2QHXA

Structure of pteridine reductase from leishmania major complexed with a ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
264
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Discovery of potent pteridine reductase inhibitors to guide antiparasite drug development.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 96
structure length 264
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qhxA00
2Q4EA 1DFGA 3KUXA 4CMHA 1PS0A 4BO2A 4CMKA 2FY8A 3U49A 3HJAA 3RKRA 2JD2A 4CODB 3RIHA 3D3EA 1DFIA 4Q3DA 2X7HA 3JQ8A 2OHXA 1P74A 3B20A 1MV8A 4D0RA 3NJ4A 3C7DB 2AEFA 3OA2A 2J5KA 3ORFA 4FBGA 4J7UA 4W9NA 3ADOA 3PVZA 2JAPA 3PI7A 5THQA 2VN8A 2I76A 1Z7BA 5JY6A 3VOSA 2VTDA 4IDFA 3DQPA 2PGDA 5JAMA 5G4KA 3Q0EA 5TSDA 3SC6A 3TZKA 3ZWAA 1GR0A 4W9NC 1ULSA 2QZ9A 3NTQA 4BKOA 4HWKA 5LDHA 2P5UA 2GF2A 4CPDA 4KP7A 1W0CA 2Q1TA 4GPD1 1LDMA 2QRLA 3DHNA 4CMGA 2NU9A 1V0JA 4JX8A 4MINA 2EKLA 3PLNA 4ALJA 3INRA 5JYEA 2OP0A 3K2BA 1HTBA 3LF2A 3K96A 1Y81A 2VT2A 2HRBA 1I33A 3LK7A 1N7GA 3H8VA 1A27A 2AEMA 5COBA 5L95A 1TXGA 3GDGA 4WNCA 4RLHA 4H7PA 3UUWA 1JAXA 4AJNA 2Y1DA 3NUGA 3DC2A 1CEQA 5I8WA 1DSSG 1LQUA 4AFNA 1VL0A 2HJRA 1C0PA 1X7GA 2IODA 3OMLA 2QW8A 2GDZA 1N7HA 4KDFA 4XRRA 4Q3EA 3P2YA 4XYMA 3UCXA 4CLOB 5IDWA 1WXDA 3H9QA 3DEYX 1KEVA 3KLMX 3CSDA 4FFNA 7MDHA 4FN4A 3MJTA 4NJMB 4I9NA 3HNPA 1I2ZA 1J49A 3H9GA 2E82A 5EQFA 4WJZA 5FI5A 1XSEA 3UCFA 5COAA 4WKGA 4CMIA 3G79A 3PDUA 4Q9NA 2YV1A 1YOVB 3I9NA 3KOUA 4OOEA 1H6BA 1DC4A 1V3VA 3HDHA 1ZK1A 4NPCA 5ER6A 4AJEA 1E7MA 1Z6ZA 3C3XA 1VL6A 1XQ6A 3GPIA 1PJLA 3BMNB 4CQLB 3PZRA 2O2SA 2O3JA 2JCYA 4Z3DA 4CM8B 3P2OA 1UDBA 4FS3A 5DNAA 3MOIA 2HAEA 2Q46A 4OXYA 1C3VA 1SZJG 2VYNA 4DBVO 5KJCA 4LRTB 3S8MA 1NASA 2GERA 2PR2A 4PVCA 4RVHA 3HB4X 2G76A 1TA4A 3EAGA 4LVUA 4CMEC 1N8KA 4XR9A 4YRAA 4GMFA 3ZWBA 1T4DA 1YBVA 3QWAA 1GFSA 2X9GA 2O3UA 3GEDA 1EDZA 1ZSYA 3DBLB 4R5HA 3OJEA 4GX1A 1YL5A 1IPFA 3GY0A 6LDHA 8LDHA 4ZQEA 3LF1A 1C14A 3FBTA 2VRCA 2RBEA 1EVZA 1PGOA 3HZZA 1NWCA 4GMGA 4N54A 3M1LA 3EDMA 4HFJA 4B3IA 4AVYA 3H5AA 3VHRA 4JBGA 1ZK4A 4DXHA 1UAGA 5IDQA 1HT0A 3NKLA 3WYEA 1HYEA 4OAQA 4AJ4A 4N5NA 5IAAA 3WTBA 1IPEA 1IL0A 3NT2A 4QX6A 2HCTA 3IJPA 1E3JA 2VUSA 4XQGA 4WEQA 4ZQGA 4OYRA 1UXGA 4IS3A 1UR5A 1UUFA 3PK0A 3QVOA 3PDJA 5DBFA 4XYEA 1WZIA 5IZ4A 4RZHA 5G0SA 1L7EA 4RVFA 4DQUA 1S7CA 2CSUA 3R6DA 2O4CA 3NAQA 3PEFA 1E3IA 3AUUA 2DBQA 2P9CA 4ALIA 4BO5A 1NQOA 1NX6A 1WAMA 5DN9A 3N58A 3RJ9A 4ALMA 4WLUA 4Y9DA 2HSDA 5B4VA 5U1PA 2BGLA 3EUWA 1PJBA 3JTMA 2FR0A 3GT0A 4XYLA 2ZYAA 3WGZA 1Q7GA 3TF5A 4M55A 1GEEA 4U5QA 4ND1A 4B8ZA 4ROSA 1M6WA 4Y98A 3JYPA 2WTBA 3ETEA 5CP8A 1ZMOA 2YHUA 4PG6A 2I5PO 1ZJYA 4J7CA 1FJHA 2X86A 4HUJA 3UGKA 2O3SA 3X2FA 1KEUA 1Q7CA 2WMDA 1ZIDA 1ULUA 3JD4A 3JD0A 3RUDA 2PKQP 2PZLA 3DWFA 4ONEA 4YR9A 2OOSA 1F06A 2OORA 1PSDA 1YXMA 5T57A 1LLUA 1E5LA 5C37A 5ICMA 3ZWVA 5TLSA 1SB9A 4IJWA 5CG1A 5KKCA 4M89A 4ALKA 1XCBA 1JTVA 1H2HA 2RHRA 3ANMA 4N5LA 4CM1A 1XEAA 2Z5LA 1LJ8A 1RWBA 2B37A 4NJMA 2X0NA 4IPTA 2BFAA 4CLXA 2EXXA 1MG0A 3L4SO 3WX0A 1F17A 1H9AA 3V5NA 1E6WA 2GNAA 1VI2A 2PD4A 1KEPA 4GGOA 3PPIA 3HDQA 3WTCA 3CMMA 2NNLD 1IOLA 1UDCA 4ND2A 2DFVA 4MVJH 4RLSA 4XGKA 4I5GA 5JDIA 1HLPA 2O7SA 5IDYA 1E3WB 3RC7A 3PJGA 4ALLA 4BNNA 5ILOA 4R4JA 4JGBA 1P1FA 2AMFA 3D3WA 4OKNA 3DOCA 1LI4A 1SC6A 3DAFA 5FWNA 1I30A 2V6BA 2WEKA 4CM8A 3KYCB 4C7JA 3ANNA 4WOJA 3JQ9A 4GGPA 3PJDA 5JDIC 1DPGA 3EYWA 4CMBA 2VRCD 2ZJ1A 3F6YA 1WMBA 1PR3A 2JHFA 1NHGA 3MJSA 4NG5A 1PQPA 4CMJA 5IJZA 4GQAA 1JQBA 1UDAA 3LT4A 2DC1A 2NACA 3HWRA 3JQ7B 4FFMA 4AL4A 2X0JA 3JQ9C 3WFIA 5L4NA 4WUVA 1U3VA 4Y67A 3H5NA 3LLSA 2EKQA 3DO5A 1V6AA 4NQZA 3QW2A 1M76A 4IDBA 2BKAA 4I1IA 4BMSA 4OHUA 4IQ0A 3R1IA 4WLEA 4F6LA 2I6TA 3L9WA 3M1AA 4O0LA 5H81A 4BO3A 2JCVA 5IFLA 4IIUA 1TVEA 4H3VA 2GO1A 3K5PA 4IXWA 3WNVA 1A7AA 4CLEA 3UICA 4I5FA 5TT0A 2FN7A 2DPHA 1BVUA 1A71A 1E1LA 2GZ3A 4GVLA 2VZ9A 2CFCA 2W2LA 4LISA 1H6CA 4EJMA 3KEQA 3WLEA 3F5QA 4J0EA 4BB5A 1KVTA 5FYDA 2CDBA 1R66A 3AY6A 3KXDA 5FEUA 3WQSB 1LLDA 2D8AA 4BGEA 4R9SA 4GH5A 3C85A 1VJ0A 5HBRA 1NM5A 3WBBA 1EK5A 3BHJA 3UFXA 4FFOA 3QVTA 4UVGA 4YJHA 1KVQA 1YS4A 3FNEA 3FNHA 2UUOA 1KEWA 4G65A 4BHTA 4BO7A 1EVJA 3ITKA 1WW8A 3QSGA 4WASA 2AG8A 3F5SA 4R69A 5G0UA 1NVGA 4J6FA 4PG7A 4HFMA 3K2EA 5IN5A 2NLOA 3DZBA 4FGWA 2X9VA 4XIYA 5AQ1A 3PJFA 1U7TA 1P1IA 5G0VA 4BNJA 3GAFA 4R1TA 2B4QA 2XAAA 5JO0A 1C1XB 2ZTLA 4K26A 3EC7A 1ZVMA 3GGOA 4MDHA 3WBFA 3D5TA 3ROMA 1KVSA 4R01A 1B3BA 2Y1FA 3QVWA 4E2XA 1DRUA 2XF8A 4J2OA 4PLZA 3MWEB 3G1TA 1FDSA 2GLXA 4XZ3A 4N7RA 3GRPA 1A9YA 5CDUA 4Z0TA 4OXKA 2CNBA 2D5AA 3EVTA 5JC1A 4GX2A 4J16A 4TRMA 4YAJA 1LLQA 4BNZA 3JSAA 3TPCA 4NHEA 5EL0A 3JYOA 2WYVA 3WJ7A 2RH8A 1W8DA 4E5YA 2VZ0A 4FW8A 3KO8A 5JO9A 4Q39A 4DYVA 4CM5A 4OQZA 2ZQZA 1O95A 4TMFA 1B2LA 2UV8A 4C4OA 2HMVA 4JP2A 4J9UE 1XQ1A 3DTTA 2ZCVA 4PIVA 1I10A 3ENNA 4PZDA 2YYYA 3PHGA 1E1MA 4HFNA 4FC6A 4MO2A 5CFZA 3LU1A 2ZJ0A 2Y1EA 1HDOA 3E9QA 5T5QA 3QVSA 1MC5A 2V6GA 2PZMA 1N1GA 4CUZA 2EF1A 3ZWNA 2G0TA 1JVBA 3WICA 1K2WA 1GD1O 5JBIA 3ZHXA 2H6EA 4CM9A 5K6AA 3ICCA 3PJEA 4IJUA 1E6EA 4KQXA 2W4QA 1EVYA 2HK9A 4E32A 