2QHVA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 67
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhvA01
4KR2A 4G84A 4XEOA 3ERRA 1YB3A 4CS3A 2ZXFA 4H2UA 4YRKA 1FYFA 2E10A 1SESA 2ZT8A 4L87A 5E3IA 1EVLA 3DSQA 4RMFA 3VQXA 4AH6A 3HXUA 2DDZA 2EJ9A 3EFSA 3RGLA 3RKXA 3V8LA 4ZIBA 3V8JA 4YRNA 4P74C 3UGQA 4XTXA 3BFMA 2DTHA 1EIYA 4BW9A 4RDXA 4P71C 4YCUA 5KNNA 3VQYA 2ZT5A 4UP7A 3UGTA 3IG2A 1YFRA 4P72C 1BIAA 3LC0A 1PYSA 2EWNA 2CIMA 2ZIMA 2DKGA 2ZNJA 3VQVA 4K88A 1ATIA 2CJBA 1H4QA 4H2XA 4UP9A 3IKMB 3PZCA 3TEHA 2ARSA 1VQZA 2IY5B 4YYEA 4H02A 3HXVA 4CS2A 4J15A 4DPGA 3WQZA 1HTTA 3W3SA 2ZGWA 4LNSA 1C0AA 2AMCA 4ZTUB 1YGBA 2E3CA 3RUXA 1YFTA 3NEMA 3LSSA 1ADYA 3MEYA 4YRMA 4OLFA 1NYQA 3HTZA 4KR3A 1E1OA 4RQFA 3L2ZA 3REUA 4TTVA 4TVYA 1X2HA 2ZINA 1X01A 3V8KA 1ASZA 4YROA 2I4OA 4XU2A 1ASYA 4YCWA 2AKWB 1WLEA 3A5YA 1BBUA 1B8AA 2RHSB 2ARTA 1W66A 4WJ3M 4CH4A 2DXTA 2CGHA 3HXYA 4XU3A 3VBBA 4HA8A 3IALA 1B7YB 2DXUA 1WNLA 2QHUA 2C8MA 2ZZEA 2CJ9A 1EVKA 2ZZGA 2RHQB 4OP0A 3ICAA 1H4VB 5ELOA 1G51A 3TEGA 4X5OA 4TVWA 2DJZA 2ARUA 1SETA 1X54A 4O2DA 2Q7HA 3RF1A 4CH6A 3M4PA 4P3PA 2I4LA 2G4CA 1B70B 1G5HA 4XTUA 3KFUA 5HGQA 3PCOA 1B76A 4TVAA 3RACA 2I4NA 1JJCB 4E51A 2EJGA 3HRKA 4K87A 4P72A 3A7AA 2ZIOA 4XTVA 4YRIA 1BBWA 3A5ZA 4H2TA 3A31A 3LSQA 2I4MA 2Q7GA 3VQWA 2QHSA 3MF2A 3HY0A 2DVEA 1E1TA 4UPAA 5C52B 4P3NA 3HFVA 12ASA 3IKLA 2CJAA 2ZT6A 3G1ZA 1HXDA 2ZCEA 3UFGA 4WI1A 3HXXA 1NJ5A 3A7RA 3QTCA 4XTZA 3L4GB 2C7IA 1WYDA 2PMFA 2XTIA 2Q5HA 2P5IA 3EFRA 1NYRA 4HWTA 4EO4A 2RHSA 3P8VA 2ZTGA 1Z7NA 5K1PA 2E41A 4YRRA 2DEQA 1E24A 3QO7A 2PMEA 1USYA 2DTOA 4WJ4A 1EFWA 4WF2A 3FJPA 4HWSA 3E9HA 5C51B 3OD1A 1SERA 4YRSA 1B7YA 2HNIA 5K1XA 5F5WA 4H2SA 4XU0A 4DQ2A 1NJ8A 3P8YA 4P75A 1Z7MA 4TQFA 2RHQA 4PHCA 4PG3A 1NJ6A 1NJ1A 2E64A 4CS4A 4NCXA 2AMCB 4K86A 2ODRD 4YRQA 1WU7A 3RIRA 4P71A 4RQEA 1X2GA 1WPYA 2E5AA 3RKWA 1HC7A 1IL2A 4YRTA 4Q15A 1QE0A 3HY1A 3A32A 3NENA 1WQ7A 2E1HA 1JJCA 4EX5A 1USYC 1NNHA 4G85A 4YRLA 4YCVA 3V7SA 2DQ3A 2XGTA 1H4TA 4P75C 4TWAA 4XTYA 4YRFA 2IY5A 1E22A 2ZR2A 4P73A 3HFZB 1N9WA 3NELA 2FYKA 2ALYB 4HWPA 4H2VA 1X55A 1G5IA 2EAYA 4YRCA 4YP0A 4XTWA 2DU7A 4HVCA 3REXA 1KOGA 4HWRA 1YFSA 5ELNA 1SRYA 3MF1A 1X56A 2EL9A 2QHTA 2ZR3A 3I7FA 1GGMA 3L4GA 2ZZFA 3V7RA 4CH5A 2ODRC 3HXZA 4ZTZB 2EJFA 2ZNIA 2Q7EA 11ASA 4YREA 2DTIA 3A7UA 1WQWA 4KQEA 1EIYB 3RL6A 1BIBA 4XU1A 4P3OA 4YRPA 4P73C 2DZCA 1EOVA 3E9IA 3M4QA 3P8TA 4YDQA 4BWAA 1PYSB 2AKWA 3HRIA 1J5WA 3PCOB 4TVAB 1QF6A 2DU5A 1NJ2A 2DZ9A 2QHVA 3UH0A 2J3MA 3HXWA 4H2XB 2P0LA 3QO5A 3TEHB 4CH3A 3BJUA 2ZT7A 3QO8A 2E65A 1KMNA 4YRGA 3L1AA 4H2YA 1L0WA 1ADJA 3CMQA 3QNEA 3R07A 5C53B 2J3LA 4H2WA 4UP8A 1KMMA 3A74A 1H4SA 2DQ0A 1RIQA 3RKYA 4P74A 3V7CA 3NETA 4YPFA 1LYLA 1EQRA 4Q6GA 4YRJA 3TUPA 4XEMA 3HFZA 4HWOA 2ALYA 4TQDA 2Q5IA 1B70A
