2QHVA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 67
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhvA01
4P75A 2E1HA 1Z7MA 1BBUA 4OP0A 1RIQA 1NJ2A 3HXWA 3NENA 4YCVA 4L87A 11ASA 3L1AA 1NYQA 4HWOA 3TEHB 2I4MA 3L2ZA 4XU1A 4P73C 2ODRC 1FYFA 3WQZA 3TUPA 2EJFA 3BJUA 4YPFA 1B7YB 4RQEA 1QF6A 2DEQA 1EQRA 2EJGA 4YRRA 3IALA 1JJCA 3MF1A 1EIYB 2AKWA 2CJAA 3ICAA 4E51A 2DQ0A 2ZZEA 1B76A 2ODRD 3TEHA 4XEMA 2AKWB 4HA8A 4P74C 3P8TA 3UH0A 4YRJA 4EX5A 2ALYA 4XU3A 2G4CA 1B7YA 2ZTGA 3HXYA 2ARSA 1E24A 2EL9A 5ELOA 5C52B 3W3SA 4XTXA 3HXZA 5F5WA 2Q7EA 2DTIA 3RGLA 2DU5A 2RHSA 3RKXA 1KMNA 1GGMA 4XTVA 2PMEA 1WNLA 2XTIA 4H2VA 4YDQA 4TQFA 1ASYA 4RDXA 3IG2A 4XEOA 1YB3A 4XTUA 3QO5A 3HRKA 2ARTA 1KMMA 4UP8A 1BIAA 2ZNJA 3QNEA 1NJ6A 3V7RA 2CJBA 3G1ZA 3VQVA 1C0AA 3E9IA 1G51A 4HWTA 4PG3A 4TVYA 4CS4A 1VQZA 3VQXA 1ATIA 2E3CA 4H2WA 1ADYA 3VQWA 1B70A 3REUA 2RHQB 4YRKA 1KOGA 4XU2A 2ARUA 3V8JA 2I4LA 3UGTA 3HXVA 4YCUA 1YFRA 1WYDA 2P5IA 2ZIMA 5K1PA 4NCXA 4TQDA 4UP9A 2ZINA 1B70B 4TVAA 4KR2A 3PCOA 2EAYA 3E9HA 4KQEA 1NJ8A 2CGHA 2ZT6A 2ZR2A 2E10A 4YREA 3BFMA 5E3IA 5C51B 3TEGA 4ZTUB 4YROA 1HC7A 2J3MA 2DKGA 4X5OA 1H4SA 4TVWA 4YRQA 4P71A 1ASZA 4CH6A 4H2XB 1L0WA 1NNHA 1WU7A 5KNNA 3RKWA 3IKLA 2J3LA 3LSSA 3M4PA 2C8MA 1X56A 4WI1A 3V7CA 2ALYB 4P71C 3QTCA 4AH6A 1N9WA 4J15A 4WF2A 3MEYA 4P75C 1H4QA 4PHCA 3A7AA 2PMFA 2FYKA 2ZCEA 4K88A 1USYC 2HNIA 2ZXFA 4XTYA 4HWPA 4K87A 4YP0A 4P3PA 2C7IA 3UFGA 2DJZA 3DSQA 1H4VB 2AMCA 1Z7NA 3L4GB 2DDZA 3M4QA 4H2UA 4G84A 4KR3A 1ADJA 5C53B 4WJ3M 4UP7A 2EJ9A 2QHVA 1IL2A 2IY5B 2DXTA 3QO8A 1B8AA 1BBWA 3I7FA 1E22A 4YRMA 1HXDA 3RF1A 2I4NA 3HTZA 3RACA 2Q7HA 3LSQA 1NJ5A 3V8LA 4OLFA 3ERRA 1E1OA 4P3NA 1X2HA 3UGQA 1SRYA 2DQ3A 2DZCA 2DTHA 3L4GA 4H2SA 4RQFA 2AMCB 3A31A 1LYLA 1EVKA 1X01A 3IKMB 4TTVA 2ZZFA 2I4OA 5K1XA 1SESA 2IY5A 2E41A 1PYSA 1EIYA 2ZZGA 12ASA 1JJCB 4YRLA 3FJPA 4YRFA 3A5ZA 3NEMA 2ZR3A 3HXUA 1YGBA 2ZT8A 2DXUA 1NJ1A 2QHUA 4ZTZB 2E5AA 2CJ9A 2QHSA 2ZIOA 4CS3A 1WQWA 2Q5IA 3VQYA 2DVEA 1EVLA 4P3OA 4DPGA 4H2XA 4H02A 3P8VA 4YYEA 4YRCA 1NYRA 3HFZB 4H2YA 1YFSA 2QHTA 4YCWA 4P74A 3RL6A 4YRTA 4XTZA 2DTOA 4HWSA 4Q6GA 3LC0A 1X54A 3REXA 1WLEA 3HY1A 1EFWA 4ZIBA 4CS2A 3RIRA 4XU0A 1J5WA 4G85A 4H2TA 1SERA 1E1TA 3EFSA 3PCOB 1BIBA 4TVAB 1X55A 4P73A 3RKYA 3MF2A 4EO4A 2Q5HA 1X2GA 4YRIA 3A5YA 3A32A 1WQ7A 4Q15A 2P0LA 3A7UA 3HFZA 3HFVA 2DU7A 5HGQA 3V7SA 3CMQA 2CIMA 3NETA 2EWNA 3PZCA 4O2DA 3NELA 3RUXA 1H4TA 2ZNIA 2ZT5A 4RMFA 3A74A 4YRSA 2XGTA 2E64A 4HWRA 4YRGA 4K86A 4HVCA 4XTWA 1G5HA 4WJ4A 4YRPA 3V8KA 1EOVA 4P72A 4CH5A 4BWAA 3EFRA 2RHQA 2ZGWA 3HXXA 3VBBA 1YFTA 3HRIA 4UPAA 1PYSB 1W66A 3KFUA 1QE0A 2E65A 2Q7GA 5ELNA 4YRNA 3P8YA 4LNSA 4P72C 2RHSB 1G5IA 3HY0A 3OD1A 4CH4A 1WPYA 1SETA 3QO7A 2ZT7A 3R07A 1HTTA 4BW9A 4DQ2A 2DZ9A 1USYA 4TWAA 3A7RA 4CH3A
