2QHVA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 67
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhvA01
3HXWA 4H02A 5C51B 2HNIA 3REXA 1NJ6A 2QHUA 1SRYA 4HVCA 3VQYA 2Q7GA 4YRKA 3BFMA 2DKGA 1KOGA 4H2XB 3V8KA 3ERRA 1ASYA 3TEGA 2ZZGA 3V7SA 4EO4A 1H4TA 3LSQA 3PZCA 1USYC 3HXVA 1E24A 4G85A 3REUA 4O2DA 4X5OA 3QO8A 2DVEA 2DTIA 4P73A 3NEMA 2DXUA 3HFVA 1EFWA 3A7UA 4YRJA 3HXXA 3R07A 4YRPA 2C7IA 4P72C 4ZTUB 4YRGA 3V8JA 3IKLA 4PG3A 2ZT8A 4YRFA 4K88A 1HXDA 3RKYA 3HTZA 3A74A 4XEOA 4XTVA 2Q5HA 3UGQA 4XU3A 4YCUA 4WF2A 2AMCB 2J3MA 1N9WA 2DQ0A 1X2HA 3DSQA 3W3SA 3KFUA 4WJ4A 3IG2A 2ZIMA 4P75C 1BIBA 2DTOA 3RIRA 3ICAA 1KMMA 1PYSA 2ZIOA 4NCXA 1YFRA 2CJBA 2RHQA 4TQDA 4XU1A 4YREA 2ODRC 1NNHA 2CGHA 5F5WA 4XTZA 1EQRA 4KQEA 2DEQA 1J5WA 4YCVA 3A31A 4YYEA 2E5AA 1H4QA 4Q6GA 4H2YA 4P71C 4P3PA 3RF1A 4HA8A 1WLEA 3QNEA 4H2SA 2PMEA 1X55A 1ADJA 2QHSA 4AH6A 4HWSA 3M4PA 4CS4A 2CJAA 2I4MA 4HWRA 3QO7A 2EL9A 4ZTZB 1NYQA 2Q5IA 1G5IA 4YCWA 4DQ2A 2IY5A 3VQXA 1W66A 4XTWA 3PCOA 2AMCA 2E10A 2ALYB 2ZZEA 3RKWA 2EJFA 1BIAA 2DZCA 4UPAA 3L2ZA 1SERA 1H4VB 3TEHA 1WU7A 3MEYA 2E3CA 4XU2A 4BW9A 4P74C 2ZZFA 1Z7MA 1PYSB 1EOVA 1SESA 3P8TA 4YRMA 2RHQB 1X54A 4YDQA 4CH4A 4H2TA 2P5IA 3V7CA 4YRQA 3FJPA 4YRCA 2CIMA 5HGQA 1NJ8A 2ARTA 3I7FA 3V7RA 4UP7A 4BWAA 3UFGA 2ZCEA 3MF1A 3HXZA 2IY5B 1IL2A 1E1OA 1YGBA 1YFTA 2ALYA 2QHTA 1Z7NA 4LNSA 3PCOB 1E22A 1BBUA 4DPGA 2G4CA 1WQWA 3E9HA 5C53B 1ATIA 1X56A 3TEHB 4HWTA 2ZTGA 2DU5A 4P72A 3VBBA 1YB3A 4Q15A 2FYKA 4XEMA 1WNLA 3L1AA 3VQWA 1EVKA 4YP0A 1HTTA 3LC0A 1NJ2A 2ZNJA 2EAYA 4TVWA 5K1PA 4RQEA 2EWNA 3A5ZA 4WI1A 1X01A 4L87A 2ZGWA 4XU0A 1QF6A 1E1TA 1B76A 3RGLA 3RACA 2DTHA 4ZIBA 3G1ZA 4XTYA 5E3IA 4UP9A 1VQZA 4EX5A 2ZT5A 2E1HA 4UP8A 3P8YA 4K87A 3IKMB 1EVLA 4CH3A 4OP0A 5C52B 4YRRA 2I4NA 4YRIA 4YRLA 1B7YB 1EIYA 4WJ3M 3WQZA 12ASA 3BJUA 4CS2A 2ZNIA 1LYLA 3HFZA 4H2WA 1C0AA 2DDZA 3P8VA 1G51A 3HY0A 1GGMA 4K86A 3HXYA 2QHVA 3HRIA 2E64A 2DJZA 4YRTA 4CH6A 2Q7EA 3RKXA 2DU7A 3TUPA 4P73C 3EFRA 1NJ5A 1ASZA 3VQVA 3M4QA 1YFSA 3QTCA 5ELNA 4P74A 2E65A 3RL6A 3L4GB 1KMNA 1FYFA 4TVAB 2E41A 3QO5A 2AKWA 1B7YA 3HXUA 4TVYA 2RHSA 1USYA 3MF2A 4CS3A 3EFSA 2DZ9A 3IALA 4YRSA 3CMQA 2ZT7A 1WQ7A 1EIYB 4PHCA 4RQFA 2EJGA 2DQ3A 4P3OA 4HWOA 3HFZB 4J15A 1B70A 4YPFA 1NYRA 2XTIA 3A7RA 2PMFA 1RIQA 4H2UA 2Q7HA 2DXTA 1JJCB 5K1XA 1QE0A 2J3LA 4CH5A 2ZR3A 1H4SA 1NJ1A 2ZT6A 2EJ9A 3NENA 3V8LA 2XGTA 11ASA 4HWPA 2ZXFA 2ARSA 4H2XA 1ADYA 1G5HA 4P75A 4RDXA 4TQFA 3LSSA 2C8MA 4KR2A 1B8AA 2P0LA 3L4GA 4KR3A 3OD1A 4TVAA 3A5YA 4YROA 4TWAA 4TTVA 1WYDA 3HY1A 3NELA 2I4OA 4OLFA 1WPYA 4P71A 1BBWA 2AKWB 4G84A 5ELOA 2RHSB 1L0WA 1X2GA 3E9IA 3UGTA 3NETA 5KNNA 1HC7A 2ZINA 2I4LA 4H2VA 3RUXA 3A7AA 4XTUA 2ZR2A 2ARUA 1SETA 2CJ9A 4P3NA 4YRNA 4RMFA 3UH0A 4XTXA 3A32A 3HRKA 1B70B 2ODRD 4E51A 1JJCA
