2QHXA

Structure of pteridine reductase from leishmania major complexed with a ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
264
Chain Sequence
b'TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Discovery of potent pteridine reductase inhibitors to guide antiparasite drug development.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 96
structure length 264
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qhxA00
3ZU5A 4XRRA 4BNLA 1NPYA 2Z95A 4GI2A 4Q9NA 5G4LA 3AOEC 1CERA 4JNKA 4KQWA 2X1HA 5G0SA 3PIIA 1TVEA 5DF1A 1ISHA 1T2AA 1YJ8A 3DTYA 5DOVA 1EK6A 2AQKA 3CMMA 3QQPA 4XYGA 3JQ8A 1OFGA 1A9ZA 2D1YA 2VNAA 1VKOA 2Q1SA 3PFFA 3VH3A 4P4GA 4YT5A 1WMBA 1DIBA 4D79A 5L7YA 5IXYA 1Y1PA 4FFOA 3RJ9A 1EBFA 1ISJA 1QYDA 2YW9A 3NYWA 4YVFA 4JN6B 4H3VA 5CFZA 4XDYA 3MTJA 4CODB 4TRJA 4JP3A 1HE3A 3PHLA 4RPGA 4RDHA 3EDMA 3KBOA 3ROMA 3QVWA 2Y93A 1K5HA 3EC7A 3U49A 3PFWO 5IFLA 2RHCA 4OOEA 3KYCB 2BFOA 1JU9A 1I24A 1NWCA 2H63A 5T57A 1PZHA 2C7VA 2YDYA 1IPEA 1VKNA 2EGHA 2DM6A 4CM1A 3ITDA 3H9GA 4B79A 2DPGA 3G49A 4NNJA 2PD3A 3LLVA 3RVDA 4EJ6A 3RJ5A 3RU7A 4LK3A 4AJEA 2X5OA 3A9WA 3D5TA 1E0DA 4Q3BA 4YAEA 3VTZA 4N54A 3VZPA 1PZGA 4F45A 1E7SA 2I3AA 2JD1A 5CDYA 3LLSA 5TLSA 4I5FA 3RSHA 1ADGA 4HADA 3GF4A 3FTPA 4YJHA 3WGGA 1ZXLA 2UDPA 4MINA 4G81A 2ZYAA 2VRBA 1MC4A 1XQ1A 1VSVA 4AJKA 3WDSA 4E5NA 3FN4A 2D3TA 3FWZA 1HE4A 2IE0A 5DCYA 3WLEA 1QSGA 3ROPA 4ZQEA 4YJDA 1PGNA 4G65A 1JKJA 5JC8A 5A04A 4DC0A 3ZWMA 5BT9A 1YOVB 1GYRA 2OO5A 2EIHA 3B1KA 3JD2A 3DBRB 1ADFA 1WP4A 3K5PA 3KV3O 3BMCB 4L9RA 2FY8A 1LX6A 2Y0DA 4A10A 2EP7A 4J1TA 1YB5A 3K96A 4IGEA 3BTVA 1M6HA 1WMAA 1M76A 4PLFA 2HK7A 4WJZA 1RM5A 3HN2A 5A9TA 3ZV3A 4AVYA 1X1EA 1NR7A 1OC2A 2C5AA 3KSUA 3GEMA 5TS3A 3BTSA 2VUSA 4FBGA 2DBVO 2WD8A 1D4FA 4I5EA 4OSOA 4GWGA 3E5MA 3I5MA 4QEDA 4EW6A 2GASA 4BNXA 1LSOA 1LLDA 5JE8A 4ZQBA 5C37A 4GMGA 5MGBA 5IDWA 3DZJA 5HBRA 1J5PA 1NFQA 1V9LA 2BI7A 4U6SA 2RAFA 3O8QB 1Z7EA 4LMRA 1NXQA 5IN5A 4ZRNA 3GC6A 3L0DA 3UF0A 1T1RA 3PYLA 4KUGA 4Y9DA 4XWYA 3E5RA 3W1VA 1AUPA 1Q7CA 2OHXA 3JQAB 3WQSB 5ITWA 3JYOA 1EMDA 1XLTA 2OL4A 2Y99A 3FR7A 4FFPA 2D8AA 1HKUA 5B4VA 2EGGA 1GL3A 4HXYA 5U1PA 1N5DA 4WUVA 3R0IA 4KTVE 3KB6A 3H8VA 3WICA 4CV1A 3AUTA 4CPDA 4CM4A 2NACA 2UV8A 2DFVA 3WYEA 3AM5A 2BRUA 1BMDA 4FCCA 3N74A 4AJPA 4Z9XA 4CMJA 3VAZA 1PL6A 1PL7A 1ZEJA 1P77A 2P9GA 2YQ4A 1QG6A 2TMDA 1VSUA 5BNFA 4AJ1A 3FBGA 1KVRA 3GNTA 4LRTB 4FOOA 4CLRA 1UZLA 5F1OA 3QSGA 4RF2A 3PHIA 3TDKA 1BRMA 3MJTA 2YV3A 4E2YA 4EUEA 9LDBA 3HADA 4WKGA 3BHJA 4JBGA 5HTOA 2CY0A 4YAJA 1U8XX 1QORA 1Q0LA 3KUXA 2NSDA 3I9NA 2IEDA 4JXKA 2HJRA 1UDAA 3EAGA 1UXKA 4KUEA 1Y5RA 1SEVA 1TEHA 3GA0A 4YAGA 5B37A 3ZU2A 4J1SA 4DL9A 3JD4A 3LT1A 3FSRA 3WFJA 3K8ZA 4CMEA 3QY9A 1SB8A 3ONEA 4ND5A 4DLBA 1Q2XA 4U7WA 3HDJA 3U0BA 1GU7A 1DFHA 3H9JA 4AJJA 2Y1GA 1L1FA 1JA9A 2FHSA 4J6FA 4RGBA 4Y6SA 3EZYA 3ZWOA 4DXHA 1GEEA 4S1VA 4CM9A 3IC5A 1E3WB 3MWDB 3RUFA 4BO9A 3DL2A 4YT2A 4W9NA 2GERA 3B1JA 1V8BA 4RZIA 1U4OA 4HNHA 4BNVA 3CPSA 1HZZA 3KM0A 4D41A 4KWHA 2GUGA 1M6WA 3L4SO 3VDQA 4UUMA 1H93A 3GVHA 4DUPA 4ZHSA 1D8AA 3PJFA 4X54A 1AGNA 1TT5B 2QHXA 4F3YA 2WM3A 1B26A 1PS0A 1KEUA 2IXAA 3K92A 2O3RA 2OORA 5J23A 1R0SA 1DPGA 3QLJA 4BL5A 8LDHA 2EEZA 4GX5A 4FC6A 4B8WA 2FR1A 2Q50A 3DTTA 2B5WA 3IQDB 3B20A 4MJLA 2VZ8A 4AJ4A 2ZCUA 3K2EA 3SJUA 1JKIA 5TNXA 5L51A 1VL0A 1E3LA 2Y66A 1UXIA 3H3JA 1G1AA 3LC1O 3MJVA 3OSUA 3WGHA 3QVOA 5ENVA 3DEYX 2QYTA 3K73O 4RO0A 1ISIA 3CZRA 4IDDA 3JYPA 1U9JA 1WDKA 1ARZA 2OBYA 4PG4A 4OL9A 4WEQA 4DTIA 2ZIZA 2O4CA 2C59A 3KYCA 4KUHA 3LT0A 4Z0HO 1CEQA 1GYPA 3WMXA 4KZPA 2RHRA 3L6DA 3LF1A 3WIDA 4B4UA 2C07A 3GN1A 1K2WA 3V8BA 3H6KA 4D0SA 2GZ2A 4U6QA 3ZNQA 4BNZA 1I3LA 3GGOA 4XCVA 1CWUA 3I52A 1V6AA 3O4RA 4BOYA 2BELA 4FC7A 4AJHA 4NK5A 2PZKA 5JCJA 4RF5A 1YB1A 4ND4A 1YQXA 5HS4A 3LZ6A 1U3WA 5IAAA 4BNHA 1AE1A 1MG0A 1RM0A 3W4JA 1JWBB 2RIRA 2D0IA 3E03A 3FCOA 1ISFA 1IB6A 2W90A 4J3FA 5GMOA 3IKVA 3D4NA 3PJGA 4JK3A 1VL6A 3KTDA 4UUPA 3PLNA 4L74A 3UKOA 2O2SA 1UDCA 4BQRA 2P4HX 3JD1A 4WLVA 4UVIA 3EYWA 1P1HA 4AG3A 3JV7A 3OIGA 2BFPA 4WE3A 3ANMA 1YOVA 4PLYA 4DQVA 4IMRA 3DBRA 4XQ9A 5HM8A 3DZKA 3BMCA 3UHAA 2IXBA 3B1FA 4A2CA 3NGXA 3PIDA 5BNTA 1DAOA 2V65A 4Z6KA 1SB9A 1HETA 3F5QA 2BGLA 5G0WA 1YWGO 3GG9A 3JQFA 3O9ZA 4AICA 4PG6A 2FRDA 1UXHA 4DMLA 2PZJA 1BXKA 4RPLA 2EWMA 2ZB4A 4ALIA 3D3WB 5L40A 2VNSA 2Q2VA 4DIOA 1T4DA 4R5MA 1EVYA 4EDFA 1XR3A 1XYGA 1H2BA 1B8UA 3L9WA 3NT4A 2O3UA 2JHFA 3BMNB 4PRKA 1YL6A 4H7PA 4RL6A 5B1YA 3O8QA 4Y6PA 3M6IA 1Y9AA 4NK4A 4II3A 4EYEA 4E3ZA 3M1AA 4CV2A 3GAFA 5GZ3A 3JQAA 1PEDA 2PZLA 5A02A 3QVSA 1LSUA 1ENOA 3D4PA 1NHGA 3LQFA 1ZJZA 2JD0A 1GQYA 3UCEA 5H82A 2JFGA 1DLIA 3I3OA 4EUHA 2AE2A 4U8GA 5F1PA 1BDMA 4GSLA 3GFGA 2WTBA 3MWEB 1FXSA 1CDOA 1ZK1A 3JYQA 4R1UA 3ZV5A 4TRMA 1IL0A 2X23A 1WDLA 4GVXA 4AJIA 3UGKA 4HFRA 3L07A 4MKXA 2G0TA 2X8LA 2J5KA 1ZJYA 1GY8A 1BVUA 4Q39A 5BR7A 5JFOA 1OZAA 3C8MA 5DT9A 4N5LA 3ZWNA 1XDWA 3GRPA 4GSKA 1DEHA 5CP8A 2VTDA 2BF7A 1LDBA 4R51A 2EV9A 3PK0A 2IZ0A 5IZ4A 2YHIB 1ZNQO 4WNCA 4BQPA 2OP0A 2EXXA 4F6LA 1T1SA 3DQPA 5C7IO 4MVJM 3ROKA 2VTEA 3RUEA 5CG2A 1E6UA 