2QHVA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
210
Chain Sequence
b'MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 67
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhvA01
4WJ4A 2CJ9A 4P71C 3TEHB 2XTIA 4BWAA 4CS2A 4EX5A 1SRYA 1USYA 1BBUA 2E1HA 2QHUA 3A5ZA 4YCUA 5E3IA 3A7RA 2E65A 3P8VA 4E51A 2IY5A 3PCOB 3A5YA 3RKWA 4ZTZB 3HXYA 4RDXA 1Z7MA 2EJFA 4KQEA 4P71A 4BW9A 1KMNA 4YPFA 3LC0A 4UP8A 1NYRA 1X55A 4CH5A 2ZINA 1WU7A 2ZNIA 3HXXA 3WQZA 4K88A 3A7UA 2CGHA 4YRQA 4PHCA 2ZR2A 2QHVA 1SETA 1B76A 4P75C 2PMFA 4YRIA 1EQRA 4X5OA 3VQYA 1WYDA 4UP9A 4XU3A 2ALYA 4CS3A 4H2XB 2FYKA 1HXDA 3DSQA 4HWSA 2I4LA 4XEOA 3UH0A 4DPGA 3MF1A 3EFRA 4NCXA 5ELOA 2ARSA 2C8MA 4YRCA 4G85A 3VQWA 4AH6A 4OLFA 2ARUA 3EFSA 3ICAA 3IKLA 3G1ZA 4HA8A 3HXUA 1RIQA 3HXZA 1J5WA 1N9WA 1SERA 4YRGA 1H4QA 3RACA 3V8KA 4ZIBA 4XEMA 1ATIA 2ZT7A 5F5WA 1B70A 3R07A 3HFZA 3TEGA 1YFRA 1B7YA 1USYC 2E5AA 4H2TA 1FYFA 3RL6A 1E22A 3RF1A 1BIBA 5HGQA 3VQXA 3NEMA 4H2VA 3RUXA 1EFWA 3A31A 1YGBA 3V8JA 1ADYA 2DU7A 2ZZFA 3MEYA 3HXWA 2DU5A 2E3CA 4PG3A 4TTVA 1WQ7A 4RQFA 1NNHA 1X54A 2DDZA 4XU0A 2ZIOA 4YREA 3A7AA 4YRSA 3REXA 5ELNA 4YRRA 1NJ1A 2ODRD 1JJCA 1NJ6A 4CH6A 2IY5B 4HWRA 2PMEA 2AMCA 2CJAA 3I7FA 3UGQA 4H2SA 1SESA 2ZT6A 4ZTUB 3V8LA 4XTUA 2RHSA 3BFMA 1G5IA 2EL9A 3RKYA 2CJBA 1PYSA 2E10A 1Z7NA 2J3LA 4YYEA 3P8TA 4YRJA 2RHQA 3OD1A 3UFGA 4TVAA 2ZIMA 3IKMB 1IL2A 3L4GA 2ZXFA 4YRPA 1BIAA 2ZT8A 1YFSA 2ALYB 4H2UA 2Q5IA 4O2DA 3V7SA 5C53B 2DXTA 3M4PA 4H2YA 2Q7GA 1YB3A 2ZT5A 2ODRC 1ADJA 4EO4A 3PZCA 3LSQA 4KR2A 1LYLA 3VBBA 4YDQA 4XTVA 3P8YA 3W3SA 2E64A 4OP0A 1QE0A 4P73C 4P74C 1HC7A 4HWTA 2QHTA 3HRIA 3M4QA 2AKWA 1C0AA 1BBWA 3ERRA 4DQ2A 2DXUA 4YRTA 1B70B 2DVEA 4RMFA 3HFZB 2DKGA 5C51B 3IG2A 3HFVA 1B7YB 1NJ8A 4G84A 3L2ZA 1EIYA 3UGTA 3NETA 3E9HA 4P73A 1ASYA 1WQWA 4P74A 5K1XA 3KFUA 2DTIA 1WLEA 4Q15A 1EVKA 2EAYA 12ASA 3V7CA 3TEHA 2Q7HA 1ASZA 1H4SA 4XTYA 11ASA 1X2HA 4CS4A 2DJZA 4YRFA 5K1PA 1H4TA 4WF2A 2DTOA 4KR3A 2DEQA 4WJ3M 1B8AA 4H2WA 1YFTA 3L1AA 2ZZGA 3HTZA 2I4NA 1JJCB 3PCOA 3HY0A 1L0WA 2AMCB 2EJ9A 4L87A 3QO7A 3IALA 4P3NA 4YRLA 3QNEA 3HY1A 4UPAA 4LNSA 4XTXA 2RHSB 3CMQA 1NJ5A 1PYSB 1NJ2A 2E41A 4YRMA 2CIMA 2ARTA 2RHQB 4TQDA 4YCVA 2DQ0A 4TVAB 1VQZA 3RIRA 3QO8A 2I4OA 1WNLA 3L4GB 4H2XA 4CH4A 1X56A 4XTWA 4P3OA 3RKXA 3VQVA 1QF6A 3HXVA 4K87A 3BJUA 2DZ9A 2G4CA 4YRKA 3QTCA 3REUA 1G5HA 4XTZA 2DZCA 4Q6GA 4UP7A 3MF2A 4YCWA 4TVWA 1EVLA 2Q7EA 3V7RA 2Q5HA 1E1OA 2ZZEA 2ZR3A 1KOGA 3LSSA 4XU1A 4TWAA 2J3MA 2XGTA 4P75A 2P0LA 4HVCA 4K86A 1E1TA 4RQEA 2EWNA 2ZTGA 4P72C 3A74A 2DTHA 3RGLA 4J15A 3E9IA 1H4VB 1KMMA 4TQFA 1WPYA 2ZCEA 4WI1A 1E24A 3TUPA 4XU2A 2QHSA 2ZGWA 1EOVA 2AKWB 3NELA 2I4MA 1X2GA 2P5IA 4YRNA 4P3PA 1W66A 1NYQA 1HTTA 4HWPA 4HWOA 2DQ3A 4H02A 4P72A 1EIYB 1X01A 4TVYA 3HRKA 2C7IA 3FJPA 3QO5A 5KNNA 5C52B 4CH3A 4YP0A 4YROA 3A32A 1GGMA 2HNIA 3NENA 2ZNJA 1G51A 2EJGA
