2QHXA

Structure of pteridine reductase from leishmania major complexed with a ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
264
Chain Sequence
b'TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Discovery of potent pteridine reductase inhibitors to guide antiparasite drug development.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 96
structure length 264
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qhxA00
1ONNA 4ID9A 1R4MA 3RJ5A 3MJEA 4IINA 3ASVA 4XDYA 1M75A 1VRWA 4XQGA 1QSGA 1Z75A 2WEKA 4IDFA 4BNTA 4R9RA 2PZJA 4I5FA 5FI3A 1MLDA 2HSDA 3BHIA 1E77A 5EMHA 2PTGA 2PD4A 4A73A 5CEEA 2X7HA 4XB1A 3AY6A 2CDBA 1N7GA 4J4HA 2OORA 4LW8A 3F5SA 4XQCA 3EDMA 2HMUA 1EK5A 4URFA 4IM7A 4J4BA 3WGGA 1U3VA 3Q1LA 3JD0A 5B4TA 3KTDA 3GG9A 4EEXA 2FR0A 3V5NA 2WMDA 1B8VA 1B16A 1I24A 1P1KA 4YT2A 5TLSA 1T4BA 4CM9D 4CQMD 3WJ7A 3GRPA 3NGLA 5EINA 3OIFA 3BIOA 1D1TA 1TT5A 3K5PA 3EGOA 2Y1DA 2VWGA 1R4MB 3AFNA 1ORRA 5LDHA 3D1LA 3PLRA 3VHRA 3RU7A 1XWFA 4PLVA 4LSMA 3K31A 4UUMA 2BFPA 2PFGA 4W9NC 5U4QA 1DB3A 2FP4A 3EK2A 5CPFA 3TJRA 3EY4A 3VVBA 1LNQA 4ONEA 3NDIA 3QJ5A 1YH3A 3UHAA 1YWGO 1GPJA 4OXYA 3GFGA 4UVDA 3U9LA 4DQVA 3GRKA 1PR9A 3I4CA 4J1SA 2NVWA 4JJGA 4W82A 2RBEA 2IYPA 3JQ8B 1WDKA 1Y8RA 3DMTA 1TT5B 5DOZA 5IJZA 1DAPA 5IXSA 3NDRA 1VI2A 3TFOA 4YR9A 5KWEA 3I6QA 1DJNA 4U0JA 1VSUA 3DTYA 4R69A 4K9DA 1P31A 2VYVD 3K96A 5L3ZA 1IB6A 5T5QA 1XSEA 2QRLA 3RUFA 4UVGA 5CEJA 1H6CA 1A4IA 2QW8A 4WLUA 4PLHA 5ILGA 4BO6A 4FDAA 1EFLA 4HADA 5FI5A 3S2GA 1EK6A 4RVDA 4RL6A 2CDAA 3CEAA 3W4IA 2OGUA 4BVAA 4TRJA 1DIHA 4BKPA 3PXXA 1UZNA 2B4TO 3H5NA 4CJXA 4RVHA 1P0FA 4RF5A 4PRLA 2DTEA 4TKMA 4IZIA 1FJHA 1LI4A 2A94A 2VHWA 3SLKA 1SAYA 1XLTA 1H9BA 2Q2VA 3OIDA 4XGIA 1Y8RB 4YRDA 1B2LA 4EI2A 1ZEMA 4OXKA 2YJZA 1TI7A 1JU9A 4W7IA 1X1EA 4UEOA 1NP3A 1YJ8A 1HLDA 2NQTA 2CDCA 3DZFA 3G49A 2JCYA 3FNEA 3GT0A 3VZRA 5G2OA 5JMPA 3DWFA 4B79A 1H0KA 1RYDA 4LN1A 4DYDA 3U49A 5I7VA 1LDGA 3FNFA 3NYWA 1LTHR 5CDYA 2W98A 4BKUA 1QLJA 5TRTA 2GSDA 1BVUA 1JN0A 4E3ZA 3SC6A 3OSUA 1KVSA 3WLEA 2ZB3A 1MGOA 1U7HA 1WDMA 5TX7A 2Q45A 1P44A 4JN6B 2JCVA 4FS3A 3ZI0A 1PQPA 4OH1A 1MA0A 1P45A 2CMDA 3MZ0A 3ENKA 3ZNOA 1GV1A 1X14A 3QW2A 4OQZA 1MB4A 4PLWA 2HCTA 3GAZA 3RC9A 3GHHA 3Q11A 1M76A 1V8BA 2Y0CA 1YO6A 1XCBA 5HA5A 1Z7EA 2FZEA 2ZATA 4XGNA 3RROA 4IDAA 2DVMA 4D3DA 2ZTVA 4CLHA 2UVDA 3W8DA 3PFFA 5TS3A 3U0BA 4CR7A 3ZU4A 2GGSA 3TL2A 4RORA 4UEJA 1N1GA 2RHCA 3BHJA 4BMNA 1IPEA 3PHHA 1YJQA 3FWNA 3FD8A 4Z3DA 4HXYA 4TZKA 2X5KO 2ZB7A 5IXYA 1E3LA 1Z74A 2ET6A 4E5KA 4NBUA 4F46A 1SMKA 4XRRA 2BKAA 2HMTA 3FPCA 4BNUA 1KY5A 2PZLA 4BNKA 4PVDA 3TZQA 2YYYA 2FN7A 1I32A 3KSZO 4Z9XA 1NYTA 2O4UX 5F5LA 3HHPA 1E3EA 2WD8A 3GMSA 3QVXA 4K6CA 4Y6RA 3AJRA 4Q3CA 7MDHA 2ILTA 1XKQA 3R1IA 1TVEA 4C7KA 3AFMA 3X2EA 3DAGA 3ZV4A 4ALMA 2CD9A 1HSOA 3ETEA 4BNHA 1KOLA 1U2DA 2VTEA 1WPQA 2V6BA 5BSEA 3E9QA 1IUKA 2GZ2A 4QX6A 3M6IA 5HS6A 2AG5A 4DGSA 4Z0TA 1OZAA 5L4SA 4L4SA 1GEEA 4L4RA 3WMWA 1O94A 3PDUA 2C7GA 4WEOA 4YYZA 3H3FA 1PR3A 3ICCA 2PH3A 3MCVA 3C7DB 4R1UA 4U7WA 4EGFA 2X5OA 4L0QA 3JQBA 3RUAA 4BMVA 1ISGA 2AQ8A 4XQ9A 3NT2A 3VH3A 4E4YA 3H65A 2QYTA 2QZ9A 3IKTA 1HWYA 5JFOA 1ZK3A 2NU9A 3DBLB 3Q2IA 3JV7A 4TZTA 4LSWA 1Y1PA 1GU7A 3RBVA 1BW9B 2PD3A 3DFZA 4I1IA 5L40A 5AVOA 4XYGA 4L9RA 4OAQA 4U0KA 4Y67A 4YACA 4NBWA 4M89A 3ZU3A 4FPXA 4LK3A 4BIIA 4GGPA 3V1UA 3E9NA 1E1KA 1T25A 2Y0EA 2ZTLA 3P5SA 4KUHA 2Y93A 4P4GA 2CSUA 1H2BA 1NQAO 1Q7CA 1OI7A 3PHLA 2A4KA 2AQIA 2VWPA 5TT0A 3P7MA 4MVJP 2FPPA 4W9NA 3UCXA 3ULKA 4B4WA 1EDOA 2WE7A 2WJPA 4JROA 1PSDA 2EF1A 3AWDA 3O03A 1KERA 6ADHA 1Q7BA 4U6SA 3IUPA 2VYND 1V0JA 3WGTA 4A26A 2R00C 1E7QA 3WYEA 2BH9A 2HQ1A 2O23A 3G1UA 5A3VA 2DFDA 1N92A 3D3WB 3QP9A 4Q3DA 5DCWA 2V6FA 1CWUA 4FCCA 3HB4X 4PRKA 4XIJA 2DU8A 3TZKA 1W0CA 4MO2A 3TFQA 4AJLA 3ONFA 3I52A 1SB8A 3TZHA 5ITWA 1TEHA 1ZMTA 4OQYA 3GUCA 2FSSA 3UGKA 3S2EA 3TWOA 1UDCA 1WZIA 2IZ1A 5CP8A 4M8SA 1LLQA 5ER6A 3PFWO 5TF4A 1XQ1A 2Y0DA 4R01A 2P91A 1QYVA 1G0OA 2DBRA 4GX0A 1QLHA 1CQJA 3A06A 3O8QA 5GY7A 2XOXA 3ROQA 2R6JA 3E48A 3C7CB 1N2SA 3WSVA 1DIBA 1BXGA 2QRJA 1GDHA 3WQSB 4JJIA 2CVQA 2X9NA 2G76A 3DQPA 4RLHA 3F4BA 3V1TC 5JO0A 4IQGA 4K26A 4Z6KA 3PWZA 3DTTA 4Z9FA 4J90A 4PLFA 2EGGA 2O7SA 3BMCA 1I2ZA 1HEUA 5IFLA 2H6EA 4RVSA 4RF4A 3ZCXA 1ZSVA 4XCVA 2C2XA 4BNGA 4RPGA 1OMOA 3WGYA 4HP8A 3H2ZA 5CPBA 1IHYA 3VOSA 4IGEA 4CLOA 3K2BA 5F1OA 1QYXA 5KJEA 2DBVO 3KB6A 1VJTA 3NV9A 1DLJA 5AYVA 2BFAA 1ZK4A 4W4TA 1OOEA 3O8QB 1IE3A 4H16A 1O89A 2DTXA 3S2IA 1ZJYA 4O6VA 1E7YA 3TF5A 4XZ3A 5A05A 1BXGB 4YBZA 4YT8A 5J23A 1V35A 1E7WA 1EQUA 2CY0A 3DR3A 4MVJE 2QQ5A 4EW6A 1C1DA 3I23A 4D0SA 2FPIA 4AG3A 4HWKA 4RPJA 2PKRA 5JY6A 4YRAA 1LU9A 4R1SA 3I83A 3K30A 1BDMA 1JW9B 3BMCB 1NHGA 4R41A 5ADHA 1C0IA 4NJOA 4LGVA 3ITDA 1MUUA 4OOFA 1I3LA 2ZB4A 4IDDA 2FZWA 1ZEJA 4ND3A 1JKFA 3I9NA 1R37A 4E31A 1KY4A 4CLOB 3RCBA 5L51A 4QECA 5FF9A 2JKVA 4BNZA 1HDOA 1SEVA 3VC7A 3G1TA 1B3RA 1M6HA 3PEFA 1DIAA 1OFGA 1ONOA 3CH6A 5EESA 1XDWA 3UOGA 3H9GA 2J3JA 1A71A 3DHNA 3KSUA 2R2GA 2ZCVA 3I3OA 2DBQA 3R3JA 4P38A 5F21A 4R5MA 4ALLA 1U4SA 1ZCJA 2HKIA 3RC7A 1PZGA 1HZJA 3E8XA 