2QHXA

Structure of pteridine reductase from leishmania major complexed with a ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
264
Chain Sequence
TVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent pteridine reductase inhibitors to guide antiparasite drug development.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 96
structure length 264
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qhxA00
3UFXA 4RZHA 4GX1A 2DPGA 4W99A 3RKUA 4QUKA 1YDWA 2YW9A 1B26A 4XYMA 1QYCA 3D5QA 3JQFA 4BO0A 1H6DA 2GF2A 4BKQA 3OIFA 3KZVA 1V3UA 2Q99A 1H9BA 2CDAA 3RBZA 4IDEA 5CDTA 2BHLA 1AGNA 1C0PA 4HNHA 4AJ2A 1HYHA 4RVGA 3GZ4A 1NBOA 3CXRA 3WJ7A 2HCTA 4RQTA 3BMNB 3EZLA 4E32A 4R5HA 4HBGA 4FB5A 3HDHA 4W6ZA 5L53A 4N5MA 3DONA 5TS3A 1XA0A 2V6GA 3GZNA 4FGSA 4NJMB 3FWNA 2BD0A 4TSKA 4BGVA 4M8SA 4U6SA 1ZMOA 2Y1FA 5GZ1A 2B4RO 4OIMA 4R01A 2PZMA 4IZHA 3K31A 1I3LA 3GPIA 4Z9YA 1NQAO 4GMGA 1PEDA 3LT1A 4D42A 4LRSB 2WD7B 4GSLA 4RPHA 3DZHA 3GT0A 2OOSA 1F06A 1TA4A 5B4VA 4MPDA 3E8XA 1U4OA 1A4UA 1X14A 2YHIB 4IJKA 1XYGA 4BNMA 3VPFA 4CM4B 3PYXA 3MEQA 5EQDA 1VI2A 3CSDA 3WNVA 2ZYGA 3Q9NA 2O4CA 4YJGB 4AJIA 5ER9A 3HG7A 2QX7A 3L4BC 3NGLA 1E3WA 2Y0DA 5JPIA 4Z6KA 1GQQA 2VWQA 1ZJYA 3PP8A 1K0UA 1DAOA 4YAGA 3D5TA 1K6XA 4J7CA 3SX2A 1HTBA 3BTOA 1E7YA 4IDDA 1YJ8A 3SXPA 4R1SA 3WOHA 3WWYA 4DXHA 5FEUA 4FFNA 2DBRA 4ND3A 4HNGA 3WTCA 1UXHA 3WGIA 1KVTA 5KWEA 1Q7CA 3H7AA 4L75A 1YL6A 2ZQZA 2HSDA 3GH3A 3QRWA 2GCGA 3NX4A 4KP7A 2Y1GA 3WSWA 4R16A 3S2GA 1B7GO 2CVQA 2X5KO 1HLPA 5CAEA 5CDGA 4NJMA 2V65A 3I9JA 1YJQA 5DULA 2FZWA 3JD4A 4QEDA 1HF3A 4XGNA 4PG5A 1TEHA 3VKUA 3QQPA 3D4NA 4NHEA 2VZ9A 1PL8A 1Y81A 3FI9A 1FMCA 2B0JA 4D41A 3PZRA 1DEHA 2Z5LA 2NWQA 4WOKA 1MP0A 2HKIA 3IQDB 5AOVA 5KKAA 5I9LA 4J2OA 4I9NA 3C7CB 1C1DB 4ZVVA 3AUUA 3D64A 3WX0A 2WYVA 4BNXA 4BNUA 4E4YA 2O7QA 4I8XA 4CLEA 5B4UA 4JCOA 5AXCA 4WCDA 1WP4A 4XB1A 1N1GA 3JTMA 2G1UA 1RYDA 4XB2A 1I33A 2BI7A 1UUFA 3OETA 5H81A 1LDNA 4KWHA 1GZ6A 2EEZA 1WAMA 3K92A 1ZK4A 1YQXA 4BO2A 4EW6A 5IAAA 3JQDA 3T4EA 3C7AA 3F6YA 4AJNA 3KLMX 3R0IA 4YT5A 4KDFA 4Z3DA 4MVJI 3L6DA 3W8EA 2GR9A 3N74A 4CQLB 3ITKA 2NADA 4FFMA 3ONEA 3D1LA 4BNZA 4YAIA 2C2YA 1N5DA 2C7VA 2DBQA 2NU8A 3BAZA 3TFOA 1PJ4A 3LLVA 1PL6A 4E5MA 4RPGA 1UP7A 1ZFNA 4XDYA 3D4OA 5CDSA 4I5GA 4O6VA 2C7GA 3MJEA 4HKTA 2W2KB 3CUKA 1IPFA 4AJHA 1PWZA 1XLTA 4Z9FA 4IUYA 4J3FA 5GZ6A 2X58A 4BKUA 1FF9A 3IJRA 3JV7A 3OJLA 2GASA 2PD4A 4JX8A 1Q2XA 3LDHA 3GNSA 3WNQA 3H9GA 5DDIP 2RBEA 4WK6A 3F3SA 5GMOA 4E33A 5AQ1A 4XJSA 3H6KA 3WFIA 5KOIA 3T4XA 3GDOA 1GD1O 3JD0A 5T57A 2Q1UA 2C5AA 4BNHA 3O38A 4YJHA 1YB5A 3VH2A 5JY1A 1V3TA 1H0KA 4OOFA 4I5FA 1PIWA 1TLTA 1WDMA 3T7CA 3LT2A 2Y67A 5IN5A 1JQBA 1X7GA 2B83A 3BMCB 4B3HA 1F12A 2WYUA 3HJAA 4M1QA 1I36A 3U49A 3D4PA 1OOEA 3GQVA 3WB9A 1CQIA 4DQXA 1UAGA 1LUAA 2ET6A 4YCAA 1UZNA 5B37A 1NYTA 3MTGA 2GUGA 1D8AA 4R4JA 1EDZA 3NDRA 3ZWCA 3AM3A 4JJGA 1DXYA 4XYBA 4E5YA 1T2FA 3JQ8B 1R66A 4E6PA 3KYBA 5IDYA 3ABIA 4QO8A 4CQMD 1U7HA 4BVAA 4CM9A 1NM5A 2I76A 5EN4A 2VZ8A 3GRPA 2IDZA 1F8GA 1TT5B 2HU2A 1BDBA 1H94A 2NUAA 4R41A 3G49A 2J6IA 1YBMA 5U1PA 1X1EA 5A9TA 4S1VA 5JCXA 2HMUA 2W90A 3EY4A 3PIIA 4HFMA 1Y1PA 4XQCA 2OP1A 4PZEA 5TLSA 1E3JA 1HDZA 1GCUA 4YYZA 1NQOA 2C07A 3U62A 1F0YA 3UHAA 4CM3A 3DAPA 1ZEMA 3GUCA 3HZZA 4A7PA 2XAAA 1P74A 2AQKA 5DCWA 4A03A 3TOZA 1CIVA 4WNIA 4JP2A 3ZW8A 1NVTA 1J0XO 2FMUA 2GN4A 3LT0A 2NV6A 2YJZA 2NQTA 4DYDA 3OJOA 4R69A 1B0AA 4BNFA 5FWNA 3DBRB 2NQ8A 4TVBA 1XU7A 1GPDG 1Y8RA 3AFMA 1S7CA 4OAQA 3U4CA 1B8PA 1R6DA 1O94A 4AL4A 2HK9A 2OO5A 3N7UA 3OJFA 5G0VA 3IIEA 2W2LA 3MJCA 4P4GA 1I2BA 1HYEA 4IINA 5I7FA 4QECA 4WASA 2FZEA 1I32A 5L7TA 3HB4X 3PLRA 1LDMA 2D8AA 4H16A 5KCZA 4YA6A 4A73A 4I9HA 2POQX 2Z95A 4EUEA 4CQLA 4CL8A 3E03A 1BVRA 4JP3A 4URFA 3F1LA 1Y8QB 4NBWA 3PFWO 4UUPA 3NDJA 3I9KA 1KBZA 2PZKA 2XXJA 4ZHSA 2R6JA 4J1QA 2Y1CA 3MWEB 4IIVA 1DJNA 2DKNA 3RSHA 5ILOA 2IZ1A 2X6TA 4JLWA 4AJKA 3UGKA 5TRTA 2VYNA 1JTVA 3OEWA 5COAA 2BI8A 3W4JA 1X7DA 1M76A 3VTZA 3VPSA 3KTDA 1QXSA 4BQPA 2PA3A 4ZRMA 3V1UA 1UXIA 5JBIA 3BZUA 3UCXA 4Z0TA 3WQQA 3E82A 4E2ZA 4DQUA 4Q3NA 2HMTA 1EK6A 4YRBA 1R0SA 2D2IA 1NNUA 3C8MA 4P22A 1GEEA 2AA3A 3RFXA 4BV9A 2GZ3A 1N92A 2EG9A 2VT3A 3B1FA 1K3TA 1SAYA 1I10A 1SZJG 4YACA 1PJ2A 4ZD6A 3JQ6A 4EZBA 2ILTA 1DO8A 4WLVA 4NPCA 3PI7A 5C5IA 3HDYA 4C7JA 3GN1A 5I9MA 3AWDA 4YAKA 3FR8A 1PR9A 4M49A 1JWBB 4NJOA 4RF3A 3FPLA 1UDCA 4AFNA 3PYMA 4ROSA 1AUPA 1KEUA 3I9MA 1PTJA 4BO3A 1ADGA 4RQUA 1C1DA 2VWHA 1NXQA 5BNFA 3ROKA 3OECA 2G82A 1QG6A 2TMDA 2X4GA 4R68A 3E9MA 1ISGA 3RFTA 5H83A 4Y6PA 2B37A 5F1KA 1P9LA 4E30A 1DIGA 3D3EA 1MV8A 4JXKA 4DYVA 5TNXA 3ZWAA 3QJ5A 1ZIDA 3DEYX 5BSGA 1HZZA 1JVBA 1IY8A 4ZU3A 4UAGA 2I3AA 3GVIA 4P8RA 2YYYA 5EERA 3I9LA 3OQBA 3OH8A 4YQYA 3WYCA 1SBYA 4UUOA 1GV0A 2GN6A 1SMKA 2BFOA 3PJGA 1Y9AA 1CRWG 4NQZA 3TOXA 3CE6A 2BF7A 1LSOA 2I5PO 4D0RA 5L4SA 4KZPA 2FP4A 2PFGA 4IDGA 2C54A 3ETGA 3QWAA 5JAIA 3TPCA 5HWSA 4OO3A 1HDOA 4LMRA 3ZWVA 4E2WA 4M55A 4DC1A 1LC3A 3WYBA 3EAGA 1D3AA 1VJ1A 1PJCA 3I83A 1LRJA 3M2PA 1RM5A 1OC4A 3W8FA 2ZCVA 2Q3EA 3E5RA 3KEOA 1HEUA 1UP6A 4RVDA 2HMSA 2O3QA 