2QIFA

Crystal structure of a metallochaperone with a tetranuclear cu(i) cluster
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
b'MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone copZ
publication title A tetranuclear Cu(I) cluster in the metallochaperone protein CopZ.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chaperone
total genus 21
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qifA00
1V3ZA 4Y2KA 3KNGA 2N4CA 2PD1A 2VV5A 2KYZA 3F44A 3HX9A 4HI1A 2ASYA 1VQSA 3GZ7A 3TOQA 4YDXA 2OFGX 3KG1A 5B08A 5IXUA 3HHLA 2BYCA 4FNIA 3BN7A 3E8OA 1OQ6A 4ZOSA 5B0BA 2LXFA 1FVSA 1N5VA 2ACYA 2OKQA 4ZA1A 5F0UA 1AFIA 1AW0A 2BJEA 1Q8BA 1SQEA 1TUVA 1IUJA 4U9RA 1SI9A 2AW0A 3LGMA 4Y2IA 1FESA 2OD6A 1YG0A 5T7LA 1Y9OA 1YJRA 3UDCA 2XMKA 2GCFA 2W4PA 3MZIA 2FHMA 1ULRA 2FIUA 1CC7A 3FRYA 2IYIA 3HHLB 4HI2A 2QIFA 3BDEA 2LQBA 3BM7A 3KKFA 3QMQA 2KKHA 2W4CA 2AP6A 2OP5A 1CPZA 2HQIA 1Q8LA 2QLWA 3QGPA 1FEEA 4YEAA 2IFXA 5B0GA 5T7LB 1VQYA 3FGVA 1YJUA 2QLXA 1FD8A 1Y3JA 3TRGA 4A47A 5B0DA 1Y0HA 2HFOA 3FMBA 1X8DA 2RU9A 3LO3A 1CC8A 2GO8A 4A48A 1OSDA 4OJHA 4OJGA 2K7JA 1TR0A 1N5QA 2PGCA 2W4DA 1YJVA 1Q53A 4NPOA 1MWYA 2FB0A 4EFAC 1TL5A 2HFNA 4FNHA 4OJ1A 3CJKA 2K7KA 1X0PA 1JWWA 1JK9B 1OQ3A 1APSA 1YJTA 5B0CA 4NL5A 2N7YA 2RILA 2XMMA 3DCAA 1K0VA 1FE4A 2GFFA 2IYGA 2JDJA 2LQ9A 4A4JA 1URRA 3HFKA 2OFHX 5F0WA 2HIQA 3IWXA 4HH1A 3CJKB 1LQ9A 2HLTA 4HH0A 2L3MA 1WD6A 3BF4A 3IWLA 3TNVA 2G9OA 2GA7A 2GGPA 1RJJA 2XMVA 2ZDPA 1KQKA 2QYCA 3DXSX 1P6TA 5B0EA 1AFJA 2BJDA 3HHLD 4Q2LA 3K7RA 2KT2A 2K2PA 1P8GA 2XMUA 3HHLC 1Q4RA 1MWZA 3MCSA 4F67A 2OMOA 1Y3KA 3I9ZA 1GXTA 1OPZA 3T9NA 3BB5A 5B0FA 2AJ1A 2HLUA 5A6PA 3VTIA 1TL4A 2GGPB 2OD4A 2BUNA 1U7LA 2BBEA 1FVQA 1W2IA 4HL9A 2AJ0A 2CRLA 1SB6A 4QOTA 5KAKA 1N5SA 3BGUA 2RMLA 2XMWA 1S6OA 1R6YA 2EW9A 1FE0A 2ROPA 1X7VA 2KT3A 2FTRA 4A46A 2K1RA 1YRXA 4Q2MA 2XMTA 5B0AA 3KG0A 4OJ3A 4DL0C 2ZDOA 5K9FA 2OAUA 1KVJA 2GV1A 1GXUA 4DN9A 1S6UA 2RSQA 2ROEA 1QUPA 3HDSA 3WDOA 2Q3PA 2XMJA 5B09A 2LDIA 5A6WA 1KVIA 2N4DA 2ROGA 1XBWA 2VH7A 3LGNA 4DPOA 4OIXA 3BR8A 2K1RB 4Y2MA 1TZ0A 3HF5A 1N5TA
chains in the Genus database with same CATH superfamily
2OHDA 1NNDA 3EGZA 2BE2A 1SQGA 2HVDA 4XDCA 2DCUB 2W9BA 1WEYA 4QJVA 1VRUA 4KRWA 4ED3A 3NGSA 3PNIA 1CC7A 4X64J 4OZ3A 1W25A 2OMLA 2IFXA 3EGWB 2WVDA 3DLGA 1RT5B 1T05B 3AD9C 1OY9A 5DLGA 1PILA 4AYBD 2ZE2B 3MD3A 4ED6A 4J9RA 3ZC4A 4OYXA 2M4MA 4MIBA 4DV0J 4J9VA 2W24A 1VQ8S 2ATLA 5F8MA 2N7CA 2C2MB 3E01B 2FVSA 4DLGA 1FI4A 3AOBA 4NZ0A 3K0JA 2G0JA 3OR1B 2GNKA 3K5MA 2HQFA 2HZAA 4HHJA 4DUTA 2BVZA 3PIPQ 3DHWC 3KG0A 3G8TA 2ZDOA 1N5YA 4FBTA 2GV1A 5I4MA 2Z2YB 1FRJA 2DGXA 4G1QA 2ZC4A 3ZTSA 2GQ2A 1WDDA 2EI5A 4QIWD 1C0UB 4FPRA 1VQ9S 3MM9A 1MN9A 1FJGF 1TQLA 4OYMA 5C42A 1RWOB 2IVYA 4NLDA 2FHMA 4EEYA 3CNQP 3SDEA 2ZC3A 1C4AA 3TVZA 4ZITA 3NS7B 4ZIWA 5D4OA 2VJUA 3FEXB 4O4RA 4C48A 2R7TA 5KFOA 2XZWA 3P96A 2VPYB 3DGVA 1FERA 3GIKA 1NB7A 4C0BA 2LEBA 2W2OP 4R5PB 2PA8D 1KONA 3MHYA 2R7SA 5IT9Y 4TYAA 3MMJA 2PI4A 1KQKA 4O3QA 