chains in the Genus database with same CATH superfamily
2NS6A 4KR2A 4G84A 4XEOA 3ERRA 1YB3A 4CS3A 2ZXFA 4H2UA 4YRKA 1FYFA 4LVJA 2E10A 1SESA 2ZT8A 4L87A 5E3IA 1EVLA 3DSQA 4RMFA 3VQXA 4AH6A 3HXUA 2DDZA 2EJ9A 3EFSA 3RGLA 3RKXA 3V8LA 4ZIBA 3V8JA 4YRNA 4P74C 3UGQA 4XTXA 3BFMA 2DTHA 1EIYA 4BW9A 4RDXA 4P71C 4YCUA 5KNNA 3VQYA 2ZT5A 4UP7A 3UGTA 3IG2A 1YFRA 4P72C 1BIAA 3LC0A 1PYSA 2EWNA 2CIMA 2ZIMA 2DKGA 2ZNJA 3VQVA 4K88A 4HT4A 1ATIA 2CJBA 1H4QA 4H2XA 4UP9A 3IKMB 3PZCA 3TEHA 2ARSA 1VQZA 2IY5B 4YYEA 4H02A 3HXVA 4CS2A 4J15A 4DPGA 3WQZA 1HTTA 3W3SA 2ZGWA 4LNSA 1C0AA 2AMCA 4ZTUB 1YGBA 2E3CA 3RUXA 1YFTA 3NEMA 3LSSA 1ADYA 4LVIA 3MEYA 4YRMA 4OLFA 1NYQA 3HTZA 4KR3A 1E1OA 4RQFA 3L2ZA 3REUA 4TTVA 4TVYA 1X2HA 2ZINA 1X01A 3V8KA 1ASZA 4YROA 2I4OA 4XU2A 1ASYA 4YCWA 2AKWB 1WLEA 3A5YA 1BBUA 1B8AA 2RHSB 2ARTA 1W66A 4WJ3M 4CH4A 2DXTA 2CGHA 3HXYA 4XU3A 3VBBA 4HA8A 3IALA 1B7YB 2DXUA 1WNLA 2QHUA 2C8MA 2ZZEA 2CJ9A 1EVKA 2ZZGA 2RHQB 4OP0A 3ICAA 1H4VB 5ELOA 1G51A 3TEGA 4X5OA 4TVWA 2DJZA 2ARUA 1SETA 1X54A 4O2DA 2Q7HA 3RF1A 4CH6A 3M4PA 4P3PA 2I4LA 2G4CA 4LVKA 1B70B 1G5HA 4XTUA 3KFUA 5HGQA 3PCOA 1B76A 4TVAA 3RACA 2I4NA 1JJCB 4E51A 2EJGA 3HRKA 4K87A 4P72A 3A7AA 2ZIOA 4XTVA 4YRIA 1BBWA 3A5ZA 4H2TA 3A31A 3LSQA 2I4MA 2Q7GA 3VQWA 2QHSA 3MF2A 3HY0A 2DVEA 1E1TA 4UPAA 5C52B 4LVMA 4P3NA 3HFVA 12ASA 3IKLA 2CJAA 2ZT6A 3G1ZA 1HXDA 2ZCEA 3UFGA 4WI1A 3HXXA 1NJ5A 3A7RA 3QTCA 4XTZA 3L4GB 2C7IA 1WYDA 2PMFA 2XTIA 2Q5HA 2P5IA 3EFRA 1NYRA 4HWTA 4EO4A 2RHSA 3P8VA 2ZTGA 1Z7NA 5K1PA 2E41A 4YRRA 2DEQA 1E24A 3QO7A 2PMEA 1USYA 2DTOA 4WJ4A 1EFWA 4WF2A 3FJPA 4HWSA 3E9HA 5C51B 3OD1A 1SERA 4YRSA 1B7YA 2HNIA 5K1XA 5F5WA 4H2SA 4XU0A 4DQ2A 1NJ8A 3P8YA 4P75A 1Z7MA 4TQFA 2RHQA 4PHCA 4PG3A 1NJ6A 1NJ1A 2E64A 4CS4A 4NCXA 2AMCB 4K86A 2ODRD 4YRQA 1WU7A 3RIRA 4P71A 4RQEA 1X2GA 1WPYA 2E5AA 3RKWA 1HC7A 4LVLA 1IL2A 4YRTA 4Q15A 1QE0A 3HY1A 3A32A 3NENA 1WQ7A 2E1HA 1JJCA 4EX5A 1USYC 1NNHA 4G85A 4YRLA 4YCVA 3V7SA 2DQ3A 2XGTA 1H4TA 4P75C 4TWAA 4XTYA 4YRFA 2IY5A 1E22A 2ZR2A 4P73A 3HFZB 1N9WA 3NELA 2FYKA 2ALYB 4HWPA 4H2VA 1X55A 1G5IA 2EAYA 4YRCA 4YP0A 4XTWA 2DU7A 4HVCA 3REXA 1KOGA 4HWRA 1YFSA 5ELNA 1SRYA 3MF1A 1X56A 2EL9A 2QHTA 2ZR3A 3I7FA 1GGMA 3L4GA 2ZZFA 3V7RA 4CH5A 2ODRC 3HXZA 4ZTZB 2EJFA 2ZNIA 2Q7EA 11ASA 4YREA 2DTIA 3A7UA 1WQWA 4KQEA 1EIYB 3RL6A 1BIBA 4XU1A 4P3OA 4YRPA 4P73C 2DZCA 1EOVA 3E9IA 3M4QA 3P8TA 