4W9NC 4B7UA 1P44A 1WLYA 4U5QA 2G1UA 4IDBA 2B69A 4TZKA 3KZVA 1BWSA 4GBJA 3GY0A 4BO1A 4BO2A 1VI2A 3TZCA 3CH6A 3IP1A 3OF2A 2EKLA 2YY7A 1P9LA 1WDMA 4P8RA 4J4BA 1CIVA 1F8FA 4W82A 3L9XA 2VZ0A 4IDFA 4JLWA 1LUAA 1LLCA 3K6JA 4OMUA 3T7EA 4WGGA 2B4QA 1E3WA 1EVIA 2HKIA 4UULA 1YBAA 4L0QA 4YXFA 4Y98A 4R01A 3AY7A 1ZK0A 1GTMA 5CDSA 3SC4A 3AK4A 4PZCA 3VOSA 4BB5A 1V3UA 2CDBA 1HE5A 3GAZA 3GNSA 1KC3A 4ZQFA 3ZWPA 2DAPA 3F4LA 3I9KA 3OJFA 4MIYA 2R2GA 2B0JA 4CM6A 3RBZA 3ZZNA 1TT5A 5KWEA 1LDGA 3FBTA 2AXQA 2VCYA 3Q6IA 3DBLB 3VH2A 2NU9A 4RVDA 4LVUA 2EP5A 4RDIA 2HK9A 5DULA 3ZGYA 3KXDA 3UVEA 1SO8A 3GZNB 2VUTA 3WNQA 2O48X 5ILGA 3IIEA 3LSYA 4WASA 2H1SA 3PJDA 4KP7A 5JXWA 2DQ4A 4BV9A 5L4NA 1PX0A 1G0NA 3B70A 3U4IA 4Y6RA 3WTCA 3BMQB 4HP8A 4J7CA 1GCOA 3QWBA 4FS3A 1HDRA 1GUYA 2VYNA 1EK5A 1XIVA 1PL8A 1RM3A 5C7LO 2AQIA 2ZCVA 5DDIP 5L7WA 5IF3A 3CMCO 4I5GA 4A27A 3I23A 4TMFA 3QIVA 5IG2A 4RF4A 5EIOA 1YGYA 2JFHA 1O94A 1I01A 1W4ZA 2IRWA 4I9NA 3G1UA 4CMAA 2Q2QA 3WMWA 1DRVA 3GVXA 1UDBA 2NADA 1R4NB 1NX6A 3FNEA 1LDMA 3HDHA 4DYDA 4JGBA 2DVMA 3VDRA 1PR9A 3FRJA 3SX2A 1LXCA 3WX0A 3GZ4A 4XB2A 2PGDA 1KC1A 1PJ4A 3BXXA 4QT0A 5DOZA 4ZA2A 2G5CA 3TJRA 4ND2A 5KJ1A 5I9MA 4BMSA 1QLJA 3JSAA 5TRTA 2WDZA 2BKAA 5KKAA 3DFUA 1K6JA 4GX0A 4BNTA 1QV6A 1U4SA 2P4QA 3KO8A 3RC1A 5KJFA 4EJ0A 1QRRA 3WGQA 2RBEA 1SAYA 1O5IA 3C85A 3D4OA 3C24A 4BNJA 4DRYA 1JAYA 1JW9B 2VHWA 1LJ8A 4NH4A 3PZBA 3PQFA 4EJMA 1B8VA 4II2A 4XIYA 3JQFC 3CKYA 5A3JA 3QVTA 1YJQA 3OJEA 1DAPA 2Q1TA 3OETA 4PZDA 3ZWVA 3H9QA 5L3ZA 4CJXA 3HDQA 5DP1A 3PWKA 5JPIA 3AFMA 1FMCA 5JDIC 3P7MA 5EL0A 3NX4A 4E5YA 1GAEO 2XF8A 2YHUA 1RWBA 4BV8A 1E92A 3ZV4A 2D5AA 2CDCA 2PR2A 3BTUA 4IZHA 4J9UE 4CQLB 2OBNA 3KLPX 2GR9A 3L6EA 3D3WA 4UEJA 4XD2A 4BNWA 3R1IA 3WXBA 4M54A 4MKZA 1EUCA 1H6AA 4GWKA 3VH4A 3DB2A 4BNIA 1IHYA 2W2LA 2CF6A 1C3VA 1CQJA 2QRJA 4M8SA 4PG7A 3H5RA 3TN7A 2UVDA 4R3NA 1YL5A 2PD6A 3UUWA 1YS4A 1ZMOA 1QMGA 1YBVA 4PVDA 3DZFA 1QYCA 1HDOA 5FI5A 3SEFA 4GQAA 4GLOA 3MCVA 3R6DA 3VVCA 3AI3A 2P9EA 4H15A 3D64A 3N7UA 1M66A 3OQ6A 4DLLA 4RCVA 3S2FA 4CM3A 3UICA 3N58A 2FZWA 1NR1A 1DFGA 4RJTA 3WLFA 4OXKA 4WOJA 3GMDA 4K28A 4E2XA 4PN3A 1ZVMA 1KVQA 3F4BA 3BHMA 4MVJA 2DTXA 4RPHA 1B15A 3OJOA 1XSEA 2PLAA 3KYDB 4HFJA 5C3MA 1GZ4A 2P68A 1YQDA 4IQ8A 2ZB8A 1NPTO 1X7DA 2UAGA 1GFSA 2ZTLA 1DC3A 5A4DA 1JVSA 1OC4A 2D5CA 1XHLA 2ILTA 3GRKA 1WW8A 3G3EA 4CM9D 1YXMA 1ONNA 3RC9A 3KSDO 1LC3A 4R69A 3DR3A 2AG8A 2FPPA 2IZ1A 3AM4A 3GDFA 4IJKA 1E3EA 4CM7A 3K2BA 1BW9B 3IJRA 1BTOA 5A9SB 4J49A 1LC0A 1IZ0A 4FPXA 3RUHA 2YHIA 1W8DA 2P9CA 3OH8A 1PJCA 2PKQP 4JBHA 4MVJG 5JDCC 1QYXA 4BNKA 3WYBA 4ID9A 3X2FA 4AFNA 5CEJA 1DHTA 1X14A 2QYSA 1T2EA 5IJZA 3S2IA 4CLOB 4K26A 1TA4A 1E5QA 1ZSVA 1RKXA 3JTMA 2W4QA 4J90A 1MGOA 1JWAB 1V0JA 1QP8A 4P22A 1H9AA 3RASA 1Z7BA 4XYEA 3OP4A 5IZCA 4E21A 2HCTA 1DOHA 3INRA 1H0KA 4ROSA 1T24A 4K6CA 4XQEA 5KJEA 3WYCA 4J0EA 5MDHA 1ID1A 4RVFA 1P1JA 4QECA 3C1AA 5TJHA 3GVIA 2YFHA 3EVTA 2PH3A 4A0SA 2X0NA 3I6IA 4D42A 4DWVA 2NWQA 1KVSA 3LT2A 3P5SA 4MOWA 5I9LA 4BKOA 2PH5A 4J4TA 3V1TC 3DHYA 3WGZA 1NYTA 3LVFO 4LW8A 3QV1A 1E5LA 4XIJA 4QO8A 1KEWA 4WLFA 4YRDA 3OMLA 3DBLA 4HWKA 1ZIDA 1HSOA 2Y68A 4AL4A 4N18A 5TX7A 3GZNA 3SJ7A 3Q11A 1L7EA 5A5FA 3FNFA 5TIIA 4FFNA 2C2YA 5JO0A 5JCJD 2WYVA 3FF4A 4NJMB 3ZN2A 3HSKA 3RKRA 2W2KB 4F6CA 1TB4A 2DBQA 3G79A 3BA1A 2C0CA 3CZMA 3BMQA 3T4XA 1FDVA 2OP1A 4R9SA 3UXYA 1KVUA 1ZSYA 1SZJG 3D0OA 1A7AA 4NR0A 1I30A 3O38A 3ANNA 3SLGA 3ZNPA 1T26A 2Y1OA 4FR5A 5G0TA 4K1LA 3UAGA 3VZQA 3WNVA 4DGSA 3GLQA 2GLXA 4QTZA 2CZCA 5G2OA 2DT5A 5C5IA 3PQDA 4CM8B 2HMUA 4R16A 4EITA 1LSSA 1X7HA 4LVCA 3TL3A 1R4NA 3AY6A 3LDHA 5DP2A 1UUFA 4ZN6A 1YONA 1PJSA 1UH5A 4TRNA 3E82A 4CMCA 5T5QA 4B8ZA 3TF5A 2V6MA 5DBGA 2UYYA 4OOFA 3STHA 2FSSA 2X9VA 2WE8A 4K9DA 1I0ZA 2NVBA 4MKRA 4ZGWA 2UUOA 3F1LA 4PLTA 1BDBA 1U7HA 4OGWA 4FJ2A 1M67A 4CLHA 3H9UA 3GG2A 3S1LA 4E5PA 2EKPA 2XAAA 1GQ2A 3UCXA 1V3TA 1XELA 3AU8A 3RUCA 3VPHA 2XOXA 4R9RA 5BSFA 2RH4A 2EW8A 1C14A 3ZU3A 4BO3A 1EE2A 1B14A 2XPCA 4DQXA 1EE9A 2PGLA 4J4HA 3HB4X 5K9ZA 1ADCA 5FFFA 4LGVA 1FDWA 1ENZA 1K89A 3EUWA 2IODA 1RPNA 3EGOA 1A5ZA 3L6OO 3OECA 5TF4A 2C7GA 1F17A 2O7QA 1ULSA 3TZHA 1HYGA 1YE3A 1HWYA 3QRWA 1JDJA 1P3DA 3NRCA 4D3DA 3ZDFA 1V3VA 4G5HA 1PS9A 2VHYA 5C7OO 3I4CA 3GOHA 4BNFA 4CUJA 4XR9A 1LRKA 1V35A 4P38A 2E82A 2AG5A 4CQLA 5CAEA 4FOSA 4RQTA 2FN7A 3VC7A 1FDTA 1PIWA 4PLCA 5THKA 4E32A 5DNAA 2X5JO 3DDNA 2FOIA 2CVZA 2YYYA 3OJLA 3PLRA 4M1QA 4UAGA 3JD3A 3ZWAA 1ONOA 4YB8A 5L4SA 3O26A 4IMPA 2F1KA 1HDZA 1I2ZA 1I3NA 3ENNA 4LMPA 4PCVA 5LC1A 4YAIA 1HRDA 4U0JA 1E3SA 1E6EA 3KVOA 2NQTA 2OXIA 4OQYA 3WS7A 1ZXBA 3ETGA 3PYXA 5F1KA 3CIFA 1DSSG 4L73A 1QKIA 1GZ3A 1FF9A 3R3JA 1Q7BA 1DBVO 1RYDA 2WE7A 4KMSA 1U28A 3JQ6A 3P2YA 1D3AA 4AJNA 1XA0A 2OMEA 4HUJA 1Y9EA 1IYZA 2VHXA 3RI3A 1NFRA 2A4KA 1DHRA 3T4EA 2GNAA 3LK7A 4W4TA 1T25A 3EVNA 4YACA 2YFQA 3VZSA 3KYDA 3GK3A 5BNIA 1XU9A 3DAGA 3GPDG 2HO5A 3AOGA 3NEPX 1DDOA 4TRRA 4XA8A 1DFIA 2HMWA 5HRUA 4OXNA 3DC2A 1VRWA 2C82A 5B4UA 4N5MA 4MP6A 2FR8A 3DZGA 2GN4A 2IDZA 4TVOA 3ZV6A 1PR3A 1MP0A 3I9MA 4NQZA 2A92A 5GY7A 3P19A 1AXGA 3GQVA 3V1YA 