chains in the Genus database with same CATH superfamily
4P75A 2E1HA 1Z7MA 1BBUA 3MQZA 4OP0A 1RIQA 1NJ2A 3HXWA 3NENA 4YCVA 4L87A 11ASA 3L1AA 1NYQA 4HWOA 3TEHB 2I4MA 3L2ZA 4XU1A 4P73C 2ODRC 1FYFA 3WQZA 3TUPA 2EJFA 3BJUA 4YPFA 1B7YB 4RQEA 1QF6A 2A8EA 2DEQA 1EQRA 2EJGA 4YRRA 3IALA 1JJCA 3MF1A 1EIYB 2AKWA 2CJAA 3ICAA 4E51A 2DQ0A 2ZZEA 1B76A 2ODRD 3TEHA 4XEMA 2AKWB 4HA8A 4P74C 3P8TA 3UH0A 4YRJA 4EX5A 2ALYA 4XU3A 2G4CA 1B7YA 2ZTGA 3HXYA 2ARSA 1E24A 2EL9A 5ELOA 5C52B 3W3SA 4XTXA 3HXZA 5F5WA 2Q7EA 2DTIA 3RGLA 2DU5A 2RHSA 3RKXA 1KMNA 1GGMA 4XTVA 2PMEA 1WNLA 2XTIA 4H2VA 4YDQA 4TQFA 1ASYA 4RDXA 3IG2A 4XEOA 1YB3A 4XTUA 3QO5A 3HRKA 2ARTA 1KMMA 4UP8A 1BIAA 2ZNJA 3QNEA 1NJ6A 3V7RA 2CJBA 3G1ZA 3VQVA 1C0AA 3E9IA 1G51A 4HWTA 4PG3A 4TVYA 4CS4A 1VQZA 3VQXA 1ATIA 2E3CA 4H2WA 1ADYA 3VQWA 1B70A 4LVKA 3REUA 2RHQB 4YRKA 1KOGA 4XU2A 2ARUA 3V8JA 2I4LA 3UGTA 3HXVA 4YCUA 1YFRA 1WYDA 2P5IA 2ZIMA 5K1PA 4NCXA 4TQDA 4UP9A 2ZINA 1B70B 4TVAA 4KR2A 3PCOA 2EAYA 3E9HA 4KQEA 1NJ8A 2CGHA 2ZT6A 2ZR2A 2E10A 4YREA 3BFMA 5E3IA 5C51B 3TEGA 4LVIA 4ZTUB 4YROA 1HC7A 2J3MA 2DKGA 4X5OA 1H4SA 4TVWA 4YRQA 4P71A 1ASZA 4CH6A 4H2XB 1L0WA 1NNHA 1WU7A 5KNNA 3RKWA 3IKLA 2J3LA 3LSSA 3M4PA 2C8MA 1X56A 4WI1A 3V7CA 2ALYB 4P71C 3QTCA 4AH6A 1N9WA 4J15A 4WF2A 4HT4A 3MEYA 4P75C 1H4QA 4PHCA 3A7AA 2PMFA 2FYKA 2ZCEA 4K88A 1USYC 2HNIA 2ZXFA 4XTYA 4HWPA 4K87A 4YP0A 4P3PA 2C7IA 3UFGA 2DJZA 3DSQA 1H4VB 2AMCA 1Z7NA 3L4GB 2DDZA 3M4QA 4H2UA 4G84A 4KR3A 1ADJA 5C53B 4WJ3M 4UP7A 2EJ9A 2QHVA 1IL2A 2IY5B 2DXTA 3QO8A 1B8AA 1BBWA 3I7FA 1E22A 4YRMA 1HXDA 3RF1A 2I4NA 3HTZA 3RACA 2Q7HA 3LSQA 1NJ5A 3V8LA 4OLFA 3ERRA 1E1OA 4P3NA 4LVLA 1X2HA 3UGQA 1SRYA 2DQ3A 2DZCA 2DTHA 3L4GA 4H2SA 4RQFA 2AMCB 3A31A 1LYLA 1EVKA 1X01A 3IKMB 4TTVA 2ZZFA 2I4OA 5K1XA 1SESA 2IY5A 2E41A 1PYSA 1EIYA 2ZZGA 12ASA 1JJCB 4YRLA 3FJPA 4YRFA 3A5ZA 3NEMA 2ZR3A 3HXUA 1YGBA 2ZT8A 2DXUA 1NJ1A 2QHUA 4ZTZB 2E5AA 2CJ9A 2QHSA 2ZIOA 4CS3A 1WQWA 2Q5IA 3VQYA 2DVEA 1EVLA 4P3OA 2NS6A 4DPGA 4H2XA 4H02A 3P8VA 4YYEA 4YRCA 1NYRA 3HFZB 4H2YA 1YFSA 2QHTA 4YCWA 4P74A 3RL6A 4YRTA 4XTZA 2DTOA 4HWSA 4Q6GA 3LC0A 1X54A 3REXA 1WLEA 3HY1A 1EFWA 4ZIBA 4CS2A 3RIRA 4XU0A 1J5WA 4G85A 4H2TA 1SERA 1E1TA 3EFSA 3PCOB 1BIBA 4TVAB 1X55A 4P73A 3RKYA 3MF2A 4EO4A 2Q5HA 1X2GA 4YRIA 3A5YA 4LVMA 3A32A 1WQ7A 4Q15A 2P0LA 3A7UA 3HFZA 3HFVA 2DU7A 5HGQA 3V7SA 3CMQA 2CIMA 3NETA 2EWNA 3PZCA 