chains in the Genus database with same CATH superfamily
3HXWA 4H02A 5C51B 2HNIA 3REXA 1NJ6A 2QHUA 1SRYA 4HVCA 3VQYA 2Q7GA 4YRKA 3BFMA 2DKGA 1KOGA 4H2XB 3V8KA 2A8EA 3ERRA 1ASYA 3TEGA 2ZZGA 3V7SA 4EO4A 1H4TA 3LSQA 3PZCA 1USYC 3HXVA 1E24A 4G85A 3REUA 4O2DA 4X5OA 4LVMA 3QO8A 2DVEA 2DTIA 4P73A 3NEMA 2DXUA 3HFVA 1EFWA 3A7UA 4YRJA 3HXXA 3R07A 4YRPA 4LVKA 2C7IA 4P72C 4ZTUB 4YRGA 3V8JA 3IKLA 4PG3A 2ZT8A 4YRFA 4K88A 1HXDA 3RKYA 3HTZA 3A74A 4XEOA 4XTVA 2Q5HA 3UGQA 4XU3A 4YCUA 4WF2A 2AMCB 2J3MA 1N9WA 2DQ0A 1X2HA 3DSQA 3W3SA 3KFUA 4WJ4A 3IG2A 2ZIMA 4P75C 1BIBA 2DTOA 3RIRA 3ICAA 1KMMA 1PYSA 2ZIOA 4NCXA 1YFRA 2CJBA 2RHQA 4TQDA 4XU1A 4YREA 2ODRC 1NNHA 2CGHA 5F5WA 4XTZA 1EQRA 4KQEA 2DEQA 1J5WA 4YCVA 3A31A 4YYEA 2E5AA 1H4QA 4Q6GA 4H2YA 4P71C 4P3PA 3RF1A 4HA8A 1WLEA 3QNEA 4H2SA 2PMEA 1X55A 1ADJA 2QHSA 4AH6A 4HWSA 3M4PA 4CS4A 2CJAA 2I4MA 4HWRA 3QO7A 2EL9A 4ZTZB 1NYQA 2Q5IA 1G5IA 4YCWA 4DQ2A 2IY5A 3VQXA 4HT4A 1W66A 4XTWA 2NS6A 3PCOA 2AMCA 2E10A 2ALYB 2ZZEA 3RKWA 2EJFA 1BIAA 2DZCA 4UPAA 3L2ZA 1SERA 1H4VB 3TEHA 4LVIA 1WU7A 3MEYA 2E3CA 4XU2A 4BW9A 4P74C 2ZZFA 3MQZA 1Z7MA 1PYSB 1EOVA 1SESA 3P8TA 4YRMA 2RHQB 1X54A 4YDQA 4CH4A 4H2TA 2P5IA 3V7CA 4YRQA 3FJPA 4YRCA 2CIMA 5HGQA 1NJ8A 2ARTA 3I7FA 3V7RA 4UP7A 4BWAA 3UFGA 2ZCEA 3MF1A 3HXZA 2IY5B 1IL2A 1E1OA 1YGBA 1YFTA 2ALYA 2QHTA 1Z7NA 4LNSA 3PCOB 1E22A 1BBUA 4DPGA 2G4CA 1WQWA 3E9HA 5C53B 1ATIA 1X56A 3TEHB 4HWTA 2ZTGA 2DU5A 4P72A 3VBBA 1YB3A 4Q15A 2FYKA 4XEMA 1WNLA 3L1AA 3VQWA 1EVKA 4YP0A 1HTTA 3LC0A 1NJ2A 2ZNJA 2EAYA 4TVWA 5K1PA 4RQEA 2EWNA 3A5ZA 4WI1A 1X01A 4L87A 2ZGWA 4XU0A 1QF6A 1E1TA 1B76A 3RGLA 3RACA 2DTHA 4ZIBA 3G1ZA 4XTYA 5E3IA 4UP9A 1VQZA 4EX5A 2ZT5A 2E1HA 4UP8A 3P8YA 4K87A 3IKMB 1EVLA 4CH3A 4OP0A 5C52B 4YRRA 2I4NA 4YRIA 4YRLA 1B7YB 1EIYA 4WJ3M 3WQZA 12ASA 3BJUA 4CS2A 2ZNIA 1LYLA 3HFZA 4H2WA 1C0AA 2DDZA 3P8VA 1G51A 3HY0A 1GGMA 4K86A 3HXYA 2QHVA 3HRIA 2E64A 2DJZA 4YRTA 4CH6A 2Q7EA 3RKXA 2DU7A 3TUPA 4P73C 3EFRA 1NJ5A 1ASZA 3VQVA 3M4QA 1YFSA 3QTCA 5ELNA 4P74A 2E65A 3RL6A 3L4GB 1KMNA 1FYFA 4TVAB 2E41A 3QO5A 2AKWA 1B7YA 3HXUA 4TVYA 2RHSA 1USYA 3MF2A 4CS3A 3EFSA 2DZ9A 3IALA 4YRSA 3CMQA 2ZT7A 1WQ7A 1EIYB 4PHCA 4RQFA 2EJGA 2DQ3A 4P3OA 4HWOA 3HFZB 4J15A 1B70A 4YPFA 1NYRA 2XTIA 3A7RA 2PMFA 1RIQA 4H2UA 2Q7HA 2DXTA 1JJCB 5K1XA 1QE0A 2J3LA 4CH5A 2ZR3A 1H4SA 1NJ1A 2ZT6A 2EJ9A 3NENA 3V8LA 2XGTA 11ASA 4HWPA 2ZXFA 