4HUJA 4XX0A 4B3HA 1DIRA 2RCYA 2JD0A 4BV9A 3CSDA 2JD2A 2YFHA 1YOVA 2UV8A 4NK5A 2ZKLA 2X4GA 4RPKA 3E5RA 4WLFA 3UF0A 4MIEA 5HRUA 1K6XA 4NH4A 5LDGA 3U5TA 4AJHA 1ZIDA 3WGZA 2OP1A 3GEMA 3KETA 3PTZA 1ZZEA 1A9YA 4ND5A 4BQPA 5THQA 4JP3A 2JAPA 9LDBA 3G3EA 3NKLA 2VHXA 1XYGA 1SC6A 1CIVA 3MJ4A 4NU6A 4E2ZA 3IUSA 4B3JA 3UFXA 1WMBA 1QR6A 2PNFA 5F1PA 4MIYA 1UP6A 1EVYA 3JD2A 3DB2A 4M1QA 3KHUA 3UVEA 5DCUA 2YFQA 4E5MA 3DBRA 4EJ0A 4GKVA 2G17A 4XKJA 1DO8A 5JCJA 4BO4A 1DFGA 2RAFA 1NAIA 1YOVB 3RUHA 1YVEI 1TA4A 2C5AA 4DC1A 2OBNA 4DLLA 4YJFA 1TB4A 3BAZA 3WGQA 2JFFA 2IE0A 4XYMA 3DAPA 1LRKA 2O2YA 1KS9A 4O63O 3AUSA 4OXNA 4TROA 4IJUA 4WLEA 4PG6A 2BD0A 4D44A 3H8VA 4WECA 4J2OA 4ROSA 3CTMA 1DBVO 4J4TA 3IP1A 1P74A 3P2OA 1YQDA 3R6DA 1NVGA 5JC1A 5C7IO 3M1AA 1OBFO 1ENZA 4QO8A 1KC3A 2J3KA 3AM4A 3ZNPA 5IF3A 3DBRB 3X2FA 1P33A 5JDCC 2I99A 3FBTA 3WIEA 1T26A 2D1YA 3MOGA 5DBIA 4DTIA 2HJRA 5TJHA 4TSKA 2B4QA 4WK6A 4INAA 2E6UX 5L45A 3UCEA 3L9XA 1VKNA 4YJFB 5COQA 2HAEA 1GEGA 3PWKA 2FR8A 3EHEA 2VZ8A 1PS8A 1PZHA 3AM5A 3PYXA 3WG9A 2R00A 1CETA 3NGXA 4BKOA 2WDZA 3GNSA 4JXKA 1YE3A 2VT3A 1XU9A 2YY7A 3ZNNA 4B7UA 5KJ1A 4DLAA 4UVEA 1VL8A 3JYLA 2J5RA 4B4UA 1YB4A 1LLCA 4KMSA 3AU8A 3WLFA 2XXJA 4FB5A 4G65A 3LSYA 3RFXA 1U5CA 3MJVA 4UULA 3LLVA 4NG5A 1Y9EA 3NUGA 1FDTA 2X8LA 1E92A 1EEHA 1A72A 3AW9A 1JVBA 2W4QA 3RIHA 3TN7A 2ZQYA 3RBZA 4WNIA 3JQAB 4CLDA 3DBHA 3U09A 1N9GA 4R1TA 1NX6A 2VTDA 5JS6A 5A9SA 1J4AA 3ITKA 3PDJA 2W2LD 4E5YA 3QSGA 1PQWA 3DONA 5B37A 2Z1NA 5CDGA 2Y68A 1YBMA 1X7GA 2Q50A 5IDWA 3PIIA 3AI3A 3JYPA 3M2PA 1XELA 3WSWA 4CM4A 4J7XA 3KBOA 1PJCA 4YB8A 4EUEA 4JK3A 1HETA 4NU5A 4RDIA 2Q4EA 3WS7A 1X13A 4CUZA 5TT1A 1T4DA 3KYCA 1NAHA 1RKXA 1N8KA 5AXDA 4GVLA 3WYCA 4RQTA 3BTUA 3FWZA 4S1VA 2EKLA 3HSKA 5EPOA 4RPHA 3UW3A 5KJCA 5C37A 3AOEC 1M66A 3U4CA 1I10A 3K8ZA 1RWBA 1EUDA 4MKRA 1PGOA 4JBIA 2Q4BA 2EXXA 3V8BA 2XF8A 1R0LA 4WLNA 3WX0A 4UUNA 4DMLA 5ICMA 4PG7A 4BO5A 3DBHB 1N9GB 3VKUA 5EQDA 2CZCA 5A9SB 3JD3A 2I65A 2BFOA 3OQ6A 1V3VA 1ADFA 1ZUD1 4LRTB 3RUIA 1EE2A 5L7TA 1VL0A 4GX5A 5FYDA 1PJ4A 5HM8A 2ZYAA 5AQ1A 3VH2A 4FIZA 4CM4B 5G4KA 1R4NA 2V65A 5EQFA 3PI7A 1ENPA 2PH5A 4RQUA 4FOSA 1JKIA 3KYCB 3LLSA 4KDEA 3LYLA 3JYOA 1MV8A 2X6TA 4PLPA 4QXMA 1D7OA 1DJQA 3P2YA 4D42A 2HLPA 3AOGA 3KYDA 1E5QA 2C0CA 1I2CA 3IQDB 3FTNA 2JHGA 3W4KA 3NX4A 2OFPA 1UDAA 3FRJA 2FHSA 4PIVA 2AQHA 2B69A 3NJ4A 4N5NA 1AHHA 1UAGA 3RC2A 2J6IA 4E5PA 1HYGA 4QTZA 4RPLA 3OFSA 4WOJA 3CINA 4XQEA 1FXSA 4ZQEA 1N5DA 2ZCUA 3V2GA 4CM3A 1M67A 3GG2A 1VJ1A 5G0TA 5G4KB 3HFSA 1R4NB 4A2CA 4YAIA 2RHRA 3TRIA 4I9NA 5BSHA 1IPFA 2W8ZA 3FF4A 5T57A 4BNIA 3QY9A 3GY0A 5B4UA 4TRRA 1NPDA 3L07A 2YZ7A 4N54A 1GQ2A 1AE1A 3KYDB 3JQ8A 2WTBA 3KV3O 3VPGA 1KVUA 2JAHA 3IKVA 2GN8A 4RCVA 3ORFA 3A14A 5JY1A 3MWDB 4D41A 1KVRA 2X9GA 1JVSA 4D46A 4FC6A 3PLNA 7ADHA 5EN4A 3H4VA 2W2KA 1XHLA 1JWAB 4M87A 4EEZA 4GMGA 5A9TA 4YA6A 2DPGA 3JQEA 1D1SA 4W7HA 1I8TA 3MOIA 1DRVA 1T2EA 3AU9A 5U1PA 4AJJA 3D0OA 5BR7A 4B8ZA 5TIIA 5ES3A 3BA1A 2A92A 3IIEA 1B8UA 4UUPA 3BTOA 4FJ1A 4A27A 3ZN2A 1O9BA 1RJWA 5JPIA 2HO5A 2EKPA 3GDFA 4I5DA 2E37A 5TC4A 2X0RA 2D59A 3ZWWA 3LT2A 4OIMA 1L7EA 3L4BC 3WICA 1XG5A 3QQPA 2VNSA 3AUTA 4BNWA 1QMGA 5ENVA 3RC1A 1N7HA 3L9WA 4BHTA 4IS2A 5DF1A 4F6LA 3TL3A 4DYVA 3E6AA 3C3XA 1PEDA 4FFMA 4AJIA 1DLIA 2RH4A 2Y05A 4DREA 2W2KB 3HWRA 1DOHA 1PU2A 4GKBA 4E6PA 2YQ4A 3JQ6A 1I01A 1SO8A 1JQBA 4XD2A 1YKFA 2IYOA 1YB5A 5MDHA 4JJFA 3OBBA 4MKZA 3PWSA 3WQRA 4XYLA 2OZPA 3O26A 1NR7A 3VPHA 5HWSA 2ZIZA 3Q2KA 3CPSA 5JDCA 4BNMA 4L4XA 3BYZA 2LDBA 1P1FA 1BSVA 1D3AA 2GN9A 4CR8A 5FEUA 1QXSA 3T7EA 4BO8A 2I6TA 4D3SA 3B1JA 3C1OA 4J3FA 4J7UA 3PZBA 1HZZA 1R0KA 2D0IA 3JYQA 4OHUA 1LX6A 1IZ0A 4Q3NA 4II3A 3PYMA 4LCJA 4L8VA 2DKNA 2PV7A 1B8PA 1R15A 5KVQA 4GSLA 4HNGA 2TMGA 2VUSA 1F14A 3CZRA 2GASA 4NIMA 2GCGA 2PWZA 1YDWA 4PCVA 3SC4A 2AE1A 3GA0A 2YV3A 3IJRA 3OJ0A 5TNXA 5T67A 2B36A 4CMBA 4D45A 4ZGWA 4MDHA 1LSJA 1OC2A 4OM8A 4YJHB 3DFUA 4IMRA 1R6DA 1C0KA 1QRRA 2C29D 4ZRNA 5HS4A 4ND1A 1GADO 4FFLA 1Z82A 4MVJF 4JIGA 1GTMA 1FMCA 3DZJA 1Z7BA 2YW9A 5G0SA 1E7RA 3U3XA 3OICA 5I7FA 3ZU2A 4EZBA 1LLDA 3EYWA 3OECA 3L77A 3LT4A 4GBJA 1IOLA 3GC6A 2VZ9A 1C3VA 1Q1NA 4WOKA 1QKIA 1ZSYA 5BNFA 3NRCA 4CLEA 2BI8A 4OGWA 1E7SA 1NWCA 5L7WA 2H9IA 3E82A 4GLLA 3FN4A 5CHEA 5KJ6A 1GQYA 4FOOA 3MWEB 4WLVA 1EZ4A 2GF2A 3RI3A 3VDQA 2DUUA 1ISIA 1WWKA 1U9JA 5JE8A 5G0UA 4NHEA 4TVOA 1D4FA 5CEFA 5JYDA 5L53A 2EWMA 4IBOA 1E3WA 4QUKA 4RZIA 5EL0A 1K3TA 3HDYA 4FR5A 3DBLA 4R5HA 1DC5A 4RF2A 5IAAA 2VRCA 1NVTA 3WJAA 1U4OA 3EUWA 1PQUA 3PQDA 2NU6A 1BW9A 1KETA 1YQGA 3DOJA 4Y9DA 5GZ6A 5IDQA 5JYEA 5F1KA 1J49A 3MJCA 2WD7B 3B1KA 3I9KA 1EE9A 4IIUA 4XRGA 3WB9A 3GK3A 5JDIA 1JAXA 2I3GA 2VHYA 3FNGA 1V3TA 2CF5A 3H5AA 4J9VA 3GEDA 4CLXA 4BV8A 4AJ2A 3RFVA 1X0VA 1BXKA 1T2AA 4E5NA 2HRBA 3BTVA 4R68A 5JCJD 1L7DA 1DFIA 5IG2A 3COSA 4KTTE 4FBGA 4XEHA 4H15A 4J1NA 1H5QA 2Z1MA 4PZCA 5BNIA 1PL6A 1UDBA 1E3WB 4YTEA 3ROPA 4J9UE 3JQ7B 3H3JA 1T2DA 3VKVA 4U5QA 2NTJA 4EJ6A 5KTKA 3DZBA 3QLJA 3T4XA 3U4HA 3WFJA 3PK0A 3ROKA 4BGIA 2PGDA 4NNJA 3WXBA 4YEDA 2AHRA 3VVCA 5JSFA 4RZHA 3D3WA 3MJSA 1NBOA 1A4UA 