2ZTVA 4BNUA 4PG5A 4DBZA 5BSGA 3U5TA 3G1TA 2X0JA 1PQPA 1ZSNA 1B3RA 1QV7A 5K6AA 1EVJA 1ZCJA 5IDQA 2H6EA 3GEGA 4JX8A 1ZFNA 2NV6A 1BW9A 2FP4A 3MJEA 2B35A 4XEHA 4R54A 5A9SA 4TSKA 4E12A 5IDXA 1NTOA 2O3SA 5KJCA 1U1IA 3T7CA 4CMKA 3KHUA 3MJSA 5IZCC 2CDAA 3NT5A 3CSDA 3CEAA 1ULUA 1LRJA 2O50A 3Q2KA 1Q7GA 3JQBA 1BVRA 3D1LA 1YBMA 4WLOA 1E3JA 5L53A 4I8XA 4I1IA 4Q3NA 4WLEA 1Y5MA 1GUZA 4CLOA 4PLGA 4GGOA 2DTEA 2JHGA 2BLLA 3AM3A 4W7IA 2NVWA 3PDJA 1K6XA 1LEHA 5K0ZA 1E7YA 3ETDA 4IDGA 1DRWA 4CMBA 3WFIA 3GVPA 2VYND 2AW5A 3NT2A 2BFMA 1U2GA 3OEWA 3ITKA 4EI2A 5TGDA 2P2SA 5KCZA 2LDBA 3RD5A 4XQGA 4YWJA 3C7CB 3TNLA 3E9QA 4OO3A 3RU9A 1IY8A 3U3XA 3KLMX 3DWFA 4TWRA 4BB6A 4IINA 1U8FO 4QO7A 3VKUA 5KNLA 4U0KA 4E4YA 1U5CA 2H5LA 1HDXA 3GR6A 3ST7A 3HFGA 1NAHA 3Q9NA 2J5RA 1VL8A 4RVSA 3SC6A 1CETA 5KVSA 3FWNA 5AXBA 4BIIA 2D4AA 2AEFA 4FSHA 3SXPA 2QW8A 4NDNE 4WCFB 5DN9A 4FDAA 4NJMA 4R68A 4XZ3A 4OM8A 1UP6A 5H81A 2W2KA 1H2HA 2I76A 1WWKA 3ANLA 4N7RA 2YV2A 5JAZA 5DZSA 1W73A 1HE2A 3NTOA 5AOVA 4YRBA 3DZBA 3UW3A 1MA0A 1MC5A 1Y6JA 2Q99A 2DLDA 4IM7A 4OYRA 5EPOA 2AQ8A 3PVZA 2NLOA 1YL7A 2ZATA 3SBOA 1GUFA 1IUKA 4M86A 4CM8A 3HG7A 5JDIA 3GHYA 4XGNA 4OKNA 2PGJA 5EMHA 3RCBA 4XGKA 5KJ6A 1YQGA 3VH1A 2W98A 4D0RA 5JMPA 4NG5A 1R0LA 4RPJA 4TVBA 5I8WA 2R00A 4PLWA 3S55A 3F9IA 2Q49A 4GX2A 4WOKA 4D3SA 1A7KA 5A3VA 7MDHA 2D2IA 5JMWA 1FDUA 3I9OA 1JVBA 1KETA 3KSZO 3E9NA 2QG4A 4ALJA 2VWGA 1LRLA 1IOLA 3OA2A 2VWPA 3E18A 4UVGA 2BGKA 5U9CA 4L4RA 3DMTA 1R15A 2GZ3A 3EK2A 2ET6A 5T6BA 1NQTA 5DBIA 4OXYA 3G0OA 3M1LA 4R3WA 3A14A 4D43A 2W2LD 4JIGA 1PGJA 5COBA 3PHGA 3OM9A 1E7MA 1GADO 1VM6A 4OQZA 4RVUA 5EN4A 2OOSA 2AEJA 1KEVA 1C0LA 3WSVA 3PRJA 1I36A 2DUUA 4Q3DA 4IS3A 1EZ4A 4CM5A 4HKTA 2O3TA 2VZ9A 3NTRA 5F21A 1GR0A 1XU7A 2FPIA 4N5NA 3AI2A 4YQZA 2P91A 3L77A 2AE1A 2BFAA 5JW6A 2JJYA 3MOIA 1K6IA 3O03A 2R6JA 1J49A 3AU9A 2CF5A 1F12A 4J2HA 4J1NA 1QLHA 3H3FA 3W8FA 3AUSA 5ADHA 5AVOA 1LSJA 2GN9A 3KYBA 4MVJD 5BQFA 4MDHA 1HTBA 2V6FA 3OEYA 4B3IA 4MO2A 1VJTA 1DXYA 1KBZA 1NM5A 1VJ1A 2HU2A 2FZEA 3GFBA 3PGJA 4R1TA 4UUNA 1YRLA 5ICSA 5JAMA 4E6PA 1SOVA 5TT0A 1GDHA 4DPLA 3A1NA 4ZRMA 3U62A 4JJGA 3E6AA 5DCWA 4NBUA 4CV3A 1F0YA 3BZUA 1EDOA 4FFRA 3WBFA 1I3MA 1ENYA 1PJQA 4YR9A 3C1OA 4YJGB 3NAQA 1IHXA 3PI7A 3A4VA 4HX5A 3S2GA 4BO7A 4I9UA 3ZWYA 5AXCA 1P1IA 4JROA 5JDCA 4Z0PA 2QX7A 1TXGA 4E2WA 5AXAA 3ADPA 5JY1A 1IPFA 2J5QA 4KOAA 3IAHA 1OOEA 2IYPA 4KTTE 2X7HA 1UZMA 1JAXA 4R5HA 1PJLA 4MVJI 4NBVA 4BNYA 4K6FA 4C4OA 4E13A 5K6AC 1PQWA 1U5AA 2VT2A 1JLLA 6ADHA 5EQFA 2GYYA 3DO5A 3HN7A 5ENDA 4RVGA 2VWQA 4IIUA 2BH9A 1PS8A 3C3XA 2C2XA 3TQHA 1R4MB 4J1QA 1VJ0A 3P2OA 4OKIA 1Q0HA 2WJPA 3PWSA 4IBOA 3MTGA 5IN4A 3JQBC 3Q9UA 1XGKA 1YKFA 3BYZA 2EG9A 2EW2A 1SPXA 4W7HA 4B4VA 2HSDA 4B7XA 1FJHA 1ZH8A 1ADBA 2ZKLA 5CDUA 4IZIA 3V2GA 2H9IA 3ZW8A 1T4BA 1DIAA 1P74A 5TJ9A 1PGPA 1PSDA 2X5KO 4BMNA 2B4RO 4JQCA 1ZK2A 1EBUA 2JKVA 2VN8A 1LDNA 1D1SA 2QQ5A 3UN1A 4ZVVA 2JD2A 5COAA 3ZWCA 1ZEMA 3RUDA 2HRZA 4OSPA 5FWNA 4LSMA 4S3MA 2VRCA 4A7PA 3GDGA 4ZICA 3UOGA 3JCZA 3IJPA 1PTJA 5TC4A 4GGPA 2VWHA 5ILOA 5G4KB 3NGLA 4Z3DA 3WSWA 2X9NA 3H7AA 3Q1LA 2C29D 3H2ZA 4YQYA 4QFDA 1LU9A 1O95A 4WPGA 5JY6A 3I9JA 4J2OA 2FPGA 3EY4A 5I7FA 3PYMA 4PG8A 4J0FA 4CMGA 2HMTA 1CF2O 1AN9A 1D1TA 3QHAA 3NV9A 1ZKMA 3V2UA 2JCXA 1E1MA 2JL1A 1EVZA 4QXMA 3SLKA 3ZNOA 1B7GO 4Q3EA 1R12A 4EGFA 2IZZA 4J9VA 4RVHA 3VKVA 3VVBA 1P1KA 4WCFA 4CMIB 4PVCA 3QP9A 4CV0A 1XG5A 3RAJA 2WSBA 2XXBA 4FFLA 4M49A 4CL8A 3VPFA 1UXGA 5A9RA 1HEUA 3TPCA 3VPGA 2Q46A 3TWOA 3RBXA 2IYOA 2I5PO 3VHRA 5I7EA 1J0XO 2R00C 1N9GB 5KVQA 1ZK4A 2Q1UA 2VHZA 2X9GA 1AHIA 4RLSA 4O6VA 4XKJA 2FMUA 1DIGA 2HMVA 1I10A 4IXTA 1ZO8A 4NFYA 3RUAA 1A72A 4CQMB 4ZU3A 1NVTA 1RYEA 2PKQO 3PHJA 4BVAA 1NNUA 3V5NA 1S7CA 4BNNA 4DPMA 3LU1A 1KEPA 1VLLA 2DU8A 4L75A 2J8ZA 4M55A 3DMTC 3HFSA 5ES3A 3NDIA 4IJVA 4JJFA 2B5VA 3BMNA 4MVJP 2BD0A 4ZQGA 4NJOA 5LCXA 4E31A 2PK3A 1E77A 3KETA 4WLNA 4E5KA 3HJAA 1HT0A 1J6UA 4JJIA 1ISMA 1PWXA 4CLDA 1E7QA 3IUSA 3NDJA 4O1MA 3S8MA 1PGOA 3IUPA 4ALLA 3ULKA 2UUPA 1PWZA 4ITUA 2V6GA 4NIMA 3ZHBA 3PTZA 2G17A 4IDEA 4IJUA 1DO8A 1N1GA 1ORRA 3JQ7B 4CLEA 3M2TA 1PJ3A 4PGFA 3H4VA 4PLVA 2J3JA 3KEQA 4YAKA 2Q1WA 2A9FA 2CUKA 1H9BA 1NAIA 2GCGA 2WD7B 1Z75A 2J6IA 4XYMA 3DHNA 3PPIA 2NVUB 4XRGA 3F46A 3ONFA 4YPOA 1MV8A 1X13A 1MFZA 3KRTA 2TMGA 4QX6A 4Z3KA 5JYEA 1I5RA 4W6ZA 5F5NA 2POQX 1E1KA 1B2LA 5HA5A 1IULA 1ONPA 3Q0EA 3QW2A 4IXWA 2AMFA 1NPDA 3ICCA 3RC2A 1DJQA 3ENKA 3TZ6A 2B4TO 1T2CA 1JN0A 2BGMA 3WBBA 1N1EA 1XEAA 1BXZA 1GV1A 2JFFA 3D3EA 4IDCA 5L4LA 3TFOA 1H6CA 1XWFA 1Y8QB 1K0UA 3I4FA 3QJ5A 4B3HA 2V7PA 4E2ZA 4BGEA 5CPFA 3COSA 2JAPA 2DUWA 1H6BA 1U7TA 3OA0A 1J4AA 2Y1DA 3TOXA 1Y81A 3CXRA 1PGQA 3RQSA 4FW8A 1YDEA 4G2NA 3OJ0A 4GPD1 4DLAA 1B0AA 2Y1FA 4JP2A 1O6ZA 5U4QA 3HNPA 3FPLA 1HDGO 3IDSA 4FD3A 3V1UA 1MUUA 3GEDA 4Z0TA 3AJRA 4AJOA 3DFZA 4B4WA 4YT4A 2GRAA 3E48A 4BNGA 4YJGA 3MZ0A 4YDRA 4H16A 3U9LA 2EJVA 1SOWA 3EMKA 4O0LA 3IOYA 2X58A 5A06A 4TKLA 1CYDA 4A26A 1KVTA 2YUTA 1E1NA 4NBTA 4YA6A 3JQCA 3PJEA 3WQQA 4R1SA 3C1TA 3H65A 3RKUA 1DRUA 1HDCA 1M75A 2NNLD 2HRBA 3BHIA 4HY3A 4MIEA 4R1NA 