3KV3O 2P9CA 4XGIA 3ROMA 1ML3A 3LSYA 1GYQA 2W2KA 2ZATA 3ZW9A 1ZK2A 4IZIA 4NBVA 5G2OA 2J3JA 1LDYA 4NDNE 4FC6A 3L0DA 5I8ZA 1GYPA 4CV3A 1E3IA 3AI3A 5T6BA 3O26A 2O3SA 1Q0HA 3A28A 4DLLA 1EUCA 4UVHA 2YHUA 4CR8A 1TXGA 5L95A 1DHTA 5DZSA 4CMIB 3M6IA 5C3MA 4EI2A 4DWVA 4IQ0A 1DRVA 1U28A 8ADHA 5HS4A 1UAYA 4B4VA 1X13A 2EHDA 4K1LA 5BNTA 3KO8A 1BG6A 1D4FA 3PYLA 5CP8A 5T5QA 3KSZO 4BO9A 3KSUA 5JYDA 1HKUA 3B6ZA 3ORFA 3ETDA 1LA2A 1Z82A 4FIZA 5COQA 5K6AC 5KJ1A 4AJLA 2EKPA 5A9SA 4JJIA 2QZZA 1QYXA 3ZDFA 1OC2A 3GGGA 3WMWA 3IL2A 2PTGA 2O4UX 3DOJA 3ST7A 3GGOA 3L4SO 3JD2A 4XJTA 3LC7O 3UN1A 3CTMA 3PHLA 5K6AA 2VHVA 5EMHA 3VVBA 4KTTE 2NU7A 3FBTA 3ZZNA 4OXYA 1LSSA 2ZK7A 4XQEA 1UXJA 4OM8A 3S8MA 1WWKA 4NFHA 4D3DA 1C3VA 3ASVA 1SO8A 4QO7A 4BNNA 1H5QA 1O6ZA 1MXHA 2ZYDA 1ZBQA 2W8ZA 1O8CA 3WS7A 3ZWPA 2Q2QA 4IDAA 2WD7A 4XDZA 5DP2A 5LC1A 5EIOA 3SEFA 5C37A 2WM3A 3WQSB 3MJSA 3SJUA 4F6CA 3WG9A 4WUVA 3H9JA 1IULA 3A1NA 4UVGA 5JS6A 5TIIA 1GUFA 4HP8A 4BB6A 1IHYA 3PFFA 4L4RA 2VTDA 4JBIA 4HADA 3VPGA 4DRYA 3I5MA 1ARZA 2HK8A 4CM4A 4A10A 2PV7A 2YUTA 4DPMA 1Q0LA 2O23A 2NACA 4PLFA 4R3WA 1E3LA 3PHIA 4PRKA 2BMAA 3E18A 4YJGA 1R12A 2FY8A 3INGA 1MC5A 4BNWA 1H6BA 3QP9A 1VM6A 5DBIA 3DC2A 4XQGA 1DIBA 1Y8RB 4J0FA 4XZ3A 3GVXA 3ZV4A 3G1TA 3Q3CA 3KSDO 2AW5A 2IZZA 3L4BA 1SEVA 2HK7A 4IGEA 5DNAA 3AY3A 2UVDA 2QRKA 3GAZA 3GNTA 3U4HA 1ID1A 3JD1A 4GVLA 4Q3CA 4OKNA 3X2EA 2E37A 2CDCA 3ONDA 5T67A 3DHNA 3RC9A 2IYPA 4L8VA 1U4SA 3U3XA 1VRWA 2QZ9A 3AOEA 4IBOA 4OXNA 2EGHA 2J3HA 5G0SA 1PJLA 2VHZA 1YDEA 1UZLA 3FBGA 1U3WA 2CDBA 2DAPA 3DZFA 5T64A 2UYYA 3AY6A 4QT0A 3KM0A 3ZU3A 4FD3A 7ADHA 1YKFA 1IZ9A 5BNIA 4J49A 1X7HA 4PVDA 5F3RA 4GKBA 4RLSA 4WCFC 4LSMA 3PXXA 3FF4A 4PLVA 2VHYA 1G0NA 3TDKA 4J91A 3AK4A 4PLTA 1CETA 1E1MA 3JQ9C 4F45A 3K2BA 4BOYA 1IZ0A 8LDHA 4I9UA 1Z7EA 5JCJA 5JC1A 2PWZA 2X1HA 1LI4A 3RUAA 5CEEA 1P3DA 4QXMA 5CPFA 4LVCA 4TROA 5JDCC 3ZWYA 1FDVA 4L73A 5HBRA 5JYEA 5JNLA 2YZ7A 3KEQA 4XRRA 3WBBA 3EHEA 3VZSA 1P77A 4E3ZA 2PNFA 3QVTA 2O2YA 1GUZA 3GMDA 2G0TA 4OXKA 3V2UA 4IGFA 1XEAA 4E21A 1ZKMA 1OI7A 3PDUA 5EPOA 4IDCA 1LRLA 3BA1A 3K96A 1KEWA 1B14A 4MIEA 2YFHA 2JD0A 4RO0A 2VYVD 2GD1O 2AQ8A 2RHCA 3JQBC 1U5AA 1I2CA 3B70A 3WDSA 1U3VA 1QRRA 4EDFA 1U2GA 5A4DA 3Q2IA 2Q49A 2VUTA 1G1AA 5AVOA 4DGSA 3C1AA 2DQ4A 3RKRA 3JSAA 1A7KA 5KIAA 1DOHA 3H5NA 3VKVA 1IB6A 4M54A 3DTTA 1ZK1A 2Q2WA 1PZEA 1PGPA 2ZTLA 1JW9B 3JQBA 2D59A 2JCVA 4AJPA 5L4LA 2BFMA 3QWHA 2EF1A 1QYWA 1GPJA 1T26A 1DC6A 3S2FA 1ZNQO 1SEPA 1HLDA 1FDUA 2PH5A 3TRIA 4ALIA 3FHLA 3QWFA 3DAGA 5HA5A 5JXWA 1ZO8A 5IG2A 1Z6ZA 3VC7A 5FYDA 2NVUB 5KVSA 3JQ7A 1ORRA 2PD6A 3HSKA 1RM3A 3GN2A 4YT4A 2HAEA 4L76A 2OXIA 4IJVA 1LQUA 3Q1LA 4FBGA 3D0OA 3TZKA 3CPSA 1ULUA 1YH3A 4DVJA 3QVXA 4HFJA 4J4TA 3VHRA 3ZWWA 1G6KA 1A71A 4BIIA 5ENDA 4ESOA 2O3RA 4D79A 1O5IA 3O4RA 3DBLA 4D0SA 2GLXA 1E92A 3RROA 3EW7A 5GZ3A 1I2ZA 2JL1A 3OHSX 1R16A 2GZ1A 4DL9A 4FQ8A 2HLPA 2IYOA 1GL3A 5L7YA 3P19A 4O1MA 3ICCA 3PWZA 4NBTA 4ZQGA 5K9ZA 1PJSA 2WSBA 3X2FA 2ZB3A 1J49A 2V6BA 4CLHA 1XR3A 1IYZA 1DLJA 3PTZA 3P2YA 4HXYA 1P31A 2V6MA 3ANMA 3PEFA 4QFCA 4WLUA 4LGVA 3TFQA 1EEHA 1G0OA 4FN4A 5EQFA 4NI5A 5IDWA 4PG4A 3S2IA 3NYWA 3L6EA 3O8QB 2OORA 5DOVA 4OOEA 3QWBA 4B7CA 3RWBA 3IKVA 1PZFA 4NK4A 4WLNA 1M67A 1X0VA 1ISHA 3BTUA 1R4NB 3NGXA 1E3SA 1XWFA 4YRAA 1GTMA 1B8UA 3C24A 4PG8A 1Y6JA 2CFCA 3JQ9A 3LC1O 1X0XA 2CMDA 2B5WA 2DC1A 3NJ4A 1KC3A 1LLUA 2DPHA 3DWFA 2YDXA 1NPTO 1KEVA 1B2LA 3NKLA 1HDGO 1BW9B 4K6FA 2FR0A 2QRLA 4O0LA 5TGDA 4FW8A 1FK8A 5F1OA 1GQYA 1ADBA 5HS6A 2JKVA 2X9VA 3RVDA 2D4AA 3TL3A 3FN4A 2ZB4A 3NTOA 3O03A 4RDHA 3W4IA 4TQGA 3K73O 3KRTA 2SCUA 3NV9A 1BDMA 1BSVA 5ENVA 4BNTA 3VZPA 1R37A 3NRCA 2WMDA 4PLGA 2B36A 4MVJF 4GKVA 4O59O 4Z9XA 3GAFA 1TVEA 5ES3A 2NNLD 4DBZA 2PD3A 4HV4A 4ZQHA 3FNGA 4NZ9A 4TRJA 4PLCA 3WMXA 1Z74A 1X15A 4PLWA 1UJMA 1YBAA 3JYOA 1TT7A 4EITA 5DOZA 1YOVB 1BGVA 4WCFA 5G4KB 2BGKA 3HN7A 3LVFO 3M1AA 5BR7A 1E1LA 4JBGA 2X22A 2TMGA 4AJ1A 1IUKA 3DHEA 3WSVA 2WD8A 2Y68A 3VOSA 1VSUA 4MO2A 3ZU4A 3JQAD 1CJCA 1SB9A 1AN9A 2X0IA 2VHXA 1CWUA 2AG5A 5ITWA 3F4LA 3KOUA 2EP5A 1ADFA 3GDFA 1RJWA 2DTDA 3INRA 1TI7A 4ALMA 1KY4A 1P44A 3H5RA 1LLCA 6LDHA 3W6UA 2QYTA 2IXAA 2FHSA 4IQ8A 2I66A 3R6DA 5B1YA 5I8WA 4PRLA 1C0IA 2ZTMA 4IMPA 3V5NA 3ENKA 4BMVA 2DLDA 1Q7GA 5IDXA 1E7SA 4Z3KA 1J5PA 3ASUA 2A92A 1UDAA 1PQUA 1YQGA 2CF5A 4J1NA 4CMKA 3PIDA 3V1YA 3I4CA 4BNLA 5I7EA 5JCJD 1XCBA 4RORA 4R51A 4E31A 4E5NA 3OQ6A 4PLPA 5B12A 1AXGA 4GGOA 3UCFA 4N54A 2W2LD 1B15A 3P2OA 3E9QA 4CLXA 4IXWA 3H9EO 2R00C 4Y98A 4MP8A 4ND2A 1NVMB 2JJYA 4N5NA 3OF2A 5A03A 4A27A 3B20A 4TZKA 3ITDA 4GX0A 4YJDA 3WFJA 1PU2A 2HJRA 2W98A 4NG5A 4E5PA 4OYRA 2IXBA 2QW8A 1EK5A 2RHRA 3FSRA 1SCUA 5A9RA 3LQFA 1P0CA 4AG3A 5HTOA 3G17A 4L4XA 4RL6A 3TSCA 2NM0A 1PGQA 4II2A 1DC4A 3M2TA 3GGPA 1AHIA 2AEMA 3BIOA 4ND1A 5IZCA 3OFSA 5DCYA 4U6QA 4D3SA 5L45A 4HUJA 5H82A 4CM7A 1HE5A 5KJCA 4UULA 2NTJA 2X9NA 3NT5A 3BMOB 4FSHA 1U8XX 2LDBA 4MDHA 3BMOA 4HY3A 2RH4A 1BW9A 3KYDA 4UEJA 3PWSA 4U7WA 2PKRA 4RJTA 1KY5A 2E6UX 3EMKA 4XR4A 3DOOA 3ZWXA 3AOGA 1FDSA 2GZ2A 1E5LA 1XQ1A 4GWGA 2VZ0A 1QR6A 2GDZA 1EMDA 3JQFC 