;  3L1A A;  4L87 A;  1YFS A;  4YCU A;  4UP9 A;  1EVL A;  2DTO A;  2RHQ A;  2ZT8 A;  3RUX A;  1JJC A;  5C53 B;  4KR2 A;  1ATI A;  2HNI A;  3BJU A;  1G51 A;  12AS A;  2FYK A;  5C51 B;  1PYS B;  5KNN A;  4KR3 A;  4YPF A;  4HWR A;  4H2T A;  4EO4 A;  4WJ3 M;  2ZIN A;  4BWA A;  3ICA A;  4P75 A;  2ART A;  2I4O A;  3A5Z A;  2ZR2 A;  2Q7E A;  1SER A;  3V8J A;  4KQE A;  4P3P A;  3RL6 A;  4XU3 A;  4DQ2 A;  2DEQ A;  11AS A;  1Z7N A;  3P8T A;  1WU7 A;  4TVA B;  1B70 A;  3RKY A;  4YRR A;  2XTI A;  4YRK A;  1ADJ A;  3LC0 A;  1USY C;  1IL2 A;  1NNH A;  5K1P A;  2E1H A;  2EJF A;  3LSQ A;  3MF1 A;  4NCX A;  1BBW A;  1WLE A;  3I7F A;  4PG3 A;  4RMF A;  3L4G B;  4DPG A;  2EJG A;  4EX5 A;  3UGQ A;  4YRQ A;  5ELO A;  1YFR A;  1BIA A;  4YRS A;  3CMQ A;  1H4T A;  4X5O A;  4O2D A;  1E1T A;  1BIB A;  1HXD A;  1WQ7 A;  1H4Q A;  2ZNJ A;  4K88 A;  3KFU A;  3IKM B;  4AH6 A;  3HRI A;  3NEM A;  4YCW A;  4XU1 A;  3G1Z A;  1KMN A;  2AMC A;  4XEM A;  4ZTU B;  4CS2 A;  2ARU A;  4BW9 A;  2Q5I A;  2CJ9 A;  4XEO A;  4YRI A;  4LVJ A;  1ADY A;  4XU0 A;  3UGT A;  3VQW A;  2ZIO A;  3A31 A;  3V8K A;  2E64 A;  2AKW A;  4P72 A;  2RHQ B;  1NJ8 A;  2DJZ A;  3L4G A;  3R07 A;  1LYL A;  4H2U A;  1SET A;  4XTV A;  4YDQ A;  4UP7 A;  3A7R A;  1USY A;  2EL9 A;  4TQF A;  4YRJ A;  4XTZ A;  4YRN A;  2ARS A;  3V8L A;  4YRC A;  5ELN A;  2P5I A;  2PME A;  4LVI A;  3TUP A;  3NEN A;  1WQW A;  4TVW A;  1NJ6 A;  2ODR C;  1EOV A;  4HA8 A;  5HGQ A;  4H02 A;  2ZT5 A;  2Q5H A;  4YRT A;  1H4V B;  1WYD A;  3UFG A;  2IY5 A;  2DTH A;  3HY1 A;  4H2X B;  1H4S A;  3QNE A;  2I4N A;  4TTV A;  4YRG A;  1PYS A;  3W3S A;  4Q6G A;  4XU2 A;  2EWN A;  3REX A;  3NEL A;  3LSS A;  4YCV A;  3VQY A;  4RQE A;  2ZGW A;  2C7I A;  4WI1 A;  2DZC A;  4P73 A;  2E41 A;  4CS3 A;  4YRF A;  3E9H A;  2QHV A;  3DSQ A;  1HTT A;  1E24 A;  2ZNI A;  3VBB A;  1SRY A;  2ZZE A;  2AKW B;  2ODR D;  2ZT7 A;  4HWT A;  4P71 C;  4P72 C;  1ASY A;  3HTZ A;  1X54 A;  4P74 C;  1NJ2 A;  4YYE A;  3OD1 A;  4G85 A;  3QO8 A;  4OLF A;  4P3O A;  4CH5 A;  1NYQ A;  2ZIM A;  3MEY A;  1RIQ A;  2E5A A;  3HFV A;  3NET A;  2RHS B;  4UPA A;  4P73 C;  2ZR3 A;  2AMC B;  4H2V A;  2XGT A;  2QHT A;  2DDZ A;  2NS6 A;  4K86 A;  3HY0 A;  3FJP A;  3A5Y A;  4P75 C;  1EIY A;  3EFR A;  1E22 A;  3A7A A;  4P3N A;  1X56 A;  3RF1 A;  3E9I A;  5E3I A;  1JJC B;  3HXV A;  4H2S A;  2ZXF A;  3HFZ B;  3VQV A;  1QE0 A;  4RDX A;  3RKX A;  2DTI A;  1X2H A;  2P0L A;  3P8Y A;  1E1O A;  1NJ1 A;  4YRP A;  1N9W A;  3PZC A;  4CH3 A;  2DZ9 A;  2ZZG A;  4WF2 A;  3HXZ A;  3VQX A;  3HXX A;  3A74 A;  3RIR A;  3IG2 A;  1B70 B;  1YFT A;  4TVA A;  4YRE A;  4PHC A;  3V7R A;  4ZIB A;  2Q7H A;  2J3L A;  2I4M A;  3QO5 A;  3EFS A;  4G84 A;  4XTU A;  2G4C A;  3BFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...