4O2DA 3NELA 3RUXA 1H4TA 2ZNIA 2ZT5A 4RMFA 3A74A 4YRSA 2XGTA 2E64A 4HWRA 4YRGA 4K86A 4HVCA 4XTWA 1G5HA 4WJ4A 4YRPA 3V8KA 1EOVA 4P72A 4CH5A 4BWAA 3EFRA 2RHQA 2ZGWA 3HXXA 3VBBA 1YFTA 3HRIA 4UPAA 1PYSB 1W66A 3KFUA 1QE0A 2E65A 2Q7GA 5ELNA 4YRNA 3P8YA 4LNSA 4P72C 2RHSB 1G5IA 3HY0A 3OD1A 4LVJA 4CH4A 1WPYA 1SETA 3QO7A 2ZT7A 3R07A 1HTTA 4BW9A 4DQ2A 2DZ9A 1USYA 4TWAA 3A7RA 4CH3A
chains in the Genus database with same CATH topology
4P75A 2E1HA 1Z7MA 1BBUA 3MQZA 4OP0A 1RIQA 1NJ2A 3HXWA 3NENA 4YCVA 4L87A 11ASA 3L1AA 1NYQA 4HWOA 3TEHB 2I4MA 3L2ZA 4XU1A 4P73C 2ODRC 1FYFA 3WQZA 3TUPA 2EJFA 3BJUA 4YPFA 1B7YB 4RQEA 1QF6A 2A8EA 2DEQA 1EQRA 2EJGA 4YRRA 3IALA 1JJCA 3MF1A 1EIYB 2AKWA 2CJAA 3ICAA 4E51A 2DQ0A 2ZZEA 1B76A 2ODRD 3TEHA 4XEMA 2AKWB 4HA8A 4P74C 3P8TA 3UH0A 4YRJA 4EX5A 2ALYA 4XU3A 2G4CA 1B7YA 2ZTGA 3HXYA 2ARSA 1E24A 2EL9A 5ELOA 5C52B 3W3SA 4XTXA 3HXZA 5F5WA 2Q7EA 2DTIA 3RGLA 2DU5A 2RHSA 3RKXA 1KMNA 1GGMA 4XTVA 2PMEA 1WNLA 2XTIA 4H2VA 4YDQA 4TQFA 1ASYA 4RDXA 3IG2A 4XEOA 1YB3A 4XTUA 3QO5A 3HRKA 2ARTA 1KMMA 4UP8A 1BIAA 2ZNJA 3QNEA 1NJ6A 3V7RA 2CJBA 3G1ZA 3VQVA 1C0AA 3E9IA 1G51A 4HWTA 4PG3A 4TVYA 4CS4A 1VQZA 3VQXA 1ATIA 2E3CA 4H2WA 1ADYA 3VQWA 1B70A 4LVKA 3REUA 2RHQB 4YRKA 1KOGA 4XU2A 2ARUA 3V8JA 2I4LA 3UGTA 3HXVA 4YCUA 1YFRA 1WYDA 2P5IA 2ZIMA 5K1PA 4NCXA 4TQDA 4UP9A 2ZINA 1B70B 4TVAA 4KR2A 3PCOA 2EAYA 3E9HA 4KQEA 1NJ8A 2CGHA 2ZT6A 2ZR2A 2E10A 4YREA 3BFMA 5E3IA 5C51B 3TEGA 4LVIA 4ZTUB 4YROA 1HC7A 2J3MA 2DKGA 4X5OA 1H4SA 4TVWA 4YRQA 4P71A 1ASZA 4CH6A 4H2XB 1L0WA 1NNHA 1WU7A 5KNNA 3RKWA 3IKLA 2J3LA 3LSSA 3M4PA 2C8MA 1X56A 4WI1A 3V7CA 2ALYB 4P71C 3QTCA 4AH6A 1N9WA 4J15A 4WF2A 4HT4A 3MEYA 4P75C 1H4QA 4PHCA 3A7AA 2PMFA 2FYKA 2ZCEA 4K88A 1USYC 2HNIA 2ZXFA 4XTYA 4HWPA 4K87A 4YP0A 4P3PA 2C7IA 3UFGA 2DJZA 3DSQA 1H4VB 2AMCA 1Z7NA 3L4GB 2DDZA 3M4QA 4H2UA 4G84A 4KR3A 1ADJA 5C53B 4WJ3M 4UP7A 2EJ9A 2QHVA 1IL2A 2IY5B 2DXTA 3QO8A 1B8AA 1BBWA 3I7FA 1E22A 4YRMA 1HXDA 3RF1A 2I4NA 3HTZA 3RACA 2Q7HA 3LSQA 1NJ5A 3V8LA 4OLFA 3ERRA 1E1OA 4P3NA 4LVLA 1X2HA 3UGQA 1SRYA 2DQ3A 2DZCA 2DTHA 3L4GA 4H2SA 4RQFA 2AMCB 3A31A 1LYLA 1EVKA 1X01A 3IKMB 4TTVA 2ZZFA 2I4OA 5K1XA 1SESA 2IY5A 2E41A 1PYSA 1EIYA 2ZZGA 12ASA 1JJCB 4YRLA 3FJPA 4YRFA 3A5ZA 3NEMA 2ZR3A 3HXUA 1YGBA 2ZT8A 2DXUA 1NJ1A 2QHUA 4ZTZB 2E5AA 2CJ9A 2QHSA 2ZIOA 4CS3A 1WQWA 2Q5IA 3VQYA 2DVEA 1EVLA 4P3OA 2NS6A 4DPGA 4H2XA 4H02A 3P8VA 4YYEA 4YRCA 1NYRA 3HFZB 4H2YA 1YFSA 2QHTA 4YCWA 4P74A 3RL6A 4YRTA 4XTZA 2DTOA 4HWSA 4Q6GA 3LC0A 1X54A 3REXA 1WLEA 3HY1A 1EFWA 4ZIBA 4CS2A 3RIRA 4XU0A 1J5WA 4G85A 4H2TA 1SERA 1E1TA 