chains in the Genus database with same CATH superfamily
4WJ4A 2CJ9A 4P71C 3TEHB 2XTIA 4BWAA 4CS2A 4EX5A 1SRYA 1USYA 1BBUA 2E1HA 2QHUA 3A5ZA 4YCUA 5E3IA 3A7RA 2E65A 3P8VA 4E51A 2IY5A 3PCOB 3A5YA 3RKWA 4ZTZB 3HXYA 4RDXA 1Z7MA 2EJFA 4KQEA 4P71A 4BW9A 1KMNA 4YPFA 3LC0A 4UP8A 1NYRA 1X55A 4CH5A 2ZINA 1WU7A 2ZNIA 3HXXA 3WQZA 4K88A 3A7UA 2CGHA 4YRQA 4PHCA 2ZR2A 2QHVA 4LVMA 1SETA 1B76A 4P75C 2PMFA 4YRIA 1EQRA 4X5OA 3VQYA 1WYDA 4UP9A 3MQZA 4XU3A 2ALYA 4CS3A 4H2XB 2FYKA 1HXDA 3DSQA 4HWSA 2I4LA 4XEOA 3UH0A 4DPGA 3MF1A 3EFRA 4LVLA 4NCXA 5ELOA 2ARSA 2C8MA 4YRCA 4G85A 3VQWA 4AH6A 4OLFA 2ARUA 3EFSA 3ICAA 3IKLA 3G1ZA 4HA8A 3HXUA 1RIQA 3HXZA 1J5WA 1N9WA 1SERA 4YRGA 1H4QA 3RACA 3V8KA 4ZIBA 4XEMA 1ATIA 2ZT7A 5F5WA 1B70A 3R07A 3HFZA 3TEGA 1YFRA 1B7YA 1USYC 2E5AA 4H2TA 1FYFA 3RL6A 1E22A 3RF1A 1BIBA 5HGQA 3VQXA 3NEMA 4H2VA 3RUXA 1EFWA 3A31A 1YGBA 3V8JA 1ADYA 2DU7A 2ZZFA 3MEYA 3HXWA 2DU5A 2E3CA 4PG3A 4TTVA 1WQ7A 4RQFA 1NNHA 1X54A 2DDZA 4XU0A 2ZIOA 4YREA 3A7AA 4YRSA 3REXA 5ELNA 4YRRA 1NJ1A 2ODRD 1JJCA 1NJ6A 4CH6A 2IY5B 4HWRA 2PMEA 2AMCA 2CJAA 3I7FA 3UGQA 4H2SA 4HT4A 1SESA 2ZT6A 4ZTUB 3V8LA 4XTUA 2RHSA 3BFMA 1G5IA 2EL9A 3RKYA 2CJBA 1PYSA 2E10A 1Z7NA 2J3LA 4YYEA 3P8TA 4YRJA 2RHQA 3OD1A 3UFGA 2NS6A 4TVAA 2ZIMA 3IKMB 1IL2A 3L4GA 2ZXFA 4YRPA 1BIAA 2ZT8A 1YFSA 2ALYB 4H2UA 2Q5IA 4O2DA 3V7SA 5C53B 4LVIA 2DXTA 3M4PA 4H2YA 2Q7GA 1YB3A 2ZT5A 2ODRC 1ADJA 4EO4A 3PZCA 3LSQA 4KR2A 1LYLA 3VBBA 4LVKA 4YDQA 4XTVA 3P8YA 3W3SA 2E64A 4OP0A 1QE0A 4P73C 4P74C 1HC7A 4HWTA 2QHTA 3HRIA 3M4QA 2AKWA 1C0AA 1BBWA 3ERRA 4DQ2A 4LVJA 2DXUA 4YRTA 1B70B 2DVEA 4RMFA 3HFZB 2DKGA 5C51B 3IG2A 3HFVA 1B7YB 1NJ8A 4G84A 3L2ZA 1EIYA 3UGTA 3NETA 3E9HA 4P73A 1ASYA 1WQWA 4P74A 5K1XA 3KFUA 2DTIA 1WLEA 4Q15A 1EVKA 2EAYA 12ASA 3V7CA 3TEHA 2A8EA 2Q7HA 1ASZA 1H4SA 4XTYA 11ASA 1X2HA 4CS4A 2DJZA 4YRFA 5K1PA 1H4TA 4WF2A 2DTOA 4KR3A 2DEQA 4WJ3M 1B8AA 4H2WA 1YFTA 3L1AA 2ZZGA 3HTZA 2I4NA 1JJCB 3PCOA 3HY0A 1L0WA 2AMCB 2EJ9A 4L87A 3QO7A 3IALA 4P3NA 4YRLA 3QNEA 3HY1A 4UPAA 4LNSA 4XTXA 2RHSB 3CMQA 1NJ5A 1PYSB 1NJ2A 2E41A 4YRMA 2CIMA 2ARTA 2RHQB 4TQDA 4YCVA 2DQ0A 4TVAB 1VQZA 3RIRA 3QO8A 2I4OA 1WNLA 3L4GB 4H2XA 4CH4A 1X56A 4XTWA 4P3OA 3RKXA 3VQVA 1QF6A 3HXVA 4K87A 3BJUA 2DZ9A 2G4CA 4YRKA 3QTCA 3REUA 1G5HA 4XTZA 2DZCA 4Q6GA 4UP7A 3MF2A 4YCWA 4TVWA 1EVLA 2Q7EA 