2ARSA 4H2XA 1ADYA 1G5HA 4P75A 4RDXA 4TQFA 3LSSA 4LVLA 2C8MA 4KR2A 4LVJA 1B8AA 2P0LA 3L4GA 4KR3A 3OD1A 4TVAA 3A5YA 4YROA 4TWAA 4TTVA 1WYDA 3HY1A 3NELA 2I4OA 4OLFA 1WPYA 4P71A 1BBWA 2AKWB 4G84A 5ELOA 2RHSB 1L0WA 1X2GA 3E9IA 3UGTA 3NETA 5KNNA 1HC7A 2ZINA 2I4LA 4H2VA 3RUXA 3A7AA 4XTUA 2ZR2A 2ARUA 1SETA 2CJ9A 4P3NA 4YRNA 4RMFA 3UH0A 4XTXA 3A32A 3HRKA 1B70B 2ODRD 4E51A 1JJCA
chains in the Genus database with same CATH topology
3HXWA 4H02A 5C51B 2HNIA 3REXA 1NJ6A 2QHUA 1SRYA 4HVCA 3VQYA 2Q7GA 4YRKA 3BFMA 2DKGA 1KOGA 4H2XB 3V8KA 2A8EA 3ERRA 1ASYA 3TEGA 2ZZGA 3V7SA 4EO4A 1H4TA 3LSQA 3PZCA 1USYC 3HXVA 1E24A 4G85A 3REUA 4O2DA 4X5OA 4LVMA 3QO8A 2DVEA 2DTIA 4P73A 3NEMA 2DXUA 3HFVA 1EFWA 3A7UA 4YRJA 3HXXA 3R07A 4YRPA 4LVKA 2C7IA 4P72C 4ZTUB 4YRGA 3V8JA 3IKLA 4PG3A 2ZT8A 4YRFA 4K88A 1HXDA 3RKYA 3HTZA 3A74A 4XEOA 4XTVA 2Q5HA 3UGQA 4XU3A 4YCUA 4WF2A 2AMCB 2J3MA 1N9WA 2DQ0A 1X2HA 3DSQA 3W3SA 3KFUA 4WJ4A 3IG2A 2ZIMA 4P75C 1BIBA 2DTOA 3RIRA 3ICAA 1KMMA 1PYSA 2ZIOA 4NCXA 1YFRA 2CJBA 2RHQA 4TQDA 4XU1A 4YREA 2ODRC 1NNHA 2CGHA 5F5WA 4XTZA 1EQRA 4KQEA 2DEQA 1J5WA 4YCVA 3A31A 4YYEA 2E5AA 1H4QA 4Q6GA 4H2YA 4P71C 4P3PA 3RF1A 4HA8A 1WLEA 3QNEA 4H2SA 2PMEA 1X55A 1ADJA 2QHSA 4AH6A 4HWSA 3M4PA 4CS4A 2CJAA 2I4MA 4HWRA 3QO7A 2EL9A 4ZTZB 1NYQA 2Q5IA 1G5IA 4YCWA 4DQ2A 2IY5A 3VQXA 4HT4A 1W66A 4XTWA 2NS6A 3PCOA 2AMCA 2E10A 2ALYB 2ZZEA 3RKWA 2EJFA 1BIAA 2DZCA 4UPAA 3L2ZA 1SERA 1H4VB 3TEHA 4LVIA 1WU7A 3MEYA 2E3CA 4XU2A 4BW9A 4P74C 2ZZFA 3MQZA 1Z7MA 1PYSB 1EOVA 1SESA 3P8TA 4YRMA 2RHQB 1X54A 4YDQA 4CH4A 4H2TA 2P5IA 3V7CA 4YRQA 3FJPA 4YRCA 2CIMA 5HGQA 1NJ8A 2ARTA 3I7FA 3V7RA 4UP7A 4BWAA 3UFGA 2ZCEA 3MF1A 3HXZA 2IY5B 1IL2A 1E1OA 1YGBA 1YFTA 2ALYA 2QHTA 1Z7NA 4LNSA 3PCOB 1E22A 1BBUA 4DPGA 2G4CA 1WQWA 3E9HA 5C53B 1ATIA 1X56A 3TEHB 4HWTA 2ZTGA 2DU5A 4P72A 3VBBA 1YB3A 4Q15A 2FYKA 4XEMA 1WNLA 3L1AA 3VQWA 1EVKA 4YP0A 1HTTA 3LC0A 1NJ2A 2ZNJA 2EAYA 4TVWA 5K1PA 4RQEA 2EWNA 3A5ZA 4WI1A 1X01A 4L87A 2ZGWA 4XU0A 1QF6A 1E1TA 1B76A 3RGLA 3RACA 2DTHA 4ZIBA 3G1ZA 4XTYA 5E3IA 4UP9A 1VQZA 4EX5A 2ZT5A 2E1HA 4UP8A 3P8YA 4K87A 3IKMB 1EVLA 4CH3A 4OP0A 5C52B 4YRRA 2I4NA 4YRIA 4YRLA 1B7YB 1EIYA 4WJ3M 3WQZA 12ASA 3BJUA 4CS2A 2ZNIA 1LYLA 3HFZA 4H2WA 1C0AA 2DDZA 3P8VA 1G51A 3HY0A 1GGMA 4K86A 3HXYA 2QHVA 3HRIA 2E64A 2DJZA 4YRTA 4CH6A 2Q7EA 3RKXA 2DU7A 3TUPA 4P73C 3EFRA 1NJ5A 1ASZA 3VQVA 3M4QA 1YFSA 3QTCA 5ELNA 4P74A 2E65A 3RL6A 3L4GB 1KMNA 1FYFA 4TVAB 2E41A 3QO5A 2AKWA 1B7YA 3HXUA 4TVYA 2RHSA 1USYA 3MF2A 4CS3A 3EFSA 2DZ9A 3IALA 4YRSA 3CMQA 2ZT7A 1WQ7A 1EIYB 4PHCA 4RQFA 2EJGA 2DQ3A 4P3OA 