2P5YA 2LDXA 3HDQA 3DMYA 3G0OA 3TN7A 3WTBA 4YRDA 2JCYA 4ZQBA 5A06A 5CDYA 3A4VA 1KS9A 3C1OA 1ADCA 2PZJA 3KYCA 5CG2A 1HETA 4LCEA 3NTRA 3OP4A 1GY8A 3PRJA 4BNGA 5KVVA 4WEOA 5EESA 3GDGA 2FSSA 2AE2A 2PKQP 4NIMA 1CQJA 2C29D 4NBRA 3DXFA 1D1TA 5JDCA 2PGLA 1V9LA 1LDEA 4WGGA 3WGOA 5FF9A 4MKXA 3AY7A 4OL9A 4R9RA 4EGFA 4ALKA 3NEPX 2E4AA 1J6UA 2AQHA 1PS9A 4K26A 4GX5A 3AUSA 4TRRA 3ULKA 2OFPA 4MVJD 1PJBA 3Q11A 4IIUA 4MOWA 1DRUA 1MX3A 2DUUA 3AI2A 4R9SA 5JDIA 1B3RA 4O5OA 4E5KA 4D44A 2IEDA 3BXXA 1LDBA 2H5LA 2CSUA 4W7IA 2V6FA 5C7OO 3QLJA 1HSZA 1LTHR 4WNCA 3ETEA 3JQAA 4UEOA 3I52A 3V2GA 3HB5X 4N7RA 5I7VA 5ITVA 4BMNA 2J3IA 4CM9D 3HE3A 4MIOA 1PZHA 3HADA 4DA9A 2GPTA 5TJ9A 3UUWA 4GGPA 1ZCJA 1T2CA 4CPDA 5KJ6A 2ZIZA 5TQVA 1HE3A 4DREA 1PGOA 2YQ4A 4TRNA 5DT9A 4R1NA 4D43A 5BSEA 1A9YA 1DLIA 5JMWA 3HDJA 5COBA 4MVJH 1EZ4A 4X54A 3ON5A 5KVCA 2X5OA 3ZWOA 1JKFA 2VYVA 3VPXA 1DBVO 1R4MB 1U7TA 4R1TA 4BS9A 4ID9A 4BNIA 3U4IA 3SLKA 2W4QA 2DTEA 4KMSA 4CUJA 1C0LA 1WMBA 4XCVA 3EK2A 1LQTA 3G79A 4PCVA 3NJ8A 1N7GA 4M89A 2OHXA 3F4BA 1O89A 1DIAA 2YHIA 1C0KA 1YL5A 1YWGO 2EP7A 2BH9A 4FOSA 2BGLA 1W6UA 4P4LA 4L0QA 4FFPA 1DFHA 2NTVA 3JQGB 5CFZA 1CDOA 2R00A 3RBXA 4XKJA 3VZRA 3ZU5A 1SNYA 3CIFA 1GCOA 1ZXLA 3IUPA 4PG7A 3SVTA 4S3MA 1VPDA 2Y1OA 4K6CA 2YQ5A 3MJVA 4A5OA 4GAEA 1LXCA 4EBFA 4RLHA 4BL5A 1K6IA 5MDHA 4J1TA 9LDTA 4E0BA 2VRCD 3BTVA 1JA9A 3AW9A 4CMBA 3L9XA 4UREA 1NR1A 5L7WA 1QV6A 4CMEC 3PVZA 2VYND 1MG0A 4Q3AA 1WDLA 3RUIA 2I67A 5JW6A 4W7HA 2FPIA 4TRMA 1F8FA 1BXZA 1YS4A 1ZMTA 3DQPA 1WW8A 3BMQA 5DBGA 1DDOA 2PGJA 5TX7A 1LDGA 3TL2A 5CG1A 4IDFA 1ENZA 3JYNA 4XQ9A 1ZZEA 1HDYA 1VL6A 4RVUA 3ZNOA 1NR7A 4L4SA 3EVTA 3NT4A 3GVCA 4WLFA 2P2SA 3NDIA 3C3XA 3FD8A 4JIGA 5F1PA 3E48A 1BHSA 1Z75A 3ZHXA 2WDZA 4C7KA 1T1SA 3OIDA 1DFIA 3L9WA 4RCVA 5G4LA 3W4KA 1IE3A 4EYEA 1DC5A 4OHUA 2XF8A 4OSOA 3K2EA 5KJFA 3WBFA 4Y6RA 4MINA 1ENPA 2BKAA 2VQ3A 3LU1A 4IJUA 3U4DA 1QLJA 4W4TA 1HRDA 3CINA 3PHJA 1JKJA 3DFZA 3WYEA 4IS3A 1E7MA 1GDHA 2BRUA 2D3TA 4UVIA 3AUTA 4DPLA 3VH4A 2HQ1A 4CODB 3I4FA 3ZGYA 1B16A 1KERA 3EDMA 3TWOA 4F6LA 2PZLA 1L7EA 3H5AA 4RF4A 1Y5MA 4RZIA 4LRTB 4TKLA 4AJEA 3CH6A 2P9EA 3U09A 1I24A 1MA0A 5IF3A 1NASA 5A5FA 3OICA 1X1TA 2CF6A 5DCUA 3RUCA 3WLFA 2GO1A 4PLHA 4ZRNA 3BMQB 3RC1A 3COSA 1IHXA 1DB3A 2BELA 3IC5A 4GLOA 1YXMA 5KKCA 1HYGA 3GVHA 4DTIA 1PGNA 1P1RA 1T2DA 7MDHA 1JDJA 1KETA 2X7HA 2Y1DA 1K6JA 2WE8A 4PZDA 4J4BA 2X9GA 4ILKA 4O63O 3UCEA 1E6UA 4LK3A 1EVZA 3EYWA 4TWRA 5G0TA 3RUFA 2NVUA 2J5QA 3UAGA 4B8WA 2AXQA 4JK3A 4NH4A 4DUPA 5L40A 1BXKA 2ZJ1A 3GK3A 5BQFA 4QFDA 3HUDA 1GFSA 1HDXA 4NBUA 4YAJA 3ZU2A 1NP3A 3WGTA 4GL4A 1ZW1A 4XA8A 4GLLA 5AXBA 2Q1TA 2BFAA 2YY7A 1YBVA 3UH1A 3ZV5A 1XKQA 4GX2A 2VTEA 3PPIA 4IXTA 1K5HA 4DQVA 3BHMA 4CL3A 1MG5A 1PGJA 3SC4A 3GFGA 3IAHA 3WGYA 3QE3A 3R3JA 1QORA 5JAQA 3PQEA 2ZCUA 1M6WA 4LISA 4OKIA 5AYVA 1BRMA 5IXSA 1K2WA 3OJ0A 2P9GA 2NU6A 4BHTA 2ZYAA 1KC1A 1VC2A 1E6WA 5A3JA 1I3NA 2HMVA 3DZGA 3BTSA 4G2NA 1U2DA 3F1KA 1JN0A 1Y7TA 2ZB8A 3GG9A 3H8VA 4FFRA 3LT4A 3RBVA 4A26A 5TT0A 2AHRA 3DFUA 2GGSA 5JAMA 4TZTA 4WCFB 2GYYA 4CV0A 2HJSA 2C2XA 3Q0EA 4HFRA 3CMMA 4BO8A 1V3VA 3HQ4O 3G1UA 3EUWA 3PGXA 2NVBA 1O0SA 3KETA 5L4NA 1LLDA 3JD3A 3RIHA 4KOAA 2JCXA 3I9NA 1U3TA 1I3KA 1Z73A 3SJ7A 1GZ3A 3JQAB 1EVIA 2PH3A 2GSDA 2Z1MA 4EJMA 1U9JA 2VOJA 2H63A 3VZQA 3KB6A 2A9FA 4I5DA 4ZQFA 2VWGA 3QIVA 2FPPA 4J90A 2GN8A 4CMEA 3RUEA 3LF2A 2C20A 4J7XA 3W1VA 1IL0A 3RFVA 5JSFA 4FJ1A 3ROPA 5J23A 4FDAA 2V7PA 3H9QA 1LU9A 3JCZA 1GV1A 3NAQA 4AJJA 2X23A 3ZV3A 2O3JA 1BXGB 2X8LA 5IXYA 2BFPA 2FR8A 1ISIA 1N7HA 1Z7BA 4MKRA 2G76A 3GEDA 3W6ZA 3H4VA 5THQA 2AE1A 2Q1WA 2PGDA 3H65A 1CERA 2ZTUA 1DAPA 1KEPA 1P1HA 3PHHA 4PVCA 3HWRA 3ZHZA 2P68A 1MGOA 2A94A 2EKLA 4K28A 1T25A 2C59A 2C5EA 1KOLA 5EJ2A 3R1IA 4YQZA 1GAEO 1SB8A 1T4DA 2OMEA 3K6JA 3MOIA 4BO1A 1R0LA 4CLRA 4IQGA 2EJVA 4CLRB 1U8FO 3OMLA 4GPD1 5HM8A 3RU7A 4CMIA 3GR6A 1DFGA 1XQ6A 2UV8A 5ICMA 4NMHA 2O3TA 4NFYA 1M6HA 1FJHA 2FWMX 2JD1A 3G3EA 3GNQA 2O2SA 2G5CA 1ISMA 1ZK0A 3H2ZA 4CV2A 2Y0CA 2FSVA 2YDYA 1XHLA 2DBVO 2HDHA 2VT2A 1LEHA 3ZWMA 4BO5A 2EKQA 4KTVE 1RYEA 4ALNA 2Q45A 4PGFA 1XIVA 4M87A 1A7AA 2B5VA 1P33A 3KLPX 2GERA 1NAIA 1NFFA 2J8ZA 4MVJA 4TMFA 1QKIA 4W82A 3BHJA 1PQPA 2FPGA 2OP0A 2Z1NA 1HDRA 1RPNA 4J2HA 2ZB7A 2Q4EA 1P1FA 2VNAA 3QVWA 3V2HA 4MP3A 3EVNA 5GY7A 5CPBA 1Q0QA 3NT2A 2Y0EA 1T2AA 5JO9A 2FOIA 1DJQA 3FR7A 5CHEA 3DBRA 5DN9A 3GVPA 1UR5A 4AJOA 4YWJA 4ZJUA 2J5RA 3A9WA 3WQRA 4C4OA 2YV3A 3TQHA 4CM8A 3TZCA 4XYEA 2QHXA 1KVQA 1EE9A 3ZV6A 3QVOA 1PWXA 5C7LO 1MXFA 3AU8A 4J4HA 1VJ0A 3UW3A 3RQSA 1NAHA 1HXHA 2WYWA 2F1KA 3GRKA 3PK0A 1MFPA 4AVYA 5CEJA 3ZWNA 2VUSA 4ND5A 4MIYA 2OBYA 4UUMA 2JHGA 5U4QA 4L74A 1NVGA 2H6EA 2I9PA 3NTQA 3ICPA 3OA0A 4GVXA 4IPTA 1MUUA 1YQDA 3PHGA 3JQGA 4II3A 2VUUA 4JNKA 4CM6A 1R4NA 1I3MA 1ZEJA 2CNBA 4FOOA 4KQWA 3S55A 1GZ4A 3CEAA 1YRLA 1CEQA 2DTXA 2P4QA 3WJAA 3CZRA 2GN9A 1DPGA 2OUIA 3DBHA 5U9CA 2X0NA 2HRZA 4YAEA 3KUXA 5TSDA 3WGZA 3H3FA 4XGKA 3VDRA 1XU9A 4GMFA 2QRJA 3EZYA 3JQ7B 1KVRA 1OBFO 3DHYA 3ZNNA 4D45A 3PZBA 3GOHA 2EIHA 1LX6A 3FTNA 4Q3DA 3WIEA 1VL8A 1VE9A 2E49A 3INTA 4XEHA 1XG5A 