2ZB3A 3PXXA 4M89A 4ND3A 4ZJUA 4XJSA 1SEPA 3E1KA 4XJTA 4A5OA 1LTHR 3W6UA 4IDAA 1T2DA 2I3GA 1C1DB 1R4MA 2YZ7A 3KOUA 2J3KA 4ONEA 1N7HA 3RFTA 2C54A 1UAYA 4ND1A 2ZTMA 4NU6A 1NP3A 5JNLA 2YQ5A 5H83A 4C7KA 1CJCA 1X1TA 1LNQA 2E4AA 1D7OA 1U3UA 5CDGA 5JLAA 3WWYA 5G0VA 4BGUA 4KDFA 2I67A 3C7DB 3RWBA 3KEOA 2DPHA 1ML3A 3TRIA 2BMAA 5B4TA 2FR0A 2HAEA 2O3QA 1UAGA 1GPDG 1P45A 1E7WA 2HQ1A 2YV1A 4O63O 4R41A 1KY4A 4W99A 5ER9A 5AYVA 4DIFA 3INGA 1A4UA 4R4JA 4ALNA 3U4HA 1PZEA 1NQ5A 3HB5X 1SNYA 3HE3A 1I32A 4I08A 1HYHA 1EDZA 3LYLA 5AQ1A 1WAMA 5L9AA 1LDEA 3AUAA 1EUDA 2NQ8A 2QZZA 4PLPA 4LISA 1CRWG 1ENPA 1YB4A 3W4IA 4BNMA 1GEGA 4D3FA 3OIDA 1IE3A 2FSVA 2Y0CA 1C0PA 4NPCA 1KY5A 2X4GA 5G4KA 5FI3A 5LDHA 4BKQA 5CEFA 3Q3CA 1Z6ZA 2Q3EA 2WYUA 2EF1A 4WCFC 1SBYA 4ESOA 1GYQA 1P0CA 4MIOA 3ON5A 1WXDA 3ZWWA 4DREA 4UEOA 1C1XB 4UVDA 4CL3A 1UXJA 4FFMA 3WJ7A 1SMKA 2LDXA 3NJ8A 4IIVA 1XCBA 4O59O 5T64A 5GZ1A 2E37A 2D59A 4PRLA 1GZ6A 1W0CA 2DTDA 3JQ9A 4NFSA 4BO4A 4CR7A 3HQ4O 3UCFA 3X2EA 4TQGA 3L4BA 4BHTA 2VOJA 2VHVA 3C7AA 1HZJA 2PKRA 4D46A 3LC2O 3ABIA 1TLTA 1WZEA 4XX0A 3JQAD 4BUCA 4CMIA 1N92A 1DIRA 1PJ2A 1DJNA 4RV9A 5T8KA 4PLHA 3JQEA 4A73A 3NDRA 3QWFA 4MVJE 2NTVA 1LA2A 5KOIA 3PWZA 2X6TA 4IGFA 4GAEA 3ZWBA 1N9GA 4URFA 1CQIA 1GQQA 4DQUA 2NTJA 5IXSA 2YJZA 3AUUA 1G6KA 3QWAA 3WGOA 1QXSA 1Z73A 1EEHA 3FPCA 2AEMA 3ICPA 1O9BA 2GN8A 4CQMA 3I1JA 3WIEA 2C5EA 5L45A 1DLJA 2Y05A 4BKUA 2P5YA 4DC1A 2VYVA 3W6ZA 3M2PA 4C7JA 5AXDA 4ALKA 2GO1A 1IZ9A 4E0BA 4BGIA 4YRAA 3AY3A 2Z1NA 2RH8A 3CE6A 1E1LA 1NVMB 4BS9A 3PHHA 3DAPA 3ZNNA 1BSVA 4YJFB 1PJTA 4PFJA 1ZMTA 1Y8RB 3FR8A 3ROQA 4P4LA 4WEOA 3S2EA 1WNTA 1XQ6A 3JYNA 4Q3CA 3WTBA 2A94A 2I6TA 1MXHA 1MLDA 3JQGB 4PLZA 3GT0A 3K30A 2J3IA 3FNHA 3OFSA 4UEKA 1P1RA 5BSEA 1Q0QA 3JQ7A 2O3JA 4IJWA 3FHLA 1NHWA 4YYZA 2RCYA 3PP8A 1TT7A 2HMSA 1DIHA 2O7SA 1EFKA 2WD7A 5KIAA 3V2HA 2NVUA 1Q1NA 1I33A 1Z45A 2Y67A 3E9MA 3HDYA 3FI9A 3GVCA 1GV0A 1F06A 3DMYA 1R16A 3TL2A 1A4IA 2JAHA 1UR5A 1WZIA 1NASA 1JKFA 4DPKA 2W8ZA 4KDEA 1N2SA 1X15A 4JBIA 3TFQA 3F1KA 2CNBA 2ZJ0A 1W6UA 2E48A 5KVCA 4GKBA 1UZNA 4PIVA 4D45A 4UUOA 3CUKA 2I65A 1T2FA 1Y8QA 3OBBA 1DC4A 5DCUA 4YTEA 1NFFA 3TSCA 3HUDA 5ITVA 5EESA 3RC7A 4HV4A 4BMVA 5ICMA 3WGTA 3RBVA 5FYDA 3ZHYA 4RORA 4BO8A 3GN2A 4EBFA 2BHLA 3VZRA 1XKQA 3I83A 5KVVA 3ADOA 2I9PA 4OIMA 1HYEA 2EJWA 5I8ZA 4P4NA 4OAQA 3H5AA 3INTA 2Y1EA 3JYLA 4NBRA 3B6ZA 4TZTA 2PV7A 4NMHA 4EUFA 3FTNA 3WWZA 2X86A 4PZEA 2VT3A 2CMDA 4YCAA 4NU5A 1X0XA 1Z82A 3GMSA 4TKMA 1NWHA 5CHEA 4QQRA 2Y0EA 1WPQA 5GZ6A 2CVQA 2ZQYA 1MG5A 3F6YA 1BXGB 2DC1A 4MPDA 4LN1A 4D7AA 4AJ2A 1I2CA 3W8EA 4J91A 3QA9A 4GKVA 1KERA 1E3IA 2E49A 3LF2A 1NQAO 4RF3A 2OZPA 2HDHA 2VRCD 3F5SA 2CFCA 4LRSB 1C1DA 1KYQA 3W8DA 2DKNA 3ETEA 5EJ2A 2PY6A 2SCUA 4M87A 4XYBA 1P33A 5A03A 3QWHA 1B8PA 3CTMA 3AW9A 4MP3A 2GF2A 3TZQA 1LLUA 3GNQA 5JYDA 1R0KA 5CEEA 1A27A 1U2DA 3SVTA 2JCYA 1HSZA 1P0FA 5TT1A 1I3KA 1UP7A 4HFMA 2AA3A 1JQBA 1U3TA 3D7LA 1GD1O 1U3VA 4QUKA 2GSDA 1ZBQA 2WEKA 4GL4A 1FDSA 2ZYDA 3DBHB 1GCUA 3ASUA 3DONA 4GX1A 4RZHA 5HWSA 5IDYA 5T67A 3U4CA 1M2WA 1ZK3A 2EKQA 3GUCA 3R3SA 2NTNA 3JQDA 4L4SA 4YEDA 1E6WA 2J3HA 4J43A 4TROA 3ONDA 2Q4EA 3I6QA 4L4XA 5F3RA 4CUKA 2EERA 4NFHA 1P31A 4WCDA 3JQ9C 5FF9A 4DVJA 3L4BC 3EZLA 2HUNA 2O4UX 4OHUA 3GHHA 2Z1MA 1UP4A 4B4OA 1BHSA 4FB5A 3WG9A 4OJNA 5T8KC 4Y8VA 4XGIA 1LQUA 1O0SA 2Y1CA 2Z5LA 2I99A 4IQ0A 4OH1A 1C1XA 1SC6A 2GZ1A 4I5DA 4D44A 5A1TA 1EFLA 1FK8A 1HDYA 1N8KA 1S6YA 2Q2WA 3FNGA 5EINA 4DBVO 4F46A 5CPBA 1GPJA 1OI7A 4HFNA 3VPXA 3IL2A 2OGUA 1DC5A 2X0IA 4HBGA 4I9HA 3NKLA 5A05A 4IUYA 2V6BA 1OAAA 1VC2A 3BMOB 4GVLA 3AFNA 1X0VA 3AWDA 1A9YA 1R37A 1VPDA 2GDZA 1O8CA 4E33A 5THQA 4XDZA 1B16A 1HLDA 3GDOA 1P1FA 5G0UA 4DMMA 3IS3A 1H94A 2GD1O 2Q45A 3H2SA 1NBOA 4XR4A 4Q3AA 3WGIA 4EZBA 3DZHA 5JAQA 3VTFA 2B83A 3JQ8B 4ZD6A 1MXFA 1Z74A 1H6DA 1LBEA 3VPSA 3RROA 4ZQHA 3LT4A 5LDGA 3PGXA 2PFGA 5JSFA 4J7XA 3MJ4A 4CMEC 2PWZA 3E8XA 3AOEA 3W4KA 3RFXA 2A35A 8ADHA 6LDHA 2GN6A 1HL3A 4ALMA 2Q4BA 2PD4A 1TI7A 1NVGA 4YJFA 7ADHA 4WNIA 5JCXA 5JAIA 1Y8RA 2X0RA 4RQUA 5JC1A 2PTGA 1B3BA 4UREA 4CLXA 1X7GA 3JQGA 3MJCA 3DZIA 4O5OA 2ZQZA 3F3SA 5BSHA 4GMFA 1KIFA 4FJ1A 4L8VA 2JCVA 2BI8A 1F14A 3NUGA 3DBVO 2ZK7A 1RJWA 2C20A 4B3JA 2B36A 1ZZEA 1BG6A 4IPTA 4BO5A 3PZRA 5CG1A 3NTQA 3BAZA 4YT8A 3GH3A 2G76A 1E7RA 4NBWA 2QRKA 2CSUA 4Z9FA 3UFXA 3GGGA 3GPIA 5JBIA 3NJ4A 1L7DA 2F00A 4YJHB 5ER6A 4BKRA 4FJ0A 3WOHA 4J16A 3IKTA 2OUIA 3OQ1A 4MVJF 1A71A 3DXFA 5KKCA 4INAA 1I2BA 1QR6A 1YO6A 2DBZA 4JCOA 3CINA 1HF3A 5B12A 5DBFA 2G82A 1YVEI 4RPKA 3G17A 1EUZA 3ZWXA 5A5EA 5I7SA 3A28A 3FD8A 3RUIA 1YH3A 5JO9A 3ZHXA 1R66A 2FWMX 2I66A 3ZU4A 3LC7O 3MOGA 4UVHA 2NU6A 3OICA 4AJLA 2YDXA 3BTOA 4XQCA 3H5NA 2ZJ1A 4FIZA 3OHSX 5L7TA 5COQA 3U09A 2ZB7A 1AXEA 1PU2A 4GH5A 1QYWA 1I8TA 4NZ9A 2DFDA 2X22A 2AHRA 3MEQA 3H9EO 4XB1A 3AI1A 4IY1A 4B7CA 4FGSA 1Y7TA 2AQHA 1AHHA 4Z9YA 1LLQA 1MFPA 4NHEA 4CR6A 2HK8A 3QWIA 4FN4A 4KQXA 4A03A 5I7VA 3WR5A 3JD0A 1EQUA 1BXGA 3PQEA 1DC6A 4E5MA 3Q2IA 3QVXA 2P5UA 5EQDA 1LDYA 1NQOA 3ZCXA 3GGPA 4ILKA 3D5QA 4CMHA 4RLHA 1K3TA 1SCUA 1G0OA 1QYVA 3EHEA 1WVGA 1KS9A 1VE9A 