2QHVA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 67
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhvA01
5KNNA 1WYDA 3REXA 3EFRA 4HWOA 3ERRA 1EVKA 4YRLA 1SERA 2CJBA 3V8JA 3RKYA 3UGQA 1EIYA 1B8AA 1YFSA 1N9WA 3HXZA 4P74A 2QHVA 1E24A 2ZZEA 3P8VA 3P8TA 4CH4A 4RDXA 2DJZA 1YFTA 2E10A 2PMEA 2DVEA 4XEOA 2ZNIA 4YRFA 4P3PA 1E1OA 4HWSA 4H2VA 2HNIA 4HVCA 4WJ3M 1H4SA 3IG2A 4O2DA 4UP7A 2C8MA 1NYRA 2P5IA 2ARSA 2IY5B 1KMMA 2ZCEA 4AH6A 1X55A 4KQEA 1Z7MA 4CS4A 2Q7HA 4HWPA 4P3OA 4RQEA 2ZIOA 3IKMB 1B70A 3NELA 2ARUA 3A7UA 3L4GA 3HXYA 3I7FA 1USYA 1EOVA 4X5OA 4XTVA 4E51A 2EL9A 1PYSB 4WF2A 3RACA 1BBUA 4H2WA 4H2TA 3VBBA 4CH5A 2Q5HA 3HXUA 2E5AA 2XTIA 4H2XA 1FYFA 1B76A 3V7SA 1WQWA 4ZTZB 2ZR2A 2DTOA 2RHSB 1EFWA 4YCWA 4CH3A 2ARTA 3QO7A 4OLFA 4CS2A 3TEHB 1KOGA 5C53B 2DTIA 3NETA 2QHSA 2ZGWA 3UGTA 4XTWA 4YRCA 2E3CA 2Q7EA 3LSSA 4TQFA 1PYSA 1WPYA 1X2HA 3IKLA 4TWAA 1WU7A 5K1PA 4YCVA 2ZT5A 2ZZFA 1H4QA 3LSQA 2EJ9A 4CS3A 1L0WA 2QHUA 1JJCB 5HGQA 4XTYA 4CH6A 3G1ZA 2QHTA 1WLEA 4K86A 4HWRA 2ZT8A 5E3IA 5C52B 3BFMA 4PHCA 2DZ9A 4YYEA 3TEHA 2ODRD 1YGBA 1HXDA 2CJ9A 3M4PA 3HRKA 4TVAA 1IL2A 3PZCA 4TTVA 4K88A 4P72A 3L2ZA 2DU5A 2RHSA 2ZINA 2P0LA 4RMFA 2ZT6A 4TVYA 3VQWA 4YCUA 4TVAB 1ATIA 2RHQA 3MF2A 2ZZGA 4XTUA 2DXTA 1ASYA 3REUA 4XTXA 3HXWA 1H4TA 4K87A 4YROA 2ALYB 3A74A 4XU1A 2XGTA 4ZTUB 1BBWA 3RL6A 3HY0A 3RIRA 1G5IA 3EFSA 3HTZA 2Q5IA 2CJAA 2DTHA 1NJ2A 1VQZA 2ALYA 3PCOA 12ASA 1USYC 4PG3A 1SETA 2Q7GA 2E65A 1YB3A 4YREA 1KMNA 3VQVA 3MF1A 3WQZA 4XTZA 1W66A 4ZIBA 4YRJA 4BW9A 2EAYA 5C51B 3MEYA 3HFZA 1SESA 3OD1A 1ADJA 1B70B 4Q6GA 3HXVA 3A5YA 4HA8A 1NYQA 1B7YB 4LNSA 5K1XA 1BIAA 1EVLA 1HTTA 4XU2A 4YRIA 1E1TA 4NCXA 3M4QA 1WQ7A 1QE0A 4YRMA 4TQDA 2DEQA 3PCOB 4TVWA 4P74C 2DKGA 3HY1A 3ICAA 2DQ3A 3BJUA 2ZNJA 4YP0A 4YRRA 1LYLA 1GGMA 2AKWA 3W3SA 3V8KA 2FYKA 4YRGA 2ZR3A 2AMCB 11ASA 3E9HA 5ELOA 1RIQA 3P8YA 4UP8A 4UPAA 4DQ2A 2IY5A 1ADYA 3RGLA 2RHQB 4WI1A 3NENA 2EJFA 1HC7A 4XEMA 4YPFA 3KFUA 2CGHA 1B7YA 1SRYA 4P3NA 1Z7NA 4P71A 3V8LA 2DDZA 3HRIA 3L4GB 3A7RA 2I4OA 4DPGA 1YFRA 3A32A 4YRKA 2DU7A 1JJCA 4H2YA 4H2SA 4G85A 2I4NA 3FJPA 1WNLA 3V7RA 4H2XB 4KR2A 2E64A 3UH0A 1EQRA 3QO8A 2DZCA 4Q15A 3UFGA 2AMCA 1NJ8A 3A7AA 4P73A 3HXXA 4EX5A 3R07A 1J5WA 4YRSA 2DXUA 1E22A 4P75A 1X56A 3V7CA 4WJ4A 3RUXA 4YDQA 2ZIMA 3HFZB 1NJ5A 3L1AA 3A31A 2I4LA 4KR3A 2E1HA 3A5ZA 3TUPA 2EWNA 5ELNA 3VQYA 4YRTA 2G4CA 4RQFA 2PMFA 3RKWA 2J3MA 1C0AA 1NJ6A 4XU3A 3TEGA 3NEMA 3VQXA 4P71C 1G5HA 4P75C 3QO5A 4YRPA 1NNHA 1X54A 1BIBA 1G51A 4P72C 4P73C 4YRQA 4H02A 3QNEA 4UP9A 4J15A 1NJ1A 2ZXFA 2EJGA 2ZTGA 4OP0A 3E9IA 4EO4A 2AKWB 2J3LA 2DQ0A 4H2UA 1EIYB 3RKXA 3LC0A 5F5WA 2I4MA 4YRNA 1ASZA 3RF1A 1QF6A 1X01A 1X2GA 2ODRC 3IALA 4L87A 2CIMA 2ZT7A 2E41A 3QTCA 4BWAA 3CMQA 4G84A 1H4VB 4XU0A 4HWTA 2C7IA 3DSQA 3HFVA