3V7RA 2Q5HA 1E1OA 2ZZEA 2ZR3A 1KOGA 3LSSA 4XU1A 4TWAA 2J3MA 2XGTA 4P75A 2P0LA 4HVCA 4K86A 1E1TA 4RQEA 2EWNA 2ZTGA 4P72C 3A74A 2DTHA 3RGLA 4J15A 3E9IA 1H4VB 1KMMA 4TQFA 1WPYA 2ZCEA 4WI1A 1E24A 3TUPA 4XU2A 2QHSA 2ZGWA 1EOVA 2AKWB 3NELA 2I4MA 1X2GA 2P5IA 4YRNA 4P3PA 1W66A 1NYQA 1HTTA 4HWPA 4HWOA 2DQ3A 4H02A 4P72A 1EIYB 1X01A 4TVYA 3HRKA 2C7IA 3FJPA 3QO5A 5KNNA 5C52B 4CH3A 4YP0A 4YROA 3A32A 1GGMA 2HNIA 3NENA 2ZNJA 1G51A 2EJGA
chains in the Genus database with same CATH topology
4WJ4A 2CJ9A 4P71C 3TEHB 2XTIA 4BWAA 4CS2A 4EX5A 1SRYA 1USYA 1BBUA 2E1HA 2QHUA 3A5ZA 4YCUA 5E3IA 3A7RA 2E65A 3P8VA 4E51A 2IY5A 3PCOB 3A5YA 3RKWA 4ZTZB 3HXYA 4RDXA 1Z7MA 2EJFA 4KQEA 4P71A 4BW9A 1KMNA 4YPFA 3LC0A 4UP8A 1NYRA 1X55A 4CH5A 2ZINA 1WU7A 2ZNIA 3HXXA 3WQZA 4K88A 3A7UA 2CGHA 4YRQA 4PHCA 2ZR2A 2QHVA 4LVMA 1SETA 1B76A 4P75C 2PMFA 4YRIA 1EQRA 4X5OA 3VQYA 1WYDA 4UP9A 3MQZA 4XU3A 2ALYA 4CS3A 4H2XB 2FYKA 1HXDA 3DSQA 4HWSA 2I4LA 4XEOA 3UH0A 4DPGA 3MF1A 3EFRA 4LVLA 4NCXA 5ELOA 2ARSA 2C8MA 4YRCA 4G85A 3VQWA 4AH6A 4OLFA 2ARUA 3EFSA 3ICAA 3IKLA 3G1ZA 4HA8A 3HXUA 1RIQA 3HXZA 1J5WA 1N9WA 1SERA 4YRGA 1H4QA 3RACA 3V8KA 4ZIBA 4XEMA 1ATIA 2ZT7A 5F5WA 1B70A 3R07A 3HFZA 3TEGA 1YFRA 1B7YA 1USYC 2E5AA 4H2TA 1FYFA 3RL6A 1E22A 3RF1A 1BIBA 5HGQA 3VQXA 3NEMA 4H2VA 3RUXA 1EFWA 3A31A 1YGBA 3V8JA 1ADYA 2DU7A 2ZZFA 3MEYA 3HXWA 2DU5A 2E3CA 4PG3A 4TTVA 1WQ7A 4RQFA 1NNHA 1X54A 2DDZA 4XU0A 2ZIOA 4YREA 3A7AA 4YRSA 3REXA 5ELNA 4YRRA 1NJ1A 2ODRD 1JJCA 1NJ6A 4CH6A 2IY5B 4HWRA 2PMEA 2AMCA 2CJAA 3I7FA 3UGQA 4H2SA 4HT4A 1SESA 2ZT6A 4ZTUB 3V8LA 4XTUA 2RHSA 3BFMA 1G5IA 2EL9A 3RKYA 2CJBA 1PYSA 2E10A 1Z7NA 2J3LA 4YYEA 3P8TA 4YRJA 2RHQA 3OD1A 3UFGA 2NS6A 4TVAA 2ZIMA 3IKMB 1IL2A 3L4GA 2ZXFA 4YRPA 1BIAA 2ZT8A 1YFSA 2ALYB 4H2UA 2Q5IA 4O2DA 3V7SA 5C53B 4LVIA 2DXTA 3M4PA 4H2YA 2Q7GA 1YB3A 2ZT5A 2ODRC 1ADJA 4EO4A 3PZCA 3LSQA 4KR2A 1LYLA 3VBBA 4LVKA 4YDQA 4XTVA 3P8YA 3W3SA 2E64A 4OP0A 1QE0A 4P73C 4P74C 1HC7A 4HWTA 2QHTA 3HRIA 3M4QA 2AKWA 1C0AA 1BBWA 3ERRA 4DQ2A 4LVJA 2DXUA 4YRTA 1B70B 2DVEA 4RMFA 3HFZB 2DKGA 5C51B 3IG2A 3HFVA 1B7YB 1NJ8A 4G84A 3L2ZA 1EIYA 3UGTA 3NETA 3E9HA 4P73A 1ASYA 1WQWA 4P74A 5K1XA 3KFUA 2DTIA 1WLEA 4Q15A 1EVKA 2EAYA 12ASA 3V7CA 3TEHA 2A8EA 2Q7HA 1ASZA 1H4SA 4XTYA 11ASA 1X2HA 4CS4A 2DJZA 4YRFA 5K1PA 1H4TA 4WF2A 2DTOA 4KR3A 2DEQA 4WJ3M 1B8AA 4H2WA 1YFTA 3L1AA 2ZZGA 3HTZA 2I4NA 1JJCB 3PCOA 3HY0A 1L0WA 2AMCB 2EJ9A 4L87A 3QO7A 3IALA 4P3NA 4YRLA 3QNEA 3HY1A 4UPAA 4LNSA 4XTXA 2RHSB 3CMQA 1NJ5A 1PYSB 1NJ2A 2E41A 4YRMA 2CIMA 2ARTA 2RHQB 4TQDA 4YCVA 2DQ0A 4TVAB 1VQZA 3RIRA 3QO8A 2I4OA 