3EFSA 3PCOB 1BIBA 4TVAB 1X55A 4P73A 3RKYA 3MF2A 4EO4A 2Q5HA 1X2GA 4YRIA 3A5YA 4LVMA 3A32A 1WQ7A 4Q15A 2P0LA 3A7UA 3HFZA 3HFVA 2DU7A 5HGQA 3V7SA 3CMQA 2CIMA 3NETA 2EWNA 3PZCA 4O2DA 3NELA 3RUXA 1H4TA 2ZNIA 2ZT5A 4RMFA 3A74A 4YRSA 2XGTA 2E64A 4HWRA 4YRGA 4K86A 4HVCA 4XTWA 1G5HA 4WJ4A 4YRPA 3V8KA 1EOVA 4P72A 4CH5A 4BWAA 3EFRA 2RHQA 2ZGWA 3HXXA 3VBBA 1YFTA 3HRIA 4UPAA 1PYSB 1W66A 3KFUA 1QE0A 2E65A 2Q7GA 5ELNA 4YRNA 3P8YA 4LNSA 4P72C 2RHSB 1G5IA 3HY0A 3OD1A 4LVJA 4CH4A 1WPYA 1SETA 3QO7A 2ZT7A 3R07A 1HTTA 4BW9A 4DQ2A 2DZ9A 1USYA 4TWAA 3A7RA 4CH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  2E1H A;  1Z7M A;  1BBU A;  4OP0 A;  1RIQ A;  1NJ2 A;  3HXW A;  3NEN A;  4YCV A;  4L87 A;  11AS A;  3L1A A;  1NYQ A;  4HWO A;  3TEH B;  2I4M A;  3L2Z A;  4XU1 A;  4P73 C;  2ODR C;  1FYF A;  3WQZ A;  3TUP A;  2EJF A;  3BJU A;  4YPF A;  1B7Y B;  4RQE A;  1QF6 A;  2DEQ A;  1EQR A;  2EJG A;  4YRR A;  3IAL A;  1JJC A;  3MF1 A;  1EIY B;  2AKW A;  2CJA A;  3ICA A;  4E51 A;  2DQ0 A;  2ZZE A;  1B76 A;  2ODR D;  3TEH A;  4XEM A;  2AKW B;  4HA8 A;  4P74 C;  3P8T A;  3UH0 A;  4YRJ A;  4EX5 A;  2ALY A;  4XU3 A;  2G4C A;  1B7Y A;  2ZTG A;  3HXY A;  2ARS A;  1E24 A;  2EL9 A;  5ELO A;  5C52 B;  3W3S A;  4XTX A;  3HXZ A;  5F5W A;  2Q7E A;  2DTI A;  3RGL A;  2DU5 A;  2RHS A;  3RKX A;  1KMN A;  1GGM A;  4XTV A;  2PME A;  1WNL A;  2XTI A;  4H2V A;  4YDQ A;  4TQF A;  1ASY A;  4RDX A;  3IG2 A;  4XEO A;  1YB3 A;  4XTU A;  3QO5 A;  3HRK A;  2ART A;  1KMM A;  4UP8 A;  1BIA A;  2ZNJ A;  3QNE A;  1NJ6 A;  3V7R A;  2CJB A;  3G1Z A;  3VQV A;  1C0A A;  3E9I A;  1G51 A;  4HWT A;  4PG3 A;  4TVY A;  4CS4 A;  1VQZ A;  3VQX A;  1ATI A;  2E3C A;  4H2W A;  1ADY A;  3VQW A;  1B70 A;  3REU A;  2RHQ B;  4YRK A;  1KOG A;  4XU2 A;  2ARU A;  3V8J A;  2I4L A;  3UGT A;  3HXV A;  4YCU A;  1YFR A;  1WYD A;  2P5I A;  2ZIM A;  5K1P A;  4NCX A;  4TQD A;  4UP9 A;  2ZIN A;  1B70 B;  4TVA A;  4KR2 A;  3PCO A;  2EAY A;  3E9H A;  4KQE A;  1NJ8 A;  2CGH A;  2ZT6 A;  2ZR2 A;  2E10 A;  4YRE A;  3BFM A;  5E3I A;  5C51 B;  3TEG A;  4ZTU B;  4YRO A;  1HC7 A;  2J3M A;  2DKG A;  4X5O A;  1H4S A;  4TVW A;  4YRQ A;  4P71 A;  1ASZ A;  4CH6 A;  4H2X B;  1L0W A;  1NNH A;  1WU7 A;  5KNN A;  3RKW A;  3IKL A;  2J3L A;  3LSS A;  3M4P A;  2C8M A;  1X56 A;  4WI1 A;  3V7C A;  2ALY B;  4P71 C;  3QTC A;  4AH6 A;  1N9W A;  4J15 A;  4WF2 A;  3MEY A;  4P75 C;  1H4Q A;  4PHC A;  3A7A A;  2PMF A;  2FYK A;  2ZCE A;  4K88 A;  1USY C;  2HNI A;  2ZXF A;  4XTY A;  4HWP A;  4K87 A;  4YP0 A;  4P3P A;  2C7I A;  