chains in the Genus database with same CATH superfamily
5KNNA 1WYDA 3REXA 3EFRA 4HWOA 3ERRA 1EVKA 4YRLA 1SERA 2CJBA 3V8JA 3RKYA 3UGQA 1EIYA 1B8AA 1YFSA 1N9WA 3HXZA 4P74A 2QHVA 1E24A 2ZZEA 3P8VA 3P8TA 4CH4A 4RDXA 2DJZA 4HT4A 1YFTA 2E10A 2PMEA 2DVEA 4XEOA 2ZNIA 4YRFA 4P3PA 1E1OA 4HWSA 4H2VA 2HNIA 4HVCA 4WJ3M 1H4SA 3IG2A 4O2DA 4UP7A 2C8MA 1NYRA 2P5IA 2ARSA 2IY5B 1KMMA 2ZCEA 4AH6A 1X55A 4KQEA 1Z7MA 4CS4A 2Q7HA 4HWPA 4P3OA 4RQEA 2ZIOA 3IKMB 1B70A 3NELA 2ARUA 3A7UA 3L4GA 3HXYA 3I7FA 1USYA 1EOVA 4X5OA 4XTVA 4E51A 2EL9A 1PYSB 4WF2A 3RACA 1BBUA 4H2WA 4H2TA 3VBBA 4CH5A 2Q5HA 3HXUA 2E5AA 2XTIA 4H2XA 1FYFA 1B76A 3V7SA 1WQWA 4ZTZB 2ZR2A 2DTOA 2RHSB 1EFWA 4YCWA 4CH3A 2ARTA 4LVKA 3QO7A 4OLFA 4CS2A 3TEHB 1KOGA 5C53B 2DTIA 3NETA 2QHSA 2ZGWA 3UGTA 4XTWA 4YRCA 2E3CA 2Q7EA 3LSSA 4TQFA 1PYSA 1WPYA 1X2HA 3IKLA 4TWAA 1WU7A 5K1PA 4YCVA 2ZT5A 2ZZFA 1H4QA 3LSQA 2EJ9A 4CS3A 1L0WA 2QHUA 1JJCB 5HGQA 4XTYA 4CH6A 3G1ZA 2QHTA 1WLEA 4K86A 4HWRA 2ZT8A 5E3IA 5C52B 3BFMA 4PHCA 2DZ9A 4YYEA 3TEHA 2ODRD 1YGBA 1HXDA 2CJ9A 3M4PA 3HRKA 4TVAA 1IL2A 3PZCA 4TTVA 4K88A 4P72A 3L2ZA 2DU5A 2RHSA 2ZINA 2P0LA 4RMFA 2ZT6A 4TVYA 3VQWA 4YCUA 4TVAB 1ATIA 2RHQA 3MF2A 2ZZGA 4XTUA 2DXTA 1ASYA 3REUA 4XTXA 3HXWA 1H4TA 4K87A 4YROA 2ALYB 3A74A 4XU1A 2XGTA 4ZTUB 1BBWA 3RL6A 3HY0A 3RIRA 1G5IA 3EFSA 3HTZA 2Q5IA 2CJAA 2DTHA 1NJ2A 1VQZA 2ALYA 3PCOA 12ASA 1USYC 4PG3A 1SETA 2Q7GA 2E65A 1YB3A 4YREA 1KMNA 2A8EA 3VQVA 3MF1A 3WQZA 4XTZA 1W66A 4ZIBA 4YRJA 4BW9A 2EAYA 5C51B 3MEYA 3HFZA 1SESA 3OD1A 1ADJA 1B70B 4Q6GA 3HXVA 3A5YA 4HA8A 1NYQA 1B7YB 4LNSA 5K1XA 1BIAA 1EVLA 1HTTA 4XU2A 4YRIA 1E1TA 4NCXA 3M4QA 1WQ7A 1QE0A 4YRMA 4TQDA 2DEQA 3PCOB 4TVWA 4P74C 2DKGA 3HY1A 3ICAA 2DQ3A 3BJUA 2ZNJA 4YP0A 4YRRA 1LYLA 1GGMA 2AKWA 3W3SA 3V8KA 2FYKA 4YRGA 2ZR3A 2AMCB 11ASA 3E9HA 5ELOA 1RIQA 3P8YA 4UP8A 4UPAA 4DQ2A 2IY5A 1ADYA 3RGLA 2RHQB 4WI1A 3NENA 2EJFA 1HC7A 4XEMA 4YPFA 3KFUA 2CGHA 1B7YA 1SRYA 4P3NA 1Z7NA 4P71A 3V8LA 2DDZA 3HRIA 3L4GB 3A7RA 2I4OA 4DPGA 1YFRA 3A32A 4YRKA 2DU7A 1JJCA 4H2YA 4H2SA 4G85A 2I4NA 3FJPA 1WNLA 3V7RA 4H2XB 4KR2A 2E64A 3UH0A 1EQRA 3QO8A 2DZCA 4Q15A 4LVLA 3UFGA 2AMCA 1NJ8A 3A7AA 4P73A 3HXXA 4EX5A 3R07A 1J5WA 4YRSA 2DXUA 1E22A 4P75A 1X56A 3V7CA 4WJ4A 3RUXA 4YDQA 2ZIMA 3HFZB 1NJ5A 3L1AA 3A31A 2I4LA 4KR3A 2E1HA 3A5ZA 3TUPA 3MQZA 2EWNA 5ELNA 3VQYA 4YRTA 2G4CA 4RQFA 2PMFA 3RKWA 2J3MA 1C0AA 1NJ6A 