4YDQA 4BWAA 1PYSB 2AKWA 3HRIA 1J5WA 3PCOB 4TVAB 1QF6A 2DU5A 2A8EA 1NJ2A 2DZ9A 2QHVA 3UH0A 2J3MA 3HXWA 4H2XB 2P0LA 3QO5A 3TEHB 4CH3A 3BJUA 2ZT7A 3QO8A 2E65A 1KMNA 4YRGA 3L1AA 4H2YA 1L0WA 1ADJA 3CMQA 3QNEA 3R07A 5C53B 2J3LA 4H2WA 4UP8A 1KMMA 3A74A 1H4SA 2DQ0A 1RIQA 3RKYA 4P74A 3V7CA 3NETA 4YPFA 1LYLA 1EQRA 4Q6GA 4YRJA 3TUPA 4XEMA 3HFZA 4HWOA 2ALYA 4TQDA 2Q5IA 1B70A 3MQZA
chains in the Genus database with same CATH topology
2NS6A 4KR2A 4G84A 4XEOA 3ERRA 1YB3A 4CS3A 2ZXFA 4H2UA 4YRKA 1FYFA 4LVJA 2E10A 1SESA 2ZT8A 4L87A 5E3IA 1EVLA 3DSQA 4RMFA 3VQXA 4AH6A 3HXUA 2DDZA 2EJ9A 3EFSA 3RGLA 3RKXA 3V8LA 4ZIBA 3V8JA 4YRNA 4P74C 3UGQA 4XTXA 3BFMA 2DTHA 1EIYA 4BW9A 4RDXA 4P71C 4YCUA 5KNNA 3VQYA 2ZT5A 4UP7A 3UGTA 3IG2A 1YFRA 4P72C 1BIAA 3LC0A 1PYSA 2EWNA 2CIMA 2ZIMA 2DKGA 2ZNJA 3VQVA 4K88A 4HT4A 1ATIA 2CJBA 1H4QA 4H2XA 4UP9A 3IKMB 3PZCA 3TEHA 2ARSA 1VQZA 2IY5B 4YYEA 4H02A 3HXVA 4CS2A 4J15A 4DPGA 3WQZA 1HTTA 3W3SA 2ZGWA 4LNSA 1C0AA 2AMCA 4ZTUB 1YGBA 2E3CA 3RUXA 1YFTA 3NEMA 3LSSA 1ADYA 4LVIA 3MEYA 4YRMA 4OLFA 1NYQA 3HTZA 4KR3A 1E1OA 4RQFA 3L2ZA 3REUA 4TTVA 4TVYA 1X2HA 2ZINA 1X01A 3V8KA 1ASZA 4YROA 2I4OA 4XU2A 1ASYA 4YCWA 2AKWB 1WLEA 3A5YA 1BBUA 1B8AA 2RHSB 2ARTA 1W66A 4WJ3M 4CH4A 2DXTA 2CGHA 3HXYA 4XU3A 3VBBA 4HA8A 3IALA 1B7YB 2DXUA 1WNLA 2QHUA 2C8MA 2ZZEA 2CJ9A 1EVKA 2ZZGA 2RHQB 4OP0A 3ICAA 1H4VB 5ELOA 1G51A 3TEGA 4X5OA 4TVWA 2DJZA 2ARUA 1SETA 1X54A 4O2DA 2Q7HA 3RF1A 4CH6A 3M4PA 4P3PA 2I4LA 2G4CA 4LVKA 1B70B 1G5HA 4XTUA 3KFUA 5HGQA 3PCOA 1B76A 4TVAA 3RACA 2I4NA 1JJCB 4E51A 2EJGA 3HRKA 4K87A 4P72A 3A7AA 2ZIOA 4XTVA 4YRIA 1BBWA 3A5ZA 4H2TA 3A31A 3LSQA 2I4MA 2Q7GA 3VQWA 2QHSA 3MF2A 3HY0A 2DVEA 1E1TA 4UPAA 5C52B 4LVMA 4P3NA 3HFVA 12ASA 3IKLA 2CJAA 2ZT6A 3G1ZA 1HXDA 2ZCEA 3UFGA 4WI1A 3HXXA 1NJ5A 3A7RA 3QTCA 4XTZA 3L4GB 2C7IA 1WYDA 2PMFA 2XTIA 2Q5HA 2P5IA 3EFRA 1NYRA 4HWTA 4EO4A 2RHSA 3P8VA 2ZTGA 1Z7NA 5K1PA 2E41A 4YRRA 2DEQA 1E24A 3QO7A 2PMEA 1USYA 2DTOA 4WJ4A 1EFWA 4WF2A 3FJPA 4HWSA 3E9HA 5C51B 3OD1A 1SERA 4YRSA 1B7YA 2HNIA 5K1XA 5F5WA 4H2SA 4XU0A 4DQ2A 1NJ8A 3P8YA 4P75A 1Z7MA 4TQFA 2RHQA 4PHCA 4PG3A 1NJ6A 1NJ1A 2E64A 4CS4A 4NCXA 2AMCB 4K86A 2ODRD 4YRQA 1WU7A 3RIRA 4P71A 4RQEA 1X2GA 1WPYA 2E5AA 3RKWA 1HC7A 4LVLA 1IL2A 4YRTA 4Q15A 1QE0A 3HY1A 3A32A 3NENA 1WQ7A 2E1HA 1JJCA 4EX5A 1USYC 1NNHA 4G85A 4YRLA 4YCVA 3V7SA 2DQ3A 2XGTA 1H4TA 4P75C 4TWAA 4XTYA 4YRFA 2IY5A 1E22A 2ZR2A 4P73A 3HFZB 1N9WA 3NELA 2FYKA 2ALYB 4HWPA 4H2VA 1X55A 1G5IA 2EAYA 4YRCA 4YP0A 4XTWA 2DU7A 4HVCA 3REXA 1KOGA 4HWRA 1YFSA 5ELNA 1SRYA 3MF1A 1X56A 2EL9A 2QHTA 2ZR3A 3I7FA 