2DBZA 1WXDA 4D46A 1OZAA 4U0KA 3BMNA 2C82A 5DF1A 3SC6A 4AJ4A 5IZCC 4YJFB 2Y05A 4LN1A 2RIRA 3MOGA 5C7IO 1WMAA 3PJFA 4H15A 4IDBA 1GR0A 4BQRA 2PY6A 3F47A 1E7WA 2OL4A 1E3EA 1DRWA 4NFSA 3VPHA 1LC0A 1YONA 4KQXA 1N2SA 1HDCA 3HNPA 1RM4A 3L07A 3QSGA 1ISJA 1NWHA 2PK3A 1NTOA 3ANLA 3OEYA 1NQTA 2J3KA 3QWIA 4FC7A 5EL0A 3AFNA 3EGOA 4PG6A 2NLOA 4ITUA 4DMMA 2H9IA 3FWZA 3IUSA 3JQCA 1QSGA 1T1RA 2CUKA 4ONEA 4RVFA 4CMGA 4UVDA 1HT0A 3E1KA 1L1FA 1LSJA 5JC8A 4BNJA 4J1SA 1I30A 5ILGA 3NUGA 1EUDA 3RC7A 4WLOA 3U5TA 1EBFA 5F5NA 4AICA 4GH5A 3PGJA 4R5MA 2PKQO 4DIOA 2DFDA 5A05A 3OBBA 3DBLB 1KVUA 4QQRA 5LDHA 1ZH8A 4B4OA 2GRAA 4BGEA 1YE3A 3ENNA 2Q1SA 2VWPA 4BMSA 3RUHA 2X0JA 3PWKA 2I65A 1H6AA 1E77A 4J16A 4XYLA 4J9UE 2DT5A 4RF5A 5JY6A 1HL3A 1FXSA 4WOJA 2JHFA 1KYQA 4XX0A 3QHAA 4WECA 3E6AA 4FJ0A 4LSWA 4B3JA 2JAHA 4D3FA 4E13A 3OIGA 4XYGA 3AJRA 2ZTVA 1NFQA 1B8VA 1I8TA 2C0CA 2QYSA 1PX0A 2IEBA 3AUAA 4PLZA 1W8DA 4CQMA 3D7LA 4ZICA 3ZNQA 1NHGA 2EJWA 2NVWA 1F14A 3H3JA 3TZQA 5KTKA 5AXAA 1PSDA 2G17A 4BO6A 1NPYA 3UF0A 1V6AA 1ZSVA 3DMTC 3O8QA 4IY1A 3MJ4A 4KUHA 4MVJP 4YT8A 2RAFA 1NHWA 1MC4A 4J9VA 3GFBA 4N5LA 4OGWA 3TZHA 1XSEA 3AOEC 4GI2A 1EQ2A 4MVJE 2E48A 1E0DA 4LMPA 3RU9A 5IN4A 1UZMA 1HE2A 3U0BA 2VN8A 1ZVMA 1QLHA 4DPKA 4RV9A 2VNSA 5FI5A 4YVFA 3AM5A 3IS3A 4I08A 4XR9A 1EUZA 1RKXA 3MWDB 1NQ5A 1P1JA 2XXBA 3ADOA 1LLQA 4QTZA 1ZK3A 4B79A 3U9LA 2H1SA 1PR3A 3GHHA 5KJEA 3LF1A 1VSVA 1V0JA 3DR3A 4UVEA 4Z0PA 4BKRA 1DIHA 1GYRA 1O95A 1ZSYA 1U5CA 4M86A 5ICSA 2EXXA 3UOGA 4CLOB 2X5JO 1CYDA 1DSSG 2DVMA 3JYLA 4U5QA 4CLOA 5IFLA 3BHIA 3I3OA 4CLDA 4MKZA 2IE0A 2WWRA 5A1TA 4MJLA 4G81A 1LNQA 3GHYA 5JAZA 4U0JA 2EW2A 2QG4A 3WXBA 5JMPA 2O50A 1PZGA 2BLLA 1Y9EA 4OSPA 1EE2A 4H3VA 4N18A 3TJRA 1QP8A 2JFHA 2B4TO 3EC7A 4D7AA 1AHHA 1UXGA 1C1XB 4R1UA 3WGQA 3C1TA 1C1XA 2CZCA 1PJQA 3GEGA 2PR2A 4BO7A 3ZWBA 1PJ3A 1N1EA 5LDGA 4BNVA 5G4KA 2OGUA 3FNHA 2VRBA 3QA9A 1GADO 5DBFA 3AI1A 5FFFA 4XRGA 3MJTA 4WPGA 3L6OO 2JD2A 3DZKA 4DBVO 3QVSA 1IPEA 5ADHA 4FFLA 2P91A 2YV1A 1M75A 3A14A 1A72A 5I9NA 4W9NC 1XELA 2BGMA 2DFVA 4WEQA 2OZPA 1EBUA 4J6FA 5AXDA 3WLEA 5IDQA 4INAA 4XIYA 4ALLA 1PQWA 1QV7A 3JYQA 4P4NA 4CUKA 3PQDA 3E9NA 2J5KA 3DZBA 5MGBA 2VHWA 1C14A 4Y8VA 4CMHA 1OFGA 1OAAA 1N8KA 5BSFA 1E1KA 4FS3A 3CKYA 4Y9DA 1VLLA 4WJZA 4TKMA 1JWAB 2EWMA 5TF4A 3RD5A 1JAYA 1NWCA 4ZN6A 2DUWA 2EV9A 4YJHB 5A5EA 3OM9A 1DHRA 5L51A 4J0EA 1OMOA 3DBHB 3RASA 1YVEI 1NFRA 2WTBA 4BNYA 2NSDA 1FDWA 3GF4A 1BXGA 3WWZA 1Z45A 4B7XA 4TVOA 3IKTA 2D1YA 2PLAA 9LDBA 4WKGA 3UICA 3IP3A 1PS8A 4L9RA 4Q9NA 1H9AA 3V8BA 3E5MA 1LJ8A 3A06A 1Q1NA 3UVEA 4EEZA 1V8BA 4PLYA 4CR6A 4CQMB 5B4TA 4R54A 4YJFA 5K0ZA 1ONOA 3UXYA 3HFSA 1F17A 3WGGA 3LZ6A 1A9ZA 1SC6A 2AEJA 4DIBA 1BTOA 3GZNB 2ZQYA 1Y8QA 3K9QO 3TZ6A 1E6EA 3F5QA 2Q46A 4DLBA 4I5EA 1B3BA 3ZCXA 3HHPA 3KXDA 3KYCB 3RUDA 4XWYA 3P5SA 4YPOA 5L9AA 2IZ0A 1XDWA 4JGBA 1D7OA 2EGGA 5T8KC 3WGHA 1ONPA 5JDIC 2AQIA 1UXKA 3GA0A 3T7EA 2GNAA 3D3WB 4JN6B 4QSMA 5KVQA 5F21A 3GMSA 5JE8A 3WIDA 2I6TA 3VDQA 3CZMA 2O48X 1JKIA 1SOWA 1CF2O 3KYDB 5T8KA 4EJ0A 2AEFA 4ND4A 4G5HA 1QYDA 4E12A 4NNJA 1WZIA 1YB1A 2D5CA 1I0ZA 1QYVA 4JBHA 5A04A 1MFZA 1U1IA 1E3WB 1TB4A 3JYPA 4RPLA 2JAPA 3VTFA 4I1IA 3JQEA 3DZIA 5G0WA 1RM0A 3DMTA 1BWSA 4CM1A 1W4ZA 5JLAA 2F00A 3OJEA 3LYLA 4OH1A 5A9SB 2CD9A 4YR9A 4NR0A 4CR7A 5TT1A 4CV1A 4FCCA 2UDPA 1P1KA 4JROA 2EW8A 4Y67A 4A0SA 4P38A 1PJTA 2XOXA 4Z0HO 4OQYA 4CMJA 5A3VA 2FR1A 1S6YA 1DC3A 2Y66A 3DO5A 3PJDA 4GWKA 4Y6SA 3BYZA 3ONFA 1RWBA 4B4UA 3I9OA 3R3SA 3I1JA 4F3YA 5I7SA 5TC4A 4KDEA 3JQ8A 2RCYA 2IODA 3W8DA 3K30A 4IS2A 4ZGWA 2Q2VA 1E5QA 2ZKLA 1EFKA 1VKNA 2X0RA 4BKOA 1YB4A 4WLEA 4HWKA 1R4MA 2VRCA 2DM6A 3MCVA 1AE1A 3S1LA 3GEMA 4WE3A 3SBOA 4BB5A 1YL7A 3DTYA 3QW2A 4UUNA 4OJNA 3VH1A 2NTNA 3VVCA 1LBEA 1T4BA 5ER6A 2WE7A 4CMCA 2P4HX 4OQZA 4BGUA 4MVJG 2JFFA 3GUYA 4FPXA 3C7DB 1EDOA 4FFOA 1I01A 4YDRA 3IOYA 2AG8A 4JQCA 5FI3A 2YV2A 1ENOA 4W9NA 2WJPA 2X86A 3IMFA 3KBOA 3C85A 1UP4A 2VOEA 5A02A 3V1TC 1A5ZA 1N9GB 5CDUA 5IZ4A 3SLGA 4CUZA 3LC2O 1U3UA 3O9ZA 1XGKA 4DC0A 4RVSA 2Y99A 1K89A 3DOCA 3FCOA 3PLNA 4GBJA 4ZA2A 2UAGA 2XPCA 5EINA 3CMCO 1MB4A 3ZN2A 2A35A 2UUPA 4XD2A 4PZCA 1HZJA 1KVSA 5BT9A 3DBVO 4NU5A 2I3GA 2AMFA 2NU9A 3IP1A 4KWIA 2VCYA 1VJTA 4GSKA 3OA2A 4K9DA 4YT2A 1T2EA 4G65A 4MP6A 5HRUA 4YB8A 3PQFA 4E2YA 1UH5A 4CMAA 1SPXA 1EFLA 2FN7A 2O7SA 2Y1EA 3B1KA 3GPDG 3K5PA 4U8GA 1YOVA 2D5AA 3FNFA 3ANNA 4HFNA 1JLLA 4PFJA 3VAZA 4YTEA 1GUYA 2Y93A 2QQ5A 3AM4A 6ADHA 3ZH2A 3F5SA 4PIVA 4UEKA 2E82A 3Q2KA 2OBNA 4QX6A 5THKA 3LLSA 3P7MA 4YBZA 1H6CA 2B35A 2WEKA 1E7QA 4B8ZA 1MLDA 3RI3A 3KHUA 4RPJA 1A4IA 2QIOA 3RJ9A 4J7UA 3DZJA 1AXEA 1JAXA 4BKPA 1NPDA 1P0FA 5G0UA 4JJFA 2D0IA 3UKOA 4EEXA 2Q4BA 3OSUA 3B1JA 3GLQA 3PDJA 2EERA 4Q3BA 4DMLA 4R3NA 3GG2A 1M66A 1VL0A 3STHA 1Y5RA 5BSHA 3Q9UA 4CM5A 3FPCA 1D1SA 4B7UA 2JFGA 3PJEA 1IOLA 1O9BA 4HX5A 3F46A 4CM8B 1BMDA 1E7RA 1GQ2A 1KIFA 3HFGA 4FR5A 5JO0A 3QV1A 4NU6A 4XIJA 5IJZA 3TF5A 4IJWA 2CVOA 4BO4A 2CY0A 4H7PA 3ZNPA 1T24A 4RGBA 3FTPA 3MTJA 1JVSA 1P1IA 1R0KA 4LVUA 4Q39A 3DB2A 1ZJZA 5F5LA 3I23A 2I99A 4RVHA 5JFOA 1NX6A 1W73A 2P5UA 4PN3A 