1DIGA 2Q1UA 1SBYA 4UUPA 2HMWA 4MKRA 4YT8A 4PLTA 3V1TC 4RVSA 1LNQA 5K6AC 2QYTA 3RQSA 5T64A 1PJSA 3PWKA 4IGEA 4R5MA 1DRWA 3JQEA 3OH8A 5C3MA 4CR6A 2Y1OA 4MP3A 1GZ4A 3KYCA 4YQYA 1LDGA 2X22A 2BI7A 4DGSA 3GN2A 2P9EA 2AQIA 2DAPA 1QSGA 2A94A 3LT0A 3FR7A 3OETA 3PYLA 1ZFNA 1PZGA 3D4PA 3PFWO 3OP4A 4PFJA 4TVBA 5U9CA 3IC5A 5BNFA 3JQ7A 4BKPA 4I5EA 3WOHA 4AJKA 5ENVA 3FCOA 1ENOA 3ZNOA 4CR7A 5HTOA 4WCDA 3EHEA 1M66A 4PN3A 2W2LD 1OI7A 3IOYA 1I32A 4IXTA 1E77A 1W73A 3GZNA 3NGLA 5JW6A 3JQGB 2FSSA 4B4OA 1GZ6A 3RU7A 3DZFA 1HL3A 4K6CA 3LDHA 1ISFA 1K6XA 3B6ZA 4E33A 4E2YA 3SEFA 1QYXA 4J3FA 3SC4A 1DIBA 2X6TA 4JNKA 5BQFA 4AJOA 3RJ5A 3MZ0A 4IDEA 4BNTA 1P1KA 5TX7A 1NPYA 4CLDA 4CMAA 4ZA2A 5A02A 1J0XO 4NH4A 5KVVA 5EPOA 4KMSA 4QEDA 1I24A 1YRLA 2IXAA 4KQWA 1Q0QA 2ZB7A 2IYOA 4UUNA 4E5PA 4I9UA 1Y7TA 1FF9A 4DC1A 4OSPA 3LC2O 1A9ZA 3NGXA 4FJ0A 3W4KA 4DC0A 1O0SA 2Y68A 4BO0A 3ITDA 5JCJD 1I36A 1QMGA 1L1FA 4Z0PA 1WLYA 2PGLA 2NU6A 2PTGA 4O63O 2Q2QA 4XCVA 3DBHA 5IG2A 1GCOA 1NR1A 4AG3A 2CY0A 1T2FA 2B4RO 2YUTA 3F9IA 4CM7A 1BG6A 4ZQFA 1CWUA 3ZWXA 2H5LA 4XB2A 1A7KA 5A05A 5TNXA 4BNVA 1U8XX 3RFVA 1P45A 1LU9A 4OOFA 1VKNA 5EIOA 1ADBA 3L07A 3W8FA 1V9LA 4EUHA 4AJLA 4FOSA 1T2DA 1BXKA 1U9JA 3HQ4O 4TKLA 4U8GA 2X1HA 2CUKA 3L6OO 5GMOA 1T25A 5L51A 5IZCA 1U3WA 1PQUA 3ZNNA 3CZMA 5DF1A 4A26A 2O2YA 1HDXA 5JAZA 1LRJA 5A03A 3B1JA 5I9LA 1VSVA 2NTNA 2NVUA 2HJSA 1LLCA 4IIVA 1DJNA 1KERA 5TT1A 1CQJA 2P4HX 3DR3A 2NTJA 2ZIZA 2BFMA 1I2BA 5CEJA 1OZAA 2POQX 2UAGA 3KEOA 3O8QA 3ROPA 3ENKA 3DZGA 3NJ8A 3U0BA 2WE8A 1HE5A 3TFQA 3GPDG 3TDKA 3LSYA 1QV7A 3WSVA 2YY7A 4BNKA 4BNIA 4MJLA 2Q45A 1F0YA 1GYRA 5I8ZA 4B79A 1C0KA 4YYZA 1K0UA 3ZWMA 4WCFB 1GEGA 2W98A 4R3NA 5T6BA 2VOEA 3AI1A 4LSWA 4Z3KA 1BWSA 4YRDA 4NBRA 4P38A 1KS9A 1ADCA 3G0OA 4GSLA 4NU5A 4YAKA 3SLKA 4PG5A 1XHLA 1GV0A 2YV2A 4OQYA 2O4UX 1KBZA 1PGNA 5A3JA 4TSKA 3KZVA 1LC3A 2G1UA 5TQVA 5KIAA 3S2GA 2Z1NA 4I9HA 2AQKA 1HWYA 1XU7A 4IDDA 4YAIA 1NPTO 3TJRA 4DRYA 3HE3A 3GLQA 2RHCA 2VYVA 2DVMA 1HRDA 1Y9AA 2Q1SA 3GH3A 5L7WA 2J3HA 2GZ2A 3I83A 4RV9A 3UN1A 4HP8A 3RUHA 3LVFO 3EVNA 2QHXA 2VUUA 3I4FA 5J23A 1D3AA 2X23A 4JROA 4RQTA 3KETA 3MTJA 1O9BA 3JQAA 4OKIA 4II2A 1ISIA 1PGPA 3F4LA 1FDVA 1PWZA 5KVQA 4YJDA 1R16A 1XWFA 3O26A 3BTUA 2Q2VA 2IZ0A 2JFFA 3P5SA 3RC2A 3JQGA 3ZGYA 1QYDA 3ZV5A 4F46A 3T7CA 4DREA 3RASA 3SLGA 2ZK7A 2ZYDA 4YEDA 2B5WA 1P1RA 1SPXA 4JLWA 2E49A 4DYDA 3Q2IA 3TWOA 3W6ZA 3DZKA 2YJZA 1P1HA 1O94A 4LGVA 1Z74A 4MIOA 4Y6PA 3FNGA 3ZZNA 4WECA 2BELA 4LMRA 5I9MA 4UAGA 4UULA 1X14A 4W4TA 2V6MA 3RROA 1T1SA 1U8FO 3TOZA 5GZ6A 1H5QA 5HRUA 2J6IA 1D7OA 4LCEA 2DM6A 5IF3A 4PLYA 2A92A 3WIEA 4M1QA 4Y8VA 1P1JA 2LDBA 1ZW1A 3HDJA 2BFPA 1NQAO 1XA0A 4J2HA 2R6JA 1Q2XA 3AY3A 4MOWA 1ZBQA 4U6SA 5I7EA 2E48A 2V65A 4WNIA 3DFUA 3ZV4A 3C24A 5EMHA 1PWXA 3VKUA 4F6CA 1ZEJA 3WWYA 4EITA 5BR7A 2X8LA 2CF5A 3IUSA 4J1NA 4RF5A 4D41A 1HE4A 3KYDA 1BMDA 2P91A 3GVIA 4UVDA 5BSHA 1VE9A 3KVOA 4A73A 3QWBA 1LDYA 2OXIA 4FGSA 2HU2A 4DPLA 3W6UA 3EY4A 3OM9A 4CMCA 1Y5RA 4OH1A 1ZK0A 3KSZO 1LEHA 3AI2A 1DRVA 4HBGA 1HDGO 1VM6A 1Y5MA 4Z0HO 2VUTA 3AWDA 4L4RA 4UREA 2HDHA 2NUAA 3PP8A 1KETA 3R3SA 1DIHA 1NQTA 2EGGA 3W8EA 1ZK2A 4WE3A 1ZEMA 2WE7A 4KTVE 4MVJI 2B0JA 1MGOA 4RVDA 3JD3A 3PHJA 1YDWA 2HRZA 2PFGA 2EJWA 3ZHBA 1U3UA 3IMFA 3F47A 3ZV3A 1JWAB 4YACA 4UUOA 1SNYA 2QRKA 2HUNA 2EW8A 3FWZA 1RYDA 1OOEA 2Y67A 4MVJM 3V8BA 1JN0A 2JD1A 2DTEA 4WOKA 2LDXA 1T24A 4NBVA 1I01A 4KTTE 4ZRNA 1EZ4A 3ASVA 3CMCO 4RPJA 3H3JA 5AXBA 3KBOA 1YH3A 5DULA 5A9SB 2GGSA 5EQDA 2DUUA 2R00A 3QVXA 3EZLA 4BL5A 1Q7BA 2FZWA 2IEDA 1WVGA 5L7TA 4PG8A 3GGGA 3QA9A 3VH2A 1OAAA 1HZJA 4NFHA 3O9ZA 2DU8A 3JQAD 4CLRB 3GDOA 3WMXA 5TJ9A 2PH3A 2VOJA 3AU8A 3F46A 4NI5A 5B12A 4W7IA 3VDQA 2VNAA 1AE1A 5LC1A 1LSSA 3TZ6A 5CDTA 3VPGA 4L73A 2WD7A 1CF2O 1LRKA 3NDIA 1QV6A 1VJTA 2C59A 4CL8A 1Z45A 2EG9A 1EUCA 1ARZA 4DIFA 2H63A 1NPDA 2G17A 1JWBB 4PCVA 3S55A 2XXJA 2BI8A 3GNSA 1Y8RA 4FDAA 1H93A 3W8DA 4QSMA 4W82A 5F5LA 3HADA 1Y8QB 1JAYA 3S2IA 3FNFA 4IUYA 4TZTA 4RGBA 4BKQA 4BNHA 3WIDA 2XPCA 5TJHA 4DQXA 4O6VA 4OM8A 3H9UA 2YHIB 4NMHA 1LDNA 2I3AA 1R4NB 3GVCA 4EZBA 4YAGA 5L4SA 3BMOB 1DAOA 3RUEA 4YQZA 1DAPA 1R15A 2IDZA 4QFDA 1AGNA 4H15A 3RC9A 1NYTA 4LN1A 3ZU3A 2VWPA 4FFRA 2GD1O 1IZ0A 3U62A 4E2ZA 4FFPA 2D3TA 3GHYA 1WPQA 3WGGA 4KUGA 4TQGA 1V3UA 3OSUA 3DB2A 2B69A 2FP4A 4R54A 3CIFA 2DBVO 2PZKA 1Y6JA 3ZV6A 4RZIA 2Q50A 4E31A 4UUMA 1PS9A 1KVUA 1MP0A 2IYPA 3JYLA 3U4HA 2BH9A 2Y1GA 5EN4A 4B3JA 5BSFA 3ULKA 3NX4A 1Y1PA 2W2KB 3IDSA 4WEOA 4AJJA 3S2FA 2BF7A 2EP7A 4YVFA 3DZIA 3MJVA 3PTZA 2AEJA 5TC4A 4CV3A 3NV9A 2Q2WA 2NQTA 5ICSA 3ICPA 3D5QA 4L0QA 2BGKA 2NTVA 2Q1WA 3PQDA 4O5OA 3TZCA 1ZJZA 2ZCUA 3FD8A 4DMLA 4KZPA 3KSUA 4NU6A 3H9EO 4G2NA 5EERA 2EERA 2YQ4A 3V2GA 2P5YA 1ZSNA 5TRTA 3MWDB 1ZH8A 2YDXA 2AHRA 4PLHA 1NQ5A 2VWHA 4D0SA 2ZATA 1NAIA 3WGQA 3GDFA 1DJQA 3I6IA 2VWQA 4BV9A 2VHYA 5JYDA 4MP6A 3AJRA 5JCXA 1A5ZA 1QORA 3DFZA 4CLOA 1SB8A 4EGFA 2NADA 4MVJE 5H82A 1ISGA 1H2BA 1PTJA 3GVHA 5CHEA 3WJAA 3VZRA 1H6DA 3UH1A 4ZGWA 3S1LA 1P9LA 1PGQA 3AFMA 4EW6A 5A9SA 5A4DA 3L6DA 2DKNA 4OMUA 5KNLA 1DHTA 4XKJA 3ZHYA 3U9LA 2EGHA 