1RM4A 3DOOA 1LI4A 2CVOA 3WB9A 1PJBA 5CDTA 4FQ8A 2VUUA 3DOCA 4GLLA 2GGSA 3WQRA 4BKPA 1MB4A 2IEBA 3IMFA 3HWRA 4BGVA 3ASVA 1PZFA 1MX3A 1DB3A 3ZHZA 1HLPA 4CM4B 5FEUA 3K9QO 2GPTA 3EW7A 1ZW1A 3ORFA 4QFCA 3U4DA 4DA9A 2WWRA 4HNGA 4MP8A 3RFVA 3IP3A 3DOJA 4DYVA 2QIOA 4CR8A 3DBHA 4CUZA 1JTVA 2PA3A 4XYLA 5TSDA 3BIOA 2ZTUA 2QZ9A 4MVJH 5HS6A 3WGYA 4EEXA 4IQGA 4CLRB 4FGWA 2XXJA 1BGVA 4DIBA 1LQTA 1N7GA 4QSMA 3I9LA 1EQ2A 5F5LA 1YDWA 5L95A 3DAFA 5KTKA 4WECA 4Y67A 4NI5A 1C0KA 3PDUA 2CD9A 4IS2A 4EEZA 2O23A 3HHPA 4CQMD 2WMDA 1ISGA 3A06A 2NU7A 1UJMA 3F47A 1KOLA 3GUYA 3OQBA 2DBRA 4WK6A 2HLPA 2NM0A 9LDTA 2VOEA 2VYVD 3QE3A 4KWIA 3HZZA 3ZW9A 1H5QA 4WLUA 3PEFA 1O89A 4UVEA 4J7UA 3TZKA 1F8GA 4YBZA 3ZH2A 1HXHA 2PNFA 3ZI0A 4LCEA 2VQ3A 4E30A 4LCJA 3TOZA 3UH1A 2QRLA 5JS6A 3DHEA 3OIFA 5TQVA 4L76A 2WYWA 2ZYGA 1OMOA 2EHDA 4BO6A 2NU8A 5I9NA 3K31A 1OBFO 1ZUD1 2HJSA 2PZMA 5EERA 3RIHA 4LSWA 2O2YA 1PQUA 3BMOA 2E6UX 1C0IA 2B37A 2NUAA 1R6DA 2OFPA 3WJAA 4BO0A
chains in the Genus database with same CATH superfamily
1LI7A 2AXNA 4IWXA 1A8UA 3ZU5A 1NI4A 1RS0A 3HBMA 5AJZA 1NPYA 2B61A 3SIXA 5G4LA 1SOMA 1WMDA 1VL2A 2JFWA 4JNKA 1QRTA 1IQ0A 2X1HA 4P6VF 3LY9A 4C7VA 1YJ8A 3DTYA 4YPVA 1UKZA 2AQKA 2HL6A 1V26A 4G8DA 5DH9A 3JQ8A 3OM0A 3BZBA 2IHNA 1AF4A 2VNAA 4JLMA 2C98A 2X7XA 3HP1A 3KKLA 3HV0A 4KO3S 2Q1SA 1TM2A 3C43A 2Z6QA 3A9TA 1WMBA 4WT7A 3O4HA 1Y1PA 4FILA 2GARA 3RJ9A 2PX8A 2CFRA 3MLEA 1QYDA 5J5VA 4QDXA 5LA6F 3I8SA 4QPZA 1YF3A 5CM2Z 4AUKA 1VE1A 2BUCA 2ZI3A 3GLRA 4OREX 2OEPA 2QU8A 1RRMA 3ONNA 2QP3A 1JHMA 1D6SA 1HLFA 1PZMA 2D2FA 1DC8A 2QTVB 4ZQIA 1HE3A 2GPNA 5IJXA 3C5CA 3AB7A 1K5HA 5K8IA 4MYRA 3EC7A 3K20A 1F3OA 1S96A 2RHCA 2XR1A 4OOEA 3CLUC 3LE8A 2BFOA 1G2IA 5IARA 4KXYA 2XQGA 3SP1A 4D02A 3DAYA 3NYQA 1GTVA 1E6LA 2XSZA 2PKCA 2XDQB 2C7VA 5C8YB 2YDYA 4F0JA 3VSAA 2CNWA 3DJFA 3NVAA 3RSQA 5DN6D 1W5EA 2B1IA 1NGSA 5AM0A 3H9GA 4B79A 3JVDA 1NXXA 3G49A 4YRZA 5JD4A 1FFHA 5FL7D 3RGGA 1OAOA 4X64B 4DNOA 1C4WA 3RU7A 5I47A 1CY0A 2JH9A 5CYGA 4FHCA 4NU8X 4F3RA 3A9WA 3LXUX 5CX1A 2JARA 2PUTA 3CUTA 4QPPA 1V45E 2I6SA 4F4HA 2QGFA 4F45A 1PZGA 3NWBA 1E7SA 2I3AA 4H4EA 5EMJA 5TLSA 4IH9A 2G9NA 2QTZA 2B5OA 3MCWA 1OFVA 5BURA 2D7DA 4B84A 2UDPA 5HG0A 2WTMA 3H5IA 4WNAA 3LY7A 1KPGA 4KV7A 4N82A 5FA6A 3R9WA 2VQDA 2YCLA 4EYQA 2G71A 3LWNA 2BWJA 2P62A 3WDSA 4U7FA 4W5HA 1R00A 3DTVA 5DWQA 4QOEA 3F6BX 1WF3A 3WLEA 4QJ5A 3UAVA 1U9CA 1PGNA 3N5KA 3QEKA 1NBWB 4UNRA 3BIFA 4QGGA 5D87A 1XVLA 5E1MA 3JS5A 4M0UA 3OCJA 3TTXA 2V98A 1SQFA 1SELA 3RT9A 4IFTA 1JPUA 3QUTA 2EX1A 4N0QA 1LX6A 2Y0DA 4L5CA 2EP7A 3DOFA 3IURA 3PQ7A 1V5FA 5BQOA 3QKSA 4BAUA 4XB6B 2GBCA 1M6HA 1WMAA 4TN5A 1RYNA 2KMLA 1OGIA 3RLFA 4AVYA 4R71A 3ZV3A 3HN2A 4ZDJA 1U99A 3N3BC 4IW3B 2C5AA 2W5UA 5TS3A 3D6FA 3K1JA 2C0QA 1YZGA 4FBGA 5KNCH 2WJHA 2ZI7A 5H4HA 1G8GA 5FOSA 4OSOA 3E05A 3IT2A 1Y6RA 2WNSA 4GWGA 3SZ3A 3W6OA 4F8YA 4ZO7A 4EW6A 5C18A 1K4MA 2GASA 5JE8A 1LLDA 4BNXA 2FOXA 3UKDA 4ARZB 1K7EB 2IYUA 2OXFA 3BE5A 4WZBA 1WOMA 2PMKA 4CKBB 3UO8B 4HNAA 3V4VB 1J5PA 2PEYA 2YS7A 3E9YA 3GUUA 4HMOA 2QTLA 4MWOA 2VAPA 1UZUA 3ZXYA 3SZUA 3I2FA 1C3OA 2ODQA 5IN5A 3ZTWA 3GC6A 4V38A 2QVLA 3PYLA 4G1BA 2JK1A 4PONA 4Y9DA 4XWOA 1RABA 4K9LA 2F9LA 4HI0E 3E5RA 4I8DA 3JQAB 1GPUA 3IEKA 5ITWA 1U8ZA 3K9LA 1KDTA 1XLTA 3DAHA 2Q6IA 3FR7A 1D03A 4FFPA 2OLKA 1B6TA 4HXYA 1EFUA 3NANA 4JOCA 2D1SA 3PC8C 2H4XA 2AF4C 4TX1A 4KFRA 2FCAA 3H8VA 4HS9A 4CV1A 1ZH6A 1QFYA 1C7FA 1OU0A 2Z43A 4W5QA 1G7CA 2PGIA 2CLLB 2WF5A 2XTJA 2O2HA 3II6X 5HQ3A 5LP6A 2R1UA 2XMDA 1P73A 2RGAA 1NLMA 2AK3A 3HYNA 1WG8A 3CRNA 1O77A 4Z9XA 2AK2A 1RRFA 3C3BA 2QPTA 2FZVA 4AS2A 2VIIA 3AEUA 1EWRA 4YAOA 1M2OB 1ABFA 2QRNA 5DPMA 1UXOA 2H1VA 1SZCA 3I28A 4IIXA 5DM1A 3ZGOA 6REQB 1CEXA 1G8FA 1UPCA 2ZYRA 2OM2A 4MCAA 4HO1X 3PHIA 2QJFA 3MJTA 2YV3A 1UC4B 3DPUA 5FPPA 4E2YA 3VOAA 1LZKA 3F2IA 3PC6A 2QN3A 4ZV7A 9LDBA 4JP5A 3GT4A 5ALYA 3B1YA 2C9DA 3BHJA 1U3FA 4H7HA 1OXTA 4JR2A 2CY0A 4BFXA 2NP7A 1ULZA 3KAJA 1CHNA 4TLBA 1TNDA 1S7GA 1COWD 2NSDA 3LP8A 3UMFA 2OE2A 1J0BA 1UDAA 3CZPA 5KC8A 3BERA 3EAGA 1UXKA 1T2VA 2BM0A 2PT5A 1Y5RA 2JLZA 3GA0A 4HDMB 2KBEA 4HQ0A 3ZU2A 3EGVA 4LQDA 3CVUA 1FQJA 1INLA 3HYCA 4KPGA 4L8WB 3KUUA 3LT1A 3WWDA 2I1WA 4NATA 1R0RE 1JQLB 1B6GA 5HP4A 3G8BA 4Z7OB 4NBSA 1IVYA 3M82A 2AKAB 3H4IA 1Q2XA 1X38A 4JSRA 2Q3MA 3L1UA 3HDJA 2W42A 1E32A 1GU7A 4V02A 1U0BB 3GB9A 5IASA 5ESXA 3T12A 1YR6A 3BK7A 4I9FA 7ABPA 5I48A 1WHSA 3ZWOA 3I9V6 4DXHA 2XRYA 1KAGA 2I1LA 2A9PA 1QE0A 1K9SA 1E3WB 3IC5A 4S1VA 5HFAA 4YT2A 3QBTA 4KX3A 4W9NA 3WV4A 3K9WA 4X8HA 1S0UA 1V8BA 3N0TA 1U4OA 1WCIB 3TCNA 4Q3OA 3W5UA 4GSYA 2GUGA 1UFOA 1M6WA 4KWHA 2IHYA 3JZDA 2VJMA 3PQCA 6AT1A 5KVAA 1CUSA 2H7YA 4DRXA 3BXZA 1CPYA 4OQ4A 2HHJA 2JLYA 1ZD5A 1XCPA 1ESMA 5COBA 1SQ6A 1XJ0A 2KJQA 1ZGGA 3K71B 5GIOE 1IPHA 4MV3A 3UW1A 5BRJA 2WM3A 1BN7A 1PS0A 3SLRA 2HSGA 2NO4A 2OUKA 1KEUA 2IXAA 2RAVA 4WGFA 3VYWA 2OORA 1ECJA 1VQ1A 4RMGA 1CJUC 1TJNA 1KF0A 1QGAA 4JVNA 4FWIB 2NU9B 5FUMA 2NV0A 3LZDA 3MNFA 1DS6A 4FC6A 3UYLA 4F3CA 3OIVA 3TEMA 1FQOA 2FR1A 3CLUD 2B5WA 3DTTA 1O4WA 1GL9B 5F7OA 1JDSA 1QP4A 3HPRA 3IIMA 2ZCUA 3K2EA 2HSJA 