2ZJQQ 1PG5B 1LXJA 4P72A 1T9WA 3C15B 2YNHA 3VTIA 2F5GA 3RAQA 3MM6B 2U2FA 5LM7E 1RAJA 5ETRA 2E29A 2PMZD 4B9VA 4PR6A 4R25A 3JSMB 3VAIA 4CO3A 2K06A 4F0HA 3VAFA 1CS4B 3KLFA 2EBEA 4C2MA 3CCWA 4M63A 2N4CA 2YH0A 3W9HA 3KNAA 4ENOA 3CGIA 3PEJA 5D15A 2WW8A 2CFXA 2YKNA 2QIFA 3RB4A 4QW8A 2VL1A 3MECA 5B0GA 4WYWA 3MFHA 5IQQA 1RTJA 2W8LA 3LP0B 4X4PA 5K8NA 3G87A 3BN4A 2IM2A 3FJ2A 2Q66A 3OTOF 1YLXA 3R5BA 2V4JB 4PRFA 1C0TA 4C11A 2DVIA 3BSNA 4AQYF 3HXMA 2X51A 3TAMB 3FFIA 2QC3A 4DXLA 2V34A 2O5DA 4JI2F 2E5IA 3I6PA 4G1PA 4KGXB 2KT3A 5HROB 1RBAA 1N36F 5K8MA 1T3NA 3OTCA 2PD1A 4QWBA 1R89A 1Z1ZA 4LF5F 3FZ2A 3R3TA 3VZHA 5KT5A 4JI3J 4LRCA 1RHRB 1RWXB 4OLPA 1F5BA 3I96A 4N77A 2FIUA 1UFWA 2LXUA 3WZ0A 3BDEA 2AZ3A 1BE4A 3GV5B 2VBXA 2VPWB 1MG7A 3M8YA 2XEXA 2MZSA 4WZMA 1HBMB 3FRZA 4BC9A 5IV4A 2VG6A 1S57A 3NEKA 4PUOA 4O4GB 2YKOA 3VALA 2UVUA 1HI8A 4P2XA 3W2VA 3LWLA 2FJBB 1F3FA 5FLXY 1UEUA 1SJ3P 3CMAS 2K3KA 3L95X 1EX8A 5F0WA 4X62F 4ED1A 5GAEI 4DV5J 3FBBA 3OUYB 4DCPB 3NGDA 3IS9A 2BQUA 4F4WA 4LF8F 1QTMA 4J9NA 3PJXA 5E3RA 5KFHA 1JKHA 4DV7F 2CRLA 4PAAA 1HD1A 2KXNB 3I87A 3D6HB 3QWUA 1SC6A 4PWDB 3OLAA 4ZP7A 3G9CA 5C25A 1T9TA 1N5TA 1R3NA 4M5DA 3M32A 5B08A 2J8SA 5J2MA 1OQ6A 4CM2A 1OO0B 1O8BA 3MPVA 1FWKA 3C3LA 4C8ZA 2F4VF 3LGMA 2WRMA 2J9DE 3UDVA 3WX8A 1W26A 4N41A 5EGYA 1SH2A 1XMQJ 1C2PA 3TUJC 5K20B 2KJWA 1KLMB 1N34J 2VUGA 2AJ2A 1U1MA 2RQCA 3DRRB 1X60A 1T11A 1APSA 5DRKA 1WHWA 2AGOA 2M5YA 3CWJA 3THPA 3ENAA 3GONA 2DR5A 3LUYA 1ZM9A 3MXHP 2JZ5A 2O1PA 3LAKA 4L6V3 1S9FA 2BW2A 3HJFA 2EFNA 2KJVA 1M1KT 4CCHA 1Q8KA 2GVZA 3MAQA 3CJTA 1JXVA 3SQOP 5KTQA 2HHTA 5HBMB 4JV5F 2IM1A 1H98A 1KN6A 2AQ4A 4LIWA 2DH8A 4D3GA 2ZD1A 3N6MA 4O3PA 1PAEX 1JQGA 1ZM4A 5G0RA 2OKQA 1GH8A 2D3O1 4CH7A 2MZRA 3M2RA 2BANB 5HP1B 2YBVA 1TMJA 3PM9A 2G13A 2E9ZA 2KTQA 1S1VA 2EC0A 1N88A 4NLRA 4PXEA 2MGZA 1WC6A 4UT4A 4XO0A 4TXSA 4WU3A 4QWDA 1HQUA 5GMDA 2MY8A 1U47A 1S0NA 5EDWA 4F67A 3MM8B 5CH7B 3MMBB 4DV6F 1OY6A 2HURA 4DV4J 1S7HA 1U8WA 2E9RX 1PSDA 4OZLA 1V6HA 3OXLA 4UW2A 1JLQA 4USWA 2CPYA 5KFVA 1TU0B 3ZZYA 1NUEA 4HI1A 3P49B 2VQFJ 2RKIB 3DC2A 1Y00A 3RBEA 3IFEA 5T41A 2RHSB 2YXLA 2AW0A 4H54A 3MI7X 3PYEA 5C2CA 3FRYA 2QL9B 2DK2A 3D28A 2OJ3A 3BPSP 3HFVA 1UJ4A 4NI2A 3DM2A 2PO4A 4QYZJ 3AQOA 3M2UA 2MSTA 4ED8A 1BGXT 2HVHA 4ZVFA 2MLXA 4ES2A 4IFVB 1DHMA 3QQCD 4QIEA 4CO0A 4OQJA 5IM0A 4G3IA 3DGPB 3W3SA 2KG1A 2Z56B 1DARA 3VZIA 4QIGA 3TARA 2XYHB 4HLBA 1TV6A 1F60B 3KLEA 3Q8SB 3OVAA 1RWNB 4U7UK 3M05A 4U6PA 2I6WA 1NKBA 2QSFA 3BO2A 2HBYB 1T9VA 3D5MA 2FTRA 1NDLA 2FLOA 2B7BB 4Q2MA 5JVGQ 3V6KA 4ZLLA 1FRMA 4R0JA 2L08A 3GV8B 1U0HB 4WIQA 2EWHA 3LGNA 3V4IB 4F50A 2AEMA 1WKJA 2MQLA 4IO1A 2WCXA 3BN7A 3DOMA 3BYRA 8ATCB 1ZBTA 1RBOB 2G1HA 2RQMA 5LSRA 2OTJS 3RRGA 3HD2A 3CIZA 1Z4UA 2LQBA 2KYXA 2EVZA 3NLCA 4J9LA 2J7UA 3LAMA 1GX6A 2FGCA 4DR5J 3G96A 2QA4G 4FBUA 2MDAA 1U4BA 1J5OA 3H20A 3QT7A 1IM4A 3OXFA 2CPZA 3GR0A 3K59A 4HT5A 3U1LA 3UDEA 5HANA 3EVWA 3GB0A 4CTAA 2PI5A 2CDRB 3NS5A 4U96A 2YTCA 2Z2LA 1Q4RA 5KFIA 2IA0A 1SL0A 1WELA 5F8IA 4C3MA 