4HWOA 3HFZB 4J15A 1B70A 4YPFA 1NYRA 2XTIA 3A7RA 2PMFA 1RIQA 4H2UA 2Q7HA 2DXTA 1JJCB 5K1XA 1QE0A 2J3LA 4CH5A 2ZR3A 1H4SA 1NJ1A 2ZT6A 2EJ9A 3NENA 3V8LA 2XGTA 11ASA 4HWPA 2ZXFA 2ARSA 4H2XA 1ADYA 1G5HA 4P75A 4RDXA 4TQFA 3LSSA 4LVLA 2C8MA 4KR2A 4LVJA 1B8AA 2P0LA 3L4GA 4KR3A 3OD1A 4TVAA 3A5YA 4YROA 4TWAA 4TTVA 1WYDA 3HY1A 3NELA 2I4OA 4OLFA 1WPYA 4P71A 1BBWA 2AKWB 4G84A 5ELOA 2RHSB 1L0WA 1X2GA 3E9IA 3UGTA 3NETA 5KNNA 1HC7A 2ZINA 2I4LA 4H2VA 3RUXA 3A7AA 4XTUA 2ZR2A 2ARUA 1SETA 2CJ9A 4P3NA 4YRNA 4RMFA 3UH0A 4XTXA 3A32A 3HRKA 1B70B 2ODRD 4E51A 1JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXW A;  4H02 A;  5C51 B;  2HNI A;  3REX A;  1NJ6 A;  2QHU A;  1SRY A;  4HVC A;  3VQY A;  2Q7G A;  4YRK A;  3BFM A;  2DKG A;  1KOG A;  4H2X B;  3V8K A;  3ERR A;  1ASY A;  3TEG A;  2ZZG A;  3V7S A;  4EO4 A;  1H4T A;  3LSQ A;  3PZC A;  1USY C;  3HXV A;  1E24 A;  4G85 A;  3REU A;  4O2D A;  4X5O A;  3QO8 A;  2DVE A;  2DTI A;  4P73 A;  3NEM A;  2DXU A;  3HFV A;  1EFW A;  3A7U A;  4YRJ A;  3HXX A;  3R07 A;  4YRP A;  2C7I A;  4P72 C;  4ZTU B;  4YRG A;  3V8J A;  3IKL A;  4PG3 A;  2ZT8 A;  4YRF A;  4K88 A;  1HXD A;  3RKY A;  3HTZ A;  3A74 A;  4XEO A;  4XTV A;  2Q5H A;  3UGQ A;  4XU3 A;  4YCU A;  4WF2 A;  2AMC B;  2J3M A;  1N9W A;  2DQ0 A;  1X2H A;  3DSQ A;  3W3S A;  3KFU A;  4WJ4 A;  3IG2 A;  2ZIM A;  4P75 C;  1BIB A;  2DTO A;  3RIR A;  3ICA A;  1KMM A;  1PYS A;  2ZIO A;  4NCX A;  1YFR A;  2CJB A;  2RHQ A;  4TQD A;  4XU1 A;  4YRE A;  2ODR C;  1NNH A;  2CGH A;  5F5W A;  4XTZ A;  1EQR A;  4KQE A;  2DEQ A;  1J5W A;  4YCV A;  3A31 A;  4YYE A;  2E5A A;  1H4Q A;  4Q6G A;  4H2Y A;  4P71 C;  4P3P A;  3RF1 A;  4HA8 A;  1WLE A;  3QNE A;  4H2S A;  2PME A;  1X55 A;  1ADJ A;  2QHS A;  4AH6 A;  4HWS A;  3M4P A;  4CS4 A;  2CJA A;  2I4M A;  4HWR A;  3QO7 A;  2EL9 A;  4ZTZ B;  1NYQ A;  2Q5I A;  1G5I A;  4YCW A;  4DQ2 A;  2IY5 A;  3VQX A;  1W66 A;  4XTW A;  3PCO A;  2AMC A;  2E10 A;  2ALY B;  2ZZE A;  3RKW A;  2EJF A;  1BIA A;  2DZC A;  4UPA A;  3L2Z A;  1SER A;  1H4V B;  3TEH A;  1WU7 A;  3MEY A;  2E3C A;  4XU2 A;  4BW9 A;  4P74 C;  2ZZF A;  1Z7M A;  1PYS B;  1EOV A;  1SES A;  3P8T A;  4YRM A;  2RHQ B;  1X54 A;  4YDQ A;  4CH4 A;  4H2T A;  2P5I A;  3V7C A;  4YRQ A;  3FJP A;  4YRC A;  2CIM A;  5HGQ A;  1NJ8 A;  2ART A;  3I7F A;  3V7R A;  4UP7 A;  4BWA A;  3UFG A;  2ZCE A;  3MF1 A;  3HXZ A;  2IY5 B;  1IL2 A;  1E1O A;  1YGB A;  1YFT A;  2ALY A;  2QHT A;  1Z7N A;  4LNS A;  3PCO B;  1E22 A;  1BBU A;  4DPG A;  2G4C A;  1WQW A;  3E9H A;  5C53 B;  1ATI A;  1X56 A;  