4JBHA 1YOVA 4DUPA 2BHLA 2VYND 1R37A 4YT2A 2RIRA 3NTRA 4PGFA 3QWHA 5A1TA 1YGYA 4J91A 5CEEA 4CLRA 4GSKA 1U1IA 5AYVA 4CQMB 4EEXA 5ES3A 5F21A 4C7KA 4NFSA 4HV4A 3BMNA 5FF9A 4CQLA 3RBVA 3WB9A 3MJ4A 3WGHA 2BMAA 4YBZA 4IBOA 2QIOA 3VH4A 1CETA 3NTOA 1LC0A 3IUPA 1QYVA 2D5CA 1JW9B 3U4DA 3B70A 3RD5A 4JJIA 4A5OA 1E6UA 3K6JA 5A06A 1LUAA 4D43A 2GR9A 3BTVA 3DBLA 3VKVA 1E7WA 4AJPA 4GX0A 5HWSA 1YJQA 4M8SA 2I67A 2HK7A 1GU7A 1PR9A 2X5JO 1CDOA 1EVIA 1S6YA 4F3YA 3HG7A 1U7HA 2YHIA 4JBIA 2UYYA 4INAA 4Q3BA 3TQHA 4JQCA 4ND4A 3PXXA 4BKRA 1R4NA 2GN6A 1KVRA 4X54A 3TL2A 4FOOA 1PJQA 3FTNA 4W7HA 1TT5B 3VZPA 4QO8A 4DPMA 3DTYA 1I2CA 2EWMA 3PIIA 4IDCA 4ND5A 3IS3A 1RM5A 3CINA 4TKMA 4E3ZA 2P68A 1XG5A 3JQDA 1B14A 5JNLA 2CD9A 2FSVA 5T8KA 5KJ1A 3PLRA 2BRUA 2HLPA 2Q3EA 1D1TA 1DC6A 5B37A 3NT4A 2WSBA 3HN2A 3Q11A 1BW9B 3A1NA 3A4VA 1YONA 1NFFA 1AUPA 2PH5A 2C7VA 2IEBA 5T8KC 4TRJA 3QIVA 4O59O 3F3SA 2C54A 1MXFA 3BHIA 3MTGA 5HS6A 4PLPA 1TEHA 1VPDA 5KKAA 3CTMA 1P3DA 5C5IA 5G0TA 3KB6A 4J43A 3C1TA 3ROKA 2EP5A 2VHXA 3I6QA 5BNIA 4BNGA 1X7DA 2OFPA 1PQWA 4DBZA 3HFSA 2P9GA 1EFLA 3MJEA 4F45A 4DQVA 1F12A 3GRKA 4BKUA 3AUAA 5F5NA 1B8VA 1NVTA 4Y6RA 3R3JA 1T26A 1KOLA 4BNFA 3DL2A 1E5QA 2CMDA 4Q3CA 3RKUA 2IXBA 4BNLA 1ZO8A 2XXBA 4H16A 3TL3A 1FDWA 2C82A 1A72A 4FSHA 1B3RA 1YQDA 5IXSA 4RL6A 5A04A 4I8XA 2TMGA 2AA3A 3A28A 5EINA 3T4XA 4M54A 5C7LO 4FR5A 1HYGA 2HQ1A 4WGGA 1FMCA 3B1FA 1UP7A 1PX0A 5G2OA 5HS4A 3BIOA 1U5AA 3G3EA 2Y66A 1B8PA 4L4XA 4XYBA 1ENZA 2X5KO 4ZD6A 5A9TA 4JIGA 3HUDA 4CL3A 2VCYA 1DIAA 2JD0A 2B4TO 2C5EA 4JJGA 5CDGA 1YQGA 5C7IO 1A4UA 4IMRA 3VC7A 3FBGA 4P4NA 3IKVA 4XYGA 4DLAA 1BXGB 1DLIA 3DMYA 3GMDA 4GL4A 4NBTA 4PZCA 3RUIA 4CUJA 4AICA 2AG5A 1GUYA 5ER9A 1JA9A 4XQ9A 3TSCA 4R1NA 4J4HA 5KCZA 5GZ3A 1E92A 5JMWA 3GUYA 2D1YA 1U4OA 2SCUA 2ZQYA 3I23A 4RF2A 4RPLA 3VH1A 1E3WA 4CQMA 3PHHA 4D44A 4RPKA 4E12A 3GAZA 4IZIA 4JXKA 4U7WA 5THKA 5KOIA 4XGIA 3WSWA 3GUCA 5I7SA 1SMKA 1NR7A 4LRSB 3W1VA 3ZWPA 1UP4A 5HM8A 3GFGA 4BIIA 3I9OA 1MUUA 3UVEA 2JFHA 4P4LA 1QRRA 5IN4A 3W4JA 1DIRA 1Q0LA 1E7SA 4UEJA 3V1YA 1Z7EA 4PZEA 3ZW8A 1GDHA 4BS9A 3FF4A 1CRWG 1Y9EA 2IZZA 4D3SA 5JDCA 3DAGA 1NXQA 1PZHA 1CQIA 4EJ6A 4HX5A 2Y0CA 4LK3A 1SOVA 4EI2A 1OC2A 2CVOA 5DCWA 2GPTA 3LT1A 1VRWA 3OBBA 4HKTA 2CDCA 3GGPA 1OMOA 2JKVA 3I4CA 3P19A 1VL8A 3ZU2A 2D59A 1EDOA 2FHSA 3QE3A 1TT5A 1HDYA 2JJYA 5DDIP 1OFGA 3DZHA 3PZBA 1KIFA 3LYLA 4DLLA 1NHWA 1PZFA 3L4BA 3H4VA 3ZHZA 3JQ6A 4Q3NA 1F8GA 3OIGA 4A0SA 1GPDG 1VC2A 3FWNA 4WLFA 4A03A 1HZZA 4AJHA 1XIVA 4DVJA 4BO4A 4ESOA 3Q1LA 4XGNA 3EMKA 3V2UA 4DMMA 1HXHA 1G6KA 1VLLA 3OJOA 2HMTA 3GHHA 4DA9A 3GFBA 1XELA 1X0XA 1H6AA 3E6AA 3AM3A 4BO9A 4XRGA 1ZMTA 4ZVVA 1JKJA 4J1TA 4R3WA 1R4MB 7ADHA 3FR8A 4UVIA 2JFGA 1C1DB 3NRCA 1M6HA 1QR6A 3ZWOA 1C1XA 3NDRA 5BSGA 1G0OA 2DT5A 4EYEA 1I3MA 4IJKA 4IQ8A 4KUEA 4XDYA 2ZB3A 3IKTA 3DBRB 2YZ7A 3RBZA 3L0DA 1U5CA 1NBOA 2AQHA 4K6FA 1NNUA 4XIJA 1ID1A 3N7UA 5GZ1A 4NZ9A 6ADHA 2CVQA 3F1LA 1X7HA 2GN8A 3PYMA 1HEUA 2ZB4A 4E30A 1HLDA 1SEVA 1BDMA 4S3MA 2CVZA 1VKOA 3SJUA 4EJ0A 1YL6A 1N1EA 5IZCC 1GQQA 4CM9D 1ZKMA 4KOAA 4E5NA 2W8ZA 1NFRA 3OECA 2GCGA 1Z82A 3D4OA 4WPGA 3ZU5A 4CV1A 1DBVO 1DEHA 4HNGA 2UDPA 4U6QA 3WQRA 4FIZA 4EBFA 1PIWA 4EUEA 1BXGA 1E3SA 3WMWA 4FCCA 4J0FA 3OQBA 4ILKA 4IINA 4M87A 1P31A 1V35A 2Y1CA 3IQDB 2OP1A 5AXCA 1UXJA 3ANLA 1KC1A 3T7EA 4YPOA 2PZJA 3SXPA 1ONPA 4YRBA 2FPIA 3LC7O 3UF0A 5DOZA 4MVJF 3WYCA 1RM4A 3KRTA 2IE0A 3AW9A 4BQRA 2QRJA 4AJIA 3PQFA 4FB5A 2J3IA 3CUKA 2O3QA 3UHAA 1EUDA 2ZYGA 3K31A 1E7YA 1LXCA 2GZ1A 4XR4A 4K9DA 3EK2A 2JAHA 2NVWA 1WDLA 4CV2A 2R2GA 5DT9A 3GQVA 5JMPA 4IY1A 1N2SA 1EEHA 4U0JA 2VHVA 1LDEA 1M75A 3D0OA 3CEAA 3GA0A 3KHUA 2WD8A 3WGIA 4IQGA 5KWEA 2C29D 5EJ2A 4B3HA 4BVAA 3GVPA 3K30A 2VT3A 4CMIB 3GZ4A 4OGWA 4BMNA 1QKIA 1CYDA 1E3LA 1JLLA 3JQCA 5CAEA 3AOEA 1T4BA 4RF3A 2VZ8A 2WWRA 3BAZA 2EV9A 3DZJA 2PD6A 4E21A 3RBXA 1RM0A 2VHZA 4RCVA 4ZQBA 3Q9NA 1P0FA 3QQPA 5DCYA 3U09A 1XLTA 3PHLA 5TF4A 1R12A 4RDHA 1BRMA 3FSRA 1EE9A 3AOEC 3K9QO 4CUKA 4GKBA 3DMTA 1NFQA 3SBOA 3TRIA 4FD3A 5BT9A 4A27A 4E5KA 4CM4B 4J7XA 4RPHA 1K6JA 2DTXA 4KWIA 4E2WA 3HFGA 4B8WA 2ET6A 3E82A 2GASA 2FPGA 3SX2A 1O5IA 3O03A 3CKYA 3DMTC 4NK4A 2V7PA 4XJSA 4B7XA 2WJPA 2B36A 2DQ4A 4URFA 3QP9A 5TS3A 4J1SA 4G5HA 3EW7A 1K89A 5ITWA 1R4MA 2PWZA 2DUWA 2PKQO 1FDTA 3H7AA 3GF4A 4HNHA 1CJCA 1QXSA 1EBFA 3GG2A 3PYXA 2Q4BA 3GOHA 4BGIA 3Q3CA 1KY4A 3IL2A 3LZ6A 4IZHA 1EUZA 3RUFA 1U4SA 3DBRA 3RUAA 4TROA 3JYQA 3G17A 3VVCA 1G1AA 1ORRA 2CZCA 4CJXA 3A9WA 1UZNA 2I9PA 4RVGA 1TLTA 1ADGA 2E37A 2E4AA 1PJCA 3H6KA 3KTDA 1MFZA 1RPNA 4NNJA 5ITVA 3E5MA 1V3TA 1ZCJA 4MP8A 1AXEA 3DOJA 2RH4A 1ISMA 5DOVA 2OZPA 3PQEA 4JCOA 2CDAA 2J5RA 4IMPA 2FOIA 5MGBA 1EMDA 3ONEA 1X0VA 3H65A 3AY7A 3WFJA 1R0KA 1JDJA 1X15A 3LT2A 2D0IA 5L9AA 3OF2A 4W6ZA 1T2CA 2Y99A 4WLOA 1YWGO 3RC1A 3FPLA 3AUSA 3TOXA 1ZUD1 3INGA 4GWGA 1ML3A 1GPJA 3UW3A 4GI2A 1MXHA 2ZTMA 5G4LA 3VDRA 2ILTA 3K8ZA 1W4ZA 1D8AA 1WWKA 4N5MA 4ZU3A 4AJ2A 2X58A 3INTA 4J49A 1KC3A 4WCFA 1XYGA 5A9RA 4ZJUA 2O7QA 4MKZA 2ZTVA 2B5VA 2NSDA 3DDNA 4MPDA 1L7DA 2VYVD 3IIEA 2AXQA 4CR8A 1A4IA 1AHIA 4NBUA 2YDYA 1KYQA 