1WNLA 3L4GB 4H2XA 4CH4A 1X56A 4XTWA 4P3OA 3RKXA 3VQVA 1QF6A 3HXVA 4K87A 3BJUA 2DZ9A 2G4CA 4YRKA 3QTCA 3REUA 1G5HA 4XTZA 2DZCA 4Q6GA 4UP7A 3MF2A 4YCWA 4TVWA 1EVLA 2Q7EA 3V7RA 2Q5HA 1E1OA 2ZZEA 2ZR3A 1KOGA 3LSSA 4XU1A 4TWAA 2J3MA 2XGTA 4P75A 2P0LA 4HVCA 4K86A 1E1TA 4RQEA 2EWNA 2ZTGA 4P72C 3A74A 2DTHA 3RGLA 4J15A 3E9IA 1H4VB 1KMMA 4TQFA 1WPYA 2ZCEA 4WI1A 1E24A 3TUPA 4XU2A 2QHSA 2ZGWA 1EOVA 2AKWB 3NELA 2I4MA 1X2GA 2P5IA 4YRNA 4P3PA 1W66A 1NYQA 1HTTA 4HWPA 4HWOA 2DQ3A 4H02A 4P72A 1EIYB 1X01A 4TVYA 3HRKA 2C7IA 3FJPA 3QO5A 5KNNA 5C52B 4CH3A 4YP0A 4YROA 3A32A 1GGMA 2HNIA 3NENA 2ZNJA 1G51A 2EJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ4 A;  2CJ9 A;  4P71 C;  3TEH B;  2XTI A;  4BWA A;  4CS2 A;  4EX5 A;  1SRY A;  1USY A;  1BBU A;  2E1H A;  2QHU A;  3A5Z A;  4YCU A;  5E3I A;  3A7R A;  2E65 A;  3P8V A;  4E51 A;  2IY5 A;  3PCO B;  3A5Y A;  3RKW A;  4ZTZ B;  3HXY A;  4RDX A;  1Z7M A;  2EJF A;  4KQE A;  4P71 A;  4BW9 A;  1KMN A;  4YPF A;  3LC0 A;  4UP8 A;  1NYR A;  1X55 A;  4CH5 A;  2ZIN A;  1WU7 A;  2ZNI A;  3HXX A;  3WQZ A;  4K88 A;  3A7U A;  2CGH A;  4YRQ A;  4PHC A;  2ZR2 A;  2QHV A;  1SET A;  1B76 A;  4P75 C;  2PMF A;  4YRI A;  1EQR A;  4X5O A;  3VQY A;  1WYD A;  4UP9 A;  4XU3 A;  2ALY A;  4CS3 A;  4H2X B;  2FYK A;  1HXD A;  3DSQ A;  4HWS A;  2I4L A;  4XEO A;  3UH0 A;  4DPG A;  3MF1 A;  3EFR A;  4NCX A;  5ELO A;  2ARS A;  2C8M A;  4YRC A;  4G85 A;  3VQW A;  4AH6 A;  4OLF A;  2ARU A;  3EFS A;  3ICA A;  3IKL A;  3G1Z A;  4HA8 A;  3HXU A;  1RIQ A;  3HXZ A;  1J5W A;  1N9W A;  1SER A;  4YRG A;  1H4Q A;  3RAC A;  3V8K A;  4ZIB A;  4XEM A;  1ATI A;  2ZT7 A;  5F5W A;  1B70 A;  3R07 A;  3HFZ A;  3TEG A;  1YFR A;  1B7Y A;  1USY C;  2E5A A;  4H2T A;  1FYF A;  3RL6 A;  1E22 A;  3RF1 A;  1BIB A;  5HGQ A;  3VQX A;  3NEM A;  4H2V A;  3RUX A;  1EFW A;  3A31 A;  1YGB A;  3V8J A;  1ADY A;  2DU7 A;  2ZZF A;  3MEY A;  3HXW A;  2DU5 A;  2E3C A;  4PG3 A;  4TTV A;  1WQ7 A;  4RQF A;  1NNH A;  1X54 A;  2DDZ A;  4XU0 A;  2ZIO A;  4YRE A;  3A7A A;  4YRS A;  3REX A;  5ELN A;  4YRR A;  1NJ1 A;  2ODR D;  1JJC A;  1NJ6 A;  4CH6 A;  2IY5 B;  4HWR A;  2PME A;  2AMC A;  2CJA A;  3I7F A;  3UGQ A;  4H2S A;  1SES A;  2ZT6 A;  4ZTU B;  3V8L A;  4XTU A;  2RHS A;  3BFM A;  1G5I A;  2EL9 A;  3RKY A;  2CJB A;  1PYS A;  2E10 A;  1Z7N A;  2J3L A;  4YYE A;  3P8T A;  4YRJ A;  2RHQ A;  3OD1 A;  3UFG A;  4TVA A;  2ZIM A;  3IKM B;  1IL2 A;  3L4G A;  2ZXF A;  4YRP A;  1BIA A;  2ZT8 A;  1YFS A;  2ALY B;  4H2U A;  2Q5I A;  4O2D A;  3V7S A;  5C53 B;  2DXT A;  3M4P A;  4H2Y