3GNTA 3WQQA 4F45A 4CM1A 1NTOA 3QVTA 2D4AA 5GZ1A 3GVHA 1CDOA 3VPSA 1UZMA 3GVIA 3RASA 4WNCA 3TSCA 4MP8A 2IRWA 1A7KA 4ND2A 3ASUA 1QYCA 5H82A 2D5AA 3SEFA 1H93A 5IDYA 3LDHA 1ISFA 5COBA 3W6UA 3ZHZA 4E2YA 3GF4A 4DL9A 4E13A 4FGWA 4DVJA 4YQYA 1H2HA 4AJEA 2O7QA 1ZNQO 3RKRA 1CF2O 1MG5A 1T1SA 3DDNA 1PGQA 2Y1FA 2FRDA 1IULA 3GVXA 5KNLA 2WWRA 1EVIA 3GFBA 1U1IA 5KVVA 3KO8A 4BNLA 3G79A 3INRA 4CMHA 1PJQA 1PJBA 2WYUA 2Y1CA 3DHYA 4IQ8A 5AXAA 2BRUA 2BGLA 1RM3A 4UVIA 3DAFA 4CQMA 4HV4A 4AFNA 3GQVA 4XJSA 3OA2A 4KQWA 4CODB 4X54A 3RJ9A 1KEUA 1EDZA 3HADA 3RBXA 2VWQA 3DBVO 4IDGA 3KXDA 2NU8A 5HTOA 3GDOA 1HDGO 1M2WA 3L4BA 2DFVA 4PLGA 3GGGA 3ETGA 4B8WA 3GLQA 1BWSA 3VH1A 1WNTA 1BDBA 2J3HA 3C1AA 4PLYA 3QVOA 4JP2A 1WMAA 4E32A 4Z3KA 4CLRB 5EIOA 1UXJA 2AMFA 5LCXA 3KM0A 5KVSA 1PIWA 2O3SA 2PLAA 1XGKA 4CMEC 3OIGA 4OKNA 3T4EA 3GNQA 4WPGA 4CMCA 2Z95A 1O8CA 4PG5A 4KDFA 2RH8A 1YONA 8ADHA 4BNVA 3OP4A 3LK7A 3S8MA 1HE4A 1KBZA 3OMLA 1P1JA 1YBAA 4XWYA 4Q9NA 3FPLA 2EG9A 4CM5A 1H6AA 1X7HA 2GUGA 1DHRA 4CQMB 1BHSA 4YPOA 1VE9A 2EJWA 2E4AA 1K0UA 1UXHA 4CPDA 3AI2A 5KIAA 1EUZA 2GZ3A 2HUNA 5CG2A 3HG7A 2IZZA 4ALJA 2PKQO 1X7DA 2X0JA 2B5VA 2C82A 1P1HA 2JFHA 1HKUA 2RIRA 3ABIA 1E1MA 3HDJA 3ZH2A 1ULSA 4GGOA 2VYVA 1CYDA 4NFHA 4NI5A 1DC4A 3EZLA 4KWHA 2AW5A 5I9LA 1W8DA 2E49A 1HLPA 3MEQA 4WCDA 4IIVA 3TPCA 3WGOA 3WDSA 2HK7A 1SBYA 3KUXA 3EZYA 3OJEA 1K6JA 1XR3A 1LJ8A 2QZZA 4XB2A 4WJZA 4BNNA 3SBOA 4GPD1 1KIFA 1DC6A 5ENDA 3CIFA 1BG6A 3BTSA 3CMMA 2D2IA 3GZ4A 3IAHA 3ICPA 3RSHA 3UICA 3VPFA 4D3FA 1HDYA 4PZEA 2B37A 5AOVA 1VC2A 2EHDA 3VAZA 4FD3A 4NBTA 1SZJG 1K89A 1EBFA 2Q99A 3CZMA 3JTMA 4FGSA 3GOHA 3ZHBA 4B4OA 3ANNA 4H3VA 1HDRA 2HK8A 2BGMA 1BTOA 1VLLA 4XDZA 4QFCA 4K28A 2FMUA 4F6CA 2I67A 4JQCA 2BLLA 4ZQHA 1JLLA 1GV0A 1PGJA 4EUFA 4EBFA 3WYBA 3LVFO 5BSFA 5COAA 4KUGA 4II2A 5A04A 3B20A 5I8WA 1HT0A 1GQQA 3F47A 3UCFA 1PZEA 3ZWOA 5T64A 1KC1A 4O59O 2DPHA 4PGFA 3VZQA 4BS9A 3D5QA 4BO9A 5JLAA 2Y66A 4XIYA 4O1MA 1YS4A 1YQXA 6LDHA 1XA0A 1Y9AA 4ZD6A 4FFRA 4NBVA 5B4VA 5BSGA 1U5AA 4KTVE 4TMFA 3WBBA 3ZHXA 2EJVA 4UUOA 1NM5A 3Q9NA 4Z0HO 1E3IA 4WLOA 1H6DA 1LA2A 2EKQA 1IL0A 3G0OA 4HNHA 3W8FA 2EP5A 1MFPA 3AM3A 3JSAA 8LDHA 1HE2A 3K2EA 3VH4A 4J7CA 4FC7A 3KZVA 3A9WA 2PY6A 3GN1A 4YAJA 1DIGA 4G81A 1NQ5A 2VUUA 4YAEA 3LF2A 1U2GA 5JC8A 1B7GO 2BFMA 3K92A 2C20A 3FR8A 2JCXA 3NTRA 5I8ZA 1P1RA 4ALKA 1JWBB 5L4NA 4G5HA 2VHZA 3H9EO 3NTOA 4CV2A 3OEWA 3TOZA 5JNLA 3FI9A 2DAPA 4CUKA 3ZWBA 5C3MA 1ZBQA 1LSOA 3QE3A 1RPNA 4XJTA 1RM0A 1ADBA 4I9HA 4HFMA 2AEMA 3H6KA 4MKXA 4BNYA 4M54A 1S7CA 4R51A 4U8GA 3UH1A 2PD6A 1Y5MA 4Q3AA 1W6UA 2ZTMA 5F3RA 1NVMB 5FWNA 3ANMA 2P5YA 1GYRA 1UZLA 3HJAA 1H94A 4EJMA 1JAYA 3DEYX 1EQ2A 1LDNA 1R66A 1LSUA 2XPCA 3I5MA 3QWBA 3FSRA 5C7OO 1J6UA 3PJEA 5T8KC 2IXBA 2FR1A 4BNXA 3GGOA 2YUTA 5JAQA 2H1SA 4NPCA 3R0IA 2Q1WA 1PZFA 4BO3A 1U7TA 1P3DA 4AVYA 3VPXA 3WWYA 3GEGA 4CM7A 1HTBA 3I9OA 3JQ9C 1HSZA 4GL4A 5CFZA 1GFSA 2BF7A 1U8XX 3S2FA 1LEHA 4UAGA 3JQFC 3JQAA 1Q0HA 1R16A 4BGEA 4JBHA 3VZPA 4I08A 4OSOA 2FPGA 4ZQGA 4MINA 5A9RA 4M49A 5I9MA 1JKJA 3IP3A 2OXIA 1NQOA 5A3JA 4TVBA 1U28A 4Y6PA 2C2YA 3GUYA 4MVJA 4WASA 1AXEA 5KCZA 4OYRA 3E5MA 3JD1A 3K9QO 3PQFA 3F46A 4JLWA 4R16A 5I9NA 1YL7A 3QWHA 3CE6A 3M1LA 2A35A 4GWGA 3ZWCA 1MX3A 1P9LA 3H7AA 1WDLA 4CR6A 1ZXLA 4NJMB 2YHIA 2Y1OA 4MP6A 1NFRA 1E6WA 1EVJA 2FSVA 1RM4A 3PIDA 4BGVA 2VZ0A 2CF6A 4R3WA 4Y8VA 1P77A 3HZZA 3R3SA 2BGKA 2EW8A 2PGJA 4QSMA 1ML3A 1NFQA 4DPMA 3DOOA 4LVUA 5L7YA 4WUVA 4CMEA 5H83A 3V1YA 3WR5A 1Y5RA 5L95A 3EAGA 3ZWXA 1HDXA 4J49A 1PWZA 1P0CA 2P9CA 2QX7A 4IJWA 2X0NA 1GZ4A 1T2FA 3HN7A 1CEQA 2Y1GA 3Q0EA 2UAGA 1SPXA 1DDOA 5IN5A 2O50A 1BVRA 1EBUA 4ILKA 4DIFA 2YV1A 3GR6A 3H9JA 1LXCA 1U3TA 2G0TA 1I3NA 2Z5LA 2YHIB 1C14A 1K6IA 5JXWA 2DLDA 4ESOA 2LDXA 1DSSG 3GZNA 4GH5A 3I4FA 3VZSA 2D3TA 1X0XA 1Z6ZA 1JA9A 2JHFA 3ZGYA 4KWIA 1PL8A 5DOVA 2OOSA 3D5TA 4HFJA 1SNYA 3ZNQA 2GERA 1BRMA 1GCOA 9LDTA 4ITUA 1QORA 2X9VA 1PX0A 2EGHA 3NT5A 1UR5A 3RUCA 1YRLA 4DLBA 2NTVA 1IZ9A 1GD1O 1G6KA 5H81A 1HF3A 2WYWA 1ZKMA 4RLSA 1NPYA 3KEOA 3HDQA 3Q9UA 1YGYA 4GLOA 2NM0A 1WLYA 2EEZA 4DUPA 4BO2A 3K6JA 1CQIA 1ZK1A 1M6WA 3L4SO 1RYEA 4B3IA 2PGLA 4ZQFA 3WTCA 3KLMX 2ZYDA 3E18A 3WFIA 1GUFA 1SOWA 1Y7TA 3QVSA 4PN3A 2NNLD 4ZVVA 2YDYA 3GZNB 3JCZA 1PGPA 5JCXA 3EVTA 4M86A 2NVUA 3C8MA 2GYYA 3F3SA 1ZK2A 2YDXA 3ZV6A 3W6ZA 1QV7A 2BI7A 1DRUA 1B26A 5A1TA 2VN8A 2NQ8A 1F0YA 4QQRA 5AXCA 3FNHA 1TLTA 4L74A 2CVOA 2PR2A 2AG8A 3CXRA 2IODA 4AJKA 3QIVA 2HMWA 1DRWA 3UUWA 3RD5A 4RVFA 3JQBC 1PTJA 4YXFA 1YBVA 3PHGA 3PRJA 3MTGA 1NR1A 3DZGA 1WXDA 5ICSA 3LT1A 3U4IA 2HJSA 3GMDA 1B3BA 1NXQA 2GPTA 4L73A 1KVTA 1AHIA 2X22A 4QO7A 1E3JA 2A9FA 2VOEA 3O4RA 4AJPA 4YAKA 2J5KA 1N1EA 2X86A 1O0SA 5I7EA 2JFGA 3RUDA 2O3JA 5ILOA 4PFJA 2NVUB 4NBRA 3F1LA 2BELA 4Q3EA 3UN1A 2ZK7A 3QA9A 1RM5A 3QV1A 3HDHA 4YJGA 4XYBA 5MGBA 2VRBA 3WGIA 1P1IA 1BMDA 1V6AA 5DN9A 2VUTA 3I9JA 4DBVO 3D4NA 4IY1A 4NFSA 5BQFA 5DZSA 3STHA 5U9CA 1WVGA 3RU9A 3JD4A 5JBIA 1KEPA 3E9MA 4TKLA 3UXYA 3VTFA 3W1VA 1UXGA 4XR4A 4B4VA 4E30A 2V6MA 4XGKA 4BO1A 3OJLA 1O5IA 3FTPA 1YDEA 5TSDA 4A5OA 4E12A 4D0RA 4WE3A 3NAQA 