2FR8A 1EE2A 4BUCA 5A5EA 2GRAA 3ADPA 3CPSA 5L45A 4JN6B 2VRBA 5GY7A 4YT4A 3C1AA 3GNTA 3UOGA 1LTHR 4WCFC 4BNXA 4IS2A 3GK3A 5K0ZA 4ITUA 5DZSA 3X2EA 5ILGA 4BQPA 2B83A 5IDXA 1R0LA 4NDNE 4PLGA 2R00C 4N18A 1OC4A 1VSUA 1MFPA 5B1YA 4TRNA 2PV7A 1X1EA 2FMUA 4BV8A 1LX6A 4OO3A 4S1VA 3CXRA 5BNTA 1UH5A 1GYPA 4RF4A 3ZW9A 4GKVA 5JAIA 1H0KA 4R16A 4AJ1A 3S2EA 3WYBA 3ZN2A 4UEKA 5AVOA 1BTOA 2Q99A 3H2SA 2I99A 2GN4A 2PGJA 2BD0A 3I9JA 3VTZA 3JD1A 3R0IA 1LSOA 1HDRA 4Z9XA 1YO6A 3D3WB 3WR5A 3OIDA 3V2HA 4CMEA 1PL7A 1SCUA 1PS8A 2Y93A 1LSJA 3E9NA 5L40A 4R9RA 2P4QA 2PY6A 1XDWA 2C2YA 2QQ5A 1LRLA 2C7GA 4YA6A 5CG2A 3RVDA 3AM4A 2F00A 2VHWA 1P77A 3GMSA 1W6UA 3N74A 4CM4A 1LSUA 5TIIA 1IHYA 1N9GB 3O4RA 5KTKA 1X1TA 2RAFA 3KSDO 1YKFA 1LA2A 1DXYA 3RU9A 2G5CA 4OXNA 3FTPA 2JL1A 1UZLA 1FK8A 1BHSA 4KDEA 4FFLA 1LQTA 1H94A 1MA0A 1Q1NA 1JKFA 3I52A 4E5MA 2DLDA 4B4WA 3C8MA 3JD2A 3MJCA 3IP1A 1HDCA 4E13A 1JKIA 4J1QA 4RVUA 1EQ2A 3HSKA 5FI3A 2NU7A 3DHEA 4K28A 1YB5A 4G81A 1IULA 2WM3A 1IZ9A 1QG6A 2JCXA 3O38A 4EUFA 3CE6A 5B4UA 1JU9A 3NT5A 3ON5A 1B7GO 2PK3A 2YFQA 1PL8A 3E03A 2QX7A 1PL6A 3WG9A 4R1UA 2IZ1A 4XWYA 1TB4A 1DDOA 5FFFA 4XQCA 3JQFA 2UVDA 1YB1A 3IJRA 2DTDA 4BO1A 3DONA 1GY8A 1IY8A 4YJHB 3L9XA 4YCAA 4Z9FA 2FPPA 1NAHA 4PLCA 3E9MA 4RDIA 3OA0A 4DIOA 4J9VA 1HF3A 5JFOA 3JQFC 3RCBA 4L76A 5F1OA 3UXYA 4PLWA 5ADHA 1CERA 1XGKA 3TFOA 1FXSA 1T2AA 3WQQA 4U0KA 1HE2A 1GQ2A 2X5OA 2X0IA 3LC1O 3U4IA 4BNWA 5K9ZA 4UEOA 3GN1A 1C0IA 3D7LA 1RKXA 3KYBA 2Z95A 3FRJA 4QFCA 3MEQA 3W4IA 1T1RA 3RFXA 2HKIA 4NIMA 3DAPA 1ISJA 2C0CA 3L6EA 3GEGA 4HFRA 1RYEA 4BB6A 1ZSVA 2HMSA 4CLHA 2C07A 5U4QA 5JY1A 5JE8A 1ZXBA 3BMQB 2P2SA 4BGUA 4QUKA 2OO5A 3AUTA 4OJNA 4NR0A 5IXYA 1MB4A 4BOYA 1EK6A 3OIFA 5T67A 4Y6SA 1UAYA 3E8XA 1DHRA 1SAYA 3JYNA 2DPGA 3WS7A 5KVCA 1E7RA 1V8BA 2NVBA 3H3FA 3P7MA 4QECA 5JXWA 3BTOA 4YB8A 1Z73A 4GLOA 5CPBA 4UVHA 1B26A 4YWJA 4E0BA 5JSFA 1H9BA 2I3GA 4XD2A 1GL3A 1Z75A 5JS6A 3SVTA 1C0LA 3GR6A 4ALNA 1BDBA 2I65A 5L7YA 3KV3O 3FPCA 1K5HA 1EFKA 5COQA 1E3EA 1WP4A 4L4SA 4BMVA 1IB6A 2O3RA 2NQ8A 2GN9A 4QXMA 1JVSA 3OHSX 4PVDA 2H9IA 2A9FA 3OEWA 5I7VA 3GC6A 4E6PA 4O1MA 1NWHA 1E7QA 1YDEA 3RI3A 2DBRA 2EEZA 1YL7A 1PJTA 4I08A 3VAZA 4MVJG 1Y8QA 2W90A 3H9JA 3CZRA 3ZWWA 1NP3A 3QWIA 3WGTA 1R6DA 3PGJA 3PRJA 3QV1A 4GX5A 2HK8A 4XDZA 5MDHA 3PWZA 1FDUA 4GLLA 2I66A 3VPFA 1NTOA 1UZMA 3ONFA 4L75A 3BMOA 4YDRA 2FWMX 2GSDA 4ZN6A 1N9GA 1XKQA 3COSA 3ZH2A 4RPGA 3D4NA 1ISHA 3NEPX 5AOVA 2EW2A 5HA5A 1U3TA 1WDKA 4YJFB 2C20A 1E1NA 4DL9A 1HYHA 2F1KA 1SOWA 4IJVA 3Q9UA 5EESA 4HXYA 1UXIA 9LDTA 1N92A 3FN4A 3GZNB 3BA1A 1D1SA 1TT7A 1I5RA 3AFNA 4XQEA 1J6UA 3U3XA 2O23A 1MLDA 4BO8A 3VZQA 3ROQA 4NFYA 4OL9A 3SJ7A 3HDYA 1EQUA 4LMPA 5DBGA 1F8FA 3ZU4A 1I3KA 2Y0DA 4XA8A 3ST7A 4RO0A 5A5FA 4WLNA 4D3DA 4JK3A 4XJTA 5KJFA 3PIDA 1GQYA 3DOOA 3OQ6A 4ID9A 4P22A 3NDJA 2AW5A 2J3KA 3GNQA 3OEYA 1GUZA 3DXFA 4B4UA 4ZHSA 2W2KA 4LCJA 4QQRA 4XEHA 5I9NA 1EBUA 1OBFO 2OBYA 3E1KA 3HB5X 2WYWA 1E1KA 2H1SA 4D46A 3OJ0A 2A35A 5CDSA 2O48X 4OSOA 5I7FA 4ZQHA 1CIVA 4XB1A 2QZZA 3VPXA 2FR1A 3DBHB 2Q49A 4TZKA 2NU8A 2FZEA 2YV3A 4XX0A 4OIMA 3OQ1A 4Q3AA 3NYWA 3RSHA 3QY9A 2J3JA 3U5TA 1MG5A 3BYZA 2J5QA 3WWZA 4DLBA 4M86A 5CPFA 3M6IA 5JCJA 3BXXA 3M2PA 1B0AA 4YT5A 3ZNPA 3IAHA 1GV1A 5AXDA 3UCEA 4FPXA 5KJ6A 4FJ1A 5KJEA 5JLAA 5CDYA 2B35A 1WMAA 3BMQA 4FJ2A 4L8VA 3E48A 4A7PA 2XOXA 3AOGA 1I0ZA 3MOGA 4JJFA 1IYZA 1K3TA 4W99A 1UJMA 1YJ8A 5DBIA 2NVUB 2OBNA 2X4GA 4PRKA 4L9RA 4YXFA 3ZWCA 5JAQA 2Y0EA 3H5RA 3O8QB 2DBZA 4P4GA 1I3LA 3ONDA 1LDBA 1ENPA 2WDZA 5L3ZA 2PKRA 5JC8A 4A2CA 3AM5A 3D64A 4ZRMA 4Z9YA 1AXGA 1MC4A 3Q6IA 3ETDA 1J5PA 3ZCXA 4QO7A 1I8TA 4RQUA 2YQ5A 3EZYA 2JHGA 5A3VA 5TGDA 1BSVA 4DIBA 3E18A 3EGOA 1NVMB 3K73O 9LDBA 1QP8A 3WGOA 1GAEO 1QLHA 4E4YA 3WXBA 1QYCA 1DO8A 1ONNA 2OUIA 4IGFA 4YJGB 3TZQA 1Q0HA 3V1UA 3B1KA 1GCUA 1R0SA 1YBAA 2PA3A 1IUKA 1K6IA 2PNFA 5ENDA 3BMCB 1B8UA 1BXZA 2NWQA 4BNUA 3E5RA 2VTEA 4B4VA 1SEPA 1VJ1A 4DPKA 3MCVA 3JV7A 1DFHA 2D2IA 5JDCC 3G49A 4YAEA 3TN7A 2X0RA 3DBVO 3C1OA 1KY5A 2G82A 4RJTA 2WYUA 1PGJA 1XR3A 1GTMA 1N5DA 3WGYA 2O3TA 3FI9A 4BO6A 4KUHA 2EKPA 3ZI0A 2C2XA 5LDGA 4YJFA 2Y05A 4D79A 4IDAA 1RM3A 2V6FA 3JQAB 3RWBA 3AI3A 5JPIA 4ND3A 2BFOA 4TVOA 2ZTUA 4IDGA 4NJOA 1DOHA 2ZB8A 1D4FA 3L4BC 1ZXLA 1O8CA 3M2TA 2D4AA 3BZUA 3PWSA 4WLVA 1BW9A 2BGMA 4D3FA 4BNYA 1T2EA 2PLAA 4K1LA 3IP3A 3I9MA 4B7UA 1X13A 3UAGA 1ENYA 5CEFA 3PHIA 2A4KA 4MVJA 2VWGA 2E6UX 1DLJA 3JQBA 3UKOA 4D45A 2FRDA 1P44A 4RORA 1XU9A 1ZZEA 4J4BA 3LLVA 1J4AA 2ZKLA 3G1UA 1ADFA 1P0CA 1AHHA 1HSZA 2VQ3A 1YBMA 3PFFA 4CV0A 3JQBC 2AE1A 1M67A 3HN7A 4GAEA 1ONOA 4TRRA 3C7CB 5DP1A 3JQ8B 5L4LA 3ETGA 2OGUA 3ZNQA 1WNTA 1HKUA 4A10A 4J4TA 1E0DA 1LBEA 1MX3A 1RJWA 2O50A 1U2GA 4I5DA 5F1PA 3ZWYA 3BHMA 3WDSA 1B15A 3KYDB 4DTIA 1DC3A 1GADO 4JP3A 5B4TA 3L77A 2CF6A 4TWRA 5G4KB 1GYQA 1PJ4A 2TMDA 4NK5A 2GUGA 4FC7A 3VPHA 2BLLA 3VZSA 5L53A 4PRLA 1O6ZA 1GUFA 4CQMD 4HY3A 2PD3A 1HDZA 2EJVA 2YW9A 4R68A 5F3RA 5G0WA 5C7OO 3JCZA 4GVXA 2OMEA 4D42A 2Z1MA 4GBJA 4R41A 1U28A 4WK6A 4Z6KA 3AK4A 4ZICA 4IM7A 4CM3A 3GG9A 2IRWA 4B7CA 3OJLA 3RAJA 1TI7A 4D7AA 4NBWA 2YFHA 