1FDAA 5GADU 3MD1A 3VWSA 1DTTB 4TY9A 4TNOA 2HSEB 1RT3B 2DY1A 1VCTA 2A1BA 3GYNA 1RT2B 1YIJS 2CNNB 4ZVHA 4MMOA 1S10A 3KNGA 3A3NB 1RTIB 1OMSA 5FIIA 1R8PA 3F56A 1SJFA 5KFYA 4ZCLA 3AODA 4W92B 2DPIA 4WE1A 2EFPA 2CQCA 1E6YA 6FD1A 3HVWA 3AB4B 4RW7B 3NGKA 3N5FA 1YJUA 2OSQA 1VQ6S 4DL2A 3OPKA 4LFAJ 3H5UA 4DV2F 3IM8A 2V94A 3HHNB 4OYPA 1SIZA 3HP6A 3O5TB 1HNXJ 5IT0A 3SQGA 3OFFA 4FYVB 3JXOA 2HK2A 1NKEA 4E98A 2GVDB 3BSAA 4YHHF 4YY3F 2WHOA 1MROB 1A9NB 4U7UD 5AE2A 1WUUA 3OBIA 4NXNF 2UUBF 3MCOA 2PDAA 2AKWB 2F3JA 4OYIA 1U1LA 1G7CB 5D4PA 2I8EA 3DN9A 4F8RA 2P9GA 1BUXA 4TN2A 1F9EB 3MEGB 1OSCA 3Q8RB 1MN7A 1EQ0A 3DRPB 4TQRA 1NPRA 4NLWA 2YX1A 2MKHA 1HBOB 2FJVA 3OLBA 3KK3B 1FA0A 4DS5A 1NKCA 4OYZA 2HFSA 4I0WA 4LSNA 4USJC 2DO0A 5H9EK 1NXIA 2PGCA 1GX5A 5C5JA 1QJHA 3CDWA 3W5ZA 1TL5A 5M2RA 1RKJA 1VQLS 2OPSB 3HMJG 3H4DA 1NDKA 1UZDA 4NRTA 4RPFA 1VQNS 2BKOA 1LWEA 1RISA 2DKOB 2MKKA 4ZN1A 1FF2A 3C14A 1ZM2A 4H4OA 2Y0BB 5HJYA 5AT1B 3OHBA 2H3EB 2WSEC 2J7WA 2H4WB 3UWTA 3CIMA 1FJGJ 5DM6Q 3GSIA 1IN0A 4L73A 5AE3A 3W8PA 3T5KA 5IWAF 3UVJA 3VGVA 5KFPA 3UR3C 4QWAA 5SUHA 1T3OA 4CO5A 4CYUB 1NK8A 3R6GB 2VDIA 3A13A 2ZEJA 4H4KA 2K8GA 5J2PB 3HVRA 4C8LA 1X4AA 5F0UA 4RZRA 2C3YA 2F7VA 1WWHA 2DHHA 3EPIA 1FNOA 3QMQA 2DNKA 2B7CB 1HKAA 1S6PA 2APOA 2WK4A 4AL6A 1N6QB 3GCWP 1O6XA 4LR7A 1KQGB 4JUZA 5AXNA 2W9CB 1VBKA 1UA0A 1RSCA 4Y0FA 4V19J 4ER8A 4Q0BB 3K8VA 2W2NP 3IA0A 1RT4A 3JYTA 1RWWB 4KH0B 3AXMA 2E1CA 4NASA 2POKA 3PX6A 4KT0C 5HMXA 1H3DA 3QO9B 1F9HA 2YKQA 4J9SA 5CXTA 4DEZA 3FNNA 3DLHA 4DR1F 1XR7A 4ZIVA 4B3TF 4ZPAA 5I3UA 3OTOJ 2CPDA 1Q81T 1KD1T 2PIIA 4J9OA 2G1DA 1U2FA 4ZCIA 3M8QA 3CJ5A 3DRSA 1Q16B 2DCLA 3ZNUA 4AQYJ 1HARA 5KFZA 3BO4A 2LCWA 5D6GA 3LP2B 4JI2J 3FKBA 4WCEQ 4DCOB 2NUHA 4QIVA 2ZH8A 5D78A 1HBUB 2QTWA 3V81B 4DPXA 1F2HA 1RXOB 1N36J 3ZFVA 4X4TA 1G1XA 2C2NA 2G2OA 4KH1B 2X1FA 1U09A 5L46A 2KDOA 2C3UA 4LF5J 2GGPB 4HL9A 4IYQA 2EFOA 3IN5A 1LKZA 3CCUS 3Q8PB 1XMOF 4I2QA 2ACMA 5JJBA 4F02A 4K7QA 4PWUA 2P6TA 1MLAA 2AJ4A 2D3ZA 2JJ4D 4CO1A 4DR2F 4B3SF 2GC8A 4JI5J 1S6QB 4EBEA 4X62J 3HHLB 2IC3A 1LNQA 1YQHA 2J9DA 4HEA9 3EVOA 3K5OA 1VJWA 1IKYA 1IKWB 2DD8S 2FVRA 1CBKA 5FDLB 4PKDB 2UP1A 4FYXB 2BZ2A 1DJ0A 2OPPA 2N7YA 2XLIA 1M5VC 2IRXA 3N5BA 4LRFA 2XNQA 5DDPC 1S99A 1RU1A 3I4PA 2JOQA 3SSQA 1VIOA 1T9YA 1C1CA 4DQSA 1FRKA 2R8HA 3DOLA 2XMUA 3HHLC 4F4KA 2W7AA 4JOUA 1XIQA 2H5IB 4UOGA 3CCVS 1BQXA 3NBPA 2W8KA 2F4VJ 3TUZC 4Y6IA 1ZYQA 3O6QA 2Y0SD 3OV7A 3CCTA 2FLPA 4IH5A 4NCGA 1UJ6A 2ROEA 2B9WA 1MMDA 1UETA 2RD5C 3KLVA 3R8YA 4ZPTR 3JAMU 2V2VA 3F41A 3MMAA 1SXLA 2VOOA 3D66A 1JLFB 3QGGA 1HQEA 1YI2S 2BOPA 1FESA 1WC1A 2HQDA 1HYSA 4IDKB 1HQ2A 4PQUA 1GTHA 5T7LB 3H90A 5E3QA 4OLOA 1DRZA 3B4MA 1ZTTA 2MKYA 1WI8A 5HLFB 2YNIB 3Q22A 2Z2MA 1JWWA 2NXJA 2ZHBA 1NM2A 2LQ5A 3RB3A 2VG5B 3J80U 3BO3A 5KFGA 3OL8A 3I0SB 2HIYA 3V5RA 2BEFA 2G2ZA 2NR0A 1X5PA 1K1QA 3BBFA 2R8IA 4HACB 1TL4A 5DDOC 2CDQA 4C6AA 5HL7Q 2AIRB 1PAUB 3ZXWA 4LT6A 1U6ZA 2V6AA 4P7TA 5IC4B 2Z0GA 1U26A 4F2SA 5A8WA 5J2QA 2EXUA 1H0HB 4MTPA 2UUCF 3J81U 