A;  2Q7G A;  1YB3 A;  2ZT5 A;  2ODR C;  1ADJ A;  4EO4 A;  3PZC A;  3LSQ A;  4KR2 A;  1LYL A;  3VBB A;  4YDQ A;  4XTV A;  3P8Y A;  3W3S A;  2E64 A;  4OP0 A;  1QE0 A;  4P73 C;  4P74 C;  1HC7 A;  4HWT A;  2QHT A;  3HRI A;  3M4Q A;  2AKW A;  1C0A A;  1BBW A;  3ERR A;  4DQ2 A;  2DXU A;  4YRT A;  1B70 B;  2DVE A;  4RMF A;  3HFZ B;  2DKG A;  5C51 B;  3IG2 A;  3HFV A;  1B7Y B;  1NJ8 A;  4G84 A;  3L2Z A;  1EIY A;  3UGT A;  3NET A;  3E9H A;  4P73 A;  1ASY A;  1WQW A;  4P74 A;  5K1X A;  3KFU A;  2DTI A;  1WLE A;  4Q15 A;  1EVK A;  2EAY A;  12AS A;  3V7C A;  3TEH A;  2Q7H A;  1ASZ A;  1H4S A;  4XTY A;  11AS A;  1X2H A;  4CS4 A;  2DJZ A;  4YRF A;  5K1P A;  1H4T A;  4WF2 A;  2DTO A;  4KR3 A;  2DEQ A;  4WJ3 M;  1B8A A;  4H2W A;  1YFT A;  3L1A A;  2ZZG A;  3HTZ A;  2I4N A;  1JJC B;  3PCO A;  3HY0 A;  1L0W A;  2AMC B;  2EJ9 A;  4L87 A;  3QO7 A;  3IAL A;  4P3N A;  4YRL A;  3QNE A;  3HY1 A;  4UPA A;  4LNS A;  4XTX A;  2RHS B;  3CMQ A;  1NJ5 A;  1PYS B;  1NJ2 A;  2E41 A;  4YRM A;  2CIM A;  2ART A;  2RHQ B;  4TQD A;  4YCV A;  2DQ0 A;  4TVA B;  1VQZ A;  3RIR A;  3QO8 A;  2I4O A;  1WNL A;  3L4G B;  4H2X A;  4CH4 A;  1X56 A;  4XTW A;  4P3O A;  3RKX A;  3VQV A;  1QF6 A;  3HXV A;  4K87 A;  3BJU A;  2DZ9 A;  2G4C A;  4YRK A;  3QTC A;  3REU A;  1G5H A;  4XTZ A;  2DZC A;  4Q6G A;  4UP7 A;  3MF2 A;  4YCW A;  4TVW A;  1EVL A;  2Q7E A;  3V7R A;  2Q5H A;  1E1O A;  2ZZE A;  2ZR3 A;  1KOG A;  3LSS A;  4XU1 A;  4TWA A;  2J3M A;  2XGT A;  4P75 A;  2P0L A;  4HVC A;  4K86 A;  1E1T A;  4RQE A;  2EWN A;  2ZTG A;  4P72 C;  3A74 A;  2DTH A;  3RGL A;  4J15 A;  3E9I A;  1H4V B;  1KMM A;  4TQF A;  1WPY A;  2ZCE A;  4WI1 A;  1E24 A;  3TUP A;  4XU2 A;  2QHS A;  2ZGW A;  1EOV A;  2AKW B;  3NEL A;  2I4M A;  1X2G A;  2P5I A;  4YRN A;  4P3P A;  1W66 A;  1NYQ A;  1HTT A;  4HWP A;  4HWO A;  2DQ3 A;  4H02 A;  4P72 A;  1EIY B;  1X01 A;  4TVY A;  3HRK A;  2C7I A;  3FJP A;  3QO5 A;  5KNN A;  5C52 B;  4CH3 A;  4YP0 A;  4YRO A;  3A32 A;  1GGM A;  2HNI A;  3NEN A;  2ZNJ A;  1G51 A;  2EJG A; 
#chains in the Genus database with same CATH topology
 4WJ4 A;  2CJ9 A;  4P71 C;  3TEH B;  2XTI A;  4BWA A;  4CS2 A;  4EX5 A;  1SRY A;  1USY A;  1BBU A;  2E1H A;  2QHU A;  3A5Z A;  4YCU A;  5E3I A;  3A7R A;  2E65 A;  3P8V A;  4E51 A;  2IY5 A;  3PCO B;  3A5Y A;  3RKW A;  4ZTZ B;  3HXY A;  4RDX A;  1Z7M A;  2EJF A;  4KQE A;  4P71 A;  4BW9 A;  1KMN A;  4YPF A;  3LC0 A;  4UP8 A;  1NYR A;  1X55 A;  4CH5 A;  2ZIN A;  1WU7 A;  2ZNI A;  3HXX A;  3WQZ A;  4K88 A;  3A7U A;  2CGH A;  4YRQ A;  4PHC A;  2ZR2 