1GGMA 3L4GA 2ZZFA 3V7RA 4CH5A 2ODRC 3HXZA 4ZTZB 2EJFA 2ZNIA 2Q7EA 11ASA 4YREA 2DTIA 3A7UA 1WQWA 4KQEA 1EIYB 3RL6A 1BIBA 4XU1A 4P3OA 4YRPA 4P73C 2DZCA 1EOVA 3E9IA 3M4QA 3P8TA 4YDQA 4BWAA 1PYSB 2AKWA 3HRIA 1J5WA 3PCOB 4TVAB 1QF6A 2DU5A 2A8EA 1NJ2A 2DZ9A 2QHVA 3UH0A 2J3MA 3HXWA 4H2XB 2P0LA 3QO5A 3TEHB 4CH3A 3BJUA 2ZT7A 3QO8A 2E65A 1KMNA 4YRGA 3L1AA 4H2YA 1L0WA 1ADJA 3CMQA 3QNEA 3R07A 5C53B 2J3LA 4H2WA 4UP8A 1KMMA 3A74A 1H4SA 2DQ0A 1RIQA 3RKYA 4P74A 3V7CA 3NETA 4YPFA 1LYLA 1EQRA 4Q6GA 4YRJA 3TUPA 4XEMA 3HFZA 4HWOA 2ALYA 4TQDA 2Q5IA 1B70A 3MQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR2 A;  4G84 A;  4XEO A;  3ERR A;  1YB3 A;  4CS3 A;  2ZXF A;  4H2U A;  4YRK A;  1FYF A;  2E10 A;  1SES A;  2ZT8 A;  4L87 A;  5E3I A;  1EVL A;  3DSQ A;  4RMF A;  3VQX A;  4AH6 A;  3HXU A;  2DDZ A;  2EJ9 A;  3EFS A;  3RGL A;  3RKX A;  3V8L A;  4ZIB A;  3V8J A;  4YRN A;  4P74 C;  3UGQ A;  4XTX A;  3BFM A;  2DTH A;  1EIY A;  4BW9 A;  4RDX A;  4P71 C;  4YCU A;  5KNN A;  3VQY A;  2ZT5 A;  4UP7 A;  3UGT A;  3IG2 A;  1YFR A;  4P72 C;  1BIA A;  3LC0 A;  1PYS A;  2EWN A;  2CIM A;  2ZIM A;  2DKG A;  2ZNJ A;  3VQV A;  4K88 A;  1ATI A;  2CJB A;  1H4Q A;  4H2X A;  4UP9 A;  3IKM B;  3PZC A;  3TEH A;  2ARS A;  1VQZ A;  2IY5 B;  4YYE A;  4H02 A;  3HXV A;  4CS2 A;  4J15 A;  4DPG A;  3WQZ A;  1HTT A;  3W3S A;  2ZGW A;  4LNS A;  1C0A A;  2AMC A;  4ZTU B;  1YGB A;  2E3C A;  3RUX A;  1YFT A;  3NEM A;  3LSS A;  1ADY A;  3MEY A;  4YRM A;  4OLF A;  1NYQ A;  3HTZ A;  4KR3 A;  1E1O A;  4RQF A;  3L2Z A;  3REU A;  4TTV A;  4TVY A;  1X2H A;  2ZIN A;  1X01 A;  3V8K A;  1ASZ A;  4YRO A;  2I4O A;  4XU2 A;  1ASY A;  4YCW A;  2AKW B;  1WLE A;  3A5Y A;  1BBU A;  1B8A A;  2RHS B;  2ART A;  1W66 A;  4WJ3 M;  4CH4 A;  2DXT A;  2CGH A;  3HXY A;  4XU3 A;  3VBB A;  4HA8 A;  3IAL A;  1B7Y B;  2DXU A;  1WNL A;  2QHU A;  2C8M A;  2ZZE A;  2CJ9 A;  1EVK A;  2ZZG A;  2RHQ B;  4OP0 A;  3ICA A;  1H4V B;  5ELO A;  1G51 A;  3TEG A;  4X5O A;  4TVW A;  2DJZ A;  2ARU A;  1SET A;  1X54 A;  4O2D A;  2Q7H A;  3RF1 A;  4CH6 A;  3M4P A;  4P3P A;  2I4L A;  2G4C A;  1B70 B;  1G5H A;  4XTU A;  3KFU A;  5HGQ A;  3PCO A;  1B76 A;  4TVA A;  3RAC A;  2I4N A;  1JJC B;  4E51 A;  2EJG A;  3HRK A;  4K87 A;  4P72 A;  3A7A A;  2ZIO A;  4XTV A;  4YRI A;  1BBW A;  3A5Z A;  4H2T A;  3A31 A;  3LSQ A;  2I4M A;  2Q7G A;  3VQW A;  2QHS A;  3MF2 A;  3HY0 A;  2DVE A;  1E1T A;  4UPA A;  5C52 B;  4P3N A;  3HFV A;  12AS A;  3IKL A;  2CJA A;  2ZT6 A;  3G1Z A;  1HXD A;  2ZCE A;  3UFG A;  4WI1 A;  3HXX A;  1NJ5 A;  