3TEH B;  4HWT A;  2ZTG A;  2DU5 A;  4P72 A;  3VBB A;  1YB3 A;  4Q15 A;  2FYK A;  4XEM A;  1WNL A;  3L1A A;  3VQW A;  1EVK A;  4YP0 A;  1HTT A;  3LC0 A;  1NJ2 A;  2ZNJ A;  2EAY A;  4TVW A;  5K1P A;  4RQE A;  2EWN A;  3A5Z A;  4WI1 A;  1X01 A;  4L87 A;  2ZGW A;  4XU0 A;  1QF6 A;  1E1T A;  1B76 A;  3RGL A;  3RAC A;  2DTH A;  4ZIB A;  3G1Z A;  4XTY A;  5E3I A;  4UP9 A;  1VQZ A;  4EX5 A;  2ZT5 A;  2E1H A;  4UP8 A;  3P8Y A;  4K87 A;  3IKM B;  1EVL A;  4CH3 A;  4OP0 A;  5C52 B;  4YRR A;  2I4N A;  4YRI A;  4YRL A;  1B7Y B;  1EIY A;  4WJ3 M;  3WQZ A;  12AS A;  3BJU A;  4CS2 A;  2ZNI A;  1LYL A;  3HFZ A;  4H2W A;  1C0A A;  2DDZ A;  3P8V A;  1G51 A;  3HY0 A;  1GGM A;  4K86 A;  3HXY A;  2QHV A;  3HRI A;  2E64 A;  2DJZ A;  4YRT A;  4CH6 A;  2Q7E A;  3RKX A;  2DU7 A;  3TUP A;  4P73 C;  3EFR A;  1NJ5 A;  1ASZ A;  3VQV A;  3M4Q A;  1YFS A;  3QTC A;  5ELN A;  4P74 A;  2E65 A;  3RL6 A;  3L4G B;  1KMN A;  1FYF A;  4TVA B;  2E41 A;  3QO5 A;  2AKW A;  1B7Y A;  3HXU A;  4TVY A;  2RHS A;  1USY A;  3MF2 A;  4CS3 A;  3EFS A;  2DZ9 A;  3IAL A;  4YRS A;  3CMQ A;  2ZT7 A;  1WQ7 A;  1EIY B;  4PHC A;  4RQF A;  2EJG A;  2DQ3 A;  4P3O A;  4HWO A;  3HFZ B;  4J15 A;  1B70 A;  4YPF A;  1NYR A;  2XTI A;  3A7R A;  2PMF A;  1RIQ A;  4H2U A;  2Q7H A;  2DXT A;  1JJC B;  5K1X A;  1QE0 A;  2J3L A;  4CH5 A;  2ZR3 A;  1H4S A;  1NJ1 A;  2ZT6 A;  2EJ9 A;  3NEN A;  3V8L A;  2XGT A;  11AS A;  4HWP A;  2ZXF A;  2ARS A;  4H2X A;  1ADY A;  1G5H A;  4P75 A;  4RDX A;  4TQF A;  3LSS A;  2C8M A;  4KR2 A;  1B8A A;  2P0L A;  3L4G A;  4KR3 A;  3OD1 A;  4TVA A;  3A5Y A;  4YRO A;  4TWA A;  4TTV A;  1WYD A;  3HY1 A;  3NEL A;  2I4O A;  4OLF A;  1WPY A;  4P71 A;  1BBW A;  2AKW B;  4G84 A;  5ELO A;  2RHS B;  1L0W A;  1X2G A;  3E9I A;  3UGT A;  3NET A;  5KNN A;  1HC7 A;  2ZIN A;  2I4L A;  4H2V A;  3RUX A;  3A7A A;  4XTU A;  2ZR2 A;  2ARU A;  1SET A;  2CJ9 A;  4P3N A;  4YRN A;  4RMF A;  3UH0 A;  4XTX A;  3A32 A;  3HRK A;  1B70 B;  2ODR D;  4E51 A;  1JJC A; 
#chains in the Genus database with same CATH topology
 3HXW A;  4H02 A;  5C51 B;  2HNI A;  3REX A;  1NJ6 A;  2QHU A;  1SRY A;  4HVC A;  3VQY A;  2Q7G A;  4YRK A;  3BFM A;  2DKG A;  1KOG A;  4H2X B;  3V8K A;  2A8E A;  3ERR A;  1ASY A;  3TEG A;  2ZZG A;  3V7S A;  4EO4 A;  1H4T A;  3LSQ A;  3PZC A;  1USY C;  3HXV A;  1E24 A;  4G85 A;  3REU A;  4O2D A;  4X5O A;  4LVM A;  3QO8 A;  2DVE A;  2DTI A;  4P73 A;  3NEM A;  2DXU A;  3HFV A;  1EFW A;  3A7U A;  4YRJ A;  3HXX A;  3R07 A;  4YRP A;  4LVK A;  2C7I A;  4P72 C;  4ZTU B;  4YRG