3UFG A;  2DJZ A;  3DSQ A;  1H4V B;  2AMC A;  1Z7N A;  3L4G B;  2DDZ A;  3M4Q A;  4H2U A;  4G84 A;  4KR3 A;  1ADJ A;  5C53 B;  4WJ3 M;  4UP7 A;  2EJ9 A;  2QHV A;  1IL2 A;  2IY5 B;  2DXT A;  3QO8 A;  1B8A A;  1BBW A;  3I7F A;  1E22 A;  4YRM A;  1HXD A;  3RF1 A;  2I4N A;  3HTZ A;  3RAC A;  2Q7H A;  3LSQ A;  1NJ5 A;  3V8L A;  4OLF A;  3ERR A;  1E1O A;  4P3N A;  1X2H A;  3UGQ A;  1SRY A;  2DQ3 A;  2DZC A;  2DTH A;  3L4G A;  4H2S A;  4RQF A;  2AMC B;  3A31 A;  1LYL A;  1EVK A;  1X01 A;  3IKM B;  4TTV A;  2ZZF A;  2I4O A;  5K1X A;  1SES A;  2IY5 A;  2E41 A;  1PYS A;  1EIY A;  2ZZG A;  12AS A;  1JJC B;  4YRL A;  3FJP A;  4YRF A;  3A5Z A;  3NEM A;  2ZR3 A;  3HXU A;  1YGB A;  2ZT8 A;  2DXU A;  1NJ1 A;  2QHU A;  4ZTZ B;  2E5A A;  2CJ9 A;  2QHS A;  2ZIO A;  4CS3 A;  1WQW A;  2Q5I A;  3VQY A;  2DVE A;  1EVL A;  4P3O A;  4DPG A;  4H2X A;  4H02 A;  3P8V A;  4YYE A;  4YRC A;  1NYR A;  3HFZ B;  4H2Y A;  1YFS A;  2QHT A;  4YCW A;  4P74 A;  3RL6 A;  4YRT A;  4XTZ A;  2DTO A;  4HWS A;  4Q6G A;  3LC0 A;  1X54 A;  3REX A;  1WLE A;  3HY1 A;  1EFW A;  4ZIB A;  4CS2 A;  3RIR A;  4XU0 A;  1J5W A;  4G85 A;  4H2T A;  1SER A;  1E1T A;  3EFS A;  3PCO B;  1BIB A;  4TVA B;  1X55 A;  4P73 A;  3RKY A;  3MF2 A;  4EO4 A;  2Q5H A;  1X2G A;  4YRI A;  3A5Y A;  3A32 A;  1WQ7 A;  4Q15 A;  2P0L A;  3A7U A;  3HFZ A;  3HFV A;  2DU7 A;  5HGQ A;  3V7S A;  3CMQ A;  2CIM A;  3NET A;  2EWN A;  3PZC A;  4O2D A;  3NEL A;  3RUX A;  1H4T A;  2ZNI A;  2ZT5 A;  4RMF A;  3A74 A;  4YRS A;  2XGT A;  2E64 A;  4HWR A;  4YRG A;  4K86 A;  4HVC A;  4XTW A;  1G5H A;  4WJ4 A;  4YRP A;  3V8K A;  1EOV A;  4P72 A;  4CH5 A;  4BWA A;  3EFR A;  2RHQ A;  2ZGW A;  3HXX A;  3VBB A;  1YFT A;  3HRI A;  4UPA A;  1PYS B;  1W66 A;  3KFU A;  1QE0 A;  2E65 A;  2Q7G A;  5ELN A;  4YRN A;  3P8Y A;  4LNS A;  4P72 C;  2RHS B;  1G5I A;  3HY0 A;  3OD1 A;  4CH4 A;  1WPY A;  1SET A;  3QO7 A;  2ZT7 A;  3R07 A;  1HTT A;  4BW9 A;  4DQ2 A;  2DZ9 A;  1USY A;  4TWA A;  3A7R A;  4CH3 A; 
#chains in the Genus database with same CATH topology
 4P75 A;  2E1H A;  1Z7M A;  1BBU A;  3MQZ A;  4OP0 A;  1RIQ A;  1NJ2 A;  3HXW A;  3NEN A;  4YCV A;  4L87 A;  11AS A;  3L1A A;  1NYQ A;  4HWO A;  3TEH B;  2I4M A;  3L2Z A;  4XU1 A;  4P73 C;  2ODR C;  1FYF A;  3WQZ A;  3TUP A;  2EJF A;  3BJU A;  4YPF A;  1B7Y B;  4RQE A;  1QF6 A;  2A8E A;  2DEQ A;  1EQR A;  2EJG A;  4YRR A;  3IAL A;  1JJC A;  3MF1 A;  1EIY B;  2AKW A;  2CJA A;  3ICA A;  4E51 A;  2DQ0 A;  2ZZE A;  1B76 A;  2ODR D;  3TEH A;  4XEM A;  2AKW B;  4HA8 A;  4P74 C;  