3A7R A;  3QTC A;  4XTZ A;  3L4G B;  2C7I A;  1WYD A;  2PMF A;  2XTI A;  2Q5H A;  2P5I A;  3EFR A;  1NYR A;  4HWT A;  4EO4 A;  2RHS A;  3P8V A;  2ZTG A;  1Z7N A;  5K1P A;  2E41 A;  4YRR A;  2DEQ A;  1E24 A;  3QO7 A;  2PME A;  1USY A;  2DTO A;  4WJ4 A;  1EFW A;  4WF2 A;  3FJP A;  4HWS A;  3E9H A;  5C51 B;  3OD1 A;  1SER A;  4YRS A;  1B7Y A;  2HNI A;  5K1X A;  5F5W A;  4H2S A;  4XU0 A;  4DQ2 A;  1NJ8 A;  3P8Y A;  4P75 A;  1Z7M A;  4TQF A;  2RHQ A;  4PHC A;  4PG3 A;  1NJ6 A;  1NJ1 A;  2E64 A;  4CS4 A;  4NCX A;  2AMC B;  4K86 A;  2ODR D;  4YRQ A;  1WU7 A;  3RIR A;  4P71 A;  4RQE A;  1X2G A;  1WPY A;  2E5A A;  3RKW A;  1HC7 A;  1IL2 A;  4YRT A;  4Q15 A;  1QE0 A;  3HY1 A;  3A32 A;  3NEN A;  1WQ7 A;  2E1H A;  1JJC A;  4EX5 A;  1USY C;  1NNH A;  4G85 A;  4YRL A;  4YCV A;  3V7S A;  2DQ3 A;  2XGT A;  1H4T A;  4P75 C;  4TWA A;  4XTY A;  4YRF A;  2IY5 A;  1E22 A;  2ZR2 A;  4P73 A;  3HFZ B;  1N9W A;  3NEL A;  2FYK A;  2ALY B;  4HWP A;  4H2V A;  1X55 A;  1G5I A;  2EAY A;  4YRC A;  4YP0 A;  4XTW A;  2DU7 A;  4HVC A;  3REX A;  1KOG A;  4HWR A;  1YFS A;  5ELN A;  1SRY A;  3MF1 A;  1X56 A;  2EL9 A;  2QHT A;  2ZR3 A;  3I7F A;  1GGM A;  3L4G A;  2ZZF A;  3V7R A;  4CH5 A;  2ODR C;  3HXZ A;  4ZTZ B;  2EJF A;  2ZNI A;  2Q7E A;  11AS A;  4YRE A;  2DTI A;  3A7U A;  1WQW A;  4KQE A;  1EIY B;  3RL6 A;  1BIB A;  4XU1 A;  4P3O A;  4YRP A;  4P73 C;  2DZC A;  1EOV A;  3E9I A;  3M4Q A;  3P8T A;  4YDQ A;  4BWA A;  1PYS B;  2AKW A;  3HRI A;  1J5W A;  3PCO B;  4TVA B;  1QF6 A;  2DU5 A;  1NJ2 A;  2DZ9 A;  2QHV A;  3UH0 A;  2J3M A;  3HXW A;  4H2X B;  2P0L A;  3QO5 A;  3TEH B;  4CH3 A;  3BJU A;  2ZT7 A;  3QO8 A;  2E65 A;  1KMN A;  4YRG A;  3L1A A;  4H2Y A;  1L0W A;  1ADJ A;  3CMQ A;  3QNE A;  3R07 A;  5C53 B;  2J3L A;  4H2W A;  4UP8 A;  1KMM A;  3A74 A;  1H4S A;  2DQ0 A;  1RIQ A;  3RKY A;  4P74 A;  3V7C A;  3NET A;  4YPF A;  1LYL A;  1EQR A;  4Q6G A;  4YRJ A;  3TUP A;  4XEM A;  3HFZ A;  4HWO A;  2ALY A;  4TQD A;  2Q5I A;  1B70 A; 
#chains in the Genus database with same CATH topology
 2NS6 A;  4KR2 A;  4G84 A;  4XEO A;  3ERR A;  1YB3 A;  4CS3 A;  2ZXF A;  4H2U A;  4YRK A;  1FYF A;  4LVJ A;  2E10 A;  1SES A;  2ZT8 A;  4L87 A;  5E3I A;  1EVL A;  3DSQ A;  4RMF A;  3VQX A;  4AH6 A;  3HXU A;  2DDZ A;  2EJ9 A;  3EFS A;  3RGL A;  3RKX A;  3V8L A;  4ZIB A;  3V8J A;  4YRN A;  4P74 C;  3UGQ A;  4XTX A;  3BFM A;  2DTH A;  1EIY A;  4BW9 A;  4RDX A;  4P71 C;  4YCU A;  5KNN A;  3VQY A;  2ZT5 A;  4UP7 A;  3UGT A;  3IG2 A;  1YFR A;  4P72 C;  1BIA A;  3LC0 A;  1PYS A;  