4AICA 4DIOA 1AN9A 1ZK0A 3O38A 2EP7A 3PHIA 4BNFA 4HX5A 4A03A 1BXZA 4DMMA 1Y8QA 2ZJ1A 4ZJUA 3GDGA 2CVZA 1VSVA 1I30A 4GX2A 5T8KA 5KJFA 2NLOA 4ALIA 3FHLA 3JQGA 5DNAA 4YT4A 3ZWNA 4YJGB 2GN6A 2PZKA 3W4JA 2Q1SA 4OKIA 1Q0LA 1LC3A 4QFDA 5DDIP 3FBGA 5A4DA 1I3KA 1IY8A 3IC5A 4OO3A 1C0LA 1E5LA 3LU1A 5FFFA 3JQ9A 5K9ZA 4YJHA 1NHWA 3TDKA 4ZN6A 4K6FA 4CMAA 3G17A 4GVXA 1C1XA 3JQFA 1E1LA 5DBFA 1DC3A 1ID1A 4IDBA 1OAAA 1FDWA 2HK9A 1Y8QB 4JBGA 3HNPA 3DO5A 3OQ1A 1UXIA 5GMOA 3TQHA 2JJYA 2OUIA 3ADOA 3JQGB 2NTNA 3FR7A 3DC2A 3BZUA 3LC2O 3PQEA 5DBGA 1L1FA 1Y81A 2B0JA 4E2WA 1DHTA 2DQ4A 3OM9A 2P68A 1QV6A 3ZWPA 1GUYA 3M2TA 4MVJH 4RV9A 1FDVA 4NR0A 1T2CA 3L0DA 3F4LA 4I5GA 4C4OA 1C1XB 3WIDA 5AXBA 3DMYA 2UUPA 3HN2A 3PVZA 1VKOA 3L6EA 4D7AA 4NMHA 4NFYA 3ZV5A 4DWVA 3AI1A 3BMQA 4LCEA 4DPLA 1QYWA 1HE5A 2GDZA 2H5LA 3RVDA 3HFGA 4GMFA 2WD7A 1I0ZA 5CG1A 4GI2A 1ZSNA 1GZ3A 4BMSA 4F3YA 3RQSA 5B1YA 2HDHA 2W90A 3WGHA 1AGNA 3OQBA 3WTBA 1NASA 4N5LA 2I9PA 1WW8A 1DPGA 2AEJA 3IJPA 1JDJA 4EYEA 4L75A 4G2NA 2H63A 3NEPX 1BGVA 4IXTA 5JO9A 4I9UA 3AOEA 2B4RO 5T6BA 1HDZA 2CUKA 4BO7A 4GWKA 3DZIA 5JAZA 2W2LA 3EVNA 3PPIA 3D7LA 1I3MA 4JCOA 1U3WA 1KEVA 3C7AA 1Z45A 1JTVA 3JQ7A 3ZW8A 3F6YA 1ENOA 2C54A 2GNAA 4ALNA 1LSSA 1T24A 1UH5A 2Y99A 4EDFA 1LUAA 2IXAA 3BMQB 3JQCA 1YL6A 5ER9A 1E6EA 1LDBA 2O2SA 4LRSB 3ONEA 1EVZA 1FF9A 4E2XA 1U8FO 3SX2A 1PJLA 4UREA 1VM6A 4OOEA 3NJ8A 4MVJM 3O9ZA 2O3RA 2AE2A 1EUCA 4I5EA 5EJ2A 4PLTA 1FK8A 4J91A 3OETA 1GL3A 4A0SA 1HDCA 1TT7A 3KRTA 3QVWA 2I76A 1ZJZA 4CMGA 2VOJA 5KOIA 2ZTUA 1I36A 2O3TA 2WSBA 4N7RA 5LC1A 3ENNA 2BMAA 1A9ZA 1Y6JA 3F1KA 4QT0A 3C24A 4HFRA 4YVFA 3ZU5A 4ND4A 4IZHA 3AUAA 4MPDA 2Y1EA 5JAIA 2OO5A 2G82A 4BKRA 1D8AA 4IGFA 4D79A 2EIHA 3OH8A 2QIOA 4E0BA 4N5MA 1UP7A 1K5HA 2VQ3A 2FWMX 4YWJA 2J5QA 2G1UA 4HY3A 4ZRMA 3ST7A 2D5CA 2AEFA 2B5WA 3C85A 1LC0A 3MTJA 3JQAD 2PK3A 1YL5A 3PGXA 3RKUA 4FSHA 2SCUA 3AY7A 1AUPA 1Q7GA 1MFZA 3F5QA 4CLRA 3EW7A 5L9AA 3AY3A 4W99A 1LLUA 3H2SA 3SVTA 2POQX 4IDCA 1F8GA 5A5EA 2C59A 4MVJD 5DT9A 1U3UA 5G4LA 2F00A 3ADPA 5K6AC 3N74A 4TRNA 1HXHA 2JD1A 2Q3EA 3CUKA 1G1AA 2YHUA 3LC1O 2B83A 1GYQA 4RF3A 3RUEA 4JNKA 3GPDG 1NNUA 4FW8A 4WEQA 4NQZA 2X58A 4CM9A 4OL9A 2IZ0A 3B70A 4BUCA 2NUAA 4D43A 3A28A 2GZ1A 3DL2A 5BNTA 3WBFA 4BO0A 4IXWA 2IDZA 4LVCA 5JW6A 3PGJA 1QP8A 2VNAA 4ZICA 3QRWA 1YXMA 3AK4A 3RWBA 4KP7A 5G0WA 4CL3A 2GR9A 2G5CA 1DEHA 4HKTA 4J1QA 1ZVMA 4CUJA 4Y6SA 1B14A 4CV1A 1WP4A 2IEBA 5IZCC 4CM6A 5KKCA 2GO1A 2Q1UA 4MJLA 3ANLA 2GD1O 4PVCA 3H9QA 4RJTA 1UXKA 5K0ZA 3BMNA 4GSKA 1ADCA 2VCYA 4KQXA 4MOWA 2Y67A 1HRDA 3H9UA 3PHJA 4WCFC 1PJ3A 2B35A 2I66A 2QYSA 2PZMA 5DULA 4AJNA 1MXFA 1XEAA 3DOCA 4IJKA 4O5OA 4AJ4A 2FOIA 3I9MA 3LT0A 3WNVA 4DA9A 2PA3A 1ZO8A 5IDXA 2EW2A 1H6BA 3OJOA 4J0FA 1NFFA 1G0NA 3LF1A 4E21A 3LZ6A 2AA3A 3ZWMA 1LRJA 4S3MA 5F5NA 3S55A 3B1FA 2OHXA 1LQTA 1R12A 2X23A 1KVQA 4GX1A 1ZW1A 2GLXA 2NADA 1LDEA 1PL7A 1QYDA 3KLPX 4FFOA 4IDEA 2O3QA 1W4ZA 4JX8A 4P8RA 3FCOA 1UJMA 3N58A 1B15A 3JYNA 1MG0A 3C1TA 3BMNB 3WOHA 3OJFA 2OMEA 1UP4A 3ROMA 1I2BA 1C0PA 4P22A 2HU2A 3Q3CA 4OJNA 5A06A 4BQRA 1GZ6A 3INGA 5GZ3A 2J8ZA 5A02A 2P9EA 4CL8A 1CJCA 2DT5A 3BHMA 1YB1A 4DQUA 3JQDA 4PLCA 4R54A 3OHSX 3RFTA 2O4CA 2Q46A 3P19A 1Q2XA 4YJDA 4MVJI 4TWRA 2I5PO 1SOVA 2NU7A 2QG4A 1E6UA 4CM8A 3NTQA 3TOXA 1PJ2A 1GR0A 4IPTA 1I5RA 2P5UA 4MVJG 4RVGA 1SB9A 1XIVA 3GN2A 4GQAA 5THKA 1E3SA 2IEDA 2C7VA 4FJ0A 5TGDA 3NT4A 5C5IA 4HFNA 2NSDA 4Q39A 4DIBA 4J6FA 2E48A 2V7PA 4Y98A 1J5PA 4EITA 1VPDA 3SXPA 4IJVA 2DUWA 2OBYA 3TNLA 4IMPA 4K1LA 3IL2A 2OP0A 3L6OO 4R1NA 2J3IA 4BB5A 3QWFA 4CMIA 3PZRA 1DXYA 1UAYA 1XU7A 3D4OA 1ONPA 4DRYA 4TRMA 4R9SA 2XXBA 2WYVA 2WE8A 5B12A 4YQZA 3PP8A 4H7PA 5TQVA 2ZYGA 2O48X 1MP0A 3E1KA 3GHYA 1C1DB 5TJ9A 4CM8B 3GVCA 4R4JA 1Z73A 3KSDO 1HYHA 1ISHA 4YCAA 4BB6A 2HRZA 4PLZA 1HE3A 4CQLA 3ZHYA 3BXXA 4MP3A 4XYEA 5CDTA 3PJDA 4EUHA 5IZ4A 1K2WA 3ZWVA 2DBZA 1PS0A 3ZWYA 3B6ZA 3K73O 3KYBA 4OMUA 1IYZA 1A7AA 3QWAA 2C07A 1UUFA 3ON5A 3HQ4O 4NZ9A 1NPTO 3Q6IA 4I8XA 2Q2WA 5DCYA 4LMRA 1X1TA 2NV6A 1PWXA 4C7JA 4CMIB 2EERA 3LC7O 1PJTA 4XA8A 3H5RA 3SJUA 3CMCO 1O95A 1ZXBA 4DBZA 5CAEA 1S6YA 4BGUA 5G0VA 5HBRA 1Q0QA 2C5EA 4N18A 1E7MA 1HL3A 2HMVA 3KOUA 4J16A 1HYEA 1ULUA 1MC5A 3ONDA 1A5ZA 1F17A 2CNBA 2AQKA 4CQLB 1ISMA 4RO0A 3VDRA 3E03A 1ZH8A 4NJMA 4YDRA 3QWIA 3DMTC 4KUEA 3EMKA 4NDNE 1F8FA 2V6GA 1IHXA 3L6DA 4BNJA 1O6ZA 4HBGA 4ZU3A 4PG8A 3A1NA 4PG4A 1ADGA 3KEQA 1GY8A 3U62A 4CMJA 4BKQA 2GRAA 1F12A 5C7LO 2DTDA 3WMXA 1VJ0A 2YQ5A 4IS3A 3DZHA 4Z0PA 5JMWA 3GVPA 3N7UA 3DXFA 3I9LA 2DM6A 4FFNA 1H9AA 1J0XO 3LQFA 4MIOA 5DP1A 4IUYA 4QEDA 4DPKA 4U6QA 2EV9A 5K6AA 3W8EA 1TXGA 2I3AA 1NQTA 3DZKA 4Q3BA 2NVBA 3D4PA 3PJGA 2P4HX 1ZFNA 3I1JA 4NK4A 3MJTA 4GAEA 3ZWAA 4B7CA 1EMDA 2VT2A 4RGBA 2P9GA 4AL4A 5CDUA 3V2UA 3BMOA 1SEPA 5L4LA 1A27A 1WAMA 3S1LA 2PKQP 3ZZNA 3OA0A 2JL1A 1FDSA 3CKYA 1FDUA 2P2SA 3GPIA 4J2HA 4W6ZA 1EFKA 2NWQA 3IDSA 4RDHA 4UVHA 3SLGA 3HE3A 1MXHA 3F9IA 4RVUA 1LDYA 4ZHSA 5IZCA 2HMSA 2Q2QA 3IS3A 4O0LA 1V3UA 4E33A 2VYNA 2GN4A 2X1HA 2YV2A 4YAGA 4FQ8A 5CDSA 2X0IA 2FY8A 4FN4A 4KOAA 2AXQA 1E0DA 2QHXA 4WGGA 2VHVA 3EC7A 4IQ0A 