3MEDA 1NZAA 2J5AA 3AOCA 2XBPA 2HNDB 5IOLA 1VK3A 3QIDA 4USIA 1F2GA 4PCQA 3QZ8A 4LF4F 1UW4A 2KG0A 3RGIA 4ECVA 2VONA 2GQQA 3DLEA 1LWFA 3MM7A 1U6FA 4PG7A 4RWWA 3L9ZA 4A47A 3KLGA 4CLZA 4DV6J 3MPWA 1FKAF 4USTA 2HWHA 2GMHA 1H38A 2ZHAA 4GKKF 5IS2A 2LQ9A 3CCJS 3AJDA 1N4LA 4QIFA 2QV6A 4CH0S 3HKWA 4OZ5A 2YY3A 1NJYA 1VYAA 4OFZA 1HBNA 2ZVIA 3R5DA 3W1YC 1EAYC 1UWBB 3CJSA 4RNMA 3L7UA 2OMOA 1XR6A 4Q45A 3M1VA 1VR6A 4JBCA 1HNWF 4IOAQ 2XMWA 2L48A 2HVIA 2DITA 1FWLA 1NPKA 1RUSA 3HT3A 4KHPF 1B3TA 1TVRA 3PX0A 2VASA 4N8OA 1CULB 4URGA 4O3RA 2JFKA 1ITPA 5L1LA 5DGAA 2Z2ZA 4YDXA 2OFGX 1BQNA 1X31C 4F4YA 3I32A 3A12A 4LSZB 2AGQA 3GFXA 4DSEA 3CD0A 3FVYA 2QT7A 2NSCA 4DX7A 2AYMA 1X0FA 2R2RA 2RU9A 4ECWA 2DGTA 4F25A 1C1BA 1FKPA 1EETB 5E7OB 1K44A 3CUNA 1Y5IB 4OHYA 3DCAA 3EICA 1NRKA 2ZOFA 4QBUA 1I1GA 3MAAB 3BGFA 4O3SA 3OL6A 2UXDF 2JEJA 2RHQB 4H4MB 4ZPVR 2H65B 4DHVA 3EMTA 3PYFA 1R8BA 4IG0B 3C2PA 4YR0A 3JSBA 4BLGA 5IV3A 4DL4A 4EYHB 3G8QA 4Z7YA 1FKOB 2LDYA 2IVFB 3L4BC 2L41A 2C28A 2L9DA 4QW9A 4NE9C 4AE5A 2EFGA 4AFFA 2HRUA 2PA3A 4ZPCA 3G86A 1TKZB 4MFBA 3SV3A 3OFHA 3PACA 5F9NA 4Y2IA 1Z2LA 1DQAA 2YWFA 3BH7B 2R8JA 1RTDA 2M70A 1WC3A 2VC0A 2JHEA 1VQPS 2HGNA 3U27A 2C2EA 3JSYA 1FCAA 2XO7A 2JC1A 3RAXA 1NO8A 1T8EA 2VFVA 2VZ9A 2W2PP 3S01A 4CZCA 3SI8A 2BQRA 1WHXA 3M6XA 1S4FA 3AAWB 3FSIA 1CJVB 2ABYA 1REVA 3M6WA 4FVMA 5GVQA 3TR5A 2X1AA 4ETZA 3TEHB 4IFYA 2A3JA 5L8RC 1TKXB 2R42A 2DHSA 2RS2A 3V2UC 3FQKA 5LMUF 2B4PA 3TO8A 1WJ9A 2MKSA 3QSIA 5L1JA 3HK2A 2CQPA 2DYAA 3GR1A 3GPAA 2RF2B 2LU1A 4DV2J 3H40A 1S1TB 1D9AA 5KFAA 3KJVA 2LLZA 2DH9A 5J1EA 3FBEA 1FFGB 4B3OA 3O2IA 5KFCA 3RAMA 1D8ZA 3GIRA 1ZPWX 4YHHJ 3EYZA 3OJUA 4R8UB 1MSWD 4P52A 1VQKS 2RH3A 3VV2B 4USMA 3EUNA 3ZNJ1 3M2VA 2UUBJ 4ZPDA 4RW8B 4DPUA 2DHGA 1S1XA 2SXLA 8AT1B 4ZJQA 4GO5X 2Q43A 1L3KA 3BF4A 1RAEB 1TL7B 2XQCA 2ZOGA 2XULA 2FY8A 1RAIB 2E1MC 2FPHX 4NLOA 3K89A 1HW9A 4P6QA 4LF1A 1GMWD 4I6WA 3T5HA 1PC4A 5F3ZA 1N5SA 5LL6d 5THWA 3PW0A 2XC9A 3ISND 4QPTA 2XY5A 4KSEB 5DQGA 3GILA 3DI6A 2CUYA 3QGIA 1NSPA 2J0WA 2HNYB 2BRLA 2BXJA 1R0AA 2A10A 4Y00A 3TAQA 2NXCA 3OR2B 1X5SA 5E3PA 3DMJB 3WIVA 1JMTA 2JWNA 3E8OA 3CCQS 2B51A 2V2ZA 4LJMA 1Y5NB 4QCLA 1AXQA 2JEGA 1NPPA 4CI0B 4EI2A 3MPUB 3NP5A 3R9LA 3VGTA 2XHWA 2Z57B 3WC2A 2KFNA 4FKXA 4V1Ak 2FYXA 3NKYA 5KFXA 2YQ3A 5IQ6A 3AHPA 4E8UA 4O44A 2N82B 3K2YA 4AXJA 3TUPA 3QIPA 5KT7A 4OX9F 1P6TA 1RWVB 2QA2A 1FTRA 4Q2LA 3H4BA 3NNCA 3FMWA 2JL9A 2X1GA 1K73T 1CJUB 3W7BA 2GVDA 5EHHA 3A3OB 3EZ5A 1NK9A 3C6UA 1XERA 2XB2D 4NLPA 3JQKA 2XCPA 3GLJA 4OIXA 1M5HA 2ZKTA 3OW2R 1CG2A 5DM7Q 1RT7A 3HO1A 2GW8A 1S79A 3SCKE 3ZTRA 2V69A 1HNIA 2R7XA 2VB6A 1Y9OA 2HVZA 3KLHA 2ZJPQ 4EZ6A 4DX5A 1GK8A 4CWBA 1MWQA 1HWKA 1LXNA 2X7IA 2Z8QA 3UNGC 1JNRB 1Q8LA 2HQ3A 2HEKA 4LSLA 4N7TA 5DGBA 2NLWA 4DPTA 4GVBA 1I3OB 1X0PA 3HD1A 2IJRA 2PFFB 1NJXA 2VD3A 4U8YA 5HATA 1JLBB 2FJWA 4NLTA 2C2KB 3MWBA 2ZVSA 5HAOA 3ZZTA 2VU5A 4USKA 4M8LA 2XTJP 1TK5A 3BYPA 3LP1B 4DR1J 4B3TJ 5A0YA 4MKYA 3KUHA 4M5HA 1NH8A 3QRPA 1XN9A 3OL7A 2QA1A 3R6LB 4OJ3A 