3QJ5A 3LQFA 4MIEA 3Q2KA 1UP6A 3DHYA 3STHA 1QLJA 3RFTA 1YVEI 1B16A 5F1KA 1O89A 2VNSA 2EHDA 1WZEA 2RCYA 3OICA 4MVJP 3OJFA 1SO8A 1ZK3A 2HMUA 3D1LA 3QLJA 3VH3A 2HO5A 3VVBA 4LVCA 2AE2A 3I9LA 1HSOA 1WDMA 2AQ8A 3GVXA 1PU2A 2J8ZA 4FQ8A 1PJ3A 4P8RA 1HETA 3I5MA 4YJGA 3U4CA 1G0NA 1GZ3A 3TZHA 2X9NA 3BMCA 4PG4A 3F1KA 1M2WA 1IE3A 3QRWA 5DP2A 1I3NA 1PZEA 4CM6A 1P33A 3QHAA 3ABIA 2NV6A 3VPSA 1DC5A 4PLVA 4HADA 5BSEA 5DCUA 1HE3A 4EEZA 2GYYA 1AN9A 4QT0A 1YE3A 1F14A 3C7AA 3QWFA 3FHLA 4QTZA 1PEDA 3ZDFA 3I1JA 1BGVA 2UUPA 3KLPX 3KM0A 5H83A 4EDFA 2WD7B 3H2ZA 1IHXA 1YB4A 4YTEA 2DFDA 4MVJD 3T4EA 1YQXA 4DWVA 1ZNQO 3HHPA 1QYWA 4LW8A 3VTFA 3RUCA 2QYSA 2C5AA 4KWHA 3K92A 4BGVA 1DB3A 1Y8RB 3WNQA 4R1SA 5KVSA 4LSMA 1PJ2A 3A06A 3A14A 4II3A 5AXAA 4R51A 3GEMA 3CH6A 2OL4A 4M49A 3ASUA 4L74A 1UXKA 3I9KA 8ADHA 4GWKA 4PLFA 1BVRA 3AU9A 3F4BA 4UVEA 1UXHA 3OFSA 4J90A 3WLFA 4MKXA 3PGXA 1C1DA 3BTSA 5LCXA 2NM0A 3I3OA 1U2DA 4BNMA 3TNLA 4MIYA 2QG4A 2EIHA
chains in the Genus database with same CATH superfamily
5I51A 1G3RA 5LZ9A 5CB4F 2FPLA 3U49A 4B4KA 5EJEA 4R40A 4XGQA 2JD2A 3RKRA 3RIHA 3CRZA 1DFIA 3PVCA 4Q3DA 4AP9A 4AZSA 5AIBA 2GEDA 2GOYA 2BVNA 2PCLA 2WSSD 1NVVQ 2XGSA 3P94A 1IB0A 4X8OA 1QIEA 3UUFA 4C06A 2AEFA 4A6EA 1OXTA 1U9IA 3GCWA 4PS1A 2X1VA 3T35A 1NA5A 3KEMA 3SKXA 1ANKA 3CZCA 1F60A 2JAPA 3P45A 3PI7A 4OBWA 2VN8A 3NOQA 3NOOA 2D13A 3KB2A 1MAAA 4I1RA 1HDEA 2PGDA 3KTAA 3RSFA 4IP0A 2R1TA 2JGMA 4LQDA 3NC1C 4EDHA 3S8YA 1NI3A 1SVNA 4B32A 2F9LA 2BE9A 2YJ4A 2CYAA 1G9XA 3D3QA 4DZZA 3W2IA 3Q8WA 3ZLJA 2ZJBA 2Z56A 3CSSA 4IJ6A 2JS7A 4CPDA 1F8XA 5K2OA 1O2DA 4RQBA 4ZGGA 2Q8PA 2FXVA 3EJ6A 3EXEA 3UV3A 4CMGA 2NU9A 4IFIA 2WYOA 1QG2A 2DP4E 2NUBA 2ZRMA 3JVDA 4ZYZA 3ACDA 1GNPA 1IHPA 1XCJA 2X9LA 4FNAA 4JX8A 4XEUA 5E3JA 4BQOA 4F5WA 3KOWA 3INRA 2AFVA 2BFDB 5JYEA 2A0UA 2BFCB 1N6OA 1AD2A 3EFOB 3LF2A 4DILA 1J9GA 4NJEB 3K96A 1W581 2HRBA 2IYTA 2I33A 4C22A 2O20A 1A8HA 3ISTA 3IERA 2HYIC 1TXGA 2WTAA 4WNCA 1E3MA 1U8EA 4FB4A 4MPPA 4AJNA 3H1EA 1BYIA 3IIMA 1E96A 5B3JC 5KX5B 3V8MA 2AC2A 3K4HA 4HX9A 2RGCA 1X19A 2YWEA 3O83A 1O6BA 2P67A 2QW8A 3CJQA 2AYYA 4LEIA 4CLOB 4ZYWA 1TKCA 1ZW6A 1WB9A 1FZTA 4N01A 1UKYA 5JSZB 4FFNA 3AHCA 2ZEJA 1T8WA 4RA6B 4RK0A 3UTDA 2IS6A 1PWHA 2V4ZA 3C48A 4I9NA 1DPFA 2TMYA 3HNPA 1J49A 3GMIA 4BUJA 3H1TA 3RYFB 1SCAA 2E82A 1WABA 1QHEA 3H9GA 4NCKA 4B8YA 2GK3A 1U0GA 3ZDRA 1U81A 1RWVA 4N03A 2D7DA 1OGYA 1PR5A 2QP9X 4CMIA 3G79A 1AJEA 2V8BA 4S05A 1CVLA 1JG2A 1YOVB 2QRMA 5ADHA 3I9NA 1SXJC 2OZEA 2WTEA 4OOEA 3UJ8A 1RLTA 3QYJA 1II8B 2HSJA 2EVWX 2ADMA 4NPCA 3A2KA 3I62A 3LCUA 1DXHA 1Z6ZA 1VL6A 3FKSA 1PJLA 2C7RA 2XQVA 3BMNB 1XZDA 3BXOA 3PZRA 1GFWA 4HJXA 4HMOA 3V6LA 3WL8A 2WNHA 3WSTA 2ZUSA 2TS1A 4CM8B 4Q82A 1A5SB 1UDBA 1WLSA 2GYUA 4NMXB 5JVDB 3V4OA 2GAIA 4DBVO 1HGXA 3BXGA 4KWTA 3S8MA 3LLUA 3HB4X 4BFSA 3E35A 4QBIA 4UUQA 2Q4RA 4ERNA 4YRAA 2XQJA 4PX3A 4ISCA 4X24A 3QWAA 4G56A 3GLFE 1YL5A 3LH5A 4X45A 2QG9A 3VNQA 1VBMA 2VNHA 4P5EA 3A6PC 5ICFA 1II9A 3A3KA 3MT8A 3E9RA 1UBUS 2CNOA 1EVZA 1Z35A 3ENQA 1PGOA 1W9HA 2V0CA 1LFDB 3ABZA 1SIUA 3GOQA 3O8LA 3RYHA 4AVYA 4JBGA 1ZK4A 1UAGA 1EGVB 3HBFA 1IPHA 4ASUA 1XMQB 2XB8A 4A91A 4AJ4A 8GPBA 4N5NA 3L0IB 2NZJA 1VMIA 1L4MA 3EOAI 3PEUA 4DJDC 2ACKA 2J6HA 1L4HA 3AETA 2A5LA 1M1YE 1A9QA 3NT2A 4BVEA 1SXPA 4YCCA 5HOQA 1NI4B 2ZP1A 2QTVB 2QD5A 2YHSA 1SGWA 4ZQGA 4OYRA 4LA4A 1XD2A 2X41A 3QU9A 4KQ6A 4QOHA 1A95A 3PK0A 5IABA 5AOCA 3CR7A 1RBQA 3PDJA 2NZYA 4XPZA 1MX9A 5IAEA 5TMBA 4IIEA 4AUMA 4YR7A 2FWAA 4RZHA 1XKXA 5G0SA 3G2PA 4RVFA 1S7CA 2BUBA 2O4CA 2YH2A 1E3IA 3NAQA 2DBQA 4BO5A 5I7RA 4RLQA 3CVUA 4OQFA 1JHRA 3N58A 5AMXA 3SDSA 2I03A 3GWGA 3T1VA 1NRIA 4DANA 1I7SB 3CR8A 2IPLA 1QHYA 1PJRA 1GWNA 4BJ5A 1W76A 4HLUA 3BRWA 1BMQA 3TQSA 1IU9A 1JBEA 1GUDA 2W2NA 3K05A 3PDHA 5K8IA 2P6RA 4JI6B 1PT8A 2OAEA 4TMZA 2GAFA 3GT0A 4BE4A 1M33A 3F9RA 3MERA 3WGZA 4MEBA 4FD2A 5AVQA 3EEQA 1V4NA 4F2WA 4ZOCA 2P5TB 3L1HA 3KSAC 1EWKA 4RS4A 4YUZA 1GNRA 4ZCIA 4KRGA 1L9KA 2N3ZA 5DLPA 5JBQA 5JPCA 3ETEA 2PMKA 5CP8A 5BVHA 2UZ3A 2COEA 1U8TA 4NBLA 2YHUA 3CUUA 1KO1A 4JLDA 2QV7A 4WADA 7REQB 4G1CA 3COJA 1ZJYA 4WN9B 4J7CA 3RK0A 3SD7A 3RWOA 4FS8A 5CURA 1ZIDA 1XZIA 4BC0A 2JCSA 1ULUA 2DY1A 3JD4A 1FS5A 3KJQA 4DV6B 4NATA 1VYHA 2PKQP 2HU7A 1J7KA 3DWFA 5AFSA 2C4VA 3W6PA 3T12A 5LOVF 1Y63A 3GFFA 4RYDA 2AN9A 2RCNA 1DTSA 1X80A 4KBGA 1PSDA 1YXMA 4R81A 3OZTA 3WBKA 5C37A 1RXSA 3H1AA 4IO1A 1YNOA 3T9FA 1P5ZB 4L5JA 1CUIA 1GILA 3K1TA 4MGIR 5E1OA 3R23A 1JHXA 2G36A 1GT91 3T3MB 3HJUA 3RO7A 3RU3A 1ZR4A 1JTVA 2A3RA 2VPXA 4XVRA 3OO1A 2RHRA 4Z9BA 5FHRA 1I9GA 3CLTC 1EYZA 1KRHA 4KQ1A 1XEAA 4CM1A 1LJ8A 1RWBA 1NL3A 1G8KA 2C5BA 2I55A 4NJMA 3U4MA 3AVTA 4IPTA 2BFAA 2H29A 4H1HA 2WT9A 4P53A 1WIWA 1M2GA 1CUYA 1KBOA 1MG0A 3L4SO 4M0DA 1GRQA 2RH9B 3WX0A 3LUAA 1F17A 4D9CA 5BXYA 5C53B 1VI2A 4WBSA 3EOZA 1E2DA 2PD4A 4GGOA 3SPXA 3SZOA 3TJMA 4QBFA 1TKBA 3W77A 5LU9A 1QRAA 2O2DA 2XUZA 3WTCA 5IUNC 2NNLD 1UDCA 1M1YB 1OXUA 2JAQA 3GYBA 2R4UA 4GW3A 2BH2A 1A0OA 2O7SA 3BL5A 3QEMB 1V5FA 2IPOA 2OFOA 2ZJOA 4BNNA 1QU2A 3V55A 4C6TB 2ZIGA 5BV7A 4PNPA 2VI5A 2VJBA 2YXDA 3D3WA 3HY4A 