3P8T A;  3UH0 A;  4YRJ A;  4EX5 A;  2ALY A;  4XU3 A;  2G4C A;  1B7Y A;  2ZTG A;  3HXY A;  2ARS A;  1E24 A;  2EL9 A;  5ELO A;  5C52 B;  3W3S A;  4XTX A;  3HXZ A;  5F5W A;  2Q7E A;  2DTI A;  3RGL A;  2DU5 A;  2RHS A;  3RKX A;  1KMN A;  1GGM A;  4XTV A;  2PME A;  1WNL A;  2XTI A;  4H2V A;  4YDQ A;  4TQF A;  1ASY A;  4RDX A;  3IG2 A;  4XEO A;  1YB3 A;  4XTU A;  3QO5 A;  3HRK A;  2ART A;  1KMM A;  4UP8 A;  1BIA A;  2ZNJ A;  3QNE A;  1NJ6 A;  3V7R A;  2CJB A;  3G1Z A;  3VQV A;  1C0A A;  3E9I A;  1G51 A;  4HWT A;  4PG3 A;  4TVY A;  4CS4 A;  1VQZ A;  3VQX A;  1ATI A;  2E3C A;  4H2W A;  1ADY A;  3VQW A;  1B70 A;  4LVK A;  3REU A;  2RHQ B;  4YRK A;  1KOG A;  4XU2 A;  2ARU A;  3V8J A;  2I4L A;  3UGT A;  3HXV A;  4YCU A;  1YFR A;  1WYD A;  2P5I A;  2ZIM A;  5K1P A;  4NCX A;  4TQD A;  4UP9 A;  2ZIN A;  1B70 B;  4TVA A;  4KR2 A;  3PCO A;  2EAY A;  3E9H A;  4KQE A;  1NJ8 A;  2CGH A;  2ZT6 A;  2ZR2 A;  2E10 A;  4YRE A;  3BFM A;  5E3I A;  5C51 B;  3TEG A;  4LVI A;  4ZTU B;  4YRO A;  1HC7 A;  2J3M A;  2DKG A;  4X5O A;  1H4S A;  4TVW A;  4YRQ A;  4P71 A;  1ASZ A;  4CH6 A;  4H2X B;  1L0W A;  1NNH A;  1WU7 A;  5KNN A;  3RKW A;  3IKL A;  2J3L A;  3LSS A;  3M4P A;  2C8M A;  1X56 A;  4WI1 A;  3V7C A;  2ALY B;  4P71 C;  3QTC A;  4AH6 A;  1N9W A;  4J15 A;  4WF2 A;  4HT4 A;  3MEY A;  4P75 C;  1H4Q A;  4PHC A;  3A7A A;  2PMF A;  2FYK A;  2ZCE A;  4K88 A;  1USY C;  2HNI A;  2ZXF A;  4XTY A;  4HWP A;  4K87 A;  4YP0 A;  4P3P A;  2C7I A;  3UFG A;  2DJZ A;  3DSQ A;  1H4V B;  2AMC A;  1Z7N A;  3L4G B;  2DDZ A;  3M4Q A;  4H2U A;  4G84 A;  4KR3 A;  1ADJ A;  5C53 B;  4WJ3 M;  4UP7 A;  2EJ9 A;  2QHV A;  1IL2 A;  2IY5 B;  2DXT A;  3QO8 A;  1B8A A;  1BBW A;  3I7F A;  1E22 A;  4YRM A;  1HXD A;  3RF1 A;  2I4N A;  3HTZ A;  3RAC A;  2Q7H A;  3LSQ A;  1NJ5 A;  3V8L A;  4OLF A;  3ERR A;  1E1O A;  4P3N A;  4LVL A;  1X2H A;  3UGQ A;  1SRY A;  2DQ3 A;  2DZC A;  2DTH A;  3L4G A;  4H2S A;  4RQF A;  2AMC B;  3A31 A;  1LYL A;  1EVK A;  1X01 A;  3IKM B;  4TTV A;  2ZZF A;  2I4O A;  5K1X A;  1SES A;  2IY5 A;  2E41 A;  1PYS A;  1EIY A;  2ZZG A;  12AS A;  1JJC B;  4YRL A;  3FJP A;  4YRF A;  3A5Z A;  3NEM A;  2ZR3 A;  3HXU A;  1YGB A;  2ZT8 A;  2DXU A;  1NJ1 A;  2QHU A;  4ZTZ B;  2E5A A;  2CJ9 A;  2QHS A;  2ZIO A;  4CS3 A;  1WQW A;  2Q5I A;  3VQY A;  2DVE A;  1EVL A;  4P3O A;  2NS6 A;  4DPG A;  4H2X A;  4H02 A;  3P8V A;  4YYE A;  4YRC A;  1NYR A;  3HFZ B;  4H2Y A;  1YFS A;  2QHT A;  4YCW A;  4P74 A;  3RL6 A;  4YRT A;  4XTZ A;  2DTO A;  4HWS A;  4Q6G A;  3LC0 A;  1X54 A;  