A;  2QHV A;  4LVM A;  1SET A;  1B76 A;  4P75 C;  2PMF A;  4YRI A;  1EQR A;  4X5O A;  3VQY A;  1WYD A;  4UP9 A;  3MQZ A;  4XU3 A;  2ALY A;  4CS3 A;  4H2X B;  2FYK A;  1HXD A;  3DSQ A;  4HWS A;  2I4L A;  4XEO A;  3UH0 A;  4DPG A;  3MF1 A;  3EFR A;  4LVL A;  4NCX A;  5ELO A;  2ARS A;  2C8M A;  4YRC A;  4G85 A;  3VQW A;  4AH6 A;  4OLF A;  2ARU A;  3EFS A;  3ICA A;  3IKL A;  3G1Z A;  4HA8 A;  3HXU A;  1RIQ A;  3HXZ A;  1J5W A;  1N9W A;  1SER A;  4YRG A;  1H4Q A;  3RAC A;  3V8K A;  4ZIB A;  4XEM A;  1ATI A;  2ZT7 A;  5F5W A;  1B70 A;  3R07 A;  3HFZ A;  3TEG A;  1YFR A;  1B7Y A;  1USY C;  2E5A A;  4H2T A;  1FYF A;  3RL6 A;  1E22 A;  3RF1 A;  1BIB A;  5HGQ A;  3VQX A;  3NEM A;  4H2V A;  3RUX A;  1EFW A;  3A31 A;  1YGB A;  3V8J A;  1ADY A;  2DU7 A;  2ZZF A;  3MEY A;  3HXW A;  2DU5 A;  2E3C A;  4PG3 A;  4TTV A;  1WQ7 A;  4RQF A;  1NNH A;  1X54 A;  2DDZ A;  4XU0 A;  2ZIO A;  4YRE A;  3A7A A;  4YRS A;  3REX A;  5ELN A;  4YRR A;  1NJ1 A;  2ODR D;  1JJC A;  1NJ6 A;  4CH6 A;  2IY5 B;  4HWR A;  2PME A;  2AMC A;  2CJA A;  3I7F A;  3UGQ A;  4H2S A;  4HT4 A;  1SES A;  2ZT6 A;  4ZTU B;  3V8L A;  4XTU A;  2RHS A;  3BFM A;  1G5I A;  2EL9 A;  3RKY A;  2CJB A;  1PYS A;  2E10 A;  1Z7N A;  2J3L A;  4YYE A;  3P8T A;  4YRJ A;  2RHQ A;  3OD1 A;  3UFG A;  2NS6 A;  4TVA A;  2ZIM A;  3IKM B;  1IL2 A;  3L4G A;  2ZXF A;  4YRP A;  1BIA A;  2ZT8 A;  1YFS A;  2ALY B;  4H2U A;  2Q5I A;  4O2D A;  3V7S A;  5C53 B;  4LVI A;  2DXT A;  3M4P A;  4H2Y A;  2Q7G A;  1YB3 A;  2ZT5 A;  2ODR C;  1ADJ A;  4EO4 A;  3PZC A;  3LSQ A;  4KR2 A;  1LYL A;  3VBB A;  4LVK A;  4YDQ A;  4XTV A;  3P8Y A;  3W3S A;  2E64 A;  4OP0 A;  1QE0 A;  4P73 C;  4P74 C;  1HC7 A;  4HWT A;  2QHT A;  3HRI A;  3M4Q A;  2AKW A;  1C0A A;  1BBW A;  3ERR A;  4DQ2 A;  4LVJ A;  2DXU A;  4YRT A;  1B70 B;  2DVE A;  4RMF A;  3HFZ B;  2DKG A;  5C51 B;  3IG2 A;  3HFV A;  1B7Y B;  1NJ8 A;  4G84 A;  3L2Z A;  1EIY A;  3UGT A;  3NET A;  3E9H A;  4P73 A;  1ASY A;  1WQW A;  4P74 A;  5K1X A;  3KFU A;  2DTI A;  1WLE A;  4Q15 A;  1EVK A;  2EAY A;  12AS A;  3V7C A;  3TEH A;  2A8E A;  2Q7H A;  1ASZ A;  1H4S A;  4XTY A;  11AS A;  1X2H A;  4CS4 A;  2DJZ A;  4YRF A;  5K1P A;  1H4T A;  4WF2 A;  2DTO A;  4KR3 A;  2DEQ A;  4WJ3 M;  1B8A A;  4H2W A;  1YFT A;  3L1A A;  2ZZG A;  3HTZ A;  2I4N A;  1JJC B;  3PCO A;  3HY0 A;  1L0W A;  2AMC B;  2EJ9 A;  4L87 A;  3QO7 A;  3IAL A;  4P3N A;  4YRL A;  3QNE A;  3HY1 A;  4UPA A;  4LNS A;  4XTX A;  2RHS B;  3CMQ A;  1NJ5 A;  1PYS B;  1NJ2 A;  2E41 A;  4YRM A;  2CIM A;  2ART A;  2RHQ B;  4TQD