4XU3A 3TEGA 3NEMA 3VQXA 4LVIA 4P71C 2NS6A 1G5HA 4P75C 3QO5A 4YRPA 1NNHA 1X54A 1BIBA 1G51A 4P72C 4P73C 4YRQA 4H02A 3QNEA 4UP9A 4J15A 1NJ1A 2ZXFA 2EJGA 2ZTGA 4OP0A 3E9IA 4EO4A 2AKWB 2J3LA 2DQ0A 4H2UA 1EIYB 3RKXA 3LC0A 5F5WA 2I4MA 4YRNA 1ASZA 3RF1A 1QF6A 1X01A 1X2GA 2ODRC 3IALA 4L87A 2CIMA 2ZT7A 2E41A 3QTCA 4LVMA 4BWAA 3CMQA 4G84A 1H4VB 4XU0A 4HWTA 2C7IA 3DSQA 4LVJA 3HFVA
chains in the Genus database with same CATH topology
5KNNA 1WYDA 3REXA 3EFRA 4HWOA 3ERRA 1EVKA 4YRLA 1SERA 2CJBA 3V8JA 3RKYA 3UGQA 1EIYA 1B8AA 1YFSA 1N9WA 3HXZA 4P74A 2QHVA 1E24A 2ZZEA 3P8VA 3P8TA 4CH4A 4RDXA 2DJZA 4HT4A 1YFTA 2E10A 2PMEA 2DVEA 4XEOA 2ZNIA 4YRFA 4P3PA 1E1OA 4HWSA 4H2VA 2HNIA 4HVCA 4WJ3M 1H4SA 3IG2A 4O2DA 4UP7A 2C8MA 1NYRA 2P5IA 2ARSA 2IY5B 1KMMA 2ZCEA 4AH6A 1X55A 4KQEA 1Z7MA 4CS4A 2Q7HA 4HWPA 4P3OA 4RQEA 2ZIOA 3IKMB 1B70A 3NELA 2ARUA 3A7UA 3L4GA 3HXYA 3I7FA 1USYA 1EOVA 4X5OA 4XTVA 4E51A 2EL9A 1PYSB 4WF2A 3RACA 1BBUA 4H2WA 4H2TA 3VBBA 4CH5A 2Q5HA 3HXUA 2E5AA 2XTIA 4H2XA 1FYFA 1B76A 3V7SA 1WQWA 4ZTZB 2ZR2A 2DTOA 2RHSB 1EFWA 4YCWA 4CH3A 2ARTA 4LVKA 3QO7A 4OLFA 4CS2A 3TEHB 1KOGA 5C53B 2DTIA 3NETA 2QHSA 2ZGWA 3UGTA 4XTWA 4YRCA 2E3CA 2Q7EA 3LSSA 4TQFA 1PYSA 1WPYA 1X2HA 3IKLA 4TWAA 1WU7A 5K1PA 4YCVA 2ZT5A 2ZZFA 1H4QA 3LSQA 2EJ9A 4CS3A 1L0WA 2QHUA 1JJCB 5HGQA 4XTYA 4CH6A 3G1ZA 2QHTA 1WLEA 4K86A 4HWRA 2ZT8A 5E3IA 5C52B 3BFMA 4PHCA 2DZ9A 4YYEA 3TEHA 2ODRD 1YGBA 1HXDA 2CJ9A 3M4PA 3HRKA 4TVAA 1IL2A 3PZCA 4TTVA 4K88A 4P72A 3L2ZA 2DU5A 2RHSA 2ZINA 2P0LA 4RMFA 2ZT6A 4TVYA 3VQWA 4YCUA 4TVAB 1ATIA 2RHQA 3MF2A 2ZZGA 4XTUA 2DXTA 1ASYA 3REUA 4XTXA 3HXWA 1H4TA 4K87A 4YROA 2ALYB 3A74A 4XU1A 2XGTA 4ZTUB 1BBWA 3RL6A 3HY0A 3RIRA 1G5IA 3EFSA 3HTZA 2Q5IA 2CJAA 2DTHA 1NJ2A 1VQZA 2ALYA 3PCOA 12ASA 1USYC 4PG3A 1SETA 2Q7GA 2E65A 1YB3A 4YREA 1KMNA 2A8EA 3VQVA 3MF1A 3WQZA 4XTZA 1W66A 4ZIBA 4YRJA 4BW9A 2EAYA 5C51B 3MEYA 3HFZA 1SESA 3OD1A 1ADJA 1B70B 4Q6GA 3HXVA 3A5YA 4HA8A 1NYQA 1B7YB 4LNSA 5K1XA 1BIAA 1EVLA 1HTTA 4XU2A 4YRIA 1E1TA 4NCXA 3M4QA 1WQ7A 1QE0A 4YRMA 4TQDA 2DEQA 3PCOB 4TVWA 4P74C 2DKGA 3HY1A 3ICAA 2DQ3A 3BJUA 2ZNJA 4YP0A 4YRRA 1LYLA 1GGMA 2AKWA 3W3SA 3V8KA 2FYKA 4YRGA 2ZR3A 2AMCB 11ASA 3E9HA 5ELOA 1RIQA 3P8YA 4UP8A 4UPAA 4DQ2A 2IY5A 1ADYA 3RGLA 2RHQB 4WI1A 3NENA 2EJFA 1HC7A 4XEMA 4YPFA 3KFUA 2CGHA 1B7YA 1SRYA 4P3NA 1Z7NA 4P71A 3V8LA 2DDZA 3HRIA 3L4GB 3A7RA 2I4OA 4DPGA 1YFRA 3A32A 4YRKA 2DU7A 1JJCA 4H2YA 4H2SA 4G85A 2I4NA 3FJPA 1WNLA 3V7RA 4H2XB 4KR2A 2E64A 3UH0A 1EQRA 3QO8A 2DZCA 4Q15A 4LVLA 3UFGA 2AMCA 1NJ8A 3A7AA 4P73A 3HXXA 4EX5A 3R07A 1J5WA 4YRSA 2DXUA 