4XK8C 4M1KA 4I2PA 1OJ4A 3AQPA 3N28A 2F63A 1KQFB 1HW8A 3CJ3A 3RTVA 1VIXA 4KO0B 2HHHF 1WC4A 1P1TA 3RBZA 2E5LF 2FJXA 1VHIA 1HA1A 1JXLA 1S1WB 1S72S 1GEHA 1RTHA 1ZAWA 2KB2A 2MLYA 4ID5B 3R7NB 1P9QC 1XMOJ 1VBZA 3HFKA 4ZVGA 5RUBA 3X1LB 4K4ZA 1SVDA 1N0UA 5LXRA 1UAWA 1AZSB 2FLLA 2FHJA 2ZZNA 4RUBA 2F4FA 1IKXA 3O1LA 3D68A 4DR2J 4M95A 3HT0A 1RT1A 1V5IB 4NLYA 2ZNZA 1S9GB 4RUHA 2EK6A 2MLZA 2LDIA 4X4OA 3PYGA 4OZ1A 3VAJA 4NX9A 2HQCA 4K4UA 1HNZF 3N6NA 1K9MT 2CJXB 3GFZA 1KOOA 4DX6A 4NLUA 2V2KA 4WZQA 2DGWA 5M2UA 2UVVA 1TL3B 1SH3A 3BM7A 3J7ZT 4WP9A 3M6VA 5DS7A 4CT8A 3SIPB 3KHLA 3QT5A 3KHRA 3POTA 1FD8A 4R0EA 1E6VB 1JNZB 1HL6A 2PEBA 4NZ6A 1XMBA 4MH8A 1FO1A 4RO0A 3NGUA 1R7IA 2HHSA 3H5YA 2V8HA 3TANA 2D9OA 4OZ0A 2YKMB 4PEOA 1Q8IA 1WD6A 2HNZA 2CJ9A 1YJ9S 1MWZA 4B02A 1ZPVA 2QFIA 2QSWA 2J76E 3ITHA 2WW4A 4DSJA 4RBUA 3UR0A 2RUSA 2MMYA 2JH3A 2LEPA 3ICLA 1S1UB 2IDLA 1D9DA 3AOAA 2KFZA 3U1NA 2V5HG 5KFSA 4C4WA 2CJAA 1X4HA 4ZN3A 4I64A 3M4XA 3FCHA 2QL5B 3TOQA 4YP3A 3PR5B 3V6DB 3LH2S 1SCJB 2D69A 2V8DA 1SQEA 1BWVA 5KG3A 1ZAXA 5D4LA 2KHDA 3CDEA 3CVKA 3GG1A 1WEZA 1VRTA 4CLUA 1J27A 3D1QA 3TI0A 1C4CA 1Y3JA 2CQIA 4AUKA 3PFEA 2DNMA 4KIAA 4C3KA 4LRAA 1RHUB 4AT1B 5LXYA 2BJ8A 3ELHA 2H5EA 1YJTA 3M9MB 3RG6A 4IR9A 1RT6B 2OFHX 2YX4A 2OIHA 4X66F 2DEJA 3NOGA 2UUCJ 4C8NA 3IMQJ 2QO3A 1LW2A 4KY3A 1RTZA 2F9DA 3M30A 2CVIA 1DTQB 4M5IA 1S5ZA 2MZQA 1JIHA 2ZH9A 1KDNA 1QUPA 1QSYA 1XC9A 3D3BJ 3H2VE 2JVOA 3MGJA 3JAMY 1Q7YT 3QJPA 2YWHA 3BGOP 1KTVA 3MM5A 4HVZA 1BHNA 1IWAA 1SUQA 3DDIA 1KRPA 1RI7A 3B8HA 2XM3A 2V63A 3KK2B 4GKKJ 2XMKA 2HW3A 5DG8A 1DLOA 2IBOA 1DZ5A 2F9JA 4YEAA 5DDRC 4EWTA 3HVTB 1CJTA 5IZHA 5LMNJ 3TRGA 3EGVA 4K4WA 3CMES 4NLSA 1EIYB 1Y5LB 1S0VA 1HNWJ 3J81j 3J80Y 1JLCA 3PRVA 1YKWA 4KHPJ 3SEOA 3AT1B 4ED5A 4Y34A 5CYQA 2AD9A 2VBWA 2JLEA 2VFTA 4ELTA 4NCBA 2KZMA 1T03A 2ZM6F 4M5KA 1YHQS 1IWGA 5CCMA 1FVQA 2ZNYA 1Q7LB 1FK9B 2LXIA 3UPFA 2IRUA 4J9UE 2Y1RI 3AFGA 1IXKA 4ECUA 1J2VA 1KVJA 3QLHA 2VG7B 2IMOA 2MZJA 5A6WA 4ZP9A 1S0OA 1RWMB 4LR9A 5KFTA 3J81Y 5HQ8A 2U1AA 4MYUA 4X4RA 1QD1A 3R5JB 1NSAA 3FCVA 1RABB 1FT8A 2ASYA 4C8YA 1H7XA 5IXUA 2BYCA 1GTEA 2XSJB 4DR4J 2XGPA 2C1EB 3ZO7A 2ZITA 2KH9A 2BR0A 4OHVA 2UXDJ 1U8SA 1WF0A 2OP5A 2F8MA 5U47A 1D9FA 3Q0AA 4RU9A 2GO8A 3LOUA 2NPIA 5HI7A 3PR4A 3AA8A 4X4VA 3RJMB 3W64A 2OPRB 2CQ0A 3K8WA 1LFWA 1KLNA 1RDRA 1W2BR 2GA7A 4KKOA 4G1IA 4XTTA 4ICLA 2AJ1A 2HFUA 2C3OA 2EG1A 3I0RA 3VCDA 2ZBCA 5KT4A 3LANA 1HFEL 4OL8A 2K1RA 3UI3A 3NRBA 3OTBA 3KYLA 4Y2AA 4RW4A 1RAOA 3HDSA 2IHR1 4OHWA 1W7WA 2W2QP 3DKDA 2ZZTA 3BGRA 1UA1A 2DR7A 3ILIA 1VBXA 1S48A 3IG1B 4WXWA 3TJ8A 2UZAA 1ZTWA 5AXLA 2XY7A 1F9FA 2DT9A 4XPCA 4L74A 1LWCB 4JB8B 1KFDA 5ETNA 4WFNQ 3MUVP 1DQ8A 1PIEA 3THVA 2HGMA 1U1NA 4DR3F 3R5AA 5A8KB 2B8QA 4YUDA 3MCNA 5LMUJ 4ZKAA 4KV8A 3BGLA 5JMNA 4UOFA 1NJZA 3IR6B 1BQMA 2P6SA 2HBRB 5ETOA 3T1YF 1QVFR 1HNVA 4EZ9A 1KP6A 2F40A 1FJCA 1H2TZ 2MKIA 4A46A 3LPEA 3NS6A 2P9EA 1BXNA 2ATCB 3Q24A 5F8NA 3MTKA 3PZPA 5A8RA 2J8AA 2XGQA 1X9SA 4DFJA 2JLFA 2VF3A 4N5SA 4Q7AA 2Y1LB 