3OF2A 4TQGA 4CMKA 1DFHA 1LQUA 3SJ7A 5A5FA 4WCFA 4AJ1A 3D64A 3HB5X 3PYLA 4YRBA 1AXGA 4J43A 2UUOA 3BMOB 4XR9A 4L76A 4DC0A 1PGNA 1SCUA 3KVOA 3U4DA 2D8AA 1CERA 1GAEO 1PS9A 2WM3A 4ZQBA 4Z9YA 2OL4A 3GH3A 1W73A 1DAOA 4KZPA 1LRLA 2VRCD 3ZW9A 4B7XA 1GPDG 4P4LA 1NWHA 2BHLA 1R0SA 4J0EA 1B0AA 1I33A 2X5JO 4ZA2A 5I7SA 3A4VA 1F06A 2ZQZA 5ITVA 1MC4A 5IN4A 4LISA 2ZJ0A 1XQ6A 4M55A 3OEYA 5BT9A 4FJ2A 3D3EA 3WWZA 5A03A 3AUUA 2UYYA 3QHAA 2DC1A 1GUZA 5KVCA 1PJSA 2QRKA 4J1TA 5KKAA 3TZCA 1KYQA 4AJOA 4DQXA 4BOYA 2Q1TA 3UKOA 1GCUA 2Q49A 3HUDA 3NDJA 4WCFB 3V2HA 3ZDFA 2ZB8A 4YT5A 2O3UA 4P4NA 3TZ6A 4R3NA 4FFPA 1V9LA 3WNQA 5JAMA 4CV3A 3I6IA 4CV0A 4PZDA 4BL5A 4JGBA 1CRWG 2UDPA 3IMFA 3GAFA 1ENYA 3T7CA 1OC4A 1QG6A 1GYPA 1VL6A 1X15A 5DP2A 3IOYA 1ARZA 5EERA 4LMPA 3PJFA 2VWHA 2E82A 3UAGA 5JDIC 4WKGA 1LBEA 4UEKA 4DXHA 2CFCA 2F1KA 4OSPA 3VTZA 1WZEA 1LDMA 2TMDA 1KEWA 2P4QA 3ZV3A 1ISJA 1ZMOA 4A7PA 3DHEA 1E1NA 2XAAA 3RAJA 1T1RA 3INTA 2NACA 3GGPA 4A10A 3ETDA
chains in the Genus database with same CATH superfamily
1FMJA 3W2FA 3U9TA 4ZANA 1EUDB 4FCTA 3BWYA 4RS4A 3V8PA 1RADA 2EVWX 3MS4A 1VRWA 4RGVA 1J8FA 1QSGA 1ELOA 2BFFB 1GTVA 3AKYA 3O1IC 4RQAA 3UUEA 4I5FA 5FI3A 4LFBB 4LNAA 4P5DA 1FUKA 1YS1X 5FV7A 1SM4A 3BHIA 3CLTC 4HZUB 4Z4QA 2XQKA 2I7DA 4LCBA 4NL4H 1FPQA 5CXXA 2PTGA 1KMQA 3I28A 2HMYB 3IBTA 3AJ9A 4J75A 5CEEA 5KTOA 4L16A 4XB1A 1ML4A 4AZTA 1N7GA 1WHSB 2W37A 4J4HA 2OORA 3ACCA 3F5SA 5ABPA 4YPFA 3RYHA 2ISSD 4G4SP 1MDBA 4I19A 4KPGA 4URFA 4X97A 2YJNA 1MJGA 2W5UA 3JD0A 4JUBA 4DAEA 4ENQA 1T6NA 2YFYA 1NNLA 2FR0A 4OFWA 1SQGA 3USCS 1KQGA 3LDGA 5IK2A 5DT2A 3D6JA 1J39A 4C0SA 3EAFA 5IAOA 5EXDA 5P21A 3ER9A 4CM9D 2A1UA 4X93A 3FUWA 1VBNA 4L5CA 3WJ7A 4DARA 3GRPA 1ZOLA 3R7NA 4WA8A 3TTYA 2V7QD 1TT5A 3PGVA 3ZGZA 2WU0A 2Y1DA 1ZG3A 5M7EA 1WBJB 2JGFA 1I6MA 1UPTA 3R5HA 5AHRA 3O2QB 3ORQA 4OQFA 4ZVTA 3M6VA 1JJFA 3RNOA 5EPEA 4RHFA 3ZWDA 2WLSA 4LSMA 3K31A 4WZZA 2R8EA 4EJSA 1T5SA 1X86B 2FRDC 4NX2A 4PSUA 3S27A 1RRGA 2GCPA 3WKCA 2FP4A 1APBA 3FSGD 3EY4A 4ZT2A 1LNQA 3A6LA 2O20A 3IPYA 1BH2A 5K8VA 1UMCB 5F76A 1YH3A 3UHAA 5JCPA 4ZT6A 3CG0A 3VM6A 1DKPA 1KMIY 4HGOA 3U9LA 4QTUB 1ZL0A 2B0CA 4I9GA 2ZJYA 3RBAA 3SF8A 4BRUA 4G26A 2IKQA 4OG2A 4J1SA 1OD6A 4X3PA 4DWWA 4YCLA 4DQDA 1EGAA 2K6GA 3WJ2A 3A6FA 1MVLA 5CH5A 2XD4A 5H59A 2X2EA 5EP1A 3RSLA 2RBEA 3GLHB 3SYKA 4HNSA 3IFSA 1XE3A 3T3OA 1MB0A 1WDKA 3ZHTA 1KYYA 4KO1S 2AKYA 4ZTBA 3MINA 4S35A 1VI2A 1HUQA 4WZBE 4TZ0A 2GPWA 2ZI6A 4X1KA 1VFPA 3FVRA 2YIMA 3AG5A 3O2SB 3G9XA 2QW0X 5JBQA 1VSUA 3DTYA 3F7NA 3JWIA 3O8DA 5AH0A 4R69A 4K9DA 5EVCA 1KI6A 1NYRA 2COKA 4QTTB 4RESA 3RTGA 3V9PA 1IB6A 3NVMB 3EVFA 4ZOQI 5LKAA 4UVGA 4C3ZA 5BURA 1UJ6A 3ROEA 3QKTA 1XZJA 1NMEA 1NI5A 2C5HA 1J0DA 4WLUA 4FDAA 5EWLA 5KWIA 3O9MA 3V48A 3IHTA 4RL6A 3VU0A 5GIOE 3UMBA 2CDAA 1V25A 3USES 3KSMA 3W4IA 4MPJA 1PFQA 4PU0A 4HEA6 1Z2DA 4O1HA 1MNAA 4R71A 4HZIA 5E9QA 1UZNA 5F9HA 3HXQA 5F1YA 3H5NA 1E2BA 3M4JA 1B74A 1ISSA 3GI1A 2DTEA 2XT6A 4TKMA 4IZIA 1W5TA 2VHWA 4I14A 4EFDA 1D07A 2I2XB 2C4NA 2QX8A 4CIXA 2KBEA 4JLBA 1XLTA 3VR5H 4EHIA 3MRVA 1Y8RB 4AY5A 3WL7A 2JHPA 4A91A 4EI2A 4ME6A 4OXKA 2YJZA 1JIJA 1JU9A 5LD2C 1L8LA 1GA4A 4KREA 3SM3A 1NUTA 1NP3A 3IDQA 4TTAA 2JLQA 1M0EA 5TEWA 2NQTA 3A7EA 3DZFA 3OZVA 3E3MA 2AX4A 3NM4A 3JATA 3VZRA 4BBZA 3IXLA 1II8A 1DRJA 3H1EA 2JIZA 4WZAB 5ECYA 2H2DA 1BQ4A 3C7TA 1XXHB 4MB0A 1LTHR 2XQIA 4Q19A 5J40A 5IJ0A 4HQFA 1BVUA 1IEWA 5C46F 1L5VA 5YASA 5D51S 1J0CA 1N6OA 1UMKA 1MGOA 2FMXA 1U7HA 2PAFA 3K9NA 3KALA 5TX7A 2Q45A 4JL6A 1P44A 2HB6A 4JN6B 4XWKA 2QXYA 4C0QC 5LQDA 4X63A 1MA0A 3MZ0A 4EY6A 2QYOA 2JANA 3OLWA 4MCJA 3ZNOA 2FMIA 3QW2A 2R9VA 4CNBA 3G9TA 4G5GA 4ARUA 1S2DA 2RK3A 5DK6A 5ECDA 5I3CA 3K0CA 1VLQA 3Q11A 4QM7A 2Y0CA 4EF5A 2QNBA 1Y4ZA 4F4UA 1Q19A 1Z7EA 3EGDA 2ZATA 1OAOA 3JQPA 3FNQA 4ON9A 1UBHS 2CXHA 2WYOA 3NHFA 4GGMX 4RA9B 4F2PA 1UBTS 1TJ4A 1SXIA 2FE4A 3U0BA 1QANA 1ZMBA 2NO1A 4JSRA 4CR7A 1N1GA 5DTMA 4NOJA 4WOPA 2VZLA 4KGXA 1IEQA 4CDMA 3L0ZA 2A0WA 4WXEA 1QH1B 5FAXA 4O0MA 5I4CA 2ZUEA 1AJEA 1FSZA 2G70A 4JLOA 2CXQA 2WPDA 1Z2NX 5K01A 2JB9A 4IGAA 5B3KA 1PG5A 2G5TA 3L1HA 2X5KO 2B1GA 3AQ4A 1ZI8A 1UIRA 4KEAA 5IXYA 1BN6A 4IMJB 2JFBA 4GLBA 4NBUA 2BKAA 4F46A 1T1EA 4YRGA 4YMLA 3GCGA 4DMCA 1T4MA 5AVQA 3KELA 4BNKA 4B87A 4LJ4A 4PO9A 1D7AA 1EFCA 4EHDA 4MPRA 5KYUB 3B3JA 2O4UX 3S7TA 5F5LA 5M04A 1DXQA 1GKYA 4R2MA 3RVLA 5FDFA 3GMSA 1IJBA 1J56A 2PT7A 1IU9A 3D6NB 4Y6RA 4RULA 1WEHA 1GG2A 1GL7A 1REQB 5ALEA 4NZNA 4DIEA 1Q0PA 1R6XA 2XZOA 4M1TA 3IA7A 5FUVA 4BATA 2FRXA 3LPDA 4DB2A 5K0NA 1KOLA 4D5GA 1MV5A 2VYFA 4DMHA 1WPQA 2XRFA 4RE6A 1KMNA 3PF8A 4MH0R 2GXQA 2QN6A 2AOTB 1S0UA 3EVDA 1P9NA 4L4RA 3AVVA 1O94A 1JQKA 3SHVA 5K51A 4YYZA 3QPCA 3H3FA 3VHLB 3UAOA 2PH3A 3C7DB 4JQSA 5DXFA 3NYIA 2QVCA 3W6NA 4BMVA 1ISGA 3QIAA 4RZSA 3IOEA 4K9RA 4E4YA 1GGNA 1OA0A 1VJCA 1YQQA 3COWA 4MQ4A 5EFZA 2QZ9A 4H3HB 4EI8A 1HLGA 3STYA 2YVUA 1A9RA 1XZHA 1ZK3A 3Q2IA 1QHXA 1M8KA 1Y1PA 1NE2A 4EFMA 3II6X 1PYDA 1DEAA 1Z5UA 3W5UA 2C95A 4TL6A 3T3MB 1SWWA 3BCHA 4QHYA 3DFZA 4PZPA 1RAEA 4KWTA 5EZYF 2LIPA 1C1HA 1OXSC 5JMTA 5AVJA 4XYGA 3GWZA 3BRWD 2Y9PB 