3K1AB 1FE8A 4Z4CA 3DD5A 4UDOA 3TR5A 2BH2A 3DXYA 1W4CA 3JRNA 4QOIA 3WL7A 3UMGA 4Z54A 5AO9A 5EGSA 1U6KA 3H3JA 3OSUA 4GZLA 1RXSA 3KKQA 5ENVA 2YJGA 2QYTA 4RCZA 1O97D 1PYDA 2BAGA 4UAJA 3KZMA 1XQWA 4ZQCB 3IFSA 1XA4A 3W06A 1PEKE 1OLUB 1VE7A 2INGX 3JYPA 4QRHA 5HF8A 2GCIA 3O8BA 1Y4AE 2TMYA 1M1NA 3N2EA 3BSWA 3L84A 3O95A 4PG4A 5DYTA 3QE2A 1BN6A 2G04A 4DTIA 4BP9A 4HQFA 4F06A 1E66A 5C1IA 2H1CA 1CZOA 2OCLA 5EXTA 2YXBA 4KUHA 4Z0HO 1CEQA 4MS3A 3WLAA 1GYPA 5C51B 3HWSA 2Z58A 2PX4A 2RHRA 3NYIA 3WIDA 3ZV7A 7YASA 3GN1A 3V8BA 3R5SA 3PV0A 4BNZA 2D0DA 2QVXX 3SC2B 4EG8A 3EZ7A 1R0XA 4QPNA 3R9IA 4X94A 4D4JA 4RPCA 3I52A 3SSMA 4EHHA 1OGYA 5DK4A 4OHVA 4UUQA 2YZMA 4PZ0A 1KGSA 5HIJA 4X24A 1X3LA 5SICE 1RJ9B 5JCJA 3SY8A 5JYCA 2XDYA 4RF5A 3KAQA 1N3LA 1V6CA 4M4SA 3OKCA 4AYWA 4DR4B 1MN6A 2WRZA 1QKJA 3LZ6A 3KEMA 5CBPB 5CT4A 3OCUA 5K8TA 1CG6A 4XSHA 3ZQJA 4JI2B 3Q3VA 4NJEA 3KKEA 1V1JA 1YDFA 2P2DA 5ULLA 1KFBB 2QJOA 4GKAA 4HB2A 4IF6A 4X20B 5J9FA 1IB6A 2P9ZA 2W90A 5C5CA 4ZVNA 1C1YA 1QJ4A 2HBZA 3G0BA 2ZZNA 4JK3A 1DKUA 3KTDA 3LDUA 3S28A 1GNLA 2XKBA 2GX6A 3PLNA 2CLFB 4L74A 3UKOA 3ETNA 2PYIA 2H0AA 4WLVA 1KNQA 1P1HA 2RH5A 3O9MA 1QU2A 4F86A 5BNTA 1F8YA 2CWWA 1W88B 3OIGA 4JBLA 1J20A 4KWTA 2ZW9A 3WB1A 3IUMA 2XCLA 1KAQA 1YOVA 4L95C 2ONJA 1KZGB 3DBRA 4NZMA 4XQ9A 2YJ3A 2E5LB 4YASA 3B1FA 3NBAA 5JZBA 2IE8A 2C7QA 3ZE1B 1MDBA 2JEZA 2V65A 2B2XA 1SXJC 2RGBA 1HETA 2RGYA 5G0WA 4AZ3B 1YWGO 4BFTA 4H7DA 1XTRA 1RU3A 1E4OA 2WYOA 3FPFA 1PR4A 4IIGA 4PG6A 3SFTA 1IM2A 4I50F 1OFUA 2XDWA 3CGWA 4GXRA 3WLLA 3QU4A 4RPLA 2ATEA 2I80A 2PA0A 2ZB4A 4WN9B 3WFZA 4KWCA 3AL3A 2OCXA 4L5AA 1Z5OA 5L40A 4D57A 2Q2VA 1H42A 4IVRA 2H2HA 4EYOA 2Z8YA 2AN1A 2XCSB 2GNOA 2O3UA 3D7RA 4TPKA 3OQNA 4MWDA 1OBCA 1MQ9A 3HU3A 1CQJB 1FP6A 2QVCA 3BMNB 3LP6A 2HLDA 4XGRA 3C98A 3AGQA 3RT7A 1YL6A 4H7PA 4RL6A 3JARA 5B1YA 4DJAA 4U4AA 3AVWA 2XH8A 1J8QA 1QX3A 5F4BA 1W5BA 1TU3A 4F72A 5HJ7A 2EAUA 2Q1XA 2QUIA 1RQXA 1FFEA 1UMBB 4XWAA 3D0RA 4NK4A 4LZZA 5B3JA 4GI7A 2BRUC 4II3A 3LQ1A 3X44A 4DMFA 4E3ZA 4JVSB 3AR4A 3RIYA 4CV2A 3UJ3X 5JEDA 3E7PA 3A0UA 2WKRA 3RS9A 3UTCA 5K0JA 2VZLA 2H17A 5F52A 3L7OA 3WZLA 3LO5A 3KVNA 1SC4A 2FW8A 1P3Y1 4J0KA 3W6PA 3QVSA 2PRIA 3UPTA 2PG3A 5BVGA 3M6FA 3D4PA 3TQSA 2W9XA 3LQFA 1ZINA 1OTXA 4ZP1A 5TE9A 2VDOB 2H4YA 4IL5A 5DEOA 4DJFC 5H82A 1MVOA 1RZRA 1PKEA 1E1DA 1DLIA 3SSOA 4U8GA 3PEWA 4XD7A 1J7JA 2GF0A 4XUDA 1D5WA 2P7HA 4EVSA 2PS9A 1UFKA 3REOA 2ZS9A 5HMMA 3S5UA 2X8AA 3KSRA 4UFNA 1IL0A 1JHPA 2LGJA 2X23A 4O33A 3UB3A 3WLQA 5K8LA 5FX2A 4TZ0A 1QB8A 4AJIA 2BTQA 2JFPA 3IQEA 4HFRA 1SCDA 3VHQA 2G0TA 3TMKA 4BB9A 4DIMA 1ZJYA 2QRGA 1GY8A 3I6YA 1BVUA 4NCXA 2PQMA 4XCXA 3DC7A 2HWYA 1UBTS 3MWYW 4L50A 1IXYA 3HNOA 4RK1A 4N5LA 4K9OA 4FI3C 1VLZA 3FKJA 3ZWNA 2VJCA 4L3VA 3K3PA 1Z8HA 3KPJA 3R5XA 4A3SA 3IP7A 1ZNXA 5IZ4A 2ZAOA 4PSVA 3Q7RA 4ZOCA 1EM8A 3PUWA 2F48A 2NZWA 4E03A 2H54A 1T1SA 2YRWA 5C7IO 3CZAA 4QEKA 5HBGA 2NO6A 3ROKA 3V4OA 4AZ0A 2VTEA 3DE5X 3C7KA 1ZOIA 3ZX4A 2V7GA 1F4VA 1E6UA 3OU2A 4B7UA 1P44A 3L7DA 2G1UA 1KEKA 3RFUA 3N8IA 5AKEA 2B69A 3N39C 4UDXX 1L5HA 1N5LA 3RS2A 1HZZC 1UJ4A 1VI2A 4FNOA 1FX0B 3PXBA 4HSEA 2BBTA 5AK3A 5HILA 1RJGA 2AI3A 3L4EA 4P8RA 2P9JA 4IUCS 1CIVA 3NPAA 3KCNA 1P2UA 3KT6A 5H59A 2VZ0A 1H2FA 3M9XA 4IDFA 3EGDB 1Y3IA 3DF9A 1FTWA 1QG2A 3FSGA 3K6JA 4DCJA 1AM4D 4WGGA 1W5SA 1EGAA 4S04A 4LBVA 3CN7A 2ZI5A 4FN5A 2GCEA 4Y98A 2WC1A 2G4VA 4C4SA 5LYJB 3I05A 1ESEA 1KXJA 4TTAA 4LRWA 3MWGA 1JQJC 1V5IA 1ZITA 2NZJA 4PZCA 1UKVY 4O3MA 1V3UA 2F8LA 3QXGA 1KC3A 1SA0B 4ZQFA 1EIWA 3D8SA 5E1BA 2P8JA 3I9KA 4B44A 1CR6A 3RBZA 3LCVB 4F04A 1LDGA 2AXQA 2I78A 2AYYA 2XYGA 3DE0X 4D97A 4KXFB 5LDDC 3Q6IA 3VH2A 1QH8A 4RBNA 3HZOA 1SQGA 4MQEB 2ZEJA 3ZGYA 1AKMA 4UHHA 1JDTA 1YV9A 1AGXA 1SO8A 3QVVA 4QPDA 3DDUA 5SY4A 6Q21A 2O48X 2GXQA 1ODSA 3IIEA 3WLKX 4RIFA 1CUDA 1KI9A 1MO4A 2DULA 3LQRA 4XJXA 3V1MA 2FEWB 2DP4E 2P65A 2QT0A 5HUQA 2HA0A 5EZYF 1XALA 1UJNA 4HGPA 3TEJA 1JEYB 1VP3A 2IA5A 4ZCTA 5IEJA 1MAHA 1GCOA 4J7CA 1QB7A 3QWBA 4FS3A 2NW6A 1DQPA 3Q8KA 2VYNA 1SXGA 2VRWA 5A71A 1EK5A 5C7LO 5L7WA 1VE5A 1SUIA 3MUNA 1OILA 1TD9A 3OUZA 4ENWA 3D8RA 3WHIA 3QLVA 1NP6A 1NG1A 2QX8A 1TCVA 3I23A 6ABPA 1I01A 3F71A 4MYUA 3G1UA 2H06A 4LRYA 5AJWA 3VNBA 2IIPA 1AQ6A 4IR7A 2IX3A 3DB1A 5GJCA 3O8LA 3HR7A 2HEGA 3OZ7A 1FYEA 5KOYA 4N48A 2DUMA 2VDWA 1Z08A 3DLTA 2R7NA 2DVMA 3CUSA 5DNVA 3FRJA 5JXJA 2FQYA 4PCUA 1B76A 4Y0NA 3I04M 4ZA2A 4QT0A 4NEQA 4CF5A 2G5CA 4KG7A 1N5JA 4URWR 4U00A 4YGYA 3VXKA 5A6SA 5KJ1A 1XEXB 2VJPA 3HI4A 4W5OA 4J29A 3OTWA 4HDKB 4MB2A 4JR0A 5HKBA 3A3OA 2WDZA 2BKAA 4Q4HB 5KKAA 3SJAA 1LWNA 1K6JA 4GX0A 4IMIB 4J03A 3ZOZA 1U4SA 2KPOA 4GICA 1CDEA 1GQOA 4EJ0A 2WBLC 3Q3JB 3WGQA 1UMCA 2TSYB 1MAWA 5C2JB 2HH9A 1O5IA 2YZ2A 3C85A 1G8SA 4BNJA 3H2YA 4WKBA 1JAYA 1SXJD 1JW9B 1RLIA 3KOZA 4YMTA 1LJ8A 5BMVA 2RIPA 2X77A 1K0FA 2X3FA 3AR2A 3F5MA 3PZBA 1MX9A 3JQFC 3CKYA 1KU6A 4GE0A 2FRDC 3OJEA 1L5GB 4BUZA 2XGMA 2CHQA 2H5EA 2HXYA 4YQEA 3PIRA 4GM0A 5ALVA 4IKPA 1FS6A 1T3GA 4ZCLA 3RSOA 4BQOA 3FVWA 3HDQA 1EK2A 3EXHB 3H1AA 3DA8A 5DSXA 3HGMA 5JPIA 3FAKA 1B42A 3Q7IA 1UFRA 1V7QA 2D13A 1S2LA 2VT7A 5JDIC 