1E22A 4P75A 1X56A 3V7CA 4WJ4A 3RUXA 4YDQA 2ZIMA 3HFZB 1NJ5A 3L1AA 3A31A 2I4LA 4KR3A 2E1HA 3A5ZA 3TUPA 3MQZA 2EWNA 5ELNA 3VQYA 4YRTA 2G4CA 4RQFA 2PMFA 3RKWA 2J3MA 1C0AA 1NJ6A 4XU3A 3TEGA 3NEMA 3VQXA 4LVIA 4P71C 2NS6A 1G5HA 4P75C 3QO5A 4YRPA 1NNHA 1X54A 1BIBA 1G51A 4P72C 4P73C 4YRQA 4H02A 3QNEA 4UP9A 4J15A 1NJ1A 2ZXFA 2EJGA 2ZTGA 4OP0A 3E9IA 4EO4A 2AKWB 2J3LA 2DQ0A 4H2UA 1EIYB 3RKXA 3LC0A 5F5WA 2I4MA 4YRNA 1ASZA 3RF1A 1QF6A 1X01A 1X2GA 2ODRC 3IALA 4L87A 2CIMA 2ZT7A 2E41A 3QTCA 4LVMA 4BWAA 3CMQA 4G84A 1H4VB 4XU0A 4HWTA 2C7IA 3DSQA 4LVJA 3HFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNN A;  1WYD A;  3REX A;  3EFR A;  4HWO A;  3ERR A;  1EVK A;  4YRL A;  1SER A;  2CJB A;  3V8J A;  3RKY A;  3UGQ A;  1EIY A;  1B8A A;  1YFS A;  1N9W A;  3HXZ A;  4P74 A;  2QHV A;  1E24 A;  2ZZE A;  3P8V A;  3P8T A;  4CH4 A;  4RDX A;  2DJZ A;  1YFT A;  2E10 A;  2PME A;  2DVE A;  4XEO A;  2ZNI A;  4YRF A;  4P3P A;  1E1O A;  4HWS A;  4H2V A;  2HNI A;  4HVC A;  4WJ3 M;  1H4S A;  3IG2 A;  4O2D A;  4UP7 A;  2C8M A;  1NYR A;  2P5I A;  2ARS A;  2IY5 B;  1KMM A;  2ZCE A;  4AH6 A;  1X55 A;  4KQE A;  1Z7M A;  4CS4 A;  2Q7H A;  4HWP A;  4P3O A;  4RQE A;  2ZIO A;  3IKM B;  1B70 A;  3NEL A;  2ARU A;  3A7U A;  3L4G A;  3HXY A;  3I7F A;  1USY A;  1EOV A;  4X5O A;  4XTV A;  4E51 A;  2EL9 A;  1PYS B;  4WF2 A;  3RAC A;  1BBU A;  4H2W A;  4H2T A;  3VBB A;  4CH5 A;  2Q5H A;  3HXU A;  2E5A A;  2XTI A;  4H2X A;  1FYF A;  1B76 A;  3V7S A;  1WQW A;  4ZTZ B;  2ZR2 A;  2DTO A;  2RHS B;  1EFW A;  4YCW A;  4CH3 A;  2ART A;  3QO7 A;  4OLF A;  4CS2 A;  3TEH B;  1KOG A;  5C53 B;  2DTI A;  3NET A;  2QHS A;  2ZGW A;  3UGT A;  4XTW A;  4YRC A;  2E3C A;  2Q7E A;  3LSS A;  4TQF A;  1PYS A;  1WPY A;  1X2H A;  3IKL A;  4TWA A;  1WU7 A;  5K1P A;  4YCV A;  2ZT5 A;  2ZZF A;  1H4Q A;  3LSQ A;  2EJ9 A;  4CS3 A;  1L0W A;  2QHU A;  1JJC B;  5HGQ A;  4XTY A;  4CH6 A;  3G1Z A;  2QHT A;  1WLE A;  4K86 A;  4HWR A;  2ZT8 A;  5E3I A;  5C52 B;  3BFM A;  4PHC A;  2DZ9 A;  4YYE A;  3TEH A;  2ODR D;  1YGB A;  1HXD A;  2CJ9 A;  3M4P A;  3HRK A;  4TVA A;  1IL2 A;  3PZC A;  4TTV A;  4K88 A;  4P72 A;  3L2Z A;  2DU5 A;  2RHS A;  2ZIN A;  2P0L A;  4RMF A;  2ZT6 A;  4TVY A;  3VQW A;  4YCU A;  4TVA B;  1ATI A;  2RHQ A;  3MF2 A;  2ZZG A;  4XTU A;  2DXT A;  1ASY A;  3REU A;  4XTX A;  3HXW A;  1H4T A;  4K87 A;  4YRO A;  2ALY B;  3A74 A;  4XU1 A;  2XGT A;  4ZTU B;  1BBW A;  3RL6 A;  3HY0 A;  3RIR A;  1G5I A;  3EFS A;  3HTZ A;  2Q5I A;  2CJA A;  2DTH A;  1NJ2 A;  1VQZ A;  2ALY A;  3PCO A;  12AS A;  