5DP1A 1PL7A 3F9IA 4FGWA 1GU7A 4DIFA 1WDKA 5TJHA 4YXFA 4BGIA 3ZHYA 1HSOA 4RPKA 4BNKA 1ISFA 1A27A 1W0CA 1E1NA 4Q3EA 2Q50A 5LCXA 1VKOA 4DLAA 3I6IA 3WR5A 1ZXBA 1WPQA 3GY0A 1EVYA 4EJ6A 1ENYA 4RF2A 1TT5A 1V35A 5L3ZA 4RDIA 3L77A 1ZUD1 2R2GA 1GEGA 1ULSA 3ZI0A 2DU8A 4EUFA 4LW8A 1YGYA 2HO5A 1BVUA 4CJXA 1JU9A 2HMWA 2RH8A 4F46A 4FJ2A 1YO6A 4YEDA 3HN2A 1EQUA 3FNEA 3ADPA 4B4WA 2HRBA 3DAFA 3ROQA 3RAJA 2IRWA 4EUHA 1LSUA 2YFQA 1PS0A 5KNLA 4E2XA 1SOVA 3WICA 3IDSA 1WLYA 4NK5A 2CVZA 1L7DA 1FDTA 1N9GA 2A4KA 4KUEA 3QY9A 3K8ZA 3AU9A 3LK7A 1I5RA 1P45A 4IMRA 4J43A 3MZ0A 3VH3A 3BMCA 3IJPA 4GQAA 4B3IA 1EVJA 1ONNA 1UDBA 3H2SA 3DDNA 4A2CA 3H9UA 1Q7BA 3DL2A 3I6QA 4BUCA 3ZHBA 4IM7A 4ZQEA 1ZSNA 3RCBA 3D3WA 3KVOA 2UUOA 1R15A 1WZEA 3M1LA 1QMGA 1LRKA 3TNLA 1H2HA 2HUNA 3N58A 3OQ1A 2B69A 3GC6A 4OMUA 1WNTA 2O3UA 1H93A 5CEFA 1WVGA 1J4AA 3Q6IA 4KUGA 2ZJ0A 2FRDA 3RC2A 1DIRA 1HE4A 4LCJA 1M2WA 4MVJM 1H2BA 3RJ5A 4ALJA 4BV8A 3FRJA 1HWYA 3S2EA 2B4QA
chains in the Genus database with same CATH superfamily
4RK7A 3UFXA 1HEYA 4HQ0A 5CVDA 5FWYB 4CKZA 2DPGA 4W99A 4H31A 4QUKA 2YW9A 1YBHA 1B26A 4XYMA 3UPTA 4B3RB 3JQFA 4BO0A 1WV0A 2GF2A 1V9CA 3IV6A 4M8LA 3B1WA 1V3UA 2QRHA 4X1YA 2IXTA 3KVNA 5CDTA 2QQGA 3BFVA 1DAKA 3LHIA 1BAPA 1RI2A 3T1TA 3X1XA 3BJZA 2QPLA 3GZ4A 1GIAA 1NBOA 2XNKA 3FFXA 2WUEA 5MN6A 3KQMA 3MCWA 3EZLA 2IU6A 2BN4A 2FN9A 4HMQA 4HWOA 4E32A 3OKPA 3LI2A 1UJ6A 2WF8A 3HDHA 1KI4A 4H0CA 4W6ZA 3BVPA 3FG9A 1JECA 3X1KA 5L53A 3VJMA 1HA3A 1ZJ6A 2WQZA 5A7GA 4XFKA 1QS0A 1E9FA 4FGSA 3CC8A 3SMQA 5TMDA 2MJLA 2NSLA 1N6PA 3IE0A 1KOFA 3SK0A 4KLZA 1QBGA 1RXCA 2QVZX 2XJ4A 3GLTA 4M8SA 4TUYB 3ZHQA 4RTQA 2WMYA 2R7KA 5GZ1A 4C2AA 2B4RO 2EFJA 3PR1A 4OIMA 2OAQ1 1BE6A 2XTAA 4KBGA 3WP0A 4DCTA 4C0BA 3TTWA 5CA0A 4F84A 1C80A 1ZNZA 5F2OA 5I3CA 1V3QE 3KQNA 3LT1A 5D2CA 1QOPB 4LRSB 2VDVE 1QWOA 4RPHA 4HWSA 5K4HA 1W19A 3AF1A 3GT0A 5C8ZA 4Z3OA 5D3MA 1Z2EA 5A6VA 1PSZA 5M7EA 1XPRA 5B4VA 1QC5B 4QRHA 1U4OA 2QROA 1X14A 4UCWA 1VYHA 1XYGA 3V7NA 3WWOA 2QTRA 3G02A 4N39A 1O6CA 3WNVA 1XEWX 1M1ZA 3Q9NA 5LYYA 1XJWA 3E4CA 4YJGB 5KOHB 5CVUA 2ES4A 1QRDA 2YQZA 3VOBA 4D8YA 3HG7A 1WB9A 4KK3A 4DFDA 3DC7A 4JDUA 1XK6A 4UU7A 2Y0DA 2VNKA 1L7NA 2ZSUA 1GQQA 1OAOA 3G7SA 2JC3A 4OSEA 5REQA 1ZJYA 3D0RA 3WI7A 1K0UA 3THYB 2DF8A 4H7JA 2PL1A 5DXJA 2CCKA 3SF8A 1OZGA 2BJHA 3BTOA 4E5SA 4KQMA 2HIHA 5C8YB 3NHLA 1UPCA 4S0ZA 3WOHA 1WZ2A 3T3OA 2HLDA 1FQOA 4FFNA 4G5OA 3IV7A 4ZU6X 3WLQA 5DRTA 3BDIA 5KWEA 1FJXA 3O2QB 4L75A 2Q62A 2ZQZA 3MGGA 4OP1A 3F7MA 1K7EB 4NAVA 2D8MA 2Z2IA 4KP7A 3ZWKA 2NYVA 2PVSA 4YDSA 3JQQA 4UPEA 2CVQA 4YR7A 1O97D 3NHKA 4WBNA 1U1CA 1X7WB 1LBSA 4LOAA 4FGLA 1K4YA 3X1WA 8GPBA 5DULA 4HAIA 3DNFA 4QEDA 1C4XA 1TQHA 2LWIA 4XGNA 4DOMA 2AG0A 3RRNA 2BFWA 2V4UA 1SUEA 1TEHA 6GPBA 1ZCAA 5IC4A 1H42A 3DPUA 3QQPA 4JCCA 1UMCA 1IZ7A 3GUVA 4N7MA 4UZEA 3R9XB 1HORA 5F2KA 1PL8A 1Y81A 4I8DA 1T35A 4KQEA 2B0JA 3MWFA 4IILA 4MROA 4D41A 1DEHA 1GPBA 2Z5LA 3UO8B 1MP0A 3IQDB 5KKAA 3UJ3X 1NR5A 3UK1A 4J2OA 3F78A 2X0DA 4I9NA 1E8DA 1TZJA 2JAOA 3R7LA 2HU8A 3GGDA 1GGJA 4MVCA 2BJWA 2IUYA 3B89A 4R6WA 4RK5A 4YLEA 1ZGCA 3BF8A 5DM0A 1BC5A 4M53A 4AMVA 5JATA 4MAMA 3SBEA 3A6PC 4E4YA 2PUWA 4AY5A 1A9XA 4WN9A 3GT7A 3HI4A 3ZHSA 2B2CA 4BLVA 5B4UA 1TZMA 2JJ2A 5AXCA 2OBLA 3QPDA 5HFJA 1PUXA 3WIOA 1JEYB 3OKAA 1WP4A 2RHOA 3QU2A 2IS4A 3R0VA 3QXJA 2BI7A 4ZDWA 1UUFA 2XE6A 3OETA 1P1CA 4KWHA 4ZO4A 2QX9A 1SKMA 2WPNA 2EEZA 4BBZA 3ZE6A 5A4FS 1WAMA 2OFFA 2Q3LA 1C1HA 3K92A 4G07A 3UMRA 2JLSA 1SXJA 2A0WA 4EW6A 2WINI 1U8UA 3WFZA 1MIOA 4QKQA 1YA6A 4FUTA 5T3YA 3WHPA 1R0XA 4AJNA 4P3KA 1FSSA 3HEMA 3W8EA 3TEFA 2K2WA 4IUDS 5ARBA 2ZRNA 3N74A 1QQTA 2YVLA 1YFZA 2LNDA 4C88A 5JSZA 3D1LA 5C34B 4EENA 2C7VA 2AOUA 2NU8A 3BAZA 3DYBA 1W96A 1FFYA 5K8IA 2EQBA 3LLVA 2GXQA 5E7JA 1YA4A 4LOLA 4JKYA 5HFAA 2QMYA 1BWQA 3VZDA 4AQYB 1Y9DA 2EBFX 4I5GA 1PYOA 1V95A 2G77B 3CNHA 5FV4A 4V0OA 3MJEA 1UKCA 1W76A 2LTAA 4C0LA 5JQWA 3IUQA 4Q47A 3KQQA 4B7ZA 1QIIA 4AJHA 4LJRA 1J9ZA 1PWZA 1XLTA 4LHEA 4D3YA 4J3FA 1A9PA 1Q3TA 2YUIA 3IOMA 4V03A 5EPUA 4BEJA 2X58A 3OJCA 1CP2A 1FF9A 2DFTA 2ZRAA 1EYZA 3JV7A 1L5FA 3SS8A 1Y3CE 4XEUA 3EWSA 4DDTA 3WNQA 4EB6A 1QX4A 3R3UA 1RMQA 2Q1YA 1U4NA 4RPIA 5EZQA 3ZHOA 4XJSA 5KDLA 5KOIA 5KKNB 3ZGOA 3T4XA 3A58B 4RESA 1BCRB 4H08A 3F49S 2Q1UA 2ZS7A 4WK0B 4R1MA 4BNHA 2ZAMA 2OVFA 1YB5A 1MQAA 4P0TA 3AKEA 2ZJFA 3H5TA 1H0KA 3T5CA 4I5FA 1P5FA 2GCIA 1B73A 1GVHA 4ITVA 3LT2A 2Y67A 4L07A 1HYQA 3L8EA 3L7YA 3TH5A 2EX4A 4OPMA 3HUFA 1MO3A 3Q40A 2QJRA 2G40A 2B83A 4GXQA 4TSFA 2R1ZA 3D6JA 3W1EA 3U7EB 4DJFC 2JB9A 1WKVA 4M1QA 1Z5OA 3NTVA 4QBTA 1GZ7A 1K06A 1HG1A 2RHDA 1P5RA 1VIMA 3U49A 3D4PA 1L7AA 2C2OA 1CQIA 1U9IA 4C2TA 4C7OA 1LPNA 3EFEA 4OA5A 2X5NA 1LUAA 2ET6A 2C7BA 2Q8QA 1UZNA 3ZCRA 1NYTA 3MTGA 1D8AA 1SVMA 2D0OB 5KAMA 1DXYA 1G20E 1VP9A 5ERXA 1T2FA 3JQ8B 4KGDA 4LZPA 3TCKA 5HF8A 4B83A 4ZCMA 1XJ0A 4E6PA 3L7CA 3KYBA 3B6IA 3AR5A 3ABIA 4QO8A 4C07A 5DM2A 2WAYA 4IVNA 4MARA 4X8LA 1TIKA 2EZ8A 1THZA 2FZ4A 2OZLB 5AK6A 3GRPA 1UBCA 1OGYA 2W6MA 1TT5B 1YE8A 3GFFA 2VBIA 5FEMA 5CA0B 1Y8ZA 5JNUA 4KEAA 1IDOA 2J6IA 1EAMA 2MMCA 3DM5A 4MWDA 