A;  3V8J A;  3IKL A;  4PG3 A;  2ZT8 A;  4YRF A;  4K88 A;  1HXD A;  3RKY A;  3HTZ A;  3A74 A;  4XEO A;  4XTV A;  2Q5H A;  3UGQ A;  4XU3 A;  4YCU A;  4WF2 A;  2AMC B;  2J3M A;  1N9W A;  2DQ0 A;  1X2H A;  3DSQ A;  3W3S A;  3KFU A;  4WJ4 A;  3IG2 A;  2ZIM A;  4P75 C;  1BIB A;  2DTO A;  3RIR A;  3ICA A;  1KMM A;  1PYS A;  2ZIO A;  4NCX A;  1YFR A;  2CJB A;  2RHQ A;  4TQD A;  4XU1 A;  4YRE A;  2ODR C;  1NNH A;  2CGH A;  5F5W A;  4XTZ A;  1EQR A;  4KQE A;  2DEQ A;  1J5W A;  4YCV A;  3A31 A;  4YYE A;  2E5A A;  1H4Q A;  4Q6G A;  4H2Y A;  4P71 C;  4P3P A;  3RF1 A;  4HA8 A;  1WLE A;  3QNE A;  4H2S A;  2PME A;  1X55 A;  1ADJ A;  2QHS A;  4AH6 A;  4HWS A;  3M4P A;  4CS4 A;  2CJA A;  2I4M A;  4HWR A;  3QO7 A;  2EL9 A;  4ZTZ B;  1NYQ A;  2Q5I A;  1G5I A;  4YCW A;  4DQ2 A;  2IY5 A;  3VQX A;  4HT4 A;  1W66 A;  4XTW A;  2NS6 A;  3PCO A;  2AMC A;  2E10 A;  2ALY B;  2ZZE A;  3RKW A;  2EJF A;  1BIA A;  2DZC A;  4UPA A;  3L2Z A;  1SER A;  1H4V B;  3TEH A;  4LVI A;  1WU7 A;  3MEY A;  2E3C A;  4XU2 A;  4BW9 A;  4P74 C;  2ZZF A;  3MQZ A;  1Z7M A;  1PYS B;  1EOV A;  1SES A;  3P8T A;  4YRM A;  2RHQ B;  1X54 A;  4YDQ A;  4CH4 A;  4H2T A;  2P5I A;  3V7C A;  4YRQ A;  3FJP A;  4YRC A;  2CIM A;  5HGQ A;  1NJ8 A;  2ART A;  3I7F A;  3V7R A;  4UP7 A;  4BWA A;  3UFG A;  2ZCE A;  3MF1 A;  3HXZ A;  2IY5 B;  1IL2 A;  1E1O A;  1YGB A;  1YFT A;  2ALY A;  2QHT A;  1Z7N A;  4LNS A;  3PCO B;  1E22 A;  1BBU A;  4DPG A;  2G4C A;  1WQW A;  3E9H A;  5C53 B;  1ATI A;  1X56 A;  3TEH B;  4HWT A;  2ZTG A;  2DU5 A;  4P72 A;  3VBB A;  1YB3 A;  4Q15 A;  2FYK A;  4XEM A;  1WNL A;  3L1A A;  3VQW A;  1EVK A;  4YP0 A;  1HTT A;  3LC0 A;  1NJ2 A;  2ZNJ A;  2EAY A;  4TVW A;  5K1P A;  4RQE A;  2EWN A;  3A5Z A;  4WI1 A;  1X01 A;  4L87 A;  2ZGW A;  4XU0 A;  1QF6 A;  1E1T A;  1B76 A;  3RGL A;  3RAC A;  2DTH A;  4ZIB A;  3G1Z A;  4XTY A;  5E3I A;  4UP9 A;  1VQZ A;  4EX5 A;  2ZT5 A;  2E1H A;  4UP8 A;  3P8Y A;  4K87 A;  3IKM B;  1EVL A;  4CH3 A;  4OP0 A;  5C52 B;  4YRR A;  2I4N A;  4YRI A;  4YRL A;  1B7Y B;  1EIY A;  4WJ3 M;  3WQZ A;  12AS A;  3BJU A;  4CS2 A;  2ZNI A;  1LYL A;  3HFZ A;  4H2W A;  1C0A A;  2DDZ A;  3P8V A;  1G51 A;  3HY0 A;  1GGM A;  4K86 A;  3HXY A;  2QHV A;  3HRI A;  2E64 A;  2DJZ A;  4YRT A;  4CH6 A;  2Q7E A;  3RKX A;  2DU7 A;  3TUP A;  4P73 C;  3EFR A;  1NJ5 A;  1ASZ A;  3VQV A;  3M4Q A;  1YFS A;  3QTC A;  5ELN A;  4P74 A;  2E65 A;  3RL6 A;  3L4G B;  1KMN A;  1FYF A;  4TVA B;  2E41 A;  3QO5 A;  2AKW A;  1B7Y A;  3HXU A;  4TVY A;  2RHS A;  1USY A;  3MF2 A;  4CS3 