1NY5A 1TIBA 2OAP1 3KP1A 1KI3A 1NY6A 3FFBA 5CNKA 1WHTB 3HCCA 1NX9A 4Y67A 2IIPA 1L5HB 3AR4A 3RVJA 5HQTA 1P81A 4K7JA 3W77A 4E15A 3ZU3A 3SSOA 1Y1TA 1WXGA 2EFHB 5DISB 2JGJA 4HDMB 1R6UA 4DR1B 4K88A 1SFRA 3DJFA 3ZH9B 3KKPA 4B4KA 3I32A 2G6TA 2FFQA 1VG8A 1T25A 2ZTLA 2Y0EA 3A7DA 4UD6A 3VYRB 1EUQA 2Y93A 5ERYA 4Y0NA 2LP4Y 1MJHA 1Z2AA 3MYYA 1MEEA 4LI3X 1Q7CA 4D9NA 4CCAA 2A0XA 2YTZA 3OIVA 2G5GX 1CS0A 3HP7A 5TT0A 4OLAA 4BWGA 2GILA 3D02A 5DX8A 2ZPUA 3FHCB 4XCQA 4XGQA 3D1VA 3MT7A 4MCIA 5DVZA 4W9NA 2NU9B 3UT5A 4INPA 1R6BX 4U2EA 2O1EA 3L93A 4Y0AA 3VU8A 1T0IA 1E9BA 4B4WA 1EDOA 2FR8C 1PSDA 3LO8A 4U6SA 3IUQA 2FJ0A 3B6KA 2VYND 4A26A 4JUDX 4P7GA 3WYEA 5E8JA 3UWOA 4K9QA 3NP7A 3TECE 2QLTA 2QAJA 3H1GA 1M10A 2QUBA 4Z1MA 2QBYB 4LBWA 4OTZA 3UB4A 1NVAA 1E4YA 1TA0A 3HB4X 2ZSFA 3KQLA 4DSTA 4DV0B 4MA0A 5B7QA 3TZKA 4XTRA 1UBUS 5DGCA 3P0IA 1E2HA 1V8FA 5BUSA 3I58A 3ONFA 1GSAA 1XLUA 3OQVA 4KLZA 5CK5A 4KQ2A 5C8ZA 3GP5A 1BVYF 4PQGA 1ZMTA 1D2EA 2IEGA 1KDPA 4IUBS 4WNAB 1QTIA 1UDCA 1CLUA 1R4ZA 1WZIA 2XZDA 2ZYVX 3EIFA 3N76A 4JLMA 5H3LA 3VR3A 5JSQA 1SXQA 1L7NA 1FIUA 2ZXFA 3MTDA 3IAFA 1ZKDA 1VXRA 2Y0DA 3G2KA 2E9SA 4GX0A 3VC1A 3A06A 4B17A 1I0IA 2IU4A 3BDVA 5I7AA 3ROQA 2R6JA 1E79A 4AF7A 4JXXA 4TKZA 2X15A 4ETWA 2BKLA 2R4QA 1N2HA 2Z2KA 1FFBA 1TCBA 2F59A 2Z83A 3Q8WA 2QRJA 4AWAA 1ND6A 1GDHA 3A3NA 1A69A 4F04A 1B0PA 2G76A 1M2VB 4RDXA 3CF6R 3R9IA 1GKIA 1IHOA 3F4BA 3JX9A 1NBHA 1Z5WA 5ARDA 4K26A 4S1OA 3V1TC 1OFIA 3OM1A 4HD8A 4OV6B 2O8VA 3IHWA 2RGNA 1IXRC 4J90A 4IHJA 3BMCA 1IXSB 5IFLA 1MJGM 3RS3A 2RIPA 4XJXA 5I9TA 1FNBA 3DM5A 2GNOA 1ZUHA 4XCVA 2C2XA 4RNDB 2C57A 5M2QA 4Q5IA 2VFAA 3NUQA 3H2ZA 4JI5B 1I1HA 5CPBA 1IHYA 1ZBDA 2FPUA 3VOSA 2G9RA 1Q2UA 2J87A 4OP2A 4XSHA 4EB0A 3VNSA 1UL1X 3NV9A 4R2KA 2CFTA 1S96A 4WZ6A 2BFAA 1R74A 3O8QB 5BRAA 2F4VB 1O89A 1QH9A 1YK0A 4PNEA 1ZJYA 3TF5A 4IIXA 1V3QE 1HNZB 4QODA 3ZW7A 5J23A 1NC1A 1LBHA 2OD7A 3D8TA 3DR3A 3FUXA 4MVJE 5PNTA 5EJ5A 1SQ6A 2NO9A 3EQZA 3PE6A 3COYA 1OLSA 4XUDA 1JSCA 4D9GA 2J67A 1JW9B 4BZXA 1NHGA 1Q3KA 4R41A 1C0IA 1MOSA 1OLXA 1JLHA 3L0SA 5GIPE 2X2PA 1VDMA 3V97A 3NBAA 4ZI7F 4RDCA 4DSUA 3T7KA 5IVPA 3I3SR 5ALIA 5D3MB 1E9EA 5BRJA 4ND3A 4L8GA 1KZ1A 3SKXA 4KPFC 2OHVA 1AO0A 2J4FA 4CLOB 5LD2B 2QX9A 1C29B 4JLPA 2IX9A 3V00A 3WNBA 5BT8A 4PHTA 2JEZA 2OQVA 7YASA 4R1OA 4PZ9A 4Y1EA 1QFYA 1SEVA 3DFIA 3VC7A 1B3RA 3ER6A 3PEFA 2QPLA 1OFGA 3MPUA 1Y6FA 1Y5IA 1ONOA 1RBYA 1XDWA 4WBSA 3UOGA 2J3JA 3ESDA 3LGAA 3L6CA 3KQUA 2BFEB 3EN0A 4FX5A 3U44A 4NU8X 2DBQA 4P38A 1M34A 2UYQA 3B7WA 3OQIA 3QXJA 4ALLA 2BFBA 2HKIA 1XROA 4L3WA 1PZGA 4FE7A 2O1XA 2B20A 1U1FA 5INTA 4NCIA 2IPOA 2RCYA 5AVWA 2HM7A 3R0XA 4BV9A 5EIBC 4BEWA 2JD2A 2ZUBA 1YOVA 4XUGB 3BQMB 5HCIA 2ZKLA 3BA6A 3WB1A 2ENUA 3FMPB 1YDFA 4RPKA 4WLFA 4MIEA 5HG0A 5DNDA 3ZCPA 5I9BA 4AJHA 3MGAA 4WK0B 3DF9A 2VBGA 3PTZA 4TWJA 3KETA 4ZZ1A 4UEWA 1YHZA 5FBVB 4L2IA 4LJKA 3SKYA 5KC8A 4JVNA 1E62A 4ND5A 4BQPA 4YMHA 4C30A 5HIJA 2P2YA 2Z04A 4C0XA 1FX1A 2VHXA 4OK6A 1XYGA 1UBCA 3RFUA 3CLRD 5FLKA 5MHTA 4OQNA 3HP1A 1HURA 1RAHA 1SC6A 4XDGA 5FBRB 3ZD9A 3MJ4A 4NU6A 1YVPA 3OCZA 2BGRA 2GWRA 4YV0A 1ZD9A 1WMBA 3RLFA 2PNFA 1ZNXA 3WYDA 1UP6A 1EVYA 4M1QA 4PE5B 3ANTA 3KHUA 3BKXA 1V8PA 3O95A 1NXOA 4G0PA 4QARA 4XX0B 4ZRDA 2P77A 2JAXA 2P11A 1KEEB 1VTKA 2NUPA 2G17A 1ODIA 4DILA 1EFRD 1DO8A 5JCJA 2WYIA 2VH5R 3ZGXA 1ZW6A 4BO4A 1HYQA 2UYHA 1AM4D 1L7MA 2LWIA 1SCDA 3HXOA 1TA4A 1YVEI 5SV2A 4JYMA 2AD5A 2OBNA 4DLLA 2QORA 2IE0A 3E22A 4J7AA 4BFYA 4XYMA 1KS9A 2Q4TA 3DYIA 4GEKA 3AUSA 5ALDA 3ZV7A 3HY4A 3QXCA 3C98A 4IJUA 3NEAA 1CUUA 1JG3A 1W75A 3RUPA 1SKYB 2YFKA 1F2VA 5IC4A 5HILA 3WLKX 3CTMA 1YAHA 2IU6A 3BERA 2CK3A 2ES4A 3HI6A 3IP1A 4X61A 4XWTA 1A77A 3GRUA 5KQPA 5DLYA 1ACMA 1P74A 4IRUB 3R6DA 1FDOA 2YWGA 2Q07A 1HTWA 2GCNA 2ZIEA 5A71A 3T3GA 5JC1A 3N05A 5C7IO 2HJWA 4AYTA 4F56A 3L8HA 2G7ZA 1EDDA 1G21A 3O6VA 1KC3A 3AM4A 2YIVX 4FI3F 4I50B 4ZKEA 2AR0A 2O6HA 2Q1XA 1MBZA 3OPQA 1QRSA 3WGMA 3O4GA 2P1ZA 5HKBA 1HE8B 4DTIA 2C96A 2HJRA 3EBLA 5TJHA 5KNBD 1U9ZA 1VZ2A 4NEGA 3SFVA 4V3BA 4WK6A 2QSJA 4GO1A 4YJFB 4YMGA 2KHZA 4PIMA 1RC0A 16PKA 1QZZA 5EXEA 4EYGA 1VYTA 4NCNA 5JSZA 1HZZC 4XCXA 2I1VB 1TZCA 1QUFA 2NT4A 1Z5ZA 3WG9A 1MHPA 3VO1A 3NGXA 2SHKA 1K06A 5AI6A 3H1BA 3WAJA 3EE6A 2WDZA 3I6MA 2FQYA 4JXKA 4ACBA 1TJNA 2R8RA 3OPVA 3H05A 3ZU6A 4DLAA 4UVEA 1VL8A 2G3YA 2J5RA 1FFEA 4B4UA 4EB6B 3ZGVA 3EMBA 4LYYA 3T7JA 1XZAA 3DC7A 1QK3A 4FB5A 2OY0A 3PNSA 3Q5GA 5FKJA 4E1VA 3E9RA 5EJGA 4KXUA 2YZNA 1MOPA 1LQ2A 1U8ZA 3AW9A 1V71A 1JVBA 3ILYA 4DCTA 1JHRA 4WNIA 3MWYW 2EGUA 3L8MA 4CLDA 3DBHA 3U09A 1EJ2A 3THWA 2I4OA 3L7LA 4MW5A 1J4AA 1UIMA 3P0JA 3PVCA 1FBNA 1JILA 1VLZA 3BFPA 5KCMA 4E5YA 2AJCA 3DONA 5B37A 2Y68A 1X7GA 1FZQA 2Q50A 4JY7A 1QIIA 3I6ZA 5BP7A 3AI3A 2Q5FA 1OI2A 3JYPA 4DR5B 1UWKA 3SBEA 3PICA 1XELA 3PS9A 2WRZA 4Y6LA 3B78A 4URVR 1KAGA 4MSUA 1PJCA 3CF0A 4Q1EA 3H17A 4YB8A 5FORA 5GPBA 2YXBA 4L9WA 3RRFA 3AHJA 4C1NA 3I62A 2DHQA 2H65A 4CT0A 1TTHA 4YO7A 2WV9A 1XPOA 5JVDB 1UBEA 5K0CA 2CJFA 1D2RA 3BTUA 3FWZA 4YUXA 5L3VA 5IABA 3HSKA 4GR9A 1XYYA 1T3HA 5EPOA 5HK9A 2QUHA 1E2UA 2FFJA 2W2OA 5KJCA 1KOFA 5CX4A 