1USY C;  4PG3 A;  1SET A;  2Q7G A;  2E65 A;  1YB3 A;  4YRE A;  1KMN A;  3VQV A;  3MF1 A;  3WQZ A;  4XTZ A;  1W66 A;  4ZIB A;  4YRJ A;  4BW9 A;  2EAY A;  5C51 B;  3MEY A;  3HFZ A;  1SES A;  3OD1 A;  1ADJ A;  1B70 B;  4Q6G A;  3HXV A;  3A5Y A;  4HA8 A;  1NYQ A;  1B7Y B;  4LNS A;  5K1X A;  1BIA A;  1EVL A;  1HTT A;  4XU2 A;  4YRI A;  1E1T A;  4NCX A;  3M4Q A;  1WQ7 A;  1QE0 A;  4YRM A;  4TQD A;  2DEQ A;  3PCO B;  4TVW A;  4P74 C;  2DKG A;  3HY1 A;  3ICA A;  2DQ3 A;  3BJU A;  2ZNJ A;  4YP0 A;  4YRR A;  1LYL A;  1GGM A;  2AKW A;  3W3S A;  3V8K A;  2FYK A;  4YRG A;  2ZR3 A;  2AMC B;  11AS A;  3E9H A;  5ELO A;  1RIQ A;  3P8Y A;  4UP8 A;  4UPA A;  4DQ2 A;  2IY5 A;  1ADY A;  3RGL A;  2RHQ B;  4WI1 A;  3NEN A;  2EJF A;  1HC7 A;  4XEM A;  4YPF A;  3KFU A;  2CGH A;  1B7Y A;  1SRY A;  4P3N A;  1Z7N A;  4P71 A;  3V8L A;  2DDZ A;  3HRI A;  3L4G B;  3A7R A;  2I4O A;  4DPG A;  1YFR A;  3A32 A;  4YRK A;  2DU7 A;  1JJC A;  4H2Y A;  4H2S A;  4G85 A;  2I4N A;  3FJP A;  1WNL A;  3V7R A;  4H2X B;  4KR2 A;  2E64 A;  3UH0 A;  1EQR A;  3QO8 A;  2DZC A;  4Q15 A;  3UFG A;  2AMC A;  1NJ8 A;  3A7A A;  4P73 A;  3HXX A;  4EX5 A;  3R07 A;  1J5W A;  4YRS A;  2DXU A;  1E22 A;  4P75 A;  1X56 A;  3V7C A;  4WJ4 A;  3RUX A;  4YDQ A;  2ZIM A;  3HFZ B;  1NJ5 A;  3L1A A;  3A31 A;  2I4L A;  4KR3 A;  2E1H A;  3A5Z A;  3TUP A;  2EWN A;  5ELN A;  3VQY A;  4YRT A;  2G4C A;  4RQF A;  2PMF A;  3RKW A;  2J3M A;  1C0A A;  1NJ6 A;  4XU3 A;  3TEG A;  3NEM A;  3VQX A;  4P71 C;  1G5H A;  4P75 C;  3QO5 A;  4YRP A;  1NNH A;  1X54 A;  1BIB A;  1G51 A;  4P72 C;  4P73 C;  4YRQ A;  4H02 A;  3QNE A;  4UP9 A;  4J15 A;  1NJ1 A;  2ZXF A;  2EJG A;  2ZTG A;  4OP0 A;  3E9I A;  4EO4 A;  2AKW B;  2J3L A;  2DQ0 A;  4H2U A;  1EIY B;  3RKX A;  3LC0 A;  5F5W A;  2I4M A;  4YRN A;  1ASZ A;  3RF1 A;  1QF6 A;  1X01 A;  1X2G A;  2ODR C;  3IAL A;  4L87 A;  2CIM A;  2ZT7 A;  2E41 A;  3QTC A;  4BWA A;  3CMQ A;  4G84 A;  1H4V B;  4XU0 A;  4HWT A;  2C7I A;  3DSQ A;  3HFV A; 
#chains in the Genus database with same CATH topology
 5KNN A;  1WYD A;  3REX A;  3EFR A;  4HWO A;  3ERR A;  1EVK A;  4YRL A;  1SER A;  2CJB A;  3V8J A;  3RKY A;  3UGQ A;  1EIY A;  1B8A A;  1YFS A;  1N9W A;  3HXZ A;  4P74 A;  2QHV A;  1E24 A;  2ZZE A;  3P8V A;  3P8T A;  4CH4 A;  4RDX A;  2DJZ A;  4HT4 A;  1YFT A;  2E10 A;  2PME A;  2DVE A;  4XEO A;  2ZNI A;  4YRF A;  4P3P A;  1E1O A;  4HWS A;  4H2V A;  2HNI A;  4HVC A;  4WJ3 M;  1H4S A;  3IG2 A;  4O2D A;  4UP7 A;  2C8M A;  1NYR A;  2P5I A;  2ARS A;  2IY5 B;  1KMM A;  2ZCE A;  