3KOYA 4OKNA 2X0EA 3DOCA 3TIXB 1MH1A 5AK6A 4XWAA 3L6BA 1SC6A 2JFYA 4S24A 4UCFA 5E7QA 4WMLA 3T0FA 2IH2A 3FHOA 3NM4A 3PJDA 5AICA 3EYWA 4EH1A 1IJBA 2RHHA 4IJ5A 3IALA 3LXUX 4B3SB 5C32A 2O7VA 1EK2A 5IJZA 1YVUA 2FMFA 1QC5A 1UPTA 1UDAA 4RIEA 3U7HB 3ZLVA 1NULA 1PT5A 3TNYA 2DC1A 2NACA 1XALA 1EFAA 1OGIA 2QRQA 2IYLD 2QTTA 2I4RA 2I54A 3HWRA 4FFMA 4AL4A 4F9TA 5K8VA 4FI3F 4WUVA 2PUTA 3OJWA 4D9FA 1U3VA 4MV4A 3H5NA 3LLSA 2EKQA 2L19A 3PKJA 1POXA 3QW2A 5CMLA 1FU8A 3H5IA 3SX0A 4NYMR 4N0PA 4N8DA 4A6DA 4HLCA 3ITEA 4G5XA 2AN5A 5E7MA 2IZ6A 2ZQ5A 4IO0A 4XLZA 2JH3A 3LHDA 5KX5F 7MHTA 1MF7A 5FPKA 3T9AA 3W7AA 5EJAA 2B9EA 1L4GA 2IIVA 2I6TA 3EZ9A 3K35A 3L9WA 3M1AA 2ORED 5H81A 4F6LA 2JCVA 3IEXA 2X3FA 3A9RA 1FSZA 1P2VA 5EZQA 3H13A 2C4MA 4IXWA 2ZPAA 2BCEA 1WMEA 3UICA 4B83A 3VR4A 1A71A 1E1LA 2ZU0C 2W2LA 1K5DA 1H6CA 2JHPA 4UM7A 3CSUA 5ALMA 2NN3C 4D9NA 4OQEA 3W5JA 1P5RA 1P4HA 5EHXA 1DKPA 3K9CA 3KXDA 5KQGA 1ZOLA 2C4NA 4XDHA 1P2UA 3P9RA 1T5TA 4IOLA 2AWOA 3VI3B 2GFIA 3PXBA 4AULA 4BGEA 4W1QA 3T1YB 1GPYA 3FMGA 3DUWA 4FONA 4GH5A 1VJ0A 5D00A 2OXEA 1K98A 1KI6A 2DRIA 1FP6A 2VRWA 4JP1A 5B5SA 2W71A 3FBWA 3AF5A 3LVRE 3KUUA 4FOPA 4G4IA 1YS4A 2RHBA 4JS0A 1LPBB 2R8OA 3NU1A 4G65A 4LXQA 5HOEA 4TKVA 2RG7A 1WW8A 2DEUA 2IS2A 2AG8A 3KHTA 4R69A 3WP1B 1NVGA 2DZDA 2PX0A 2Z3ZA 5IN5A 1MOZA 2PXHA 1RYZA 3K2EA 4LJ9A 1JU3A 3DZBA 4FYWA 2IHJA 2DT8A 2ZSAA 2CVHA 3PJFA 5KOJA 1P1IA 5G0VA 2WSYB 4XLTA 2ZWVA 1M6NA 5JVDF 2V7VA 3OOJA 2B4QA 5JZSA 5JO0A 1QVAA 1FMTA 2A5DA 2BISA 3HC7A 1ZA2A 1N2JA 1ZVMA 2LV8A 3GGOA 3WBFA 1TK2A 2WAYA 4C4XA 3NHKA 3ROMA 3IQEA 1KVSA 3QVLA 1B3BA 4C1BA 4GLBA 1J1ZA 3ZS8A 1FIUA 3PC8A 3HUFA 4PLZA 5IKEA 4BYMA 1ZD9A 1FDSA 4N7RA 1A8SA 5KEIA 5CDUA 2FWRA 4OXKA 5IAGA 1Z2NX 4ZCSA 4M37A 2BGGA 4KX5A 3NWEA 4YAJA 4BNZA 1SBHA 1NY5A 5T4HA 1UPUA 3OLZA 1AGRA 1MJGM 1UMBA 3REFA 1ULHA 3TPCA 5KYYB 2NZVG 4OAOA 3OY7A 3JYOA 1C41A 4JLBA 4E5YA 2G4VA 4Z9AA 4FW8A 3KO8A 3DWEX 3TOXA 1QU3A 3T3DA 2UV8A 1J8VA 2WWWA 4R1PA 4J16C 3S99A 1XZQA 3H5WA 3DTTA 4GPZA 1N6KA 4MVWA 4LV6A 1NMZA 4F4CA 1D0SA 4BVFA 2YYYA 3RRMA 1IONA 1UC8A 2FUKA 4MO2A 1VL2A 2XRYA 3OLCX 2H7VA 2P9JA 4G8DA 3DOIA 3C6BA 4WACA 3ZQKA 3N05A 4CUZA 3H0KA 3R5TA 2G0TA 1JVBA 5LN1A 3WICA 4RKRA 1ORWA 4RXMA 1E20A 4WY5A 1U99A 4MV8A 4DIEA 1SOUA 3OWXA 4DUGD 1T9KA 4TLEA 2X8JA 3ICCA 3R3YA 4UAJA 1E6EA 4KQXA 4QBGB 3AKCA 3IEPA 4XW2A 1FX1A 2AJ8A 2P6UA 5AVTA 4EA6A 1DGQA 4R1OA 3TUJC 1PZMA 4E32A 1IMOA 2CNLA 2Q1UA 1SBYA 2PCJA 1JXAA 2HMWA 3N8DA 3ORSA 4V03A 4MARA 5C8YB 1V45E 4GKKB 1B00A 4K9LA 2I7DA 4OHXA 3OC6A 5K6AC 2JGKA 3OCXA 2WU0A 4JI1B 3VR6A 3ZXIA 4EZEA 2FMIA 2JFXA 3TB6A 3KAPA 4QJIA 3JQEA 3S70A 3C3MA 3TE6A 1PWEA 1P3Y1 3AL3A 1REQB 3I2IA 4YQYA 3A70A 2VFAA 1RXUA 1WUYA 3BQ9A 5FA8A 1F20A 2ZYVX 3TMYA 1I4DD 1WP9A 3DEHA 1T6YA 1O7JA 2OYCA 5KQRA 2GEUA 2V96A 3I61A 2D5IA 4HBZA 5ALKA 1U1CA 1ZFNA 1M2EA 4FUQA 2GRJA 2WJHA 3ZIAA 2WLTA 1UOPA 5J4HA 2H1VA 5JARA 3CO5A 3WOHA 4LRYA 4AJKA 2PUCA 3FCOA 3OKFA 2BY4A 3MG9A 2IWHA 2WLSA 2QJTA 5LZ2A 4FGLA 3S68A 3EHEA 1M66A 1SVMA 4LXHA 4LZJA 2YWJA 2JVJA 3RTCA 2O2GA 1JZQA 1OI7A 1I32A 4DG9A 5I9IA 1A2QA 2ID7A 2ZBRA 2R1UA 1P6QA 4OI4A 2QE7D 3TTXA 5JW6A 2C9MA 2PT9A 2VSXA 1HY3A 2X2EA 1LV7A 3PX2A 3QXCA 4U9IS 3VZBA 5EHIA 1F6DA 5TPZA 2I4OA 3AUKA 4JEIA 4K6CA 4D5GA 1NUAA 4U7JA 3I8SA 5KVAA 2O7NA 4ND7A 5CIQA 2FN8A 3D3KA 3SC4A 4HEQA 4JNKA 3ETJA 4IHQA 4LZAA 3NNSA 3RJ5A 1JHVA 1S2OA 1NPYA 2PS0A 3GXOA 2QVLA 2EGUA 2FPSA 5JJBA 3BCHA 4NH4A 1XZEA 4AUEA 2F59A 1OZGA 2IXAA 3MT7A 5B30A 3OIVA 1GRRA 4J3NA 2IYOA 4UUNA 3SM3A 5I45A 4I9UA 1Y7TA 2H1FA 2V0NA 3LC2O 3IP9A 3NGXA 5FX2A 3DMHA 4RZ2A 1O0SA 2W43A 1VECA 4BO0A 5JCJD 4GU5A 2QL5A 2EQ5A 3QTLA 3FYCA 1D4ZA 1W1WA 1IWBB 1VCIA 2P6NA 5EOVA 4EF5A 4LJ5A 1KDPA 2PGLA 1AKNA 4O63O 4Q3LA 3W2TA 1XDDA 3BPSA 3IP5A 5IG2A 1EJ6A 4IGKA 2WIAA 4AG3A 4P0PB 1T2FA 3F9IA 1COWA 3MN1A 5H70A 1IEQA 4XB2A 2ZUTA 2W93A 5CH5A 1E3QA 1U8XX 2P11A 4R71A 4F7WA 3PPXA 1W2HA 3VO1A 4DR4B 3L07A 4F1KA 3DDZX 3R20A 4IG4A 4LYYA 4AJLA 5JRDS 5IK2A 3DE3X 2GBFA 1U9JA 3HQ4O 3O91A 4J76A 4TKLA 3UT5B 1YTUA 4XTCS 4AIIA 3DCNA 3C3EA 3WDKA 5L51A 3PNPA 3K20A 5KTYA 1U3WA 2WQZA 1EM8A 5H16A 1ZX1A 3DF9A 1D2AA 2JHAA 3TSWA 2HT1A 4GOOD 5AUPB 1XCMA 4F84A 4PINA 5EZ6B 4N65A 4UTXA 4H0NA 1VL5A 1HG0A 3ND7A 4NF2A 4Z7NB 1FQWA 2NVUA 2PRZA 4V0RA 4JSYA 4DMUB 1FW8A 2PKYX 2Q0SA 2QX8A 1GR1A 4IDQA 4OQPA 3UK0A 5J2TB 1DJNA 1CQJA 4FHGA 4KLCA 2VBFA 4OL0A 2P4HX 3DR3A 2FPWA 3FMPB 5ALGA 1FTYA 3EFHA 3O2JA 2Q7OE 1P5FA 4A8JA 5IFKA 5JZMA 3ROPA 1MAUA 3ENKA 4U2KA 3O8NA 3DMDA 2X7JA 5CTAA 4Q9DA 1XB2A 2ZUFA 2WE8A 3PBKA 1AKMA 2EWWA 4D82A 3DNMA 3KOZA 1SKYE 1HE5A 1NV8A 3GUZA 3V1NA 3TDKA 4EJFA 4JL5A 4L5CA 2O2IA 3WSVA 1CUAA 2YY7A 3P9CA 4JA2A 4LWPA 4BNKA 5L6MB 3HXLA 2VS1A 5B3KA 2MINB 3OQNA 1MB3A 3K1ZA 2P69A 3W05A 1DDIA 2V7TA 1WSWA 4WCFB 3C4QA 3CRQA 2RB4A 3NWOA 4AN1A 1MEEA 2A9QA 2FPOA 4LSWA 3FCSB 2DHQA 1VLMA 3BIXA 1EH5A 2PRSA 3IELA 2XUFA 1ADCA 4NU5A 3F2VA 5DYIA 2GILA 1KEKA 1A5AB 4Z4EA 2YV2A 2Z9DA 3GRVA 4MYTA 4ZHQB 3WMFA 1PBTA 3DZDA 1KBZA 1PR4A 2DH6A 4MVYA 3AIOA 1LC3A 2G1UA 1J39A 1BQ4A 5KIAA 1TVCA 3EVFA 4JWKA 2PUEA 1EAYA 3H97A 