4TMZA 3TM4A 4FINA 3AOEC 1JA1A 4KR7A 4UE2A 3U4CA 1OPXA 1K7XB 4M37A 2OCLA 3G9UA 1PGOA 1W4RA 2YWFA 2Q4BA 3LH5A 1J2JA 1XYVA 2XF8A 4NJEB 4RV5A 3ENQA 4LXYA 4UUNA 4PC6A 3HM2A 4PG7A 1NNEA 1N9GB 4HG2A 2CZCA 4UPDA 4UQPA 1IOZA 3IIMA 3JD3A 4B84A 1ZUD1 4HXEB 4LRTB 5AOAA 3V7FA 2JVKA 3MF4A 2JF0A 4EY3A 4OXIA 3B38A 3TZEA 4CVNA 4LQCA 1R4NA 3G2JA 4INJA 2IEYA 3FRHA 5EQFA 3PI7A 5B55A 1ENPA 4OI4A 2DOKA 1JKIA 4G86A 2WF8A 3AR7A 3JYOA 3UO8B 4PLPA 4NFLA 4P36A 1EIWA 1DJQA 1QO9A 3FZQA 1JSRA 1M2OA 3A6GA 1KK1A 2CXSA 3P2YA 2DFNA 1DQSA 2QMOA 3L0PA 5EZYA 2GSWA 4H0NA 3UH0A 1AOXA 3L7IA 4LQDA 3LXXA 4JI8B 4ARZA 2D5LA 2ACVA 1IBKB 3VR2D 3W4KA 2JLWA 4L28A 4P80A 4GPTA 4BWFB 2OFPA 1EE1A 2FX3A 1IOVA 3FRJA 3KLOA 5I4IA 4PIVA 4KLRA 4BN0A 3NJ4A 3U3OA 2IH5A 2HA7A 3O8LA 1U7UA 1TKBA 3ZEIA 1GPKA 3VC3A 2VHQA 2ZSUA 1K7FB 4Y1FA 4MHTA 4BMPB 4Q4HB 3EAQA 1SUBA 3CINA 1Z8FA 2AUNA 1KMMA 2FP3A 1OVGA 2JGLA 2XQJA 2YWDA 4OUKX 3C7KA 4KYVA 3N5CA 1M67A 2AN9A 3GG2A 5IM4F 1VJ1A 5G0TA 1VLVA 2NPIA 3HFSA 5D6OA 4YUZA 3T95A 1JUDA 4I9NA 1JIIA 4A16A 3FF4A 3Q8XB 1DWPA 4I99A 3GY0A 1CF4A 3FMGA 1OJLA 3KYJB 2PDAA 3KSRA 3K2QA 1J2RA 1RLUA 1R8SA 1NPDA 2P67A 1QAMA 2Q6TA 2VRWA 2P0AA 3IVRA 4Q0MA 1J1ZA 1GQ2A 3R44A 1SUPA 3EEOA 1XEFA 4PC7A 3WMRA 3JQ8A 5FWYA 3FBWA 1DQZA 3EPRA 1Z4KA 2Q5QA 4LG1A 3REQA 1MRSA 4ZO4A 2GN8A 3QBVA 4RCVA 3ORFA 5FLXA 2FG7C 4JI3B 4L7QA 1KVRA 4EA8A 2X9GA 4M99A 4IJQA 2HRQA 4JKYA 3CVWA 7ADHA 2IHZA 5EN4A 2W2KA 3E1SA 3TLJA 4CCYB 3D6FA 1RU3A 3C97A 1K4MA 3GT7A 4H1HA 4BQIA 4EEZA 1D1SA 3ZX4A 5FUXA 4EHAA 3MOIA 1DRVA 3EWSA 3FYTA 5U1PA 2A57A 4AJJA 1S8AA 2OG2A 3SPXA 4B8ZA 5BR7A 3I1IA 5ES3A 3WGNA 1V47A 5TIIA 2RG1A 2FTKE 3BA1A 2BRUC 1B8UA 4KQGA 3OC0A 1O9BA 3L0BA 5CD9A 2HO5A 3GJSA 3LYUA 1W87A 4OGLA 4TL7A 1Y34E 4DM3A 4AS1A 2X0RA 2QN3A 2D59A 2O8FB 3ZWWA 1FYXA 4JI4B 4MI3A 4EHNA 4H31A 3RRYA 3NI2A 4ZVQA 1QMPA 5T6MA 1N2CE 2VNSA 2WKQA 1Y4SA 3AUTA 4FDVA 4BMCA 5BPFA 2FPKA 3WO0A 3KKOA 3RC1A 2VH1A 2DEUA 1XNRB 3OZDA 1O96B 2PX4A 3AF3A 4IWNA 3VNAA 4DYVA 4FFMA 3UA3A 2FX2A 3JARA 4OLJA 2PG3A 2JGKA 4M7OA 1DJMA 3TGLA 3QVLA 4DREA 4DXDA 3DLIA 121PA 2AT1A 3C5CA 5JH7A 1N5IA 5EMMA 1IK6A 1U99A 2PGAA 4QGGA 4JQOA 1U4NA 1TFUA 5IARA 4BBJA 5J1SB 3SJAA 4FSDA 4NEHB 1G4HA 5JJIA 1C7FA 3IBSA 4ZXPA 4HDSA 1EHCA 1ZD2P 4UXHA 1E6MA 4CKEB 5B6JA 2IYOA 2HU5A 2V9ZA 4HN4B 3SMQA 2OC9A 1H1LB 1RT9A 1U7WA 2W6PA 3PWSA 4A0RA 1OIVA 5DNUA 2N3ZA 4NABA 4UCQA 3O26A 3OEHD 4KYUA 3ZWKA 5HWSA 4HLUA 5JZSA 2OE2A 2PUJA 4EQ6A 3CPSA 4KIJA 1FFDA 1USUA 3FVVA 5JDCA 3TYXA 4REQA 3QE4A 4C7MA 3KSAC 3TRFA 2LDBA 1EPUA 3I61A 1XZCA 4FYJA 3RKSA 1D3AA 2XUFA 5T4EA 4WBNF 3RS8A 4BO8A 3H13A 3WWEA 3FLAA 1TEVA 3LUGA 3C1OA 4KSBA 3AIMA 4YMVA 1NJ8A 4E7PA 4J7UA 3PZBA 3I12A 3UIEA 3R9WA 1L7AA 1LX6A 2OOKA 4Q3NA 4R2JA 3BL8A 4L8VA 5FWDA 2J3MA 1V41E 3RRNA 1R15A 4PPQA 1UJCA 3WNCA 5KVQA 2Q7DA 1SD1A 2XT9A 1PWYE 3HY3A 4GSLA 3NASA 2FAXA 2FGKA 5D3KA 1EWKA 4K2HA 1JNXX 2HCFA 2I6FA 3HDVA 2Z57A 4TXLA 4N41A 4Q9AA 1AKQA 1E9SA 1F14A 4O4IB 4R9VA 4RJLA 4UCXA 5FBLB 4D6PA 1WZ2A 4OGFA 1T6XA 4L5AA 3LQKA 5KWJA 2GBIA 2Q5LA 4B35A 3IJRA 5TNXA 4D25A 4MI6A 3G5MA 2VSXA 4M9CA 5BSRA 1LSJA 1OC2A 1ZMRA 1RQXA 1W88B 1GLVA 2NX2A 1QZXA 3B85A 1PQYA 10MHA 3AB3A 3QJGA 1Q16A 4U9IS 1H42A 2NZJA 1H65A 2QG6A 3O4JA 1JG6A 1XTZA 2R6FA 2YZMA 1U63A 2CLIB 4G5SA 2NTYC 4BV2A 2FSIA 1GTMA 1FMCA 3DZJA 4INZA 3DL0A 2C4VA 2XGGA 3ZU2A 2ZR9A 5KOHB 2F9LA 3MRSA 3CYFA 2LCFA 4GOJA 5CURA 4DLPA 1RXVA 2JGDA 4Q37A 2A9JA 3NTLA 4K9SA 3IV7A 4UCFA 3S40A 5A62A 1M74A 1IOLA 1Q1NA 1QKIA 5BNFA 2QVZX 4WJKB 3STWA 2BI8A 4KGZA 1PVVA 3HFJA 1PLKA 5TQ0A 1E7SA 1NWCA 4ZVSA 4BCCA 1DMSA 4L15A 2GK3A 2AOUA 3NVDA 4GNKA 4YLGA 3WIOA 2QZPA 4XH9B 5CDFE 2E55A 1J00A 1G20E 4OEHA 1EZ4A 4JJ8A 2DUUA 2X1VA 1QJ4A 1N1DA 1X7WA 1P0MA 3UMFA 1NF3A 4R8KA 5HF9A 3VAAA 2XCTB 4MLZA 1CHNA 3OOYA 2G7MC 4TVOA 2XNKA 5ECGC 3VOAA 4AK9A 1NM5C 4OHYA 2ZI3A 4B2YA 3HKBB 3HDGA 5I4BA 4Z4GA 1K3TA 4FR5A 4H6PA 5EA2A 1DAEA 5IAAA 2B21A 2WW8A 1W46A 2HDWA 3SVLA 1GDDA 1SXGA 5LFAA 1XMXA 3EUWA 1BW9A 1KETA 3W8NA 3DOJA 1NT2A 5GZ6A 4CF3A 5IDQA 3WDKA 4DG9A 4ZP1A 3DFMA 4E08A 1K5DA 3B1KA 3BX1A 1EE9A 4PZUA 1XAJA 4OYYA 5CYOA 4XRGA 3QA3E 5B3LA 5FRDA 5JS2A 1SOMA 5JDIA 4LGYA 1KAMA 2AC2A 3U7FB 3H5AA 3NRBA 3FYDA 2VP3A 3GEDA 1RHQA 3G8CA 1MPTA 5CJ2A 3K9HA 2YS7A 5LUAA 4PANA 5LZ5A 2R7MA 5JISA 4E5NA 1TYBE 1EFDN 2HRBA 1WQ1R 3BDAA 2ATEA 1P5RA 2IEAA 3E27A 4OQQA 5AM4A 3V4OA 3OX3A 3PKZA 3P20A 1TTQB 2C58A 3K6SA 2NVOA 2Z1MA 3CH7A 4RTQA 1JLSA 1SUSA 1C3OB 1YBFA 4AP9A 5CJPA 3HACA 4WKOA 3QUCA 2IV3A 1PL6A 4BFWA 1AH2A 1TD1A 4QGBA 4ZTZB 1OT5A 3EGXA 3LUCA 1H2ZA 4M1SA 2OGSA 2JDIA 1EYZA 2QVBA 2H0AA 3DTVB 4ZEWA 1WY5A 4WTOA 4QSHA 4ETMA 1QJCA 3NHZA 4BFVA 5DX1A 2NU6B 2X0EA 1JPVA 3HY6A 3UJ6A 1G3MA 4RAOA 2QQFA 4PCUA 3EB9A 3EMDA 3WLAA 2C8KA 3PK0A 5SZHB 3TXXA 3A2NA 3VR5D 4ARIA 3K09A 1QVVA 1XL1A 4NNJA 1Q91A 1YOBA 2AYXA 3G88A 2OV1A 3D8UA 4GMKA 2IYXA 4GW3A 1GQSA 2EZ9A 3JRXA 1JSZA 2MU1A 3DBIA 3ADDA 1Z35A 3Q7QA 4FR0A 4G5YA 1KPGA 4B80A 3A4NA 1CDOA 1FDIA 1NVXQ 1SC9A 3JQRA 3RAGA 2VCHA 1SCAA 3NHWA 1M5TA 2ZIAA 1Y6ZA 2HPZA 1A9QA 3VZCA 3CT6A 3LE8A 4Z1OA 4WZBB 5H82A 2D5AA 