4X90A 4HSGA 4XIGS 5J2UB 2ZRLA 2CUZA 4NPAA 4S1VA 5ALHA 5JCXA 2PHZA 4X6UA 4CT5A 5CB6A 3EIQA 3PIIA 4HFMA 2P6RA 4LJ5A 4OHVA 2GK3A 2HDWA 1HDZA 4YYZA 5KC9A 2BGTA 1X7ZA 5ADUS 5TPZA 3UHAA 3O21A 3DAPA 1ZEMA 2H9AA 5PNTA 3UGTA 3KXPA 4JITA 2XAAA 3MTDA 1P74A 2X8JA 4IEEA 1SVLA 3X2SA 1UXOA 3K71B 4JP2A 1J0XO 3REQB 4R2XA 4R69A 1B0AA 1XRLA 5J43A 4YRNA 3DBRB 1MU0A 4I50F 1XU7A 1XMQB 4OAQA 3U4CA 1OV4A 4N4AA 1O94A 2LUOA 2MOKA 3DZCA 2HK9A 3LY8A 2I78A 4WDRA 2OO5A 3N7UA 3PEYA 5G0VA 2W2LA 3LOPA 4HRVA 1GM5A 1PDVA 4MB6A 3QKRA 1HYEA 2WZQA 3C3YA 2JS7A 1K4KA 2IXDA 3QKRB 4OP2A 4WKNA 2FZEA 1QV9A 4CQNA 1LDMA 3HKBA 4KO3S 1N6RA 2YINC 4YA6A 3WZLA 5FORA 2VXBA 4EK9A 4LF9B 2POQX 1P5HA 5ALIA 4PPQA 2P9HA 2Z1DA 3CONA 4WBNB 5AW5A 1IBKB 2CCGA 4C4XA 3E03A 2WHYA 1LB1B 3QYJA 4URFA 1NUQA 1Y8QB 4QATA 3HJNA 4UU0A 4UUPA 2CJPA 4J0CA 3PX7A 2GJSA 2B61A 3BSWA 4LEIA 5IEJA 2P9YA 5CFQA 1U5BB 3HRKA 1QRAA 2WA2A 2WTXA 3CUEF 3KYJB 2Y4NA 5ILOA 2X2EA 4JLWA 4AJKA 4F4DA 2O8DB 2H5EA 4CRWB 2FFQA 6YASA 4RPCA 1UKZA 1JTVA 2ZW9A 3BGSA 3U39A 1S02A 1XB2A 1M0SA 1R5NA 2BI8A 1X7DA 1HBJA 3KVYA 3VPSA 5CM9C 4CKEB 3MINA 5AM5A 3OUZA 4HL6A 5LLTA 3T1QA 5CDFA 4BRWA 4UFNA 1UXIA 5E6RB 5JBIA 3PUIA 4RSMA 3AFOA 3PCXA 1Y3FE 2XB8A 1BKDR 2GJKA 4OGKA 3NRBA 4NYJR 4Q3NA 5GQSA 4D5GA 2YOFA 2FFRA 5A4MS 1R6BX 1A9XB 2H4HA 1RZVA 3EMBA 2VPTA 4RWEA 1SWVA 4B3BA 3UMYA 4PBTA 1IBRA 2EG9A 4QUBA 4XUGB 1MEOA 4NCXA 2PYZA 1ISPA 2EC5A 3Q6MA 4LXGA 1K3TA 1SAYA 1PCXA 3S2ZA 1I10A 4LF4B 3BXOA 1N4AA 4BNDB 1VP3A 4J2TA 3AQ4A 5D85A 2I87A 2ILTA 4WLVA 3CVUA 5C5IA 1SD2A 1XZGA 4MDEA 1MZPA 3B6MA 3GN1A 4TTRA 3AWDA 5I9MA 2WW8A 1XJ5A 3EC1A 2N75A 4ZXFA 3W8RA 3AVYA 3AEQA 3SZRA 1G5FA 1UDCA 3B8EA 2F3UA 4BLSA 3OI7A 2EFEB 3BCUA 5GVRA 3L4JA 1AUPA 5ALDA 4KOEC 3TSYA 1VB5A 1ADGA 3D2CA 4KQ9A 2BMWA 1C1DA 3H3XA 2VWHA 1NXQA 5CYPA 5AICA 2ORWA 3IBTA 3OZEA 1QG6A 1XXHB 4X1IA 4F2HA 2X4GA 4OB8A 5A4KA 1X8LA 2IOQA 1OY1A 2EIXA 4UUAA 5H83A 4AQ7A 3QKSB 3BXEA 3PFGA 4H0FA 2B37A 5ILQA 2IY7A 4E30A 2F90A 1AUQA 3D3EA 1MTZA 4JXKA 1WKCA 3MCTA 2XCTB 2ONKA 1EI9A 3L8CA 3MQFA 2ZBUA 2FEXA 4HCJA 4L6CA 1IY8A 1F2DA 1PDOA 4UAGA 4ZU3A 2YV5A 3SDBA 4ETMA 2XUOA 4QOIA 2FF5A 3OH8A 1QR2A 2OQIA 1SBYA 2WIJA 3RTBA 4D8UA 1TJ3A 2XUZA 3OUTA 3ID6C 1GO2A 1SMKA 3AZQA 2C4WA 3IDFA 1MO4A 3T3DA 4FZ5A 4GUAA 3TOXA 4DAOA 3THOA 3R8XA 2GJAA 3UK2A 2JGDB 2VPZA 1IXZA 4YQFA 5KWVA 1UDWA 1YSCA 2PMBA 2J7PA 2DSTA 4EUSA 5IU6A 3B7PA 3I53A 3QWAA 2CB9A 2HA4A 2IYEA 2Q0XA 4XD7D 4V39A 1A8SA 1B6GA 4DVGA 4DC1A 1RIIA 3C6MA 3VVLA 3EAGA 2DR2A 3PCTA 3GDHA 3I83A 1LRJA 3B5IA 3OPYB 3RVKA 3E2IA 4Q00A 1G3QA 5EKXA 1OC4A 2DBYA 4OQEA 3E5RA 2H57A 4ZV4A 1FFSA 1OFIA 1NE2A 4YCBA 4BQQA 1YZTA 1UEXC 2ZROA 4XGIA 1GWNA 3LSYA 2XMZA 3ZW9A 2J59A 4C78A 1V6SA 1AQLA 1V7CA 1JDNA 4UMVA 1MDBA 3AB3A 3ENVA 1Q0PA 2J3JA 4HAYA 5G2OA 2R8XA 3UATA 3DLPX 3AEUA 5DT2A 4DA4A 2JJ8A 1E3IA 1QF9A 4CG1A 3ERCA 3E15A 3OSZA 5K3FB 3WDLA 2PQMA 3A28A 3G8YA 3L0PA 5B3JC 5LLSA 3J80A 3STTA 2P0YA 3Q5GA 1COZA 1FNNA 3Q7EA 4IYJA 3WKCA 4CR8A 5L95A 2X0KA 1JHZA 4KIUA 4BVLA 4C3UA 4V0MA 3VFDA 4YJKA 1GG9A 3RT1A 4ENPA 2DY1A 2IPMA 5DZSA 3WL8A 1CJMA 2GTHA 4CMIB 2XQIA 3OLYA 5J4KA 5ELXA 1G9XA 4KIJA 3G2NA 1JJAA 1PQYA 1UAYA 3UWOA 1WXGA 2WWGA 2JBHA 1GLGA 3G1WA 3KQWA 3Q3IA 1KARA 3COYA 4IHKA 5BNTA 1DT3A 1BG6A 1RXIA 4O2BF 1D4FA 4S1NA 5CP8A 5T5QA 5E2IA 5DISB 1RRCA 4XXHA 1VJDA 5BQXA 5E8JA 3TCNA 3V7WA 3BILA 1H1TA 3ACBA 3T1YB 3AVOA 3EZ7A 1Z82A 3IOEA 2MWMA 3DTVB 4FIZA 5JAHA 4I55F 1CR2A 2EKPA 4HYEA 5A9SA 1KQFA 1XL0A 3G2IA 3HWX1 1P0PA 2OBXA 3ZDFA 1O8BA 1TJ4A 1OC2A 3BSSA 3ND5A 1NATA 4RGVA 4MQMA 1Z2PX 1TCVA 2JGDA 5FRDA 3T0FA 3MSCA 4LBVA 4CGYA 2ZS9A 3KKKA 1VLZA 2JEYA 1COWD 3JD2A 4XJTA 1AVTA 1XTSA 2XX3A 3LC7O 2VAPA 4DSZA 1ECFA 1QUEA 1ZN2A 3PHLA 4RYLA 1RHMA 3DFKA 5EMHA 3VVBA 4C4SA 2NU7A 4MA5A 5JWHA 3BL5A 3I72A 3ZZNA 1JFRA 4F60A 4TS4A 2OG1A 2Z57A 1ZL0A 2FMHA 2ZK7A 2VP3A 1E2JA 3IXMA 2XCQA 4FDUA 4MWCA 2FQWA 3VA7A 2AWNA 3OZWA 4F4IA 3AHDA 2E5FA 3C43A 1SO8A 4IQ4A 4BNNA 4BCCA 3ADCA 1O6ZA 2ZYDA 5HXAA 1T6XA 5CD1A 3O95A 4B6JA 4OGFA 3LUHA 4MUXA 2DKFA 2Z9DA 1P91A 5IYZA 4PTZA 2YBDA 2XUPA 3NAMA 1SUSA 2O7NA 3ZGXA 3R40A 1M10A 4RX1A 3ZE8A 4GIBA 1WSAA 2VKQA 5IP5A 2WPDD 3WQSB 3VSAA 4MIKA 5DNUA 4UNRA 5TMPA 1JEQA 1J8VA 4O3MA 4EY3A 1FFEA 2BI4A 2BFDB 2LRHA 5I7AA 3M3PA 1AUVA 1WUHS 4OAPA 3VPGA 1JWLA 4DRYA 1ARZA 2HK8A 4CM4A 3D8RA 4NARA 2PV7A 3UJ8A 4A10A 2HNAA 2R1TB 3QI7A 4PWZA 1IJKA 2O06A 1TADA 3EXEA 3GZJA 4PYJA 4NX2A 3OTQA 1UL1X 3IOCA 4RQAA 5TV2A 4FK8A 4M9XA 5F7OA 4YJGA 4QNNA 4TZ6A 1FTNA 1AKWA 3PWTA 1DBPA 2WIBA 1I4WA 3A2NA 4I4TB 3PDWA 5DBIA 3WWPA 4F9TA 5BRJA 5JANA 1DIBA 4AUEA 1Q0TA 1Y8RB 1XHEA 1Y3BE 2VJOA 3GBSA 1NSTA 2I7DA 3CH4B 3NANA 3SSMA 3TLMA 1ZLYA 1JAIA 1OFUX 1RLJA 2AW5A 3KSRA 3VXKA 1SEVA 1TF2A 2HK7A 3IXQA 4IGEA 3T9EA 4CTJA 5H7XA 4D26A 4IRXA 4JDPA 3EDCA 3WQHA 2O8CA 3KQSA 3T5AA 2E4YA 1M83A 2LR0A 4GVLA 1US8A 4OKNA 2AN9A 4FDTA 5SY4A 1TF5A 4AN1A 3KKOA 1JUDA 2E37A 2UXCB 2CDCA 2M2IA 4U2BA 4YFVA 4D9IA 3TGPA 3ONDA 1I4TD 2AJCA 5FADA 5HE9A 1ZHHA 2I6SA 2HK6A 2PL9A 2Q5FA 3LHFA 4EGSA 2EL9A 4IDOA 2PKCA 5IXJA 3U3XA 1VRWA 4LXYA 1ZH0A 2EGHA 5KYGA 2HF8A 