4AH6 A;  1X55 A;  4KQE A;  1Z7M A;  4CS4 A;  2Q7H A;  4HWP A;  4P3O A;  4RQE A;  2ZIO A;  3IKM B;  1B70 A;  3NEL A;  2ARU A;  3A7U A;  3L4G A;  3HXY A;  3I7F A;  1USY A;  1EOV A;  4X5O A;  4XTV A;  4E51 A;  2EL9 A;  1PYS B;  4WF2 A;  3RAC A;  1BBU A;  4H2W A;  4H2T A;  3VBB A;  4CH5 A;  2Q5H A;  3HXU A;  2E5A A;  2XTI A;  4H2X A;  1FYF A;  1B76 A;  3V7S A;  1WQW A;  4ZTZ B;  2ZR2 A;  2DTO A;  2RHS B;  1EFW A;  4YCW A;  4CH3 A;  2ART A;  4LVK A;  3QO7 A;  4OLF A;  4CS2 A;  3TEH B;  1KOG A;  5C53 B;  2DTI A;  3NET A;  2QHS A;  2ZGW A;  3UGT A;  4XTW A;  4YRC A;  2E3C A;  2Q7E A;  3LSS A;  4TQF A;  1PYS A;  1WPY A;  1X2H A;  3IKL A;  4TWA A;  1WU7 A;  5K1P A;  4YCV A;  2ZT5 A;  2ZZF A;  1H4Q A;  3LSQ A;  2EJ9 A;  4CS3 A;  1L0W A;  2QHU A;  1JJC B;  5HGQ A;  4XTY A;  4CH6 A;  3G1Z A;  2QHT A;  1WLE A;  4K86 A;  4HWR A;  2ZT8 A;  5E3I A;  5C52 B;  3BFM A;  4PHC A;  2DZ9 A;  4YYE A;  3TEH A;  2ODR D;  1YGB A;  1HXD A;  2CJ9 A;  3M4P A;  3HRK A;  4TVA A;  1IL2 A;  3PZC A;  4TTV A;  4K88 A;  4P72 A;  3L2Z A;  2DU5 A;  2RHS A;  2ZIN A;  2P0L A;  4RMF A;  2ZT6 A;  4TVY A;  3VQW A;  4YCU A;  4TVA B;  1ATI A;  2RHQ A;  3MF2 A;  2ZZG A;  4XTU A;  2DXT A;  1ASY A;  3REU A;  4XTX A;  3HXW A;  1H4T A;  4K87 A;  4YRO A;  2ALY B;  3A74 A;  4XU1 A;  2XGT A;  4ZTU B;  1BBW A;  3RL6 A;  3HY0 A;  3RIR A;  1G5I A;  3EFS A;  3HTZ A;  2Q5I A;  2CJA A;  2DTH A;  1NJ2 A;  1VQZ A;  2ALY A;  3PCO A;  12AS A;  1USY C;  4PG3 A;  1SET A;  2Q7G A;  2E65 A;  1YB3 A;  4YRE A;  1KMN A;  2A8E A;  3VQV A;  3MF1 A;  3WQZ A;  4XTZ A;  1W66 A;  4ZIB A;  4YRJ A;  4BW9 A;  2EAY A;  5C51 B;  3MEY A;  3HFZ A;  1SES A;  3OD1 A;  1ADJ A;  1B70 B;  4Q6G A;  3HXV A;  3A5Y A;  4HA8 A;  1NYQ A;  1B7Y B;  4LNS A;  5K1X A;  1BIA A;  1EVL A;  1HTT A;  4XU2 A;  4YRI A;  1E1T A;  4NCX A;  3M4Q A;  1WQ7 A;  1QE0 A;  4YRM A;  4TQD A;  2DEQ A;  3PCO B;  4TVW A;  4P74 C;  2DKG A;  3HY1 A;  3ICA A;  2DQ3 A;  3BJU A;  2ZNJ A;  4YP0 A;  4YRR A;  1LYL A;  1GGM A;  2AKW A;  3W3S A;  3V8K A;  2FYK A;  4YRG A;  2ZR3 A;  2AMC B;  11AS A;  3E9H A;  5ELO A;  1RIQ A;  3P8Y A;  4UP8 A;  4UPA A;  4DQ2 A;  2IY5 A;  1ADY A;  3RGL A;  2RHQ B;  4WI1 A;  3NEN A;  2EJF A;  1HC7 A;  4XEM A;  4YPF A;  3KFU A;  2CGH A;  1B7Y A;  1SRY A;  4P3N A;  1Z7N A;  4P71 A;  3V8L A;  2DDZ A;  3HRI A;  3L4G B;  3A7R A;  2I4O A;  4DPG A;  1YFR A;  3A32 A;  4YRK A;  2DU7 A;  1JJC A;  4H2Y A;  4H2S A;  4G85 A;  2I4N A;  3FJP A;  1WNL A;  3V7R A;  4H2X B;  4KR2 A;  2E64 A;  3UH0 A;  1EQR A;  3QO8 A;  2DZC