1G7CA 4QQFA 3DUFB 2PX0A 3LDHA 1FVOA 5C4GB 5E7JA 5COBA 5DWDA 4I5IA 1N7IA 4DL9A 4QOSA 3AINA 4UMDA 4FGWA 3QG5A 4AJEA 3BH0A 2IXFA 4F8EA 2GJ8A 1OYWA 1TQ8A 1PGQA 2Y1FA 1IULA 2EBWA 2WWRA 3G2OA 2FPMA 1U1IA 1NMZA 4EIWA 3DT8A 3ZK9A 2HBRA 2QAGA 4QUAA 4H77A 2PTHA 3S68A 2ZSJA 4K81B 4IJMA 5A2QA 4IQ8A 3LRXA 2IVZA 2BGLA 4X90A 5DO9A 3QX3A 1W6RA 5UKDA 4MWEA 1K2VN 2QTZA 4EG8A 1M5RA 4MV4A 1V4NA 3HBFA 3T3IA 4AFNA 1NDQA 1P6UA 4R2LA 3OA2A 4CFSA 2QLLA 4EYSA 2QY6A 1KEUA 4HH0A 4K46A 1II9A 3LUFA 4TMKA 2BFWA 3RJ9A 3WL3A 3U19A 5HTOA 1FFYA 3GDOA 1HDGO 1M2WA 3IMKA 2DFVA 2JGMA 3L4BA 2J0EA 3NH6A 3GLQA 4IV8A 3I09A 3W78A 5MFPA 4JB0A 1H0RA 3KHKA 1BDBA 3NTUA 2OYCA 2EZUA 3DMGA 3QVOA 4DMUB 4JP2A 1WMAA 2A88A 2FSVC 4G1CA 4Z3KA 1G19A 2CYCA 2PRJA 1C7QA 1RQGA 1UXJA 2AMFA 1FS4A 3IEIA 3KM0A 5KVSA 4QVIA 3HJGA 2BFNA 2AWOA 2R85A 1ST3A 1B4DA 1XGKA 4JJEA 4CE6A 4Q1VA 1G5FA 4V0SA 3GNQA 2TECE 1YASA 5CLJA 2AR7A 1B00A 4GYYA 3DEHA 4HQRA 4UBKA 5HCNA 2PIDA 5AK4A 4A6PA 4KDFA 3G5TA 3IAS6 2VHTA 5EWMB 4OI0A 2MSKA 1ZMXA 3LK7A 1TM5E 2ZAMA 3VGPA 1QFXA 4WFIA 1UT5A 1SWVA 1KBZA 2COEA 2E3JA 1P1JA 1E2QA 2OZLA 3K15A 2ATXA 4LC1A 3FPLA 4XWYA 5DPMA 2H59A 2VDKB 2XKBA 4J3NA 4EKDA 1X7HA 3TG2A 1DUVG 2FLWA 1VE9A 5EKSA 3TTXA 4N0QA 1K0UA 2RGYA 3SR0A 3EZFA 5KIAA 2WUGA 3I2YX 4AWXA 3LHSA 5AHWA 4MQUA 4ALJA 1JJBA 2X0JA 1QQAA 1NBWB 2B2NA 1BGXT 2JFHA 4C6RA 2F1HA 1EI9A 1NMYA 2IYRA 2XMGA 3IAM6 3MIZA 2CHUA 2VYVA 1CYDA 4LKOA 5AJYA 3Q8MA 3SAJA 4CKWA 1DC4A 4NP6A 3HDTA 1D1QA 1P7CA 4H59A 3V8QA 2VG8A 5HMLA 2KW5A 1SC1A 3WDSA 5J2UB 1WZUA 3BXOA 3TZLA 3KUXA 2A2ZA 1U9IA 1K6JA 3EZYA 3OJEA 1PWEA 4K9NA 5NLLA 3STUA 4WJZA 5GM1A 5FH9A 3FA2A 3A11A 2ZREA 3EVGA 4W6QA 3W3AA 1DWOA 3NM5A 3LBIA 2JZCA 2YWXA 5ENDA 3CIFA 1BG6A 3ICPA 4UZSA 4G97A 1ODJA 5EIFA 4G0NA 1IHPA 3MS7A 3GO4A 5HZGA 3SHTA 5I7OA 2MSWA 1BWPA 1FDRA 1VC2A 3ZCQA 3AVWA 1IN1A 4NBTA 1K89A 1EBFA 4B4OA 4B48A 3B1YA 2R79A 3M6LA 1E6CA 4H3VA 3EDOA 4Q1DA 1X9IA 2Q3JA 1DO0A 4LF4B 1VCOA 4BC1A 1K8YB 2I4TA 4NH0A 4XDZA 4K28A 1AQIA 1PG0A 2FMUA 4GOMD 3VO8A 4AKSA 1IBMB 4DKJA 1DP4A 2I67A 2XNDA 1G8YA 1BEZA 4JQCA 4UNQA 4IOJA 1H4QA 1JLLA 1GV0A 1PGJA 1DV2A 4EUFA 3WYBA 1SIBE 3LVFO 1GZVA 2BF4A 4ZDIA 1W5BA 2HBZA 1IM2A 2JGNA 3P2IA 3I0NA 1EX9A 5BSFA 1RPZA 4ZMRA 4MQEB 2I2WA 2CUTA 2X19A 1HT0A 3B20A 1QRDA 1X80B 1P2VA 3BH6A 4QU0A 1NUQA 1KNXA 2GX6A 1Z9BA 3IQZA 4OA5A 3SYNA 4CTOA 4RY0A 2C2GA 4PGFA 5DASA 3AL3A 1GKKA 1PTJC 3H5WA 3VZQA 4DQ0A 4DUZB 4F60A 1RYBA 3M33A 3HWX1 2YY5A 4R81A 1JHXA 4CIYA 4QBKA 5JROA 1F6DA 3Q40A 1Y9AA 2BTQB 4ZD6A 1DS6A 1TEXA 3FWYA 2O2DA 1R0CA 3KOYA 1IUPA 2QLNA 3RSCA 3TAUA 4LWZA 4TMFA 3W05A 3ZHXA 3RB8A 3IEUA 1D9ZA 2IP4A 1YIAA 2EKQA 4MGHA 3H0KA 3DCJA 3I0MA 3G0OA 4UEQA 1S9DA 4B3CA 3IUNA 2NXWA 4J7CA 1MO4A 2NO6A 3IMEA 1JDTA 1SRRA 4FC7A 4OJKA 3UJCA 1XEXA 3A9WA 4RFSA 2PY6A 4R7GA 3VYVA 3FZYA 1NQ5A 1XC7A 4G9BA 1XQVA 4JL8A 3LF2A 1QP4A 4KHPB 4W7SA 1A76A 5JC8A 1X8KA 3KB8A 3O3MB 3ZE2B 4Y7CA 2ODAA 2JCXA 4ALKA 2OKGA 1GNSA 1HR0B 1G7SA 4LJLA 1MU0A 1DE0A 1GRCA 1X1DA 2FZKA 3ND9A 2VK4A 3SDBA 5B58C 5IEBA 5JNLA 4MA4A 4P08A 2QN8A 4YRPA 4BZPA 1VKJA 5C3MA 1E9CA 1ZBQA 2GMWA 3QE3A 3L4EA 5HPYB 3EZ9A 4M21A 2KPOA 2AG0A 4IW3B 2EWVA 4LRWA 2AFHA 4ZVLA 4FOLA 2YVLA 1OW3B 4MKXA 4O29A 4OU5A 4IXMA 2HIAA 1QP0A 5AW0A 3I2IA 2E5WA 3KJXA 4G4GA 1Y5MA 2P4EA 2W0SA 5JD5A 4JYPA 2P5YA 4URUR 3HJAA 1H94A 1WW2A 3E05A 1OSNA 3K0EA 5C7OO 1LSUA 2X77A 1Q0TA 3U31A 3FSRA 3N1UA 4LC0A 4G5OA 2C4WA 4JMPA 3VSEA 4LFAB 2NQ2C 3L8GA 4BNXA 1UCFA 2VA9A 1S2LA 3GGOA 5CYPA 2TMYA 3OE1A 3COJA 2H5EA 5JAQA 3QNWA 3K4HA 3LC0A 1DAMA 4L6AA 4UPVA 4C0KA 4L22A 1RCUA 4MAAA 2HPHA 2VPXA 5MN5A 1CIPA 2WA2A 3VPXA 1WXQA 3WL6A 2PS9A 2W6NA 1N8NA 1EVQA 1XUOA 2ODWA 3A4TA 3AYXB 3I9OA 1ULTA 3HLTA 4DKXA 4GL4A 5JI3E 3MELA 1OFHA 3ZK8A 3JVEA 4QBIA 3NB0A 2E4ZA 1Q0HA 4Q4AA 4ZT7A 4PM4A 4GZ6A 1E2NA 4JLJA 3DFKA 1O6FA 2ZB2A 4JBHA 4OHCA 4K0RA 4OSOA 4QG3A 2I62A 4RTLA 1DEOA 4E03A 1SUCA 2G5PA 4UHHA 1AX9A 3A3YA 4FGKA 5HFJA 1L5NA 1JKJA 1NQOA 2OFFA 4LV5B 5BOSB 4MW7A 4TVBA 2WPNA 1D2GA 4Y6PA 4IFEA 3W5IA 3ISJA 4TYQA 5JZBA 4EI7A 5DSTA 2UZ4A 2C5SA 2BBTA 1CVLA 2LXNA 2X6RA 1DWQA 5H0IA 4BB9A 3K9QO 4MTLA 5HGXA 2IF2A 4O08A 2JJ8A 3F46A 4R16A 4Y2RA 5I9NA 2N42A 1EXWA 5LSAA 3RWOA 3CE6A 3M1LA 3P4UA 2A35A 1CC1S 2JS7A 1MX3A 1P9LA 2WF5A 4IQ4A 3P0FA 4DLSA 1AQUA 2XQGA 1XTKA 4MS3A 2YHIA 2WA1A 4PTYA 1CY8A 2Y1OA 1GUDA 1NFRA 1ZD4A 2INGX 3EVCA 3P32A 5JWRA 2W6MA 1EVJA 3VR6A 1QO0D 3L7BA 2XQFA 3O47A 4WFJA 2DH6A 2YXDA 3TR6A 2FPXA 1CP3A 4Y8VA 3PNMA 4DEVA 1JHVA 3HZZA 5HX7A 4QSMA 3X43A 4EL0A 1AHPA 2ZVPX 2UZ1A 3BK2A 3T1NA 3I2GA 4CHGA 2FPGB 3V1YA 4C08A 5FTMA 3WR5A 5L95A 2GZSA 5ENZA 3EAGA 1NW5A 3FTEA 3ICQB 1NI4A 2K7ZA 1K97A 2ID8A 4J49A 3THRA 3EFBA 1P0CA 1YJXA 3B7GA 3BILA 4IJWA 4YMTA 5KYXB 2RE8A 1H69A 1T2FA 1XD8A 3HN7A 4GKAA 4U9HS 4WDQA 5FQNA 1DBWA 2PGXA 3Q0EA 3SE0A 3EXG2 4RZUA 4AZ3B 2ZRPA 2GXUA 4M46A 1BVRA 5EVJA 4UHJA 1UJ2A 1XD2A 3S1AB 4DIFA 3JPWA 4ZCMA 2YV1A 3H9JA 4TMWA 5CM9C 4MICA 2NSLA 3IMGA 3BE4A 3ZQUA 3BFJA 2YN0A 3FGNA 2K7FA 1ZCZA 4ER7A 1KYVA 1K6IA 2BKEA 4X1OA 4NMWA 3W5HA 4Y1RB 4CEJB 3AEQB 5DHTA 2D3TA 1Z6ZA 2JHFA 2AFIB 1P5JA