A;  3EFS A;  2DZ9 A;  3IAL A;  4YRS A;  3CMQ A;  2ZT7 A;  1WQ7 A;  1EIY B;  4PHC A;  4RQF A;  2EJG A;  2DQ3 A;  4P3O A;  4HWO A;  3HFZ B;  4J15 A;  1B70 A;  4YPF A;  1NYR A;  2XTI A;  3A7R A;  2PMF A;  1RIQ A;  4H2U A;  2Q7H A;  2DXT A;  1JJC B;  5K1X A;  1QE0 A;  2J3L A;  4CH5 A;  2ZR3 A;  1H4S A;  1NJ1 A;  2ZT6 A;  2EJ9 A;  3NEN A;  3V8L A;  2XGT A;  11AS A;  4HWP A;  2ZXF A;  2ARS A;  4H2X A;  1ADY A;  1G5H A;  4P75 A;  4RDX A;  4TQF A;  3LSS A;  4LVL A;  2C8M A;  4KR2 A;  4LVJ A;  1B8A A;  2P0L A;  3L4G A;  4KR3 A;  3OD1 A;  4TVA A;  3A5Y A;  4YRO A;  4TWA A;  4TTV A;  1WYD A;  3HY1 A;  3NEL A;  2I4O A;  4OLF A;  1WPY A;  4P71 A;  1BBW A;  2AKW B;  4G84 A;  5ELO A;  2RHS B;  1L0W A;  1X2G A;  3E9I A;  3UGT A;  3NET A;  5KNN A;  1HC7 A;  2ZIN A;  2I4L A;  4H2V A;  3RUX A;  3A7A A;  4XTU A;  2ZR2 A;  2ARU A;  1SET A;  2CJ9 A;  4P3N A;  4YRN A;  4RMF A;  3UH0 A;  4XTX A;  3A32 A;  3HRK A;  1B70 B;  2ODR D;  4E51 A;  1JJC A; 
#chains in the Genus database with same CATH homology
 3HXW A;  4H02 A;  5C51 B;  2HNI A;  3REX A;  1NJ6 A;  2QHU A;  1SRY A;  4HVC A;  3VQY A;  2Q7G A;  4YRK A;  3BFM A;  2DKG A;  1KOG A;  4H2X B;  3V8K A;  2A8E A;  3ERR A;  1ASY A;  3TEG A;  2ZZG A;  3V7S A;  4EO4 A;  1H4T A;  3LSQ A;  3PZC A;  1USY C;  3HXV A;  1E24 A;  4G85 A;  3REU A;  4O2D A;  4X5O A;  4LVM A;  3QO8 A;  2DVE A;  2DTI A;  4P73 A;  3NEM A;  2DXU A;  3HFV A;  1EFW A;  3A7U A;  4YRJ A;  3HXX A;  3R07 A;  4YRP A;  4LVK A;  2C7I A;  4P72 C;  4ZTU B;  4YRG A;  3V8J A;  3IKL A;  4PG3 A;  2ZT8 A;  4YRF A;  4K88 A;  1HXD A;  3RKY A;  3HTZ A;  3A74 A;  4XEO A;  4XTV A;  2Q5H A;  3UGQ A;  4XU3 A;  4YCU A;  4WF2 A;  2AMC B;  2J3M A;  1N9W A;  2DQ0 A;  1X2H A;  3DSQ A;  3W3S A;  3KFU A;  4WJ4 A;  3IG2 A;  2ZIM A;  4P75 C;  1BIB A;  2DTO A;  3RIR A;  3ICA A;  1KMM A;  1PYS A;  2ZIO A;  4NCX A;  1YFR A;  2CJB A;  2RHQ A;  4TQD A;  4XU1 A;  4YRE A;  2ODR C;  1NNH A;  2CGH A;  5F5W A;  4XTZ A;  1EQR A;  4KQE A;  2DEQ A;  1J5W A;  4YCV A;  3A31 A;  4YYE A;  2E5A A;  1H4Q A;  4Q6G A;  4H2Y A;  4P71 C;  4P3P A;  3RF1 A;  4HA8 A;  1WLE A;  3QNE A;  4H2S A;  2PME A;  1X55 A;  1ADJ A;  2QHS A;  4AH6 A;  4HWS A;  3M4P A;  4CS4 A;  2CJA A;  2I4M A;  4HWR A;  3QO7 A;  2EL9 A;  4ZTZ B;  1NYQ A;  2Q5I A;  1G5I A;  4YCW A;  4DQ2 A;  2IY5 A;  3VQX A;  4HT4 A;  1W66 A;  4XTW A;  2NS6 A;  3PCO A;  2AMC A;  2E10 A;  2ALY B;  2ZZE A;  3RKW A;  2EJF A;  1BIA A;  2DZC A;  4UPA A;  3L2Z A;  1SER A;  1H4V B;  3TEH A;  4LVI A;  1WU7 A;  3MEY A;  2E3C A;  4XU2 