3ZDBA 4B2PA 4UCWA 3IA7A 1M5UA 1NPTO 1P5HA 3QLEA 4DRYA 1SUBA 4DRXA 2XZOA 4N0DA 4Q1VA 2RHCA 3PR3A 4EG7A 2DVMA 3AQIA 2PEZA 3GMTA 3PR2B 1C8LA 2GZ2A 3Q10A 3VC2A 3ZJVA 2IP1A 2JB9A 3ANSA 4RV9A 1DOAA 2AOWA 3VSCA 1AK1A 4DCTA 4YRSA 1Q11A 3KR2A 5A1JA 3I0MA 3F4KA 4JROA 4P92A 5HNKA 2YVQA 1PP4A 3MTJA 3D31A 3ED5A 3HV0A 5JEEA 3IBTA 1EUCB 1ISIA 3DGEC 2ZE7A 4II2A 3S1AB 1PRYA 2CCJA 5KVQA 4GMXA 2CL0X 5DRTA 1FYXA 2P9ZA 3P5SA 2A7QA 3ESRA 4DLKA 1D9ZA 4N47A 3R0ZA 1CS4C 2B2XA 4MCIA 5L6LB 3RASA 1Z5NA 2ZYDA 1T0BA 4PZZA 5HIJA 3X1KA 1SCUB 4KXVA 1VIVA 2QTWB 3W6ZA 4XDGA 4BMXA 3Q3IA 4FSDA 4OJTA 1OX4A 3BMXA 1RIFA 3M4NA 4K8RB 1I4EB 3U2QA 5BSUA 4RWZA 1OHHA 1Z74A 3CEPB 4HD8A 1D07A 3FNGA 1NKSA 2E89A 4EQ6B 4A0FA 5I9MA 4G8CA 3GV0A 4RSHA 1K63A 1KQOA 1OIVA 1T1SA 1H5QA 2DCMA 2JLSA 4ACBA 3WIEA 1L3IA 3SC2B 2EHJA 4M1QA 1ZW1A 2I3BA 1B76A 1CS0B 4NENA 5I7OA 3A6ZA 3ZGZA 4L8WB 3Q7QA 1XU4A 1Q2XA 1G42A 4JVSB 3KXLA 1VJGA 3U16A 4LJ7A 2V65A 1XP8A 1FUEA 3HI4A 4XWKA 3DFUA 5C8YF 4BVHA 1R0YA 5EMHA 2XCQA 1U2DC 1SKYB 1PWXA 1YZLA 4IG9A 3VKUA 2A30A 2JCBA 3FDXA 1O0CA 2VDPB 4DLPA 2X8LA 3PEVA 3O21A 3HKDA 3L5OA 2GDJA 3P8ZA 4KIUA 4DE5A 4JLSA 3KYDA 4ZOBA 1J23A 2XBLA 3QNWA 3B7GA 3LMKA 2P91A 3GVIA 3QSGA 4RYLA 3FLEA 3RRNA 4UVDA 5BSHA 4G24A 1EP1B 1AKRA 3KVOA 5DTRA 4JDPA 4A73A 3NMUF 1JR4A 5HCUA 3HNOA 2OZVA 3GEPA 3W6UA 3FOFC 4NBNA 3PGVA 4ROTA 4A0RA 4KNYA 4HH1A 4UU7A 4NECA 3ORRA 5AUNB 1XAIA 2JGJA 4HAIA 1DBWA 3ICVA 2ETXA 1C4XA 1HDGO 2JW5A 1Y5MA 4UOQA 4F5EA 1EP3B 2G5TA 1GG9A 1KH1A 2JBAB 3PP8A 3S4YA 2F9MA 1KETA 3GU3A 5DSZA 4X61A 1Y5NA 1XMVA 2EX4A 2VDWB 1N5RA 4GRIA 3AUXA 4C7OB 2O5EA 2FPPB 4MUXA 5J2UB 4WFIA 4WE3A 2L17A 1KPGA 2R8EA 3M1YA 5BVGA 2PLFA 5A7GA 3CLUC 1T8YA 2B0JA 4FKZA 4FEYA 1OAKA 2G1JA 4RD2A 1RWMA 4LK2A 3KD2A 4TTJA 3ZHBA 2V7WA 1U3UA 4PR3A 3IMFA 1BA2A 4GYWA 1JWAB 1WB4A 4YACA 4YRMA 2Z6VA 3VHLB 4YUWA 2QRKA 3KKEA 1M83A 2EW8A 3WKBA 3VKGA 3V8BA 5FNVA 5IMSA 4B3TB 4GI7A 5HVNA 2JD1A 2DTEA 1ZL2A 2IEGA 3QE0A 1EZ4A 3Q7PA 3MS4A 4ER6A 1DG3A 1NE7A 4DCGA 4OV6B 1G5PA 1WV1A 1ZNWA 2IVZA 2GGSA 4R2HA 1SIOA 3QVXA 1E5VA 2AFIE 1G59A 3IESA 4Z2AA 4EB0A 4OHWA 1RJ9A 3Q3VA 3TRDA 1Q7BA 1FSSA 1WVGA 2J4CA 4ZKDA 2OVFA 3QA9A 2I2AA 3PQ6A 3O9ZA 3WGVA 3JQAD 2WNIA 3VR4H 1D4OA 4HMPA 4ND8B 2PKEA 4E5SA 4Y1RA 4EO4A 1ZJJA 3QFFA 5K0SA 4QJ5A 4H1VA 4K9RA 3NFRA 5CCXA 1QIIA 2ATVA 3PJRA 4I99A 1QFJA 5BUCA 1F5SA 1YA8A 1X94A 5LC1A 5KKNB 5LNK1 1Y1QA 1TCBA 3MTBA 1TM7E 5JANA 4M0PA 3VPGA 1GZ7A 2ZFUA 1O4VA 4K6GA 3UJCA 5KNDD 5IBPA 4WK2B 1V16A 3NDIA 1QV6A 1VJTA 3NIFB 3KQKA 2C59A 3F49S 2Q9UA 3FFXA 3DQZA 1Z45A 3DEIA 4NCIA 2XKAA 2W6IA 4KEAA 3M5CA 3WV4A 2O2EA 3HEBA 5IRCD 2KWIA 4DNOA 3MW8A 3N2ZB 4QUGA 4F9EA 2N47A 2PX8A 3B5IA 4TX1A 1UDWA 3OCYA 5J2TF 4FDAA 1Y8RA 3H17A 3ESYA 3V8QA 3VV3A 4QSMA 1M2OB 1N2CE 2X8AA 3NZEA 3HADA 5D86A 1JAYA 2AR7A 4AMYA 2HZ7A 2CDRA 1C4OA 1G20E 2WG0A 2JAOA 1IY9A 2AI2A 1AV7A 1SU6A 4LCBA 2JATA 5F2OA 2P3QA 4DQXA 4OM8A 2WF6A 4F8EA 4XSGA 3UYLA 3U44B 2RE8A 2CUTA 3IEVA 1C7IA 2PZ8A 1C9YA 4R7ZA 2I3AA 1R4NB 2PFKA 3HUEA 4Q16A 2XXAB 1CRLA 4KH0A 1JQEA 1PFWA 1DAOA 3FRHA 2BBWA 1P7YA 2JRCA 4ODIA 4DYHA 1DAPA 1EIZA 3L4JA 2HU5A 4JJZA 2IDZA 1QLWA 3QOYA 5B1HA 4DM4A 1GM5A 2OSVA 2GJ9A 4H15A 3EDCA 3H18A 3ZU3A 3X43A 2VIIA 4K86A 1GZVA 5E7IA 4J07A 4MUFA 4NYIQ 3OZAA 2PYDA 1UDXA 4FFVA 5UKDA 4K0KB 1ZHFA 1LY1A 3VI4B 4KE6A 1MVOA 4WN3A 3PFBA 5HJ2A 3K9LA 5EIXA 4AY4A 4RS3A 4TQGA 3PRYA 4ZHQF 1V3UA 3IO5A 3OSUA 1JSRA 2WPDD 1J90A 2MTBA 3BERA 1TL7C 1SKMA 3GRFA 2QW1A 3GJ6A 3OU7A 4NZZA 3KQOA 5FWXA 2SKEA 1D6NA 2Q50A 4XXHA 3GLIE 3V7FA 2BFBA 1X1AA 2IYPA 1U04A 1KZ4A 2Y1GA 3MTIA 4LGCA 3DDHA 4KYTA 4WL0A 2OXTA 5BSFA 1HH4A 2ZWMA 1W85B 1SXGA 3QJGA 4HNSA 1BMFA 3MRTA 1UT8A 3VO2A 3RRFA 4NAHA 4B3BA 2ZBEA 5T4EA 4BGDA 2PJDA 2EAUA 3IFSA 3IX7A 2IBMA 4PSAA 2NV0A 8AT1A 2AFIB 4B82A 4ZEVA 1HEYA 4DMKA 1QHHA 1HFJA 2AEJA 4H7KA 5F9MA 2ZSIA 3NV9A 2Q2WA 5TC4A 3WRXC 5ICSA 3ICPA 4OA8A 4BLSA 4KQEA 3A26A 4H0CA 4LFAB 5E6RB 5HIAA 1T8TA 4I1SA 4M6WA 4MWSA 5CA0F 4N5HX 1VE1A 1JVNA 3FD8A 3IAS1 4NU6A 3U7QA 2IYYA 4X5OA 2UUCB 5EERA 3OCUA 3L1VA 1R8QA 4L02A 3UEOA 1V5WA 2BGTA 3DS8A 4JH0A 4KACA 3VXKA 1LS1A 1RACA 1W30A 4XX0B 4JXZA 3ADKA 1YAHA 1EAMA 1T5BA 1JR3D 1EXMA 2Y6VA 4D0GA 4F9FA 2QB5A 4RKYA 2F1OA 1NRWA 1DJQA 2EL7A 3H11A 2YZGA 3I6IA 3QI7A 4JKYA 3Q2OA 4ZOEA 3SI7A 4URXR 4FI3C 2VWQA 4IJQA 5HMLA 4POOA 1RTKA 2VHYA 4MRMA 3HKEA 3UT0A 5KOHB 2VKQA 1KK1A 2A0WA 1RLMA 2XYRA 4JHLA 2OC9A 2OLEA 2HV8A 3ODGA 2AW3A 2OHOA 4PQGA 4RNCA 1UJ6A 3K09C 1N2CB 3I2FA 3EDRA 1ISGA 3K7EA 3KS9A 1RJDA 4L5YA 3I09A 4MJXA 5DM0A 1VXOA 1ZMRA 4KI7A 3RQIA 1G20B 2GEBA 5KDLA 3UH1A 5CT6A 4LYFA 5CIYA 1RRVA 2RH5A 1OXKB 1WQ1R 2ZRJA 1X38A 2VP2A 5EPEA 3GXBA 4DJAA 3HVUA 5BYBA 4IVNA 1NXTA 2MYUA 4XKJA 3ZHYA 5JXWA 1H3EA 1PTJC 1IK4A 2J07A 4DUPA 2BHLA 2VYND 1T9HA 1XMJA 1Q7EA 1H8HA 4YT2A 4MRRA 4NEQA 2GFQA 2YRWA 4M99A 3VR2D 1CTQA 5CEEA 1F8UA 4CLRA 1S0UA 1YU6A 2BEUA 3DNPA 4JLAA 2YVAA 4OQQA 5AYVA 5BO5A 4CQMB 5ES3A 1YE5A 5F21A 1X39A 3VISA 2OQRA 1WSBA 4C7KA 2HL6A 4NFSA 1T6XA 5EIAA 3T3HA 3BE8A 1ABEA 2AMVA 1QZ3A 1E1CB 2R751 3H86A 3BFJA 2A9PA 3NYIA 1ZZGA 3E5NA 4G37A 2IU3A 