A;  4Q15 A;  4LVL A;  3UFG A;  2AMC A;  1NJ8 A;  3A7A A;  4P73 A;  3HXX A;  4EX5 A;  3R07 A;  1J5W A;  4YRS A;  2DXU A;  1E22 A;  4P75 A;  1X56 A;  3V7C A;  4WJ4 A;  3RUX A;  4YDQ A;  2ZIM A;  3HFZ B;  1NJ5 A;  3L1A A;  3A31 A;  2I4L A;  4KR3 A;  2E1H A;  3A5Z A;  3TUP A;  3MQZ A;  2EWN A;  5ELN A;  3VQY A;  4YRT A;  2G4C A;  4RQF A;  2PMF A;  3RKW A;  2J3M A;  1C0A A;  1NJ6 A;  4XU3 A;  3TEG A;  3NEM A;  3VQX A;  4LVI A;  4P71 C;  2NS6 A;  1G5H A;  4P75 C;  3QO5 A;  4YRP A;  1NNH A;  1X54 A;  1BIB A;  1G51 A;  4P72 C;  4P73 C;  4YRQ A;  4H02 A;  3QNE A;  4UP9 A;  4J15 A;  1NJ1 A;  2ZXF A;  2EJG A;  2ZTG A;  4OP0 A;  3E9I A;  4EO4 A;  2AKW B;  2J3L A;  2DQ0 A;  4H2U A;  1EIY B;  3RKX A;  3LC0 A;  5F5W A;  2I4M A;  4YRN A;  1ASZ A;  3RF1 A;  1QF6 A;  1X01 A;  1X2G A;  2ODR C;  3IAL A;  4L87 A;  2CIM A;  2ZT7 A;  2E41 A;  3QTC A;  4LVM A;  4BWA A;  3CMQ A;  4G84 A;  1H4V B;  4XU0 A;  4HWT A;  2C7I A;  3DSQ A;  4LVJ A;  3HFV A; 
#chains in the Genus database with same CATH homology
 5KNN A;  1WYD A;  3REX A;  3EFR A;  4HWO A;  3ERR A;  1EVK A;  4YRL A;  1SER A;  2CJB A;  3V8J A;  3RKY A;  3UGQ A;  1EIY A;  1B8A A;  1YFS A;  1N9W A;  3HXZ A;  4P74 A;  2QHV A;  1E24 A;  2ZZE A;  3P8V A;  3P8T A;  4CH4 A;  4RDX A;  2DJZ A;  4HT4 A;  1YFT A;  2E10 A;  2PME A;  2DVE A;  4XEO A;  2ZNI A;  4YRF A;  4P3P A;  1E1O A;  4HWS A;  4H2V A;  2HNI A;  4HVC A;  4WJ3 M;  1H4S A;  3IG2 A;  4O2D A;  4UP7 A;  2C8M A;  1NYR A;  2P5I A;  2ARS A;  2IY5 B;  1KMM A;  2ZCE A;  4AH6 A;  1X55 A;  4KQE A;  1Z7M A;  4CS4 A;  2Q7H A;  4HWP A;  4P3O A;  4RQE A;  2ZIO A;  3IKM B;  1B70 A;  3NEL A;  2ARU A;  3A7U A;  3L4G A;  3HXY A;  3I7F A;  1USY A;  1EOV A;  4X5O A;  4XTV A;  4E51 A;  2EL9 A;  1PYS B;  4WF2 A;  3RAC A;  1BBU A;  4H2W A;  4H2T A;  3VBB A;  4CH5 A;  2Q5H A;  3HXU A;  2E5A A;  2XTI A;  4H2X A;  1FYF A;  1B76 A;  3V7S A;  1WQW A;  4ZTZ B;  2ZR2 A;  2DTO A;  2RHS B;  1EFW A;  4YCW A;  4CH3 A;  2ART A;  4LVK A;  3QO7 A;  4OLF A;  4CS2 A;  3TEH B;  1KOG A;  5C53 B;  2DTI A;  3NET A;  2QHS A;  2ZGW A;  3UGT A;  4XTW A;  4YRC A;  2E3C A;  2Q7E A;  3LSS A;  4TQF A;  1PYS A;  1WPY A;  1X2H A;  3IKL A;  4TWA A;  1WU7 A;  5K1P A;  4YCV A;  2ZT5 A;  2ZZF A;  1H4Q A;  3LSQ A;  2EJ9 A;  4CS3 A;  1L0W A;  2QHU A;  1JJC B;  5HGQ A;  4XTY A;  4CH6 A;  3G1Z A;  2QHT A;  1WLE A;  4K86 A;  4HWR A;  2ZT8 A;  5E3I A;  5C52 B;  3BFM A;  4PHC A;  2DZ9 A;  4YYE A;  3TEH A;  2ODR D;  1YGB A;  1HXD A;  2CJ9 A;  3M4P A;  3HRK A;  4TVA A;  1IL2 A;  3PZC A;  4TTV