2ADCA 5E5NA 3W2WB 3C6TA 2LXFA 3ET6A 2OPQA 1DURA 3SBMA 1MNEA 4PG5A 3M9NB 4ZVOB 1JLAA 4Q5VA 2RU3A 4B9TA 4DUZJ 5EX3A 4WFAQ 3KOAA 1R31A 4OJGA 4C3LA 3HSJA 5I42A 1SKRA 2DB1A 5AJ3F 1SIWB 4LF9F 2J0XA 1SV5A 1SC4B 2LA4A 2IAJA 7FD1A 3D7SB 5EX0A 4OMFG 3GU0A 4EBDA 5CZXA 2IJFA 2HGLA 4PQAA 1VK8A 4C8MA 4DG1A 1UVIA 4KR0B 5ETQA 4ZMMA 4YB7A 3KHGA 1AUDA 5MAOA 4NOHA 1AROP 2NREA 2WOMA 1O0PA 5K14B 2V9KA 2YWEA 2XLKA 3RYLA 2RRBA 3WIUA 2YPZA 1QE1A 2J9CA 2WONA 1RHQB 4NEYA 3OFEA 2WVCA 4K2XA 2CQ1A 5ETMA 3KG4A 4WYLA 1N32F 4L3KA 1TKTB 4O3OA 5C24A 3NWRA 1LW0B 2MHNA 3Q89A 5BJRA 5KG7A 1XNRF 4FYWB 3R5GA 1D3WA 1WG4A 4N8NA 3CD5A 4UY8T 1L3UA 3OVBA 2BE2B 2HBQB 4MK8A 1JX4A 1QSSA 2W9BB 1VRUB 4OX9J 2V8GA 2KXHA 2VQEF 3D3CJ 4RW9A 2W7OA 1RLCL 2NYHA 3KK1A 3G6ES 3E2EA 3CMQA 1VI7A 2H48B 2H54B 2V9WA 1DY3A 5E41A 3DLGB 1V5VA 1URRA 5EWFA 2ZUGA 3E51A 1UCNA 4BS2A 3MCSA 1SL1A 4I7FA 1X5OA 4FP9A 1FTCA 5F3TA 2BUNA 2MPUA 2AX1A 3M8PA 5KT6A 3UO0A 3GFYA 3MR3A 1PGZA 2LQ8A 1JLEA 3N79A 3QPIA 3S8SA 2VH7A 1N5YB 2HHXA 3THTA 2QLBB 4G1QB 1IKVA 2XNRA 2NUUG 4FS1A 2L9WA 2OD6A 4XIUA 3MR6A 4DSIA 2IYIA 3MM9B 2M8DB 4K5SA 2B5JA 5KFLA 4EMDA 5C42B 2FY1A 4DSFA 5BR8F 1RYRA 4YS2A 3O44A 3SDEB 1N5QA 4CP5A 2F1FA 3MF5A 1N33F 4U7CA 4OHXA 4OX7A 4Y65A 1RADB 2I1RA 2RRNA 1NHKL 2OLWA 4ILLA 2RNEA 1TL1A 2VFRA 1R0CB 4FXWA 3CC4S 4DF8A 2W7PA 1NH7A 4CO2A 3M6UA 5EWEA 3UDLA 2HS4A 2QMXA 3FSYA 4I69A 5LT5A 1UTAA 3N0VA 2GJ2A 2NSBA 3M8WA 1WHVA 1RQ0A 2IY5B 2UVRA 2AJ0A 1U48A 2IVMA 2HHHJ 4OI1A 3VHQA 5IT9U 2J0SD 5I3QA 3R2DJ 1NJIT 2YNHB 2E5LJ 1QTNB 2UXCF 5CAAA 3MUMP 2V68A 2Z58B 4LMZA 1TZ0A 4Y2KA 1KQSR 3KLFB 1U25A 3C16A 4PPZA 3E3XA 2BJ1A 3CW2C 2H51B 1FFWB 2BM0A 2HWTA 1I94J 4ZHRA 3NNAA 3BKUA 1KSPA 5KFDA 3H59A 3HHKA 3MEEB 3P4UB 3CJ8A 2YWKA 3MOJB 2YKNB 2D3OR 4FVCA 2R2SA 1WSRA 3MECB 4RWXA 2BW7A 3F0NA 1MWYA 1OQ3A 2ZBIA 4DPWA 6FDRA 1RTJB 4DPYA 1URNA 4J9QA 2ZUAA 2DBBA 1WF2A 3RW6A 2BKPA 2K2PA 5DETA 3CJQA 5EUHA 3O3LA 1HNZJ 3ZTQA 4M94A 2OD4A 3P8BB 4MKAA 1C0TB 4LVNP 4C11B 5E3AA 4FXDA 3FFIB 4PPDA 2DRAA 2QMUB 4LQ3A 1N8RT 5A76A 4DLEA 2ZH6A 2DH7A 3D6MB 2C3MA 2B6AA 1TP7A 4JI6J 4WJBA 4LVOP 1MMNA 4D3HA 4IKAA 2CNKB 2HHQA 2BJ9A 3KDNA 2RDIA 5J2NA 4ID8A 4YR3A 2GMLA 4ES3A 3WC0A 3CULA 3HM9A 4ZLPA 1H7WA 2HFNA 2KM8B 4UQGA 1NBEB 2F8EX 2VG6B 3IXQA 4PUOB 3VQTA 1TUWA 2QE5A 1N0VC 3W2VB 3D9BA 2ZDPA 1U6BA 5L9NA 3T1HF 1X9MA 5AE1A 1O51A 1OPZA 3NMAA 2M88A 3TX8A 3IS9B 2JRSA 3EPGA 1FX2A 1GMUA 1S9EA 1SPBP 3EXCX 2KM8C 1GXUA 1JKHB 4DN9A 4FF1A 1RHMB 4K5RA 1ZETA 1FWPA 3DDNA 2KYZA 2XS2A 2J0QD 4AL5A 4I68A 3KTQA 1XR5A 5C25B 2YQ1A 1Q8BA 5ETPA 4DSLA 4M5DB 5CCLA 3M32B 2VFUA 5J2MB 1R6VA 1NDPA 1M1GA 4X66J 3G8SA 3BH6B 2LFVA 1WTBA 4LFBF 2CQ2A 2PMHA 3W5XA 2K7JA 3RU0A 3BEGB 3TA0A 5H9FK 5D0HA 2D3UA 2XHCA 2E66A 5I3PA 4MJKA 5KG0A 3LA0A 3D0GE 2EFQA 2CJBA 3G82A 3KJQB 5CYMA 2GO9A 2PSZA 3D1OA 1FRXA 2I5JA 4J7CA 3T9NA 3A4TA 2BBEA 1SB6A 1B7YB 3TZYA 1IR2A 2ZKUA 1HMVA 3KUGA 2A2DA 4DUYJ 1T94A 3GJRB 4RNNA 1PKUA 5FD1A 2GVZB 3G6VA 3EVMA 3KWMA 1WSVA 2O3DA 1OIAA 3GG0A 4ZOSA 2R7OA 