A;  4BW9 A;  4P74 C;  2ZZF A;  3MQZ A;  1Z7M A;  1PYS B;  1EOV A;  1SES A;  3P8T A;  4YRM A;  2RHQ B;  1X54 A;  4YDQ A;  4CH4 A;  4H2T A;  2P5I A;  3V7C A;  4YRQ A;  3FJP A;  4YRC A;  2CIM A;  5HGQ A;  1NJ8 A;  2ART A;  3I7F A;  3V7R A;  4UP7 A;  4BWA A;  3UFG A;  2ZCE A;  3MF1 A;  3HXZ A;  2IY5 B;  1IL2 A;  1E1O A;  1YGB A;  1YFT A;  2ALY A;  2QHT A;  1Z7N A;  4LNS A;  3PCO B;  1E22 A;  1BBU A;  4DPG A;  2G4C A;  1WQW A;  3E9H A;  5C53 B;  1ATI A;  1X56 A;  3TEH B;  4HWT A;  2ZTG A;  2DU5 A;  4P72 A;  3VBB A;  1YB3 A;  4Q15 A;  2FYK A;  4XEM A;  1WNL A;  3L1A A;  3VQW A;  1EVK A;  4YP0 A;  1HTT A;  3LC0 A;  1NJ2 A;  2ZNJ A;  2EAY A;  4TVW A;  5K1P A;  4RQE A;  2EWN A;  3A5Z A;  4WI1 A;  1X01 A;  4L87 A;  2ZGW A;  4XU0 A;  1QF6 A;  1E1T A;  1B76 A;  3RGL A;  3RAC A;  2DTH A;  4ZIB A;  3G1Z A;  4XTY A;  5E3I A;  4UP9 A;  1VQZ A;  4EX5 A;  2ZT5 A;  2E1H A;  4UP8 A;  3P8Y A;  4K87 A;  3IKM B;  1EVL A;  4CH3 A;  4OP0 A;  5C52 B;  4YRR A;  2I4N A;  4YRI A;  4YRL A;  1B7Y B;  1EIY A;  4WJ3 M;  3WQZ A;  12AS A;  3BJU A;  4CS2 A;  2ZNI A;  1LYL A;  3HFZ A;  4H2W A;  1C0A A;  2DDZ A;  3P8V A;  1G51 A;  3HY0 A;  1GGM A;  4K86 A;  3HXY A;  2QHV A;  3HRI A;  2E64 A;  2DJZ A;  4YRT A;  4CH6 A;  2Q7E A;  3RKX A;  2DU7 A;  3TUP A;  4P73 C;  3EFR A;  1NJ5 A;  1ASZ A;  3VQV A;  3M4Q A;  1YFS A;  3QTC A;  5ELN A;  4P74 A;  2E65 A;  3RL6 A;  3L4G B;  1KMN A;  1FYF A;  4TVA B;  2E41 A;  3QO5 A;  2AKW A;  1B7Y A;  3HXU A;  4TVY A;  2RHS A;  1USY A;  3MF2 A;  4CS3 A;  3EFS A;  2DZ9 A;  3IAL A;  4YRS A;  3CMQ A;  2ZT7 A;  1WQ7 A;  1EIY B;  4PHC A;  4RQF A;  2EJG A;  2DQ3 A;  4P3O A;  4HWO A;  3HFZ B;  4J15 A;  1B70 A;  4YPF A;  1NYR A;  2XTI A;  3A7R A;  2PMF A;  1RIQ A;  4H2U A;  2Q7H A;  2DXT A;  1JJC B;  5K1X A;  1QE0 A;  2J3L A;  4CH5 A;  2ZR3 A;  1H4S A;  1NJ1 A;  2ZT6 A;  2EJ9 A;  3NEN A;  3V8L A;  2XGT A;  11AS A;  4HWP A;  2ZXF A;  2ARS A;  4H2X A;  1ADY A;  1G5H A;  4P75 A;  4RDX A;  4TQF A;  3LSS A;  4LVL A;  2C8M A;  4KR2 A;  4LVJ A;  1B8A A;  2P0L A;  3L4G A;  4KR3 A;  3OD1 A;  4TVA A;  3A5Y A;  4YRO A;  4TWA A;  4TTV A;  1WYD A;  3HY1 A;  3NEL A;  2I4O A;  4OLF A;  1WPY A;  4P71 A;  1BBW A;  2AKW B;  4G84 A;  5ELO A;  2RHS B;  1L0W A;  1X2G A;  3E9I A;  3UGT A;  3NET A;  5KNN A;  1HC7 A;  2ZIN A;  2I4L A;  4H2V A;  3RUX A;  3A7A A;  4XTU A;  2ZR2 A;  2ARU A;  1SET A;  2CJ9 A;  4P3N A;  4YRN A;  4RMF A;  3UH0 A;  4XTX A;  3A32 A;  3HRK A;  1B70 B;  2ODR D;  4E51 A;  1JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...