3REX A;  1WLE A;  3HY1 A;  1EFW A;  4ZIB A;  4CS2 A;  3RIR A;  4XU0 A;  1J5W A;  4G85 A;  4H2T A;  1SER A;  1E1T A;  3EFS A;  3PCO B;  1BIB A;  4TVA B;  1X55 A;  4P73 A;  3RKY A;  3MF2 A;  4EO4 A;  2Q5H A;  1X2G A;  4YRI A;  3A5Y A;  4LVM A;  3A32 A;  1WQ7 A;  4Q15 A;  2P0L A;  3A7U A;  3HFZ A;  3HFV A;  2DU7 A;  5HGQ A;  3V7S A;  3CMQ A;  2CIM A;  3NET A;  2EWN A;  3PZC A;  4O2D A;  3NEL A;  3RUX A;  1H4T A;  2ZNI A;  2ZT5 A;  4RMF A;  3A74 A;  4YRS A;  2XGT A;  2E64 A;  4HWR A;  4YRG A;  4K86 A;  4HVC A;  4XTW A;  1G5H A;  4WJ4 A;  4YRP A;  3V8K A;  1EOV A;  4P72 A;  4CH5 A;  4BWA A;  3EFR A;  2RHQ A;  2ZGW A;  3HXX A;  3VBB A;  1YFT A;  3HRI A;  4UPA A;  1PYS B;  1W66 A;  3KFU A;  1QE0 A;  2E65 A;  2Q7G A;  5ELN A;  4YRN A;  3P8Y A;  4LNS A;  4P72 C;  2RHS B;  1G5I A;  3HY0 A;  3OD1 A;  4LVJ A;  4CH4 A;  1WPY A;  1SET A;  3QO7 A;  2ZT7 A;  3R07 A;  1HTT A;  4BW9 A;  4DQ2 A;  2DZ9 A;  1USY A;  4TWA A;  3A7R A;  4CH3 A; 
#chains in the Genus database with same CATH homology
 4P75 A;  2E1H A;  1Z7M A;  1BBU A;  3MQZ A;  4OP0 A;  1RIQ A;  1NJ2 A;  3HXW A;  3NEN A;  4YCV A;  4L87 A;  11AS A;  3L1A A;  1NYQ A;  4HWO A;  3TEH B;  2I4M A;  3L2Z A;  4XU1 A;  4P73 C;  2ODR C;  1FYF A;  3WQZ A;  3TUP A;  2EJF A;  3BJU A;  4YPF A;  1B7Y B;  4RQE A;  1QF6 A;  2A8E A;  2DEQ A;  1EQR A;  2EJG A;  4YRR A;  3IAL A;  1JJC A;  3MF1 A;  1EIY B;  2AKW A;  2CJA A;  3ICA A;  4E51 A;  2DQ0 A;  2ZZE A;  1B76 A;  2ODR D;  3TEH A;  4XEM A;  2AKW B;  4HA8 A;  4P74 C;  3P8T A;  3UH0 A;  4YRJ A;  4EX5 A;  2ALY A;  4XU3 A;  2G4C A;  1B7Y A;  2ZTG A;  3HXY A;  2ARS A;  1E24 A;  2EL9 A;  5ELO A;  5C52 B;  3W3S A;  4XTX A;  3HXZ A;  5F5W A;  2Q7E A;  2DTI A;  3RGL A;  2DU5 A;  2RHS A;  3RKX A;  1KMN A;  1GGM A;  4XTV A;  2PME A;  1WNL A;  2XTI A;  4H2V A;  4YDQ A;  4TQF A;  1ASY A;  4RDX A;  3IG2 A;  4XEO A;  1YB3 A;  4XTU A;  3QO5 A;  3HRK A;  2ART A;  1KMM A;  4UP8 A;  1BIA A;  2ZNJ A;  3QNE A;  1NJ6 A;  3V7R A;  2CJB A;  3G1Z A;  3VQV A;  1C0A A;  3E9I A;  1G51 A;  4HWT A;  4PG3 A;  4TVY A;  4CS4 A;  1VQZ A;  3VQX A;  1ATI A;  2E3C A;  4H2W A;  1ADY A;  3VQW A;  1B70 A;  4LVK A;  3REU A;  2RHQ B;  4YRK A;  1KOG A;  4XU2 A;  2ARU A;  3V8J A;  2I4L A;  3UGT A;  3HXV A;  4YCU A;  1YFR A;  1WYD A;  2P5I A;  2ZIM A;  5K1P A;  4NCX A;  4TQD A;  4UP9 A;  2ZIN A;  1B70 B;  4TVA A;  4KR2 A;  3PCO A;  2EAY A;  3E9H A;  4KQE A;  1NJ8 A;  2CGH A;  2ZT6 A;  2ZR2 A;  2E10 A;  4YRE A;  3BFM A;  5E3I A;  5C51 B;  3TEG A;  4LVI A;  4ZTU B;  4YRO A;  1HC7 