2EWN A;  2CIM A;  2ZIM A;  2DKG A;  2ZNJ A;  3VQV A;  4K88 A;  4HT4 A;  1ATI A;  2CJB A;  1H4Q A;  4H2X A;  4UP9 A;  3IKM B;  3PZC A;  3TEH A;  2ARS A;  1VQZ A;  2IY5 B;  4YYE A;  4H02 A;  3HXV A;  4CS2 A;  4J15 A;  4DPG A;  3WQZ A;  1HTT A;  3W3S A;  2ZGW A;  4LNS A;  1C0A A;  2AMC A;  4ZTU B;  1YGB A;  2E3C A;  3RUX A;  1YFT A;  3NEM A;  3LSS A;  1ADY A;  4LVI A;  3MEY A;  4YRM A;  4OLF A;  1NYQ A;  3HTZ A;  4KR3 A;  1E1O A;  4RQF A;  3L2Z A;  3REU A;  4TTV A;  4TVY A;  1X2H A;  2ZIN A;  1X01 A;  3V8K A;  1ASZ A;  4YRO A;  2I4O A;  4XU2 A;  1ASY A;  4YCW A;  2AKW B;  1WLE A;  3A5Y A;  1BBU A;  1B8A A;  2RHS B;  2ART A;  1W66 A;  4WJ3 M;  4CH4 A;  2DXT A;  2CGH A;  3HXY A;  4XU3 A;  3VBB A;  4HA8 A;  3IAL A;  1B7Y B;  2DXU A;  1WNL A;  2QHU A;  2C8M A;  2ZZE A;  2CJ9 A;  1EVK A;  2ZZG A;  2RHQ B;  4OP0 A;  3ICA A;  1H4V B;  5ELO A;  1G51 A;  3TEG A;  4X5O A;  4TVW A;  2DJZ A;  2ARU A;  1SET A;  1X54 A;  4O2D A;  2Q7H A;  3RF1 A;  4CH6 A;  3M4P A;  4P3P A;  2I4L A;  2G4C A;  4LVK A;  1B70 B;  1G5H A;  4XTU A;  3KFU A;  5HGQ A;  3PCO A;  1B76 A;  4TVA A;  3RAC A;  2I4N A;  1JJC B;  4E51 A;  2EJG A;  3HRK A;  4K87 A;  4P72 A;  3A7A A;  2ZIO A;  4XTV A;  4YRI A;  1BBW A;  3A5Z A;  4H2T A;  3A31 A;  3LSQ A;  2I4M A;  2Q7G A;  3VQW A;  2QHS A;  3MF2 A;  3HY0 A;  2DVE A;  1E1T A;  4UPA A;  5C52 B;  4LVM A;  4P3N A;  3HFV A;  12AS A;  3IKL A;  2CJA A;  2ZT6 A;  3G1Z A;  1HXD A;  2ZCE A;  3UFG A;  4WI1 A;  3HXX A;  1NJ5 A;  3A7R A;  3QTC A;  4XTZ A;  3L4G B;  2C7I A;  1WYD A;  2PMF A;  2XTI A;  2Q5H A;  2P5I A;  3EFR A;  1NYR A;  4HWT A;  4EO4 A;  2RHS A;  3P8V A;  2ZTG A;  1Z7N A;  5K1P A;  2E41 A;  4YRR A;  2DEQ A;  1E24 A;  3QO7 A;  2PME A;  1USY A;  2DTO A;  4WJ4 A;  1EFW A;  4WF2 A;  3FJP A;  4HWS A;  3E9H A;  5C51 B;  3OD1 A;  1SER A;  4YRS A;  1B7Y A;  2HNI A;  5K1X A;  5F5W A;  4H2S A;  4XU0 A;  4DQ2 A;  1NJ8 A;  3P8Y A;  4P75 A;  1Z7M A;  4TQF A;  2RHQ A;  4PHC A;  4PG3 A;  1NJ6 A;  1NJ1 A;  2E64 A;  4CS4 A;  4NCX A;  2AMC B;  4K86 A;  2ODR D;  4YRQ A;  1WU7 A;  3RIR A;  4P71 A;  4RQE A;  1X2G A;  1WPY A;  2E5A A;  3RKW A;  1HC7 A;  4LVL A;  1IL2 A;  4YRT A;  4Q15 A;  1QE0 A;  3HY1 A;  3A32 A;  3NEN A;  1WQ7 A;  2E1H A;  1JJC A;  4EX5 A;  1USY C;  1NNH A;  4G85 A;  4YRL A;  4YCV A;  3V7S A;  2DQ3 A;  2XGT A;  1H4T A;  4P75 C;  4TWA A;  4XTY A;  4YRF A;  2IY5 A;  1E22 A;  2ZR2 A;  4P73 A;  3HFZ B;  1N9W A;  3NEL A;  2FYK A;  2ALY B;  4HWP A;  4H2V A;  1X55 A;  1G5I A;  2EAY A;  4YRC A;  4YP0 A;  4XTW A;  2DU7 