2J3HA 4NSNA 4EEZA 4KQGA 1G9SA 2VHZA 3ICWA 4JLOA 1YDEA 1UZLA 1NMYA 4FHDA 4RKFA 2CDNA 5K8TA 1RYYA 2ZWMA 5T64A 1MW8X 2ZDHA 2UYYA 3AY6A 2NX2A 3AR9A 3DPIA 3LQQA 2HMAA 2E87A 3T9BA 2G9RA 4MGIR 4KQKA 3U7RA 7ADHA 1CRPA 5KTPA 1E8NA 4J49A 1X7HA 3BJIC 4PVDA 4RXMA 4RLSA 3DE0X 4R2KA 1SGWA 5F3RA 4MJ7A 4ZOLA 4UM8B 2XMQA 2WNSA 2JH9A 3V4OA 1XDSA 2QP4A 3TDKA 1P8JA 1LWNA 1Z8HA 3COWA 5HDQA 4BOYA 3RVOA 2W0SA 5FLXA 1IWOA 3RUAA 1P3DA 2JZOA 1ECPA 4LVCA 4MRMA 4P9NA 5JDCC 1MVOA 4EABA 1IHOA 4AP9A 1G6HA 1GG2A 4FFVA 1KXJA 1XWIA 3NBUA 1OZ0A 1Y33E 4KXNA 4WY2A 1JG1A 3EHEA 4E2FA 4YX9A 3O0DA 4L3WA 4E3ZA 3G82C 2X15A 4LDAA 3AHIA 3R76A 3MT8A 2LXNA 4ON9A 3D2BA 3ROEA 4E21A 3OLVA 1WUTA 1MT0A 1ZC4A 3WK4A 5EPOA 3D02A 1XTJA 4QOJA 3C3KA 3RC3A 3PFKA 3TRFA 2C5BA 2AMLA 2VYVD 4RO0A 4JUCA 3HVKA 4BRUA 3L0OA 3JQBC 3PDIB 1SPBS 1U5AA 1C8LA 5C1BA 3B2EA 3K0EA 3TECE 1KZYC 3CW8X 4EDFA 1Q7EA 2QRMA 3C1AA 4GSYA 4CNBA 3DMNA 3RFFA 1A7KA 2BFEB 5LZ8A 4E70A 1AZLA 4M54A 1Z4LA 2GZSA 1PGPA 3CURA 4R8LA 3JQBA 2GAOA 2D59A 2JCVA 4IH4A 3MMPA 5SZKB 1COWA 3QWHA 2EF1A 1JMYA 1SD5A 5IANA 1UJ4A 3I6BA 1E9BA 4IJMA 5HCIA 3UMFA 2JLAA 2XCLA 3K7EA 1SEPA 2JFPA 2AD5A 2DPXA 4QVKA 1FDUA 4C0KA 4J8PA 3QWFA 3E4DA 3P2EA 1EWRA 3M4YA 4KYIB 3W6OA 4F8EA 4I46A 2JLWA 2W2XA 3G2HA 1SRQA 1TL7C 3NYQA 4H7KA 4IGIA 4N0EA 4V3CA 3VC7A 1N0UA 2NO1A 2A14A 2E2WA 4EZIA 3OZFA 1NT4A 2ZYWX 3GN2A 3KVRA 2O1EA 4MNTA 4PO3X 4RMHA 3ENQA 5K3FA 1LQUA 4FBGA 3DP9A 5FOWA 3AJ8A 4FDLA 2AG6A 4DVJA 4ME6A 4JC5A 1U0GA 1A71A 2GPYA 1IN1A 4YV7A 2MYNA 5KEIA 1FFCA 4BUZA 2O3RA 1OTXA 3O4RA 2OD7A 2TSYB 3DBLA 5DLDA 4D0SA 2B7LA 1CULC 4LRUA 5JD5A 2RGNC 4O4HB 3EW7A 4CI0B 2E4XA 3N3AC 4M7WA 2I6FA 1MO5A 3B2NA 1I2ZA 4L72A 4IG4A 5B36A 1HRKA 1A9SA 1TVCA 4QIHA 1L4NA 1J07A 1N3IA 1RHQA 2AV6A 2KMLA 1CUGA 2IYOA 2ROQA 1SVOA 3H86A 3PRHA 2PZBA 4B6FA 3P19A 1YQUA 1DAHA 1Z6TA 1OLXB 3OFNA 3PWZA 3QE2A 3EAQA 1QWSA 5K9ZA 3I73A 1K8RA 2AEEA 2EZUA 3FMPB 1VSBA 1YZVA 3GLSA 4IFIA 4TV9B 2ZB3A 1J49A 3S5UA 5BWLA 2V6BA 4CLHA 4ZV7A 1WQ4A 4XUEA 3VR5H 4L6AA 4R40A 2IP1A 2O6LA 1L3BA 3U7IA 3VX3A 1B41A 2V6MA 3ANMA 4BVBA 4HAWA 4QFCA 4WLUA 1YNSA 3T38A 3VRHA 2H48A 3TNJA 2HXSA 1O5TA 3C39A 5DOVA 3CO5A 2AFHE 3TLBA 1EXWA 2HWYA 5DLPA 4NK4A 4EJFA 2Q29A 3B3AA 3BTUA 1R4NB 3QKSA 4KZKA 2NXCA 1PFKA 2HLDD 3C24A 1ZD1A 2A30A 1VYTA 1QHHA 3GCXA 3HEAA 4ANFA 3ZJTA 3LC1O 5EIBD 1Z63A 5LQJA 1NKSA 4N0PA 2CMDA 4HRYA 1ECLA 2RGUA 1Y4ZA 5LFAA 2JLZA 5KDDA 2P9BA 2DC1A 2JRCA 2VCHA 2DPHA 1LLUA 3NJ4A 5IKEA 3P5BA 4FQ7A 2F4VB 1EG7A 4H7DA 1KEVA 4EMTA 1QK5A 2EX0A 1B2LA 4DQLA 1HDGO 1BW9B 1X1DA 3JVVA 1L3CA 2FR0A 1XAIA 4X60A 3EQ9A 1JHVA 3OCZA 2O5CA 1GQYA 4PNZA 4MS3B 4E4RA 5HS6A 5F3WB 2OXFA 2X9VA 3CZ5A 1MX5A 3RVDA 4D81A 2X1MA 4YMSA 1GZVA 5JBNA 2OHHA 3TL3A 1RAGA 1BS9A 3FN4A 1PI3A 3TEJA 2NUTA 3F6EX 3WRXA 3W4IA 3BZBA 1Q6ZA 1TFRA 3DR5A 3NV9A 2WT8A 1BSVA 2P2YA 5ENVA 4OHRA 3RS5A 1R37A 3HVHA 4EQ6B 3UOAB 4ARAA 1LCIA 3HGTA 4O59O 1UZUA 5CW2A 3SQLA 3L04A 4YAOA 5BN4A 3I3SR 5IPFA 2AC4A 4FI3F 3W77A 1VLMA 2WHEA 3UK6A 5K6RA 2FCAA 2X7JA 1UBHS 1RCTE 5CK4A 3K53A 3VAYA 4ZYLA 1XOIA 2J0SA 1JZQA 4N03A 1YBAA 3JYOA 1TT7A 4OA8A 3UA4A 1U3CA 3CCBA 5IJ0A 1GKIA 3H0KA 2X4LA 1M2VB 2J7KA 5G4KB 3KTAA 3HN7A 3LVFO 4XH9B 2CXOA 1AMUA 4AMGA 4KBFA 1CDEA 1MVLA 3K9LA 1E1LA 4YO8A 2CXTA 4JBGA 3ZGZA 1MZVA 3W2IA 2Y76A 1ABFA 1I9GA 1MENA 1Z08A 3DHEA 2G28A 4RMIA 3G2PA 3UM9A 4F3KA 2WD8A 2Y68A 3KT8A 3VSDA 4NZYA 4N5DA 4AAYA 3DZDA 5EIWA 1AN9A 1YVRA 2X0IA 2GTPA 1RFLA 1DTWB 1MH1A 5AW6A 3L8ZA 4F8JA 5IBRA 4GKAA 4IFTA 2OQVA 1E1QD 1GXSA 5I4IA 2D1QA 2O07A 3WMRA 4B3GA 6LDHA 1KKLA 3W6UA 1R2QA 3UXMA 4UEQA 3QLVA 4S12A 2Q9UA 2IXAA 4IQ8A 2I66A 2VDWA 3R6DA 3NS7A 1T3ZA 4BDTA 1F2UB 2PZEA 4QNRA 4BBJA 3WL4A 3Q7IA 1RJEA 2DLDA 3LQ2A 2HYDA 4CE6A 3T9FA 4E5VA 5IDXA 1ES9A 1DWUA 3QU4A 2JGFA 1T5SA 1PQUA 4E1AA 4CMKA 1JIVA 1LK0A 1BKSB 3HR8A 3V1YA 1T43A 4YAUA 3DCJA 5DGHA 4RJLA 1DX4A 5EOVA 4JY7A 5I7EA 4KWCA 1DGQA 4Q7EA 1OTYA 1RQXA 1RWOA 3QLUA 4UXHA 3KQUA 2X3UA 2JHPA 1XTIA 4IRMA 2C2WA 5EYPB 4ASUA 1IDN1 3CX3A 1Q22A 4GGOA 5B12A 3BIXA 2FN3A 2GFIA 5MN5A 3P2OA 2H4YA 3WMGA 4DUGA 3H9EO 1YCHA 2CLEB 4KG7A 1RKUA 3P9ZA 3I9FA 1RRVA 4ND2A 5IMSA 1NVMB 4N5NA 1SQ5A 3L1VA 4L5CA 5JZBA 3EIWA 1SUBA 2DX7A 3B20A 3FSJX 1JXQA 2PH1A 3TIFA 3TZLA 1W2WB 4GX0A 5D84A 2CUTA 2HJRA 4HDQB 1ZU5A 1L7MA 1LV8A 2JW5A 2Y27A 3FWHA 4TYMA 3TTTA 4WGFA 5AKGA 1EX1A 5I9SA 2IC5A 2QW8A 1E1YA 2QAGA 3FSRA 4UTOA 1UPXA 1KJ8A 1SCUA 1NA5A 2PBFA 4MW2A 4LYJA 5JTTA 4DJJA 3GEBA 4Q4JA 1A88A 3ZBQA 1U63A 1FTSA 3MWEA 4C1BA 2OWDA 2ZSEA 2GNOA 4K9SA 5ETJA 2P6PA 1UWKA 2CD7A 3K5IA 3A6KA 1NBHA 1TKAA 4JL6A 1KRHA 2V7VA 5F7ZA 3O31A 3GGPA 2AEMA 3TW8A 2A8YA 3EISA 4JL8A 5L45A 4MYCA 5JVDB 4PTLA 2Q0SA 2QPTA 3ES9A 4HUJA 4LJ8A 4WAUA 4CM7A 5E6RA 2NTJA 2X9NA 3OMWA 3NT5A 4FSHA 4ER0A 2LDBA 2RH4A 1SCQA 1AKNA 3B7GA 3KYIB 3KYDA 3CZ4A 2WB2A 4U7WA 4X1OA 2HEIA 2PKRA 2E6UX 2ZJYA 1CXZA 4FE7A 4I1SA 4PZUA 4TN5A 4Y0AA 4YAWA 4C7VA 4UARA 2GZ2A 2XBUA 2CXPA 3Q41A 1XUOA 4X24A 3T7IA 4BLOA 4Y1GA 2QN3A 2VZ0A 5E7QA 1IUPA 4D9HA 5F1YA 2GDZA 1EMDA 3GGSA 1RXSA 3JQFC 1SCBA 2P5YA 4LE2A 2C5SA 3QPWA 3H6GA 3DMYA 1A3CA 3HSYA 