A;  2J3M A;  2DKG A;  4X5O A;  1H4S A;  4TVW A;  4YRQ A;  4P71 A;  1ASZ A;  4CH6 A;  4H2X B;  1L0W A;  1NNH A;  1WU7 A;  5KNN A;  3RKW A;  3IKL A;  2J3L A;  3LSS A;  3M4P A;  2C8M A;  1X56 A;  4WI1 A;  3V7C A;  2ALY B;  4P71 C;  3QTC A;  4AH6 A;  1N9W A;  4J15 A;  4WF2 A;  4HT4 A;  3MEY A;  4P75 C;  1H4Q A;  4PHC A;  3A7A A;  2PMF A;  2FYK A;  2ZCE A;  4K88 A;  1USY C;  2HNI A;  2ZXF A;  4XTY A;  4HWP A;  4K87 A;  4YP0 A;  4P3P A;  2C7I A;  3UFG A;  2DJZ A;  3DSQ A;  1H4V B;  2AMC A;  1Z7N A;  3L4G B;  2DDZ A;  3M4Q A;  4H2U A;  4G84 A;  4KR3 A;  1ADJ A;  5C53 B;  4WJ3 M;  4UP7 A;  2EJ9 A;  2QHV A;  1IL2 A;  2IY5 B;  2DXT A;  3QO8 A;  1B8A A;  1BBW A;  3I7F A;  1E22 A;  4YRM A;  1HXD A;  3RF1 A;  2I4N A;  3HTZ A;  3RAC A;  2Q7H A;  3LSQ A;  1NJ5 A;  3V8L A;  4OLF A;  3ERR A;  1E1O A;  4P3N A;  4LVL A;  1X2H A;  3UGQ A;  1SRY A;  2DQ3 A;  2DZC A;  2DTH A;  3L4G A;  4H2S A;  4RQF A;  2AMC B;  3A31 A;  1LYL A;  1EVK A;  1X01 A;  3IKM B;  4TTV A;  2ZZF A;  2I4O A;  5K1X A;  1SES A;  2IY5 A;  2E41 A;  1PYS A;  1EIY A;  2ZZG A;  12AS A;  1JJC B;  4YRL A;  3FJP A;  4YRF A;  3A5Z A;  3NEM A;  2ZR3 A;  3HXU A;  1YGB A;  2ZT8 A;  2DXU A;  1NJ1 A;  2QHU A;  4ZTZ B;  2E5A A;  2CJ9 A;  2QHS A;  2ZIO A;  4CS3 A;  1WQW A;  2Q5I A;  3VQY A;  2DVE A;  1EVL A;  4P3O A;  2NS6 A;  4DPG A;  4H2X A;  4H02 A;  3P8V A;  4YYE A;  4YRC A;  1NYR A;  3HFZ B;  4H2Y A;  1YFS A;  2QHT A;  4YCW A;  4P74 A;  3RL6 A;  4YRT A;  4XTZ A;  2DTO A;  4HWS A;  4Q6G A;  3LC0 A;  1X54 A;  3REX A;  1WLE A;  3HY1 A;  1EFW A;  4ZIB A;  4CS2 A;  3RIR A;  4XU0 A;  1J5W A;  4G85 A;  4H2T A;  1SER A;  1E1T A;  3EFS A;  3PCO B;  1BIB A;  4TVA B;  1X55 A;  4P73 A;  3RKY A;  3MF2 A;  4EO4 A;  2Q5H A;  1X2G A;  4YRI A;  3A5Y A;  4LVM A;  3A32 A;  1WQ7 A;  4Q15 A;  2P0L A;  3A7U A;  3HFZ A;  3HFV A;  2DU7 A;  5HGQ A;  3V7S A;  3CMQ A;  2CIM A;  3NET A;  2EWN A;  3PZC A;  4O2D A;  3NEL A;  3RUX A;  1H4T A;  2ZNI A;  2ZT5 A;  4RMF A;  3A74 A;  4YRS A;  2XGT A;  2E64 A;  4HWR A;  4YRG A;  4K86 A;  4HVC A;  4XTW A;  1G5H A;  4WJ4 A;  4YRP A;  3V8K A;  1EOV A;  4P72 A;  4CH5 A;  4BWA A;  3EFR A;  2RHQ A;  2ZGW A;  3HXX A;  3VBB A;  1YFT A;  3HRI A;  4UPA A;  1PYS B;  1W66 A;  3KFU A;  1QE0 A;  2E65 A;  2Q7G A;  5ELN A;  4YRN A;  3P8Y A;  4LNS A;  4P72 C;  2RHS B;  1G5I A;  3HY0 A;  3OD1 A;  4LVJ A;  4CH4 A;  1WPY A;  1SET A;  3QO7 A;  2ZT7 A;  3R07 A;  1HTT A;  4BW9 A;  4DQ2 A;  2DZ9 A;  1USY A;  4TWA A;  3A7R A;  4CH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...