A;  4HVC A;  3REX A;  1KOG A;  4HWR A;  1YFS A;  5ELN A;  1SRY A;  3MF1 A;  1X56 A;  2EL9 A;  2QHT A;  2ZR3 A;  3I7F A;  1GGM A;  3L4G A;  2ZZF A;  3V7R A;  4CH5 A;  2ODR C;  3HXZ A;  4ZTZ B;  2EJF A;  2ZNI A;  2Q7E A;  11AS A;  4YRE A;  2DTI A;  3A7U A;  1WQW A;  4KQE A;  1EIY B;  3RL6 A;  1BIB A;  4XU1 A;  4P3O A;  4YRP A;  4P73 C;  2DZC A;  1EOV A;  3E9I A;  3M4Q A;  3P8T A;  4YDQ A;  4BWA A;  1PYS B;  2AKW A;  3HRI A;  1J5W A;  3PCO B;  4TVA B;  1QF6 A;  2DU5 A;  2A8E A;  1NJ2 A;  2DZ9 A;  2QHV A;  3UH0 A;  2J3M A;  3HXW A;  4H2X B;  2P0L A;  3QO5 A;  3TEH B;  4CH3 A;  3BJU A;  2ZT7 A;  3QO8 A;  2E65 A;  1KMN A;  4YRG A;  3L1A A;  4H2Y A;  1L0W A;  1ADJ A;  3CMQ A;  3QNE A;  3R07 A;  5C53 B;  2J3L A;  4H2W A;  4UP8 A;  1KMM A;  3A74 A;  1H4S A;  2DQ0 A;  1RIQ A;  3RKY A;  4P74 A;  3V7C A;  3NET A;  4YPF A;  1LYL A;  1EQR A;  4Q6G A;  4YRJ A;  3TUP A;  4XEM A;  3HFZ A;  4HWO A;  2ALY A;  4TQD A;  2Q5I A;  1B70 A;  3MQZ A; 
#chains in the Genus database with same CATH homology
 2NS6 A;  4KR2 A;  4G84 A;  4XEO A;  3ERR A;  1YB3 A;  4CS3 A;  2ZXF A;  4H2U A;  4YRK A;  1FYF A;  4LVJ A;  2E10 A;  1SES A;  2ZT8 A;  4L87 A;  5E3I A;  1EVL A;  3DSQ A;  4RMF A;  3VQX A;  4AH6 A;  3HXU A;  2DDZ A;  2EJ9 A;  3EFS A;  3RGL A;  3RKX A;  3V8L A;  4ZIB A;  3V8J A;  4YRN A;  4P74 C;  3UGQ A;  4XTX A;  3BFM A;  2DTH A;  1EIY A;  4BW9 A;  4RDX A;  4P71 C;  4YCU A;  5KNN A;  3VQY A;  2ZT5 A;  4UP7 A;  3UGT A;  3IG2 A;  1YFR A;  4P72 C;  1BIA A;  3LC0 A;  1PYS A;  2EWN A;  2CIM A;  2ZIM A;  2DKG A;  2ZNJ A;  3VQV A;  4K88 A;  4HT4 A;  1ATI A;  2CJB A;  1H4Q A;  4H2X A;  4UP9 A;  3IKM B;  3PZC A;  3TEH A;  2ARS A;  1VQZ A;  2IY5 B;  4YYE A;  4H02 A;  3HXV A;  4CS2 A;  4J15 A;  4DPG A;  3WQZ A;  1HTT A;  3W3S A;  2ZGW A;  4LNS A;  1C0A A;  2AMC A;  4ZTU B;  1YGB A;  2E3C A;  3RUX A;  1YFT A;  3NEM A;  3LSS A;  1ADY A;  4LVI A;  3MEY A;  4YRM A;  4OLF A;  1NYQ A;  3HTZ A;  4KR3 A;  1E1O A;  4RQF A;  3L2Z A;  3REU A;  4TTV A;  4TVY A;  1X2H A;  2ZIN A;  1X01 A;  3V8K A;  1ASZ A;  4YRO A;  2I4O A;  4XU2 A;  1ASY A;  4YCW A;  2AKW B;  1WLE A;  3A5Y A;  1BBU A;  1B8A A;  2RHS B;  2ART A;  1W66 A;  4WJ3 M;  4CH4 A;  2DXT A;  2CGH A;  3HXY A;  4XU3 A;  3VBB A;  4HA8 A;  3IAL A;  1B7Y B;  2DXU A;  1WNL A;  2QHU A;  2C8M A;  2ZZE A;  2CJ9 A;  1EVK A;  2ZZG A;  2RHQ B;  4OP0 A;  3ICA A;  1H4V B;  5ELO A;  1G51 A;  3TEG A;  4X5O A;  4TVW A;  2DJZ A;  2ARU A;  1SET A;  1X54 A;  4O2D A;  2Q7H A;  3RF1 A;  4CH6 A;  3M4P A;  4P3P A;  2I4L A;  2G4C