2C4VA 1ZR4A 3GJTA 1A97A 1SHZA 5FLYA 1VZ3A 4RKWA 3QBDA 1X9IA 1Z16A 3WKAA 3GL9A 1L4YA 3OHPA 5I4BA 2HZ7A 4LPKA 1RAIA 2CDCA 3BTUA 4XPIA 5CAEB 3WK6A 4CQLB 2FWIA 1VBMA 3KLPX 3B36A 4RCYA 4UKDA 1DWPA 2O52A 5A3SA 3L6EA 2JNWA 4HSGA 5HRAA 1AC5A 2WUEA 1JF8A 1TYEB 1JBKA 1YZFA 2C3OA 4AY3A 2C58A 5E4JA 5FBWB 4OAOA 3BD8A 3DB2A 1KFJB 5HF9A 2OV2A 1Q20A 5TQ0A 1IHYA 2W2LA 3PF9A 1D2MA 2BOVA 3ORHA 4B2YA 5JS7A 1C3VA 1JV2B 2QRJA 1ZJJA 1L7BA 1KOJA 3ETLA 1SIUA 1YL5A 3WLHA 1ESNA 1QMGA 3VZDA 4WBNF 3AESA 3C4JA 3SEFA 4MW0A 4GQAA 2YWDA 3MCVA 4MO9A 3AI3A 1QH1B 1K4KA 4ZYWA 4BZXA 2VNHA 4DMUB 4MGHA 5B2FA 5LXTA 3W3AA 3S2FA 3ZQUA 5AVSA 1P5HA 3RYIB 1ATIA 2ZSBA 1NR1A 3OPYI 1DFGA 3WLFA 4OXKA 4WOJA 4CG1A 1FFAA 1WW2A 3ESYA 2XQIA 3ZGNA 4DVGA 1KVQA 2V59A 4E51A 4MVJA 4EATA 4P2GA 2DTXA 3FWYA 3OJOA 3RABA 3GBPA 1IUNA 5EKXA 3R6GA 3G8CA 2P68A 1I7LA 1XQ9A 1YQDA 2O2EA 3AEXA 3E8MA 1OLSB 2QG6A 1LPPA 1VP9A 1X7DA 5E6RB 1JQKA 2UAGA 1GFSA 2DQSA 3EFHA 3VNUA 1DC3A 3KOXA 1XMIA 2NXCA 2OT3B 2J7PD 4XXHA 2D5CA 3G23A 1T43A 4KXNA 4DAOA 5EJ5A 2YV4A 3GRKA 5M3BA 1WW8A 2GBPA 3OZXA 1RBYA 3U9SA 3Q4GA 1J5XA 2C5LA 2GAFA 2V96A 3MN1A 4X1IB 1PK9A 4FDVA 5E7MA 4ZT7A 3SF8A 5JPCA 4UBOA 1AMNA 4DQ0A 2OXRA 3DR3A 1G59A 4QBGB 4RE5A 1MO3A 2ZIEA 2CCJA 3FPSA 2IZ1A 3CB2A 3IIKA 1R7RA 1I5EA 2WU3A 3K2BA 4E08A 1PV4A 1PJRA 2R6CA 4BBPA 1T8SA 2FP4B 1PWYE 3IHTA 4FBLA 3QXHA 5FUQA 1WETA 3SD7A 4B40A 3TL6A 4LFAB 1C9DB 4TQUS 1SUBA 2R6GA 4XH9B 2YBEA 1L5LA 1JQ5A 5D3KA 1TCBA 3WSTA 4PIMA 2LKDA 3NAMA 4IXDA 4LWZA 4MVJG 4X9XA 5FKJA 2UXBB 2G70A 3RJZA 3KQLA 4ID9A 1S2DA 4R05A 5GJBA 2HDWA 1TIKA 3BAFA 2JLXA 2XE6A 3VMMA 1FX1A 1ZU4A 1X14A 1CUUA 2R1VA 2R8BA 3M49A 4K2AA 4QGAA 1T2EA 5FNVB 1KQOA 3RK4A 3UMBA 5IJZA 2C88A 3V8EA 4KYUA 4ME6A 3V1NA 1WCV1 1DVRA 3NBZC 4H3KB 1QP8A 1TF5A 5T4HA 3RASA 4XEUA 1XZCA 5JWRA 4XYEA 1DINA 4E21A 2HPHA 2JJ2A 5K20A 1B74A 1DAKA 2HD4A 1YZYA 3AONB 4OATA 2VDPB 2ZBGA 3CX6A 1H2AS 1RQNA 3QI7A 4G1FA 4Y3UA 4DN6A 4K6CA 4XQEA 1HYQA 1RRGA 4J0EA 3X1WA 1V41E 1XKLA 3R0QA 1KI4A 3C1AA 1K8XB 3PRKE 5K8CA 5FL3A 4KIUA 2I6XA 1WCXA 1Z0SA 1YRYE 3P5SA 1T1EA 3GJ4A 4MOWA 3SEZA 5JSYA 5I9LA 2PH5A 4TLCA 1IHUA 5KTTA 5BSUA 2X5XA 3BBPA 2P78A 4D26A 1OWPA 2EWVA 4QO8A 4YRDA 1MAUA 3S0JA 3DHWC 4E7PA 4EB3A 4OG2A 4C2AA 1HSOA 1MCZA 3B6KA 4AL4A 3C3JA 2X13A 1YS1X 3KOOA 3PRHA 4B73A 1FB5A 4ENTA 3Q11A 1L7EA 1RQLA 3AF5A 3FNFA 3VGJA 3GFSA 3VU3A 3NEJA 4OI2A 1SCAA 4FFNA 4RESA 1Q11A 1O94C 4ZKDA 4YRIA 3FF4A 4NJMB 5JNRA 2C1XA 1ZNYA 5DX0A 5DJ5A 2PX2A 1EINA 2UZ0A 4Q1VA 4DGQA 3AYXB 4F6CA 3SFZA 3AQIA 1VCMA 4KBFA 1TMOA 3UMYA 3BMQA 1NBME 1KRXA 3I09A 1KVUA 3UXYA 1NRJB 2Q21A 3W5JA 5AW2A 4WUTA 5DIZA 4NR0A 1I30A 1NZDA 3BL5A 5G0TA 1GZVA 3UAGA 4Q1BA 3VZQA 1PNRA 5BWOA 3GLQA 2GLXA 1AU9A 1K8QA 2CZCA 3WK8A 2MINB 1DQNA 2V4ZA 5JYBA 4A9AA 4Z51A 3NPMA 4LZNA 4G5SA 4D1YA 4EITA 2X40A 2CJPA 4JL8A 3ILYA 2PL5A 1R4NA 3AY6A 3LDHA 4M0LA 3IDQA 5DP2A 1UUFA 4G09A 3RR2A 4ZN6A 3HVKA 2BIFA 4M8NE 2I7XA 2AN4A 3EMBA 1P7PA 1T29A 4PICA 2C3YA 3IOMA 4N3NA 2CYCA 4CMCA 1ZWKA 5T5QA 3WQBA 1IU9A 4P54A 2BSXA 5AUNB 5DBGA 4LHSA 4RS3A 4HAZA 2FSSA 2X9VA 4K9DA 3NXSA 4NMLA 1AIPA 2DXIA 2WICA 1QQ5A 4JASB 4GDMA 3QEOA 1DCFA 1PO7A 1UMDB 4C0AC 1JHZA 3E61A 4DKXA 4Q7QA 4OGWA 3QBJA 2UYGA 2H8GA 4CLHA 3TGLA 1SG9A 1CUIA 2XAAA 1PFYA 1EP9A 4F6RA 3D4IA 3CVJA 3DZCA 1XELA 2HPZA 3R7DA 3T5DA 5CTJA 1C4KA 3R8FA 3ROXA 1II8A 3RYCA 3HYLA 1ZCAA 3PCTA 1IRIA 2RH4A 3OCZA 1NXPA 1CUEA 1O3YA 1C14A 4V0KA 3UK0A 1F6DA 4EEKA 4ZGGA 3U6BA 4PV7A 4E1VA 5DTMA 1B14A 1DAHA 4DQXA 3OZSA 2F55A 2C4KA 2XUKA 3OTGA 3A2NA 2ORIA 3UT5B 4X90A 1SC1A 2JGLA 1UDRA 4DC9A 4LGVA 3GT3A 3PUHA 4JJ4A 3P9IA 4NTZA 5FB3A 1RPNA 2R25B 1SVSA 1ZRSA 2FPIB 5FYQA 1PVOA 1F17A 3VBCA 1XP5A 1HYGA 1O4VA 1YE3A 1N2EA 2QTMA 2QR3A 1LFDB 4U7JA 1US8B 3ZDFA 3SNKA 4BQFA 4UZEA 1AMOA 1KTIA 3O0TA 1MA3A 4DQLA 1D8TA 4MEBA 4XR9A 1LRKA 2QRQA 4QWWA 5GQSA 4KC0A 3OE7A 2QAGB 1JIJA 4BYMA 3FTQA 1KRWA 2AG5A 1K86A 1TKCA 4FOSA 3J7AC 1AOXA 4J0JA 5C31A 2FN7A 2QLJA 4MUBA 3BQNB 5B58T 5C32A 1T6BY 3GMTA 3LX6A 5A7HA 1PIWA 1Q74A 2P9FA 2QKYA 3A6JA 2YUIA 5DNAA 2JJ8A 1O96B 1IIBA 2JI6A 2BEVB 5CA0B 2HW8A 1SQSA 3QX9A 5L4SA 1IZYA 1I2ZA 1L2TA 4LMPA 4WINA 4C6TB 4ZIRA 5C8XA 3OX3A 2CXRA 4CU5A 3GIWA 4LNHA 3UATA 4C4YA 3MILA 4PTYA 3GU3A 1PUXA 3SEQA 3MD0A 2IY9A 3R7AA 3MB8A 1S2OA 4BVHA 1CUCA 1L4LA 1EFCA 1AO3A 1XMXA 3PYXA 4HZUA 5CW2A 3CIFA 4F4UA 3FOEC 3QFFA 1GZ3A 5CVDA 5JJ5A 4RY0A 5B1EA 1DBVO 4FW9A 4KMSA 3U4AA 5ARDA 4G0MA 4EA7A 1MB2A 4K3UA 3OEHD 4KODA 4KXMA 4URZR 1EESA 3CW9A 4NKRA 1KXZA 3UWOA 4HUJA 2AT1A 1Y9EA 1IYZA 1UBMS 2PL9A 1BHO1 1CTQA 1Z3IX 2GD0A 3LK7A 3GRVA 5FOTA 2XVYA 3EVNA 4YACA 2YFQA 4RK6A 3NC0C 1Y5NA 2HO5A 1WDWB 1OAKA 1M2NA 1UK9A 3EWSA 3GPDG 5LQDA 3REGA 2ZPAA 4TYPA 1MB3A 2HMWA 3AETA 3MQ2A 2UZ1B 1VRWA 4C5CA 1Q7EA 1UPFA 5B58C 3FW1A 2FR8A 5BSVA 2PCJA 3ZV6A 1NJ5A 2BT4A 1MP0A 1VIDA 3U1TA 3TG8A 3QG5A 2WUGA 3Q6MA 2A92A 4IXNA 3PNSA 1TUEA 5GY7A 3C97A 1Y1QA 5IAEA 3SBDA 3FJYA 3U5TA 2IS2A 4G26A 1THMA 5FOQA 1WBBA 3L3BA 4UHCA 5FT9A 3HFRA 5EWMB 5E0OA 3EDCA 1B1CA 1PQPA 4GECA 4QSHA 1LK7A 5SYNA 4Q1EA 1DKRA 1ZCJA 2YC2C 3RIGA 5IDQA 2BKEA 5F78A 