A;  4YCV A;  2DQ0 A;  4TVA B;  1VQZ A;  3RIR A;  3QO8 A;  2I4O A;  1WNL A;  3L4G B;  4H2X A;  4CH4 A;  1X56 A;  4XTW A;  4P3O A;  3RKX A;  3VQV A;  1QF6 A;  3HXV A;  4K87 A;  3BJU A;  2DZ9 A;  2G4C A;  4YRK A;  3QTC A;  3REU A;  1G5H A;  4XTZ A;  2DZC A;  4Q6G A;  4UP7 A;  3MF2 A;  4YCW A;  4TVW A;  1EVL A;  2Q7E A;  3V7R A;  2Q5H A;  1E1O A;  2ZZE A;  2ZR3 A;  1KOG A;  3LSS A;  4XU1 A;  4TWA A;  2J3M A;  2XGT A;  4P75 A;  2P0L A;  4HVC A;  4K86 A;  1E1T A;  4RQE A;  2EWN A;  2ZTG A;  4P72 C;  3A74 A;  2DTH A;  3RGL A;  4J15 A;  3E9I A;  1H4V B;  1KMM A;  4TQF A;  1WPY A;  2ZCE A;  4WI1 A;  1E24 A;  3TUP A;  4XU2 A;  2QHS A;  2ZGW A;  1EOV A;  2AKW B;  3NEL A;  2I4M A;  1X2G A;  2P5I A;  4YRN A;  4P3P A;  1W66 A;  1NYQ A;  1HTT A;  4HWP A;  4HWO A;  2DQ3 A;  4H02 A;  4P72 A;  1EIY B;  1X01 A;  4TVY A;  3HRK A;  2C7I A;  3FJP A;  3QO5 A;  5KNN A;  5C52 B;  4CH3 A;  4YP0 A;  4YRO A;  3A32 A;  1GGM A;  2HNI A;  3NEN A;  2ZNJ A;  1G51 A;  2EJG A; 
#chains in the Genus database with same CATH homology
 4WJ4 A;  2CJ9 A;  4P71 C;  3TEH B;  2XTI A;  4BWA A;  4CS2 A;  4EX5 A;  1SRY A;  1USY A;  1BBU A;  2E1H A;  2QHU A;  3A5Z A;  4YCU A;  5E3I A;  3A7R A;  2E65 A;  3P8V A;  4E51 A;  2IY5 A;  3PCO B;  3A5Y A;  3RKW A;  4ZTZ B;  3HXY A;  4RDX A;  1Z7M A;  2EJF A;  4KQE A;  4P71 A;  4BW9 A;  1KMN A;  4YPF A;  3LC0 A;  4UP8 A;  1NYR A;  1X55 A;  4CH5 A;  2ZIN A;  1WU7 A;  2ZNI A;  3HXX A;  3WQZ A;  4K88 A;  3A7U A;  2CGH A;  4YRQ A;  4PHC A;  2ZR2 A;  2QHV A;  4LVM A;  1SET A;  1B76 A;  4P75 C;  2PMF A;  4YRI A;  1EQR A;  4X5O A;  3VQY A;  1WYD A;  4UP9 A;  3MQZ A;  4XU3 A;  2ALY A;  4CS3 A;  4H2X B;  2FYK A;  1HXD A;  3DSQ A;  4HWS A;  2I4L A;  4XEO A;  3UH0 A;  4DPG A;  3MF1 A;  3EFR A;  4LVL A;  4NCX A;  5ELO A;  2ARS A;  2C8M A;  4YRC A;  4G85 A;  3VQW A;  4AH6 A;  4OLF A;  2ARU A;  3EFS A;  3ICA A;  3IKL A;  3G1Z A;  4HA8 A;  3HXU A;  1RIQ A;  3HXZ A;  1J5W A;  1N9W A;  1SER A;  4YRG A;  1H4Q A;  3RAC A;  3V8K A;  4ZIB A;  4XEM A;  1ATI A;  2ZT7 A;  5F5W A;  1B70 A;  3R07 A;  3HFZ A;  3TEG A;  1YFR A;  1B7Y A;  1USY C;  2E5A A;  4H2T A;  1FYF A;  3RL6 A;  1E22 A;  3RF1 A;  1BIB A;  5HGQ A;  3VQX A;  3NEM A;  4H2V A;  3RUX A;  1EFW A;  3A31 A;  1YGB A;  3V8J A;  1ADY A;  2DU7 A;  2ZZF A;  3MEY A;  3HXW A;  2DU5 A;  2E3C A;  4PG3 A;  4TTV A;  1WQ7 A;  4RQF A;  1NNH A;  1X54 A;  2DDZ A;  4XU0 A;  2ZIO A;  4YRE A;  3A7A A;  4YRS A;  3REX A;  5ELN A;  4YRR A;  1NJ1 A;  2ODR D;  1JJC A;  1NJ6 A;  4CH6 A;  2IY5 B;  4HWR A;  2PME A;  2AMC