4K4VA 4W98A 4CLWA 1VGYA 2ZD1B 4ZS6A 1ZA1B 4PXDA 1K0TA 2XI3A 3QAEA 4HT7A 1AUSL 5G0RB 4ED2A 4WP8A 3LGHA 4FPIA 2ZM6J 3CPWR 3FMBA 1KEKA 4F26A 3GJQB 4OJHA 3M2RB 4NRUA 3D1HA 4CLSA 2R7WA 2UV8A 1CVJA 3ZZRA 2B43A 4ZP8A 2CPEA 2MGZB 1KR4A 3IR5B 2R4FA 1NDCA 3U1MA 1HQUB 3DLKA 4UOCA 4EUVA 2DNYA 2DJWA 4OZNA 1W2IA 2AYEA 5KAKA 1B64A 2YNFA 4RNOA 4DL0C 2FJEB 1XMQF 3WBZA 2DGOA 3GMGA 3I31A 5ETKA 2AHOB 3PW5A 5ETTA 3TVYA 2RQ4A 4WFXA 3GZ7A 3HULA 4TY8A 4JI7J 2HRYA 4N47A 1JLQB 5B0BA 2ZH3A 3HHDA 4KGKA 2MQPA 3C8YA 4F4XA 3MMCA 1ZAVA 1IBMF 2J6UA 4ED0A 2R7UA 5H1SV 4KQZA 4NI2B 2QRRA 1S97A 3M2UB 3PJ9A 3NOCA 3KLIA 4HHUA 3TVKA 4XAKA 1K0VA 2VA3A 3FBCA 3IRWP 2HMIA 2E5JA 3HJVA 3PRDA 5IM0B 4Z2XA 5DO2A 4ECXA 5AXKA 3LTOA 3DLJA 1MMLA 3KJNB 4IUFA 5HO4A 1TV6B 3KLEB 4DV3F 5DG9A 2W25A 2XMTA 5K5MA 3PHEA 2RAQA 2QYGA 3MURP 4B08A 3HX9A 2UU9F 2GIQA 3FZBA 2WSCC 3RBXA 1TK0A 1WHYA 3TX0A 4DR3J 1CQMA 5D0RA 4DL3A 1G4CA 5D3GA 2YNGA 1B99A 4NXMF 3VGUA 4HDHA 2PC6A 1V3RA 2BACA 2NZ4A 4L75A 3DOMB 3RB0A 3TP2A 1UL3A 2AYGA 3CXCR 3RRKA 5B0DA 2X3DA 3UW1A 3T1YJ 4ECYA 3IRXA 3OSNA 1S4EA 2ZOMA 2ZWPA 1Q78A 2CXEA 1T9UA 4A8XA 2PEHA 3A8KA 5BYRA 1J5OB 4JI8J 5B0EA 4ED4A 4LRBA 1S7IA 4RLEA 4DN0A 5DDQC 4CTAB 4K50A 3Q8YA 1SC3B 1MU2A 2NXNA 4BWMA 1YBUA 2P8IA 3D54A 1RA7A 3ONQA 4KHRA 5A2QY 3KXDA 2ADBA 2JSXA 5KFBA 5M2PA 1FXLA 2C2DA 2DIUA 1I51B 4RW6A 1HPZA 3NCRA 3MR2A 5AJ3J 2I0XA 4LF9J 3MFIA 3K57A 4KC5A 4FDFA 5J1NA 3QJJA 1IR1A 1JJ2R 1VQYA 4WE1B 2V0NA 1E6YB 3TJAA 2R9LA 2NZCA 2KZZA 5T14A 1EP4A 2BQ3A 3CJKA 2Z4PA 3ENVA 1R43A 4DV1F 2ASLA 3Q2SC 3H8YA 4L3NA 4DFKA 3DOKA 2JLGA 2CPFA 1NHVA 2CQ4A 3BREA 3VF0B 1N32J 2H5JB 3SQGB 3KJFB 4K4TA 1NK0A 3PDNA 5HMWA 4P71A 1RAFB 1XNRJ 1FX4A 1FNXH 4S0MA 3GTYX 1RHKB 3HVAA 4RNHA 1ELOA 3DYAB 2VQEJ 4KFBA 1JLGA 2HPUA 2AYBA 3UN2A 3CCRS 2P2CB 5DG7A 1IBLF 3BKTA 4O0NA 1YJRA 3U02A 4E0DA 1TELA 3W62A 1GAOA 1NK6A 1NSQA 4DSKA 2RS8A 2KRRA 5LJ5Y 1CJKA 2PE8A 4QZVB 2R2TA 2H4YB 3DU6A 2V8PA 4KE5A 4IG3A 4MT1A 2GFFA 1NK4A 2JNJA 2HLTA 4WK3A 2IM3A 2DGSA 4F3OA 1H6KX 5DLFA 3NXZA 4DU8A 1LWEB 3MDFA 1YDLA 3JTPA 1JB0C 2HLUA 3C14B 4H4OB 1KC8T 3PEHA 2BMBA 1UPMB 4URQU 3NG8A 1RBLA 5DQIA 2ZH1A 2BA9A 2QL7B 4TYBA 2ASDA 2XWXA 5BR8J 3UVJB 3I56S 4LFAF 2QEXS 2A6MA 1KS2A 2HVEA 1WG5A 4U9RA 2LQJA 1LW0A 3C66A 1RT5A 2CAJA 2FVCA 4MIWA 1T05A 4NMXA 4OYWA 2AP6A 5E3CA 2ZE2A 5K8PA 2CA9A 1Q82T 3H5SA 4LR8A 5JUMA 3M8ZA 3Q23A 4Z37A 1YITS 1S6PB 4FNHA 3SFUA 2HFZA 3R1LA 2OEKA 2M52A 3E01A 5E2QA 2MEWA 4F7VA 2MZTA 3TJ9A 2UXCJ 4H4KC 3OR1A 3ZZ0A 2W2MP 1WC0A 2HHUA 5A6PA 2VDHA 4AL7A 2X1BA 2VKRA 4MK9A 1RT4B 3JYTB 4ELUA 3HZGA 5KFNA 4B9SA 1R0BG 1KHWA 3UN5A 4C7QA 3UCUP 4ZLNA 2PFDA 1IQZA 3BV8A 1C0UA 3W63A 5F8GA 4DPOA 4Y28C 4V19X 5KT3A 1HHQA 2GS8A 4X4QA 2KHCA 1Q79A 3H2UB 3LQVA 3IGNA 1KFSA 1YG0A 5I3UB 2DRDA 3H98A 1L3SA 3GJTB 4GO7X 1NK5A 1TUGB 2R8GA 3PKMA 4R5PA 3GYGA 4DR7F 4A48A 3GSDA 3OVSA 2GJFA 3OTDA 2ZBQA 3KHHA 3M8QB 3DRSB 4EK2A 4KHMA 4WWSA 1JJ4A 2JDJA 4F3QA 3C15A 1S0MA 1OY8A 3ZTOA 3MM6A 1AFJA 4PXBA 2KT2A 1FD2A 1Y3KA 5KFFA 3LPYA 