A;  4K88 A;  4P72 A;  3L2Z A;  2DU5 A;  2RHS A;  2ZIN A;  2P0L A;  4RMF A;  2ZT6 A;  4TVY A;  3VQW A;  4YCU A;  4TVA B;  1ATI A;  2RHQ A;  3MF2 A;  2ZZG A;  4XTU A;  2DXT A;  1ASY A;  3REU A;  4XTX A;  3HXW A;  1H4T A;  4K87 A;  4YRO A;  2ALY B;  3A74 A;  4XU1 A;  2XGT A;  4ZTU B;  1BBW A;  3RL6 A;  3HY0 A;  3RIR A;  1G5I A;  3EFS A;  3HTZ A;  2Q5I A;  2CJA A;  2DTH A;  1NJ2 A;  1VQZ A;  2ALY A;  3PCO A;  12AS A;  1USY C;  4PG3 A;  1SET A;  2Q7G A;  2E65 A;  1YB3 A;  4YRE A;  1KMN A;  2A8E A;  3VQV A;  3MF1 A;  3WQZ A;  4XTZ A;  1W66 A;  4ZIB A;  4YRJ A;  4BW9 A;  2EAY A;  5C51 B;  3MEY A;  3HFZ A;  1SES A;  3OD1 A;  1ADJ A;  1B70 B;  4Q6G A;  3HXV A;  3A5Y A;  4HA8 A;  1NYQ A;  1B7Y B;  4LNS A;  5K1X A;  1BIA A;  1EVL A;  1HTT A;  4XU2 A;  4YRI A;  1E1T A;  4NCX A;  3M4Q A;  1WQ7 A;  1QE0 A;  4YRM A;  4TQD A;  2DEQ A;  3PCO B;  4TVW A;  4P74 C;  2DKG A;  3HY1 A;  3ICA A;  2DQ3 A;  3BJU A;  2ZNJ A;  4YP0 A;  4YRR A;  1LYL A;  1GGM A;  2AKW A;  3W3S A;  3V8K A;  2FYK A;  4YRG A;  2ZR3 A;  2AMC B;  11AS A;  3E9H A;  5ELO A;  1RIQ A;  3P8Y A;  4UP8 A;  4UPA A;  4DQ2 A;  2IY5 A;  1ADY A;  3RGL A;  2RHQ B;  4WI1 A;  3NEN A;  2EJF A;  1HC7 A;  4XEM A;  4YPF A;  3KFU A;  2CGH A;  1B7Y A;  1SRY A;  4P3N A;  1Z7N A;  4P71 A;  3V8L A;  2DDZ A;  3HRI A;  3L4G B;  3A7R A;  2I4O A;  4DPG A;  1YFR A;  3A32 A;  4YRK A;  2DU7 A;  1JJC A;  4H2Y A;  4H2S A;  4G85 A;  2I4N A;  3FJP A;  1WNL A;  3V7R A;  4H2X B;  4KR2 A;  2E64 A;  3UH0 A;  1EQR A;  3QO8 A;  2DZC A;  4Q15 A;  4LVL A;  3UFG A;  2AMC A;  1NJ8 A;  3A7A A;  4P73 A;  3HXX A;  4EX5 A;  3R07 A;  1J5W A;  4YRS A;  2DXU A;  1E22 A;  4P75 A;  1X56 A;  3V7C A;  4WJ4 A;  3RUX A;  4YDQ A;  2ZIM A;  3HFZ B;  1NJ5 A;  3L1A A;  3A31 A;  2I4L A;  4KR3 A;  2E1H A;  3A5Z A;  3TUP A;  3MQZ A;  2EWN A;  5ELN A;  3VQY A;  4YRT A;  2G4C A;  4RQF A;  2PMF A;  3RKW A;  2J3M A;  1C0A A;  1NJ6 A;  4XU3 A;  3TEG A;  3NEM A;  3VQX A;  4LVI A;  4P71 C;  2NS6 A;  1G5H A;  4P75 C;  3QO5 A;  4YRP A;  1NNH A;  1X54 A;  1BIB A;  1G51 A;  4P72 C;  4P73 C;  4YRQ A;  4H02 A;  3QNE A;  4UP9 A;  4J15 A;  1NJ1 A;  2ZXF A;  2EJG A;  2ZTG A;  4OP0 A;  3E9I A;  4EO4 A;  2AKW B;  2J3L A;  2DQ0 A;  4H2U A;  1EIY B;  3RKX A;  3LC0 A;  5F5W A;  2I4M A;  4YRN A;  1ASZ A;  3RF1 A;  1QF6 A;  1X01 A;  1X2G A;  2ODR C;  3IAL A;  4L87 A;  2CIM A;  2ZT7 A;  2E41 A;  3QTC A;  4LVM A;  4BWA A;  3CMQ A;  4G84 A;  1H4V B;  4XU0 A;  4HWT A;  2C7I A;  3DSQ A;  4LVJ A;  3HFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...