3WTBA 3AR6A 4O1HA 4WZ6A 1KGDA 1XZMA 3A4VA 1KS9A 2P6MA 2Q3CA 3IILA 3RS2A 4CG2A 2GKOA 3KYCA 2A57A 2W2OA 4LCEA 5CM2Z 5FX2A 3NTRA 5KVVA 1C3EA 1NF3A 4WEOA 3ONVA 3OTOB 1Y6FA 5EESA 2ZDGA 2BTQA 2AE2A 3GRAA 2VBFA 1AD2A 3GROA 4I2NA 3ESBA 4O4LA 5EHZA 3BRQA 5HQTA 2NTEA 2QLLA 1V9LA 2QD4A 3IHWA 1CUIA 2PWBA 3TIVA 4MEAA 1EM8A 3ZVKA 5FBVB 1TA0A 2E0IA 1Q19A 3DMGA 4OL9A 4YDQA 2CKMA 1MOQA 1SXPA 4ALKA 3T3MB 2E4AA 4YHBA 2ZE6A 1E0KA 3PVCA 2C77A 5ARCA 3IAUA 2E85A 1W85A 1U0JA 4MWBA 1XPOA 3ULKA 4NAUA 1QQ7A 4Z5XA 1LF0A 3GT4A 2DUUA 3AI2A 3FOBA 3NBZC 1JHAA 4A8JC 2ZM6B 2C3OA 3ADDA 1PSWA 3C1UA 3HYCA 2IEDA 4KRGA 5FFMA 5LDDC 3DGEC 3QHPA 2H5LA 1Y6ZA 4QJIA 3BJRA 4W7IA 4Q9JA 2JFWA 1HSZA 1LTHR 1KMMA 3QG1A 2H1LA 3TTXA 1OKKA 3IAFA 5AQEA 4MDYA 4KH0A 1EGHA 3JQAA 2E7ZA 5FL3A 5BV0A 1DAGA 2R6ZA 3I52A 3V2GA 1T8UA 1U2PA 3HB5X 1KFJB 4V3BA 4LC9A 1T0BA 2WKQA 1XZLA 3EEQA 3O92A 4JB0A 4JLDA 4U39A 3ZQKA 4BMNA 2J3IA 5K51A 3HE3A 3FTCA 3PUWA 4UQOA 5JVDF 1N2JA 4X7RA 2R5WA 1WXWA 3ILXA 5GWXA 3WA6A 4DA9A 3GLFA 3G0BA 4BN4A 3QXCA 3ET5A 3BXZA 4AECA 1K92A 2I6QA 4CPDA 4JA2A 4LYGA 5JFGA 4D0LB 4D43A 5BSEA 4R1NA 1KE2A 3V80A 5LMNB 1K08A 1JFTA 4H7HA 1VGRA 5JMWA 3HDJA 4QQNA 2XKAA 5E4TA 1EZ4A 3MS2A 2Q4DA 1STOA 3ON5A 4JJ4A 1H3EA 5L3QA 4QDZA 3CV3A 4IIXA 1F38A 3H1TA 4JB8A 4MCHA 4ID9A 4LHSA 4XWAA 1Y4DE 3U4IA 3PXUA 1GLNA 4BNIA 2YY5A 2W4QA 3AQIA 2WM9B 4KMSA 5GJVC 4EHHA 4Q6BA 3KT0A 5F7JA 1EM8B 1NVAA 2G5PA 4N7BA 4DR1B 2YWDA 1XD8A 1ZM7A 3NJ8A 5EE0A 3E70C 3M4JA 4KV9A 1EU1A 1DIAA 2YHIA 3FZQA 1QIMA 4RCYA 1FRZA 5B2ZA 1NP7A 1OT5A 3K1TA 1CUBA 3QNWA 4L0QA 4JQZA 1QTIA 2F62A 5CFZA 5LQCA 1CDOA 5CBPB 1VIAA 3RBXA 5BY2A 1Z0DA 2IZ7A 4L27A 1JG6A 1XRQA 5KTNA 1GCOA 1Z22A 1VPDA 2Y1OA 4K6CA 1XRPA 4DR5B 3HTXA 3EBOA 5AI6A 1WIWA 2X40A 3ZGLA 2PBRA 3RHSA 4UQPA 5HOEA 4MQEA 3GX1A 1KDTA 1YB7A 3DKVA 2HX1A 3H19A 4PGMA 3SZGA 2UKDA 3HGQA 2QRQA 3HPRA 3B38A 1IZ8A 4J1TA 3QVVA 4RD4A 3RVNA 1U0SY 2BWJA 4OGGA 4YPVA 3IR7A 4FNOA 2QT1A 4XAQA 1SXJE 2VRCD 4YHHB 1ABEA 2OFOA 2H5JA 2G83A 1NR1A 1YU9A 5L7WA 4CMEC 3LM8A 4IDNA 1M54A 4JI0B 1Z8DA 3OPQA 4D6PA 4OUDA 2JI7A 1BXZA 3DQPA 3M9WA 4EJSA 4NCBA 1PD1A 4KGXA 5BR8B 3WDMA 2B78A 3F90A 4C3ZA 1C7JA 1D8TA 1DDOA 1DEKA 2C3UA 2VBGA 3BXFA 3FSGA 1A0OA 1T4GA 5JJCA 1V96A 3TL2A 1OREA 1GZ5A 3TLZA 4S04A 1I7SB 3JYNA 3QEJA 4WXYB 1HDYA 3IALA 2IQIA 3P0HA 4H4DA 5EVCA 4RVUA 2JFOA 5HCUA 5J4VA 1M74A 4JLUA 4ZT5A 4S05A 2G80A 3G2QA 3KR1A 1Z0SA 3EVTA 2ZUBA 4HQRA 4R1QA 3RIXA 5FP0A 4ZVPA 3AV3A 2P2SA 1O2DA 2PUGA 5L3SA 2CXQA 4CCSA 2B8WA 1YZNA 5T41A 2XMRA 1YRWA 3V7FA 4MUMA 4AMYA 4ETWA 5DNDA 5EHGA 4PHGA 5G4LA 4UJ3A 1GR1A 2FPWA 5BOSB 5JHHB 3BZWA 1SIOA 5HKOA 2KYRA 1U65A 4OHUA 3HVIA 2XF8A 4G56A 4OSOA 3QBJA 3K2EA 3T61A 5KJFA 1NG9A 2C7OA 1JPVA 3R4CA 4MINA 1VFPA 2G4CA 4OREX 4JLPA 6ABPA 1ML4A 2PSHA 1V2GA 4G0NA 1IG0A 4PR3A 4R2HA 2O54A 2ODNA 2V03A 4N5HX 3V34A 4K9PA 4RIGA 2WWHA 3DFZA 4MW6A 3RTEA 2BRUA 1WZUA 2ZYIA 3JAKB 3DOFA 4FX5A 1R88A 3AUTA 4DPLA 2EKDA 5K8CA 3VH4A 4V0RA 1W4AA 2MSWA 3I4FA 2F64A 1DWOA 1O7JA 4Q82A 1PNVA 3EIHA 4EI7A 4YALA 4F6LA 2Z5VA 2IIQA 5IK2A 2I6GA 2B5OA 2FEPA 1CB7A 3FUUA 1FFAA 3IKJA 4RF4A 4FB4A 1XZ8A 4TKLA 4A6DA 2P9EA 1Z5UA 4PF1A 5FUYA 1FYEA 1SUIA 2GM9A 5AO9A 3PGLA 5CDHA 1D0VA 1ZHOA 4Z53A 3N05A 1S5PA 5CA0F 2C4UA 4JBXA 4BPRA 2VH2A 1DKUA 3DMHA 4PLHA 4HN2A 4ZRNA 3SI7A 1IHXA 3AF5A 3LCCA 4EDHA 2VNIA 2GVZC 4X6YA 1KRXA 1TVMA 3UUGA 1U90A 5HZGA 1Y89A 3ZHVA 3GVHA 1A9OA 3F7NA 3RYHA 4DTIA 3EWAA 4YNBA 5K6TA 2X41A 5I48A 3LLCA 3QNUA 3AYZB 5A6SB 2I4OA 3HCCA 4L15A 4H1WA 2PSEA 3VUFA 3E9RA 3X3HA 5ALUA 1SOMA 2ZWPA 2Y1DA 4LC1A 3A6ZA 1K6JA 3L1HA 1XTZA 1KDVA 4PC2A 1MRSA 1YUMA 1Q5PA 2X9GA 4MV6A 2G08A 4F86A 1VKRA 2VJNA 1E6UA 1XDBA 3EYWA 5G0TA 5JEEA 3KPUA 1AKYA 4DA6A 2BM0A 4IXMA 3BCSA 3ZKWA 4NH4A 5JPDA 1G8JA 4H0NA 4KO4S 4V1CI 3N7TA 3H6HA 3BORA 2ZJ1A 1EKXA 4PZYA 421PA 1T4CB 5BQFA 2XE7A 4TS3A 2DQSA 2Z5FA 2AR9A 4HAUA 4OATA 3UENA 3HUDA 2PT6A 3S2SA 5DWDA 4NBUA 4WXRA 1PLJA 2WP8J 1GPAA 4F4JA 1OX4B 1ZW1A 2B3DA 4GLLA 1YJCA 5FUXA 3V1NA 5KSPA 2VP4A 2VTEA 2WICA 4W1RA 1DC7A 1KH2A 3LE8A 4IXTA 4XLTA 1GT6A 1CPYA 2RK4A 1K5HA 4HK4A 1LK7A 4U2EA 3M6UA 1MG5A 5H02A 4S2EA 5BV7A 3HJRA 2EHJA 3IAHA 3WGYA 1M72A 4B3TB 3HHEA 3EEYA 5B6IA 5LP6B 1NLMA 3PQEA 3M6WA 4DJTA 4DLTA 3R75A 1TJ5A 4YPFA 2CW5A 3ZK9A 5KU1A 3ONWA 1WX1A 2VAMA 1N78A 4BHTA 1Y9ZA 5FIUA 3WMEA 5JCPA 3T7DA 1ZUIA 1VC2A 1E6WA 2Q9CA 2ZU0C 4WH0A 2HMVA 2R4QA 3LMKA 1JN0A 1TDJA 3H8VA 4A26A 2MT9A 2CK3A 1G16A 1HH4A 4BEBA 2QX6A 5TT0A 3VV3A 2GGSA 1VIVA 1CU1A 2RAUA 4C6HA 5EXTA 3O3CA 1TOAA 5ALLA 2GFQA 2IHKA 2V58A 3N2YA 1G66A 1SC4A 3BWVA 3GP5A 4WCFB 4XI9A 5GONA 1EFDN 3RADC 1FU4A 5C52B 3ISJA 1MJ5A 4HQFA 1N6OA 1NZDA 2EFCB 5AVWA 1ZR4A 1RZRA 4PPGA 1AT1A 1AQIA 4HDNA 3K35A 5AJXA 1Z2DA 2Q8PA 4JT8A 3PGXA 5D6OA 3PQ2A 1ULTA 1QVAA 3KETA 5L4NA 2AOTB 1LLFA 1N0VC 4KOAA 2QQFA 2YFYA 4PS1A 2PMEA 1Y3AA 3I9NA 3AH8A 1POWA 3ZIUA 1FVOA 3H5WA 3BREA 1AXRA 1V16A 2PJDA 3AF2A 1VDMA 4MITA 2QJFA 1P7CA 5G1OA 1P2GA 3NUZA 4UBKA 2VOJA 3FCEA 3S1SA 1IFXA 2BVNA 1Y5LA 3KB6A 4I5DA 2IYRA 1F6BA 3H8WA 4FMCB 4DCJA 2C88A 2FPPA 2ZRMA 2F2TA 5EWLB 4KN9S 4CMEA 1S3FA