A;  2CJA A;  3I7F A;  3UGQ A;  4H2S A;  4HT4 A;  1SES A;  2ZT6 A;  4ZTU B;  3V8L A;  4XTU A;  2RHS A;  3BFM A;  1G5I A;  2EL9 A;  3RKY A;  2CJB A;  1PYS A;  2E10 A;  1Z7N A;  2J3L A;  4YYE A;  3P8T A;  4YRJ A;  2RHQ A;  3OD1 A;  3UFG A;  2NS6 A;  4TVA A;  2ZIM A;  3IKM B;  1IL2 A;  3L4G A;  2ZXF A;  4YRP A;  1BIA A;  2ZT8 A;  1YFS A;  2ALY B;  4H2U A;  2Q5I A;  4O2D A;  3V7S A;  5C53 B;  4LVI A;  2DXT A;  3M4P A;  4H2Y A;  2Q7G A;  1YB3 A;  2ZT5 A;  2ODR C;  1ADJ A;  4EO4 A;  3PZC A;  3LSQ A;  4KR2 A;  1LYL A;  3VBB A;  4LVK A;  4YDQ A;  4XTV A;  3P8Y A;  3W3S A;  2E64 A;  4OP0 A;  1QE0 A;  4P73 C;  4P74 C;  1HC7 A;  4HWT A;  2QHT A;  3HRI A;  3M4Q A;  2AKW A;  1C0A A;  1BBW A;  3ERR A;  4DQ2 A;  4LVJ A;  2DXU A;  4YRT A;  1B70 B;  2DVE A;  4RMF A;  3HFZ B;  2DKG A;  5C51 B;  3IG2 A;  3HFV A;  1B7Y B;  1NJ8 A;  4G84 A;  3L2Z A;  1EIY A;  3UGT A;  3NET A;  3E9H A;  4P73 A;  1ASY A;  1WQW A;  4P74 A;  5K1X A;  3KFU A;  2DTI A;  1WLE A;  4Q15 A;  1EVK A;  2EAY A;  12AS A;  3V7C A;  3TEH A;  2A8E A;  2Q7H A;  1ASZ A;  1H4S A;  4XTY A;  11AS A;  1X2H A;  4CS4 A;  2DJZ A;  4YRF A;  5K1P A;  1H4T A;  4WF2 A;  2DTO A;  4KR3 A;  2DEQ A;  4WJ3 M;  1B8A A;  4H2W A;  1YFT A;  3L1A A;  2ZZG A;  3HTZ A;  2I4N A;  1JJC B;  3PCO A;  3HY0 A;  1L0W A;  2AMC B;  2EJ9 A;  4L87 A;  3QO7 A;  3IAL A;  4P3N A;  4YRL A;  3QNE A;  3HY1 A;  4UPA A;  4LNS A;  4XTX A;  2RHS B;  3CMQ A;  1NJ5 A;  1PYS B;  1NJ2 A;  2E41 A;  4YRM A;  2CIM A;  2ART A;  2RHQ B;  4TQD A;  4YCV A;  2DQ0 A;  4TVA B;  1VQZ A;  3RIR A;  3QO8 A;  2I4O A;  1WNL A;  3L4G B;  4H2X A;  4CH4 A;  1X56 A;  4XTW A;  4P3O A;  3RKX A;  3VQV A;  1QF6 A;  3HXV A;  4K87 A;  3BJU A;  2DZ9 A;  2G4C A;  4YRK A;  3QTC A;  3REU A;  1G5H A;  4XTZ A;  2DZC A;  4Q6G A;  4UP7 A;  3MF2 A;  4YCW A;  4TVW A;  1EVL A;  2Q7E A;  3V7R A;  2Q5H A;  1E1O A;  2ZZE A;  2ZR3 A;  1KOG A;  3LSS A;  4XU1 A;  4TWA A;  2J3M A;  2XGT A;  4P75 A;  2P0L A;  4HVC A;  4K86 A;  1E1T A;  4RQE A;  2EWN A;  2ZTG A;  4P72 C;  3A74 A;  2DTH A;  3RGL A;  4J15 A;  3E9I A;  1H4V B;  1KMM A;  4TQF A;  1WPY A;  2ZCE A;  4WI1 A;  1E24 A;  3TUP A;  4XU2 A;  2QHS A;  2ZGW A;  1EOV A;  2AKW B;  3NEL A;  2I4M A;  1X2G A;  2P5I A;  4YRN A;  4P3P A;  1W66 A;  1NYQ A;  1HTT A;  4HWP A;  4HWO A;  2DQ3 A;  4H02 A;  4P72 A;  1EIY B;  1X01 A;  4TVY A;  3HRK A;  2C7I A;  3FJP A;  3QO5 A;  5KNN A;  5C52 B;  4CH3 A;  4YP0 A;  4YRO A;  3A32 A;  1GGM A;  2HNI A;  3NEN A;  2ZNJ A;  1G51 A;  2EJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...