5I9SA 2H6EA 4AW9A 5CXSA 1ZFNA 2PV0A 3T7DA 3BWYA 3M6WA 5IDXA 2VYFA 3AVUA 1XZPA 5KJCA 2D3WA 4ENRA 3EXG1 3WA6A 4IDHA 2BSAA 2RDMA 1TVKA 2CDAA 2IZOA 2YICA 3KOMA 3MJFA 4M60A 1ULAA 5A3QA 1BXRA 3FCYA 3LI2A 4IIYA 3HXTA 5FPQA 3Q2KA 4GOKA 4H08A 3RLIA 3JQBA 1ZI6A 5KNBD 3A4IA 2GTHA 2BBSA 3D1LA 4WLOA 3CWCA 4CIAA 3QX7A 4I1IA 1GLNA 2JAWA 4L8GA 4WLEA 1GUZA 2V5AA 1HEIA 3F97A 4DKJA 1RDFA 2JHGA 2I71A 2ZB2A 4KGZA 4JMLA 1FQKA 5ALEA 2WY2D 2NVWA 2QI9F 3BH0A 4LV8B 5DT2A 2Z2JA 5HIAA 1BIFA 4ZXFA 1E7YA 3C6YA 3ETDA 5K0ZA 1Q15A 1GRQA 3GJ5A 1KH1A 4YC7A 3GVPA 2QD3A 2OOKA 4YRSA 1T0BA 4CNQA 1U90A 3WLOA 4IHAA 5TGDA 5D85A 5AVQA 5J4HA 2LDBA 3TUIC 4XDGA 4M88A 4YWJA 3C7CB 1O94D 1OASA 2MYNA 3JX9A 1JKXA 3O6VA 4OO3A 3W0LB 3N8HA 4YUAA 3WOVA 3P96A 4JLKA 2GXUA 2XWBF 1U8FO 1M2KA 4QO7A 3VKUA 1W2GA 1E9SA 1OXUA 5IT0A 4E4YA 6YASA 2NTYC 2H5LA 3IQWA 3GR6A 4LHYA 4A2WA 2LCIA 3ST7A 3A31A 3KD3A 5JZOA 1NAHA 3KQHA 1N2XA 4X1YB 3U3RA 4AULA 1HI9A 1ZWLA 3SVZA 4F3TA 1K9VF 3VC1A 4JUDX 2P2YA 3T5BA 3G9UA 2AEFA 1I51A 1Z56C 4TXMA 4R68A 1DQRA 3R5FA 4ND6A 1KP2A 4C01A 2ZWIA 5FUBA 2I76A 1CS0B 1JMYA 3ANLA 3MOSA 3ENQA 3P0HA 1N3IA 4NONA 4W8HA 3RRNA 1XTUA 5JAZA 2BFBA 2A8YA 3DMFA 4II7A 1HE2A 2RI1A 3MUEA 3NTOA 3FMFA 4QRIA 4Y9RA 4CVNA 5AOVA 5BSWA 2YYZA 2AMJA 1AZLA 3PTLA 2QROA 4F2HA 3BZWA 3BJZA 2JGMA 4IM7A 4BP3A 2AOUB 1WV0A 4JC8A 2GQ0A 1QYRA 3I64A 4X6UA 2FDRA 1YL7A 3NWOA 3SBOA 2UYCA 3UHPA 1E18A 2IDKA 1BA3A 3DKIA 3MT7A 3EW9A 3H04A 2PGXA 5EMHA 1T1JA 2PR7A 5KJ6A 3W2TA 2VATA 5JROA 3QKUA 2PE5A 3Q8MA 1GUDA 5UKDA 4P33A 4D0RA 5FPKA 2PMDA 3X1ZA 1ZL2A 5CFOA 2ZJFA 1XZAA 4RPJA 1R3DA 4TVBA 2R00A 3CY6A 3EVDA 4PLWA 4YJ2B 3ZC3A 1SURA 2W70A 3F9IA 3S27A 2KBFA 5A3VA 3DWGA 3PQ6A 5JMWA 5KHLB 4L85A 4HQRA 1TF2A 1SHLA 4ZTUB 1ECBA 2PQ2A 4LJ9A 1EXMA 1S02A 4XTRA 3GCGA 1UEXC 3RBAA 1W5FA 3E18A 1OX4B 3T3NA 3HSSA 4O2BF 5FQNA 3H2IA 2V7XA 3EK2A 2ET6A 1OW3B 5T6BA 1NQTA 2DFLA 5IC6A 4GPTA 4OXYA 1GGMA 4PRYA 3G0OA 3M1LA 2ID8A 4R3WA 5CCDA 3WWOA 4EFLA 5IU6A 2QX4A 4UDYX 2IYSA 2OENG 3OM9A 1VM6A 1USVA 1H0RA 4OQZA 3J81A 5HK9A 2BCJQ 1G18A 4AXXA 3I01A 3K8QA 4AP6A 3ETHA 5FHRA 1N6HA 3O73A 4ZJZA 4MUJA 1XZJA 1SY7A 3ROZA 5LZ9A 4HKTA 2O3TA 2ZJ8A 5J59A 4NNOA 1XU7A 4CHTA 3LPCA 4YQZA 4OLHA 4WW0A 3OZGA 1XZHA 3K6SB 2WIJA 3G1WA 3MIIA 3R74A 2X3UA 2ONKA 1SIOA 3O03A 1BWQA 2BE7A 2R6JA 3BULA 1AKYA 3AEQA 1M34E 1EWVA 4J2HA 4ZMRA 1QLHA 1KHHA 3EOZA 3H3FA 1OBHA 3T3MB 5AVOA 2ORWA 4YUYA 5K8JB 1FU7A 3KYBA 5ADWA 2V6FA 2QZPA 4WH0A 2OCBA 1JJFA 1QE3A 4B3IA 1VJTA 2MIIA 5KDOA 1RE1A 2ASEA 2HU2A 1IEWA 3CG4A 3K4QA 1M8GA 3GFBA 2AB0A 3B1ZA 4UUNA 1GFWA 2B7BA 4ER3A 3D1JA 5EJMA 4PIPA 2W2MA 5JAMA 3ZDBA 13PKA 4HDMA 4JJZA 5AH0A 5A3RA 4GO1A 4ZRMA 2YBDA 3N8KA 2RE8A 2CXTA 3PQ5A 5DGTA 5DE3A 1GU1A 5DCWA 2FOLA 2FUNB 2R8ZA 2RI6A 3A6DA 3SICE 4CV3A 2B4YA 3BZUA 4J6EA 1X6VA 3AINA 1H1LB 4FFRA 3WBFA 2EW1A 1XTTA 4DBLE 3U44A 2B1JA 2AVDA 5DHPA 5KYXA 2PMBA 4YR9A 4YJGB 5BRNA 4ER0A 1HO3A 3HL0A 3NAQA 4M36A 4IG9A 1CT9A 1G17A 3FZQA 2HA2A 2COKA 3IQHX 2PXHA 3KR2A 3K9GA 5AXCA 3FUUA 4Z0PA 4D8YA 1CJMA 4HAVA 5CNIA 2QX7A 1TXGA 1OQAA 1D2GA 1G3QA 5AXAA 2EFJA 1Z13A 2QWXA 3PPVA 3MUOA 1WCIA 4UARA 5K3FA 3OJWA 1A2OA 1DELA 1OOEA 3SU8A 4MB0A 2EZ8A 2X7HA 3KTAA 3LYHA 3O75A 4IIJB 1BHQ1 1NF3A 2N42A 1QUFA 7REQB 1HX7A 5TPZA 4NBVA 2APJA 2JAQA 2ZGVA 3NWPA 3EFOB 4PBTA 3EIQA 1QOZA 5DFAA 4C4OA 2L69A 3DDOA 2J0QA 4BB0A 4R1OA 5EQFA 4DWJA 2VWQA 1Z4OA 3AVYA 4MS1A 5DXAA 4UPDA 2E1PA 1TO2E 4J1QA 2VXYA 4F4DA 1R8XA 2CJFA 5NULA 1U0FA 4Q4JA 3AV3A 4LJLA 1WB4A 5JISA 1VSQA 1L6IA 1IJKA 5E6SB 5BN5B 5CLIA 5E7IA 3U0VA 5ES4B 3ABRB 5AP9A 1Z8NA 2QVYX 3Q9UA 1NOIA 1YKFA 3BYZA 4MTCA 1DC7A 4FCWA 5J43A 1QDEA 3P2IA 4HZIA 1FTQA 3ZUGA 4B4VA 1ZOPA 3HBAA 5DX8A 4QHTA 2HSDA 2YRXA 1CY1A 5HFNA 3QE0A 1ADBA 4ZCPA 4DSZA 2CJXA 5KQLA 4MAFA 5HOEA 3HVJA 2JLRA 4K6HA 4Z2AA 2H9IA 4RFSA 4LC9A 1A96A 1RCTE 1E2GA 3GCWA 2AI1A 4TTQA 3WIBA 3QE9Y 1U7ZA 5TJ9A 8AT1A 1JFFB 3JTEA 4X7BA 3VGPA 2AC2A 3VJKA 5JHHB 3ZE9A 1U2GC 3IQIX 1QF9A 5D3MA 2VH2A 3OO1A 3W5SA 2VN8A 2H85A 4ZVVA 3KE8A 4F12A 1W9MA 3KEFA 4GRAA 3HUEA 2JD2A 4EMTA 4AO7A 3ZWCA 1IJFA 3HDTA 3O8OA 4EJSA 1KWKA 2OYCA 4LSMA 1AKUA 4DCMA 1N4DA 1RKVA 3SC2A 2W2XA 3A6KA 3UOGA 4NRDA 1RLJA 2DPXA 3E23A 1AJEA 4DE5A 1I7DA 5A0VA 2ZE8A 3F7OA 4HNVA 4OB6A 3VR6D 1JR3D 3R0JA 1QCDA 4HEJA 1LWOA 3AY0A 4Z3OA 3R0ZA 4HWRA 1JMVA 4RELA 4AWAA 1Y8CA 1UPTA 3UKJA 3OPVA 1YRHA 4WRRA 1W36B 3PYMA 4MNTA 5G1OA 2Y1XA 2OMKA 4CT5A 5I4IA 4J0FA 4BFZA 1UWVA 4ETWA 1AN9A 5BSRA 2OC4A 1D1TA 4K05A 3IESA 3NV9A 3FETA 1RKQA 2AG6A 2GBIA 4REQB 1ZKMA 5HDQA 1E1MA 4QATA 1LNSA 3K9BA 3A9UA 2GD2A 3UT0A 3CZCA 1SVOA 1J2YA 1QQ7A 3H1BA 4KXVA 3WLPA 4EL5A 1OH6A 1R12A 2JHAA 3B89A 1I13A 3C5WP 3EIUA 3FUVA 3KT8A 3PDCA 4RVHA 1WXGA 1Q6ZA 3OOHA 4WCFA 2REQB 2LCQA 4QUGA 1GVHA 2FZLA 1PR5A 1TYDE 2Q7OE 4FFLA 4TS3A 3TE7A 3ZHTA 4CL8A 5EHXA 3Q8LA 4W1SA 2O0KA 3G8YA 2V45A 4V1CB 2JCSA 2HU7A 4KMOA 4UXIA 3SXUA 2Q46A 3FKSA 1QHHA 4M0CA 3TWOA 2G1AA 4WXRA 5KVQA 3RSFA 1N9GB 3KNZA 1ZK4A 4G89A 3L49A 2D6FA 4RLSA 1JXOA 3R0VA 1DRKA 4QU5A 1ZO8A 1N9KA 2ZQ5A 3BGVA 5F9MA 1N2CA 4AUMA 4CQMB 3CX8A 821PA 2PZFA 4I1OA 4GXNA 2I1VB 4IP0A