4LXGA 5CK5A 2VHCA 3PENA 1Z2OX 4FE3A 1UJ4A 2YYAA 4ZEOA 5EHNA 4F38A 3MMXA 4GPIB 4LOLA 1RXCA 2DSTA 4V0LA 3RWMB 3DD1A 4X66B 3B8HA 1US8B 2O6LA 3GLIB 2F90A 3BM5A 4A36A 2IW3A 3PFNA 1AGYA 5J2UF 3EGVA 1TQ6A 1YTLA 2BGUA 3BTVA 4FYHA 1CQIB 3LHIA 4JT9A 4DCVA 1E7WA 4WBNF 5CCDA 4AJPA 4ZGBA 1J2EA 5CB8A 1ML4A 4RMJA 3ZX5A 1YJQA 3IGFA 5BSKA 4C4TA 2CHFA 2GEKA 1VLJA 2X5JO 2Q4TA 1FFBA 4F3YA 5EWMB 3HG7A 3Q3JB 2C78A 2UYYA 1ESZA 4JKIA 3NQ41 3T0GA 2B8EA 2RGYA 3TQHA 2QRHA 3DYBA 4MW4A 1G8SA 2EFHB 1NYQA 2JVKA 4X54A 4TTIA 3RJTA 1K7EB 4FOOA 3TL2A 4P0QB 1BJRE 1TT5B 1WCXA 5DASA 2IEIA 2VAPA 2Y8EA 3S28A 4M0MA 1WQ4A 3RJZA 5MHTA 4DPMA 3IMGA 3TXXA 4MZXA 1RRMA 1QTIA 3SZ3A 5D01A 3GLGE 1N2IA 1BFDA 2RHLA 4R8VA 2PVCA 4TKMA 4TXNA 4E3ZA 2PRIA 1PW5A 3GLKA 1UEXC 3QM1A 4TV8B 3SZRA 4C4SA 2VPZA 4JU8A 4JU9A 2CD9A 1E2UA 2RJNA 3VU0A 5T8KA 3TBFA 5C80A 1WS6A 1E6LA 1RRCA 2HLPA 2Q3EA 3EXHA 3IQWA 4CEIB 1Z6AA 2Q6OA 1RKBA 3PFGA 2WSBA 3HN2A 2MSDB 1GGJA 3OPYA 1BW9B 1GIAA 3FPSA 4L50A 3A1NA 4F3CA 4B6PA 4EBBA 1Q83A 1UMDA 2N9UA 1BDIA 4NXNB 4IR7A 3F3SA 1EVEA 5JSYA 1Y80A 4G5SA 5HS6A 2YW2A 1TEHA 1FNMA 3Q6NA 4EY6A 3FYUA 1DQZA 5JSQA 1I6MA 3C1TA 4KLNA 3ZCRA 4ZVTA 1RLUA 3AUJB 3ROKA 1M2VA 1X7DA 3PDIA 3R3HA 4YECA 4C20A 4PSKA 4DBZA 1XRSB 2PKCA 2Q3FA 1S2NA 1EFLA 2AFRA 4DKJA 3QFHA 1F12A 1KQPA 3CA8A 4BKUA 3AUAA 4C87A 3IBSA 3UJNA 4Y6RA 4PBSA 1UK6A 1E5QA 3KXIA 3QA3E 4Q3CA 4JUCA 1QGZA 3G5UA 4CIXA 1ZO8A 3QYPA 2JFWA 4S0ZA 4H16A 2WT8A 4B17A 1U0HC 3IUJA 3O2NA 2ZROA 1A72A 1C9KA 2AH5A 4RU1A 4ZPJA 1R5BA 5A04A 2BKEA 4I8XA 2IXGA 4LGMA 1N6IA 5EINA 2GYWA 4M54A 4NCJA 2VT6A 2X5NA 5C7LO 2G9QA 2QMQA 2HQ1A 2I22A 1FMCA 4AZ3A 1YI1A 2BP7B 3AXTA 1PX0A 2KE5A 4Y2SA 4FYVA 5G2OA 4BMPB 4F56A 2HF9A 3F6SA 3U9SA 2QLJA 4G9GA 4BECA 5FO0A 4QGFA 4L4XA 1PN3A 2JLXA 3V4LA 1RABA 2QGFA 4CF3A 3RT1A 1NMXA 2OE2A 5A9TA 2CVPA 1Q77A 4CL3A 2LNDA 2D1RA 1M6VA 3L0ZA 3A6HA 4EJSB 1NG1A 2BFEA 1C3EA 1DIAA 2HQSA 3DJYA 3I73A 4KXLA 3SSOA 4AIRA 4BV3A 2C5EA 3NHWA 1ZP6A 1UPFA 5F4BA 5HPYB 2W83A 4AQYB 1N2BA 1LBHA 1MC8A 1VRVA 3VC7A 1F2TA 3R6GA 4XYGA 5ALRA 3TVDA 2H2FA 1DQPA 1SUDA 1A04A 3N2KB 4N49A 1VPVA 4NBTA 2I7XA 2W9XA 2J09A 3OOYA 3VX3A 5LBTA 3VBCA 5DN6D 1F0KA 5BRNA 1JA9A 4CHGA 2PYZA 4J4HA 5KCZA 4TL8A 2YNMD 1AF4A 1YBFA 1ZUIA 2IOYA 2PT6A 3HKCB 3GUYA 3R5KA 4YIHA 4FDLA 5JMWA 3GLGB 2SCUA 3VH1A 1ULZA 1K66A 2GEVA 4RF2A 3RADC 1E3WA 3EE6A 2Z8ZA 1PK8A 2UZAA 3CVXA 3QUSA 1LQ2A 5GOTA 2D1SA 1SKAA 1NSTA 1PI3A 2C4TA 4HLDA 3T4UA 3O9MA 2CKDA 5K0LA 3VYTB 3HZHA 3K1AB 1CZOA 2JIZA 1UP4A 1UEJA 3PPWA 3IHWA 3G8YA 1KJIA 3LQ4A 5DNUA 1IBLB 3I9OA 1MUUA 4M98A 8OHMA 5LPNA 1ZMBA 1KO7A 1TZMA 5TARA 3W4JA 1DBQA 3THRA 3V1YA 1AUQA 3CLSC 3PTAA 1L5YA 3HZOA 4RPCA 1DARA 4C21A 1GDHA 1MNAA 1USWA 2CK3D 2XVXA 1LCIA 2REQB 3N0WA 3IPRA 5A4AA 5JDCA 1M1NA 2K5UA 1NXQA 5EHGA 3RIMA 1M1UA 3FVVA 1H5NA 4RAQA 4JLKA 1MAVA 1LPOA 1SOVA 2ECFA 2HTEA 2PEYA 5DCWA 3RVNA 2D1FA 1USVA 2FZKA 2HRDA 3LT1A 4HKTA 1JB9A 3GGPA 1VSQA 1UMCA 3I4CA 3P19A 1A7UA 5LKAA 5F2EA 2EARA 2Q2NA 5F51A 3QE3A 1I7PA 1QV9A 2A1UA 2ZYRA 1Z68A 4OLHA 2VNIA 5CFLA 4MQEA 3RM3A 2PGOA 5DDIP 1NIPA 5CB0A 4AC9A 2O1EA 4GM1A 2QIPA 5TVGA 3VSBA 5LXTB 1OH8A 1SU8A 3F90A 4Z4HA 1GKUB 4BCDA 3L6CA 1Y4DE 1MOSA 2O8FB 5DGHA 4V39A 4X44A 3JQQA 3GT4A 1QCYA 3O93A 2FUG6 2J45A 2WFMA 3FWNA 3NIWA 2W2MA 4GIBA 1N2HA 3IAEA 4A03A 2AZXA 1XIVA 2ZIAA 4PYMA 4DARA 4M21A 3TMAA 3V2UA 1D2RA 2W2QA 1Y4AE 4BWGA 1QH8A 1CX9B 4QEZA 3GHHA 3W3AD 4ETIA 3CG0A 3WDMA 4NLLA 2L42A 4G09A 4BVLA 1YRWA 1WF6A 2VEOA 1XELA 4RK5A 1H6AA 3FZGA 3BORA 3F8WA 3KNZA 3OKPA 1CUDA 4Q1FA 5P8WA 4KO1S 6YASA 1I3OA 1YBHA 4DG8A 4R3WA 1JUDA 2VYCA 3PLAE 2X42A 4MWBA 2BR4A 5F1YA 3WQSB 1VIMA 2WSIA 4JQZA 3UQYS 3ZHSA 5CXUA 4UVIA 1UM9A 2JFGA 2F67A 4LYAA 1M6HA 5CDHA 1CR0A 1Z47A 5GWXA 3GA7A 2EDAA 5H80A 3UC9A 3UBMA 4QIHA 4F96A 1VIYA 2A4MA 3D7RA 4KAFA 5LU8A 2FH5B 3PICA 1O95D 2CNWA 1C8BA 3HEAA 4BX0A 3IKTA 3RBZA 1OI4A 5FEMA 1FFWA 1DJLA 3MWEA 2F43B 3PGMA 1U5CA 4B31A 1NJ1A 1ID1A 3N7UA 1XZAA 4YDHB 1SBTA 3ZKWB 3PX7A 1JTEA 4AKGA 1OFHA 1VYTA 4YCDA 5SY9A 2R8XA 3M82A 1YS9A 1QQBA 4ABTA 2BTEA 5K09A 1JH8A 3N07A 4TYQA 4X9XA 4S3MA 2IHBA 2CVZA 1P81A 5K0NA 4BVGA 1EUQA 1O9GA 4RMNA 3OTOB 1N1EA 3WIOA 2ICAA 2O1XA 5IZCC 3PG5A 3HB9A 4MS1B 5KSYA 4KH1A 1ZRSA 1D2CA 1Z0ZA 3OECA 3Q7EA 3ZE2B 4K9NA 2NQ2C 5BQOA 3D4OA 2WSSA 3JRNA 1PNOA 5HX7A 1GKLA 1ZIXA 1DEHA 1UDRA 2DPLA 3G9XA 3TTTA 5EUCA 4F4DA 5C35A 4U6QA 2FUNB 4OGFA 4TV8F 3WQRA 1PNTA 1ADYA 4IIFA 2BGWA 4I8IA 4FIZA 1JYFA 1A97A 2XJ4A 2O14A 2SECE 4GC9A 4K6OA 2YZMA 3IBGA 3W5VA 4WSOA 5ERYA 1BXGA 2R6GA 2XTJA 1Z6GA 3PPVA 4EUEA 1ZN7A 4FCCA 1DINA 4E03A 1CC1S 1P31A 2ZU6A 3KZKA 1H69A 5B53A 2B9VA 4II7A 1P7CA 1RZ3A 4EVQA 4LWQA 4RSMA 5JG7A 2PZJA 5TDHA 1E0SA 3LC7O 2GFHA 2A33A 3JVEA 2AV6A 4YRBA 4AZ0A 2LKDA 1E9DA 1BEEA 2I80A 4TS1A 1VCHA 2C2MA 3ROFA 3DE0X 4JMPA 2MYTA 4DTCA 2H7CA 1Z33A 4HH3C 2P2NA 3W2EA 1WW2A 3S40A 4FB5A 2YN4A 1X7YA 3SICE 2FRVA 1Z2DA 4PEVA 2ZYGA 5FR2A 2J9GA 3GROA 5JAPA 4QYIA 2GZ1A 4PS0A 2YJNA 2ZBPA 1XTIA 1BE6A 1XN4A 3C0KA 3S6JA 2CLDX 2G6TA 1WDLA 3UMCA 2R2GA 4PC2A 4QULA 5DT9A 3U7RA 3OLYA 3GQVA 2V74B 5JMPA 4EGQA 2E87