A;  4LVK A;  1B70 B;  1G5H A;  4XTU A;  3KFU A;  5HGQ A;  3PCO A;  1B76 A;  4TVA A;  3RAC A;  2I4N A;  1JJC B;  4E51 A;  2EJG A;  3HRK A;  4K87 A;  4P72 A;  3A7A A;  2ZIO A;  4XTV A;  4YRI A;  1BBW A;  3A5Z A;  4H2T A;  3A31 A;  3LSQ A;  2I4M A;  2Q7G A;  3VQW A;  2QHS A;  3MF2 A;  3HY0 A;  2DVE A;  1E1T A;  4UPA A;  5C52 B;  4LVM A;  4P3N A;  3HFV A;  12AS A;  3IKL A;  2CJA A;  2ZT6 A;  3G1Z A;  1HXD A;  2ZCE A;  3UFG A;  4WI1 A;  3HXX A;  1NJ5 A;  3A7R A;  3QTC A;  4XTZ A;  3L4G B;  2C7I A;  1WYD A;  2PMF A;  2XTI A;  2Q5H A;  2P5I A;  3EFR A;  1NYR A;  4HWT A;  4EO4 A;  2RHS A;  3P8V A;  2ZTG A;  1Z7N A;  5K1P A;  2E41 A;  4YRR A;  2DEQ A;  1E24 A;  3QO7 A;  2PME A;  1USY A;  2DTO A;  4WJ4 A;  1EFW A;  4WF2 A;  3FJP A;  4HWS A;  3E9H A;  5C51 B;  3OD1 A;  1SER A;  4YRS A;  1B7Y A;  2HNI A;  5K1X A;  5F5W A;  4H2S A;  4XU0 A;  4DQ2 A;  1NJ8 A;  3P8Y A;  4P75 A;  1Z7M A;  4TQF A;  2RHQ A;  4PHC A;  4PG3 A;  1NJ6 A;  1NJ1 A;  2E64 A;  4CS4 A;  4NCX A;  2AMC B;  4K86 A;  2ODR D;  4YRQ A;  1WU7 A;  3RIR A;  4P71 A;  4RQE A;  1X2G A;  1WPY A;  2E5A A;  3RKW A;  1HC7 A;  4LVL A;  1IL2 A;  4YRT A;  4Q15 A;  1QE0 A;  3HY1 A;  3A32 A;  3NEN A;  1WQ7 A;  2E1H A;  1JJC A;  4EX5 A;  1USY C;  1NNH A;  4G85 A;  4YRL A;  4YCV A;  3V7S A;  2DQ3 A;  2XGT A;  1H4T A;  4P75 C;  4TWA A;  4XTY A;  4YRF A;  2IY5 A;  1E22 A;  2ZR2 A;  4P73 A;  3HFZ B;  1N9W A;  3NEL A;  2FYK A;  2ALY B;  4HWP A;  4H2V A;  1X55 A;  1G5I A;  2EAY A;  4YRC A;  4YP0 A;  4XTW A;  2DU7 A;  4HVC A;  3REX A;  1KOG A;  4HWR A;  1YFS A;  5ELN A;  1SRY A;  3MF1 A;  1X56 A;  2EL9 A;  2QHT A;  2ZR3 A;  3I7F A;  1GGM A;  3L4G A;  2ZZF A;  3V7R A;  4CH5 A;  2ODR C;  3HXZ A;  4ZTZ B;  2EJF A;  2ZNI A;  2Q7E A;  11AS A;  4YRE A;  2DTI A;  3A7U A;  1WQW A;  4KQE A;  1EIY B;  3RL6 A;  1BIB A;  4XU1 A;  4P3O A;  4YRP A;  4P73 C;  2DZC A;  1EOV A;  3E9I A;  3M4Q A;  3P8T A;  4YDQ A;  4BWA A;  1PYS B;  2AKW A;  3HRI A;  1J5W A;  3PCO B;  4TVA B;  1QF6 A;  2DU5 A;  2A8E A;  1NJ2 A;  2DZ9 A;  2QHV A;  3UH0 A;  2J3M A;  3HXW A;  4H2X B;  2P0L A;  3QO5 A;  3TEH B;  4CH3 A;  3BJU A;  2ZT7 A;  3QO8 A;  2E65 A;  1KMN A;  4YRG A;  3L1A A;  4H2Y A;  1L0W A;  1ADJ A;  3CMQ A;  3QNE A;  3R07 A;  5C53 B;  2J3L A;  4H2W A;  4UP8 A;  1KMM A;  3A74 A;  1H4S A;  2DQ0 A;  1RIQ A;  3RKY A;  4P74 A;  3V7C A;  3NET A;  4YPF A;  1LYL A;  1EQR A;  4Q6G A;  4YRJ A;  3TUP A;  4XEM A;  3HFZ A;  4HWO A;  2ALY A;  4TQD A;  2Q5I A;  1B70 A;  3MQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...