3JSMA 1NZ8A 1U0SA 5HMZA 1B0TA 2R7VA 4BC7A 1X4CA 1CS4A 4M5LA 1YRXA 2VJVA 3FEYB 3Q8VA 5K9FA 4C0OC 2B4OA 2FDNA 4TVAB 3IP0A 3OD2A 3AJ1A 4I2QB 2D7SA 3OQ2A 4QQBA 3WHIA 4LF8J 2H1YA 5CYJA 3D2WA 2MJNA 1FVSA 2QLFB 3UFCX 3LF0A 4DV7J 1LEOA 3UD4P 4X2BA 4UF4A 2FD2A 2JEIA 3LP0A 4YDDB 4F36A 4K4YA 4LF6F 3T1HJ 2IC3B 4WFBQ 2V50A 5ITHA 2V4JA 3MEEA 2XS5A 3JS9A 1SBRA 3TAPA 1WKKA 5D77A 1IKYB 3J7Z5 1HI0P 3VAHA 1U02A 1Y10A 2AWZA 3BBCA 2QLJB 3TAMA 5HVFA 2L3MA 2OPPB 1Q86T 2YH1A 3IC1A 1T0TV 4DL6A 3G71S 2CPJA 4I56A 3PO5A 1P1LA 1HWUA 2GHPA 5HROA 1M5PC 1B0PA 5LSOA 1C1CB 3A1YG 3DDKA 3DOLB 3T1AA 2B4VA 4Q44A 2DNPA 5B0AA 2C2ZB 3W9IA 1QAYA 3NBPB 1VBYA 1P27B 4AXIA 4LFBJ 4WKRA 4NCGB 2R2UA 4QWCA 4QR1A 3IAM9 2CQBA 2UV8G 4ZA1A 1EQMA 1AW0A 1QAXA 3MMAB 1M5SA 2YQ0A 1HBMA 4CRJA 4P73A 1HQEB 4O4GA 5KFKA 4JV5J 3HPOA 2LYVA 1Y0HA 4TKTA 1HYSB 3ZZPA 2GHWA 2HG4A 1VQOS 4PQUB 1NB2A 1SH0A 3OUYA 1VQ4S 3D0IE 2HIQA 2MYFA 4KBIA 4DQQA 3UCZP 9RUBA 3Q83A 2YPYA 1F5AA 2HQGA 2IBKA 1UJ5A 3S1TA 4X84A 2PT0A 4JI5F 2UVWA 1XNQF 4TU8A 2AZ1A 1WG1A 1X7VA 4PWDA 4HTIA 4ELVA 5SZTA 4W4MA 1AT1B 2ROGA 3AJ2A 1H72C 3QJLA 2WAQD 4HI2A 2IM0A 4P2MA 1VQSA 5A8WB 3IWNC 5J2QB 1PC5A 5KFMA 3ZZOA 3G4SS 2ILYA 5ETVA 3MEDB 3MZIA 1ACMB 1KLMA 1EB0A 3W66A 4QPXA 1UEKA 2VHGA 3DRRA 2LEAA 2ERRA 1WDTA 3OXGA 1CC8A 2OO4A 1M90T 4LF7F 3DLEB 1LWFB 3MM7B 5CD4H 1NLKL 3KLGB 3T9ZA 1QY7A 3CC2S 4KGZB 2DO4A 2CPHA 1TTHB 4CNYA 5KG6A 4NA1A 3DXSX 5HVHA 2JX2A 2DNZA 4LRDA 1CLFA 5HBMA 1HBNB 4JI4F 5ADZA 3W60A 4USHA 3KFWX 4ZJOA 3M1VB 1IR0A 4A8OA 9ATCB 1IBMJ 4KJIA 4JYAF 4OZJA 1TVRB 2P9CA 3J7AN 4WK1A 2HWIA 3AA9A 4ETXA 3PW4A 4PYDA 2BANA 5HP1A 2V4QA 3US5A 2E5GA 3LWMA 3C19A 4C8KA 2DNRA 2OH2A 2B9YA 1BQNB 4IH7A 1VFJA 4RUCA 3SV4A 4P10A 4BCAA 2DNLA 2KXFA 4P7VA 4CH1A 2MQ8A 2QFJA 1WOPA 2XS7A 4M5JA 2GIFA 4GVLA 4NEZA 1K8AT 3D67A 4DV3J 1QM9A 3BR9A 2IYGA 1C1BB 3MM8A 3MMBA 1FKPB 4RBTA 3H7HB 2UU9J 2YX7A 4DFMA 3PTWA 3D6FB 1JJCB 3OHAA 4NXMJ 3A8IA 2O01C 2MTLA 1RZMA 1REGX 3TQEA 2RKIA 4ECRA 1HD0A 3HSGA 3SCIE 5D0EA 2F8HA 3NNHA 4FNIA 2WBRA 4NA3A 1HHTP 3CJRA 1L5UA 1IUJA 1K47A 4HR2A 3CO0P 4F04B 4MFBB 2ZHOA 2HZCA 4YFUA 1SKUB 2KI2A 4IFVA 3SFGA 1VQ7S 1WNEA 3LO3A 3DGPA 1RTDB 3PRBA 2RILA 1VC6A 5F8HA 2AJQA 4A4JA 5L38A 4J9MA 4URSA 3L3CA 4C0HA 2CADA 3FC9A 4WBFA 3TNVA 4DMZA 3VVUA 3RZAA 3B82A 3HHLD 1ZM3A 2CIMA 1KKHA 4F4ZA 2O66A 1T02A 2HBZB 2HHPA 1L3VA 3T6BA 1REVB 1U0HA 2BJ7A 3MPYA 1HWLA 4IFYB 5KFRA 3I55S 3GYXB 4A8YA 3V4IA 3QRQA 4G65A 2ZFHA 1Q5VA 3ADAC 4WFZA 1EARA 2XZTB 1R27B 4NYZA 1YJNS 3T5JA 2A18A 4YY3J 2HHVA 5CHCB 3BQ0A 4RJVA 1FDBA 4DV1J 4PZVA 4NXNJ 2GCFA 2B4UA 4LFCF 3PX4A 2OGUA 2KKHA 4CM0A 2GIRA 5CA5A 3KJVB 5J1EB 3BBBA 5GAGI 3KMQA 2DGQA 2JFDA 4B3OB 1X9WA 2Q6BA 4NPOA 4EFAC 3NY0A 1RU2A 4AD6A 1H2UX 2XMMA 1PJ6A 4B3MF 3M2VB 4OHZA 1DTTA 2VKZG 2KT5A 4K4XA 1S1XB 1IBKF 3NMRA 2MY7A 1A0OB 1RT3A 2CNLB 4IRCA 1NCLA 3EGNA 3R97A 1RT2A 1FE0A 1IBLJ 2BRKA 3CCLS 1UKUA 1GXLA 1FJEB 1GT8A 4L76A 1RTIA 3WDOA 3UE2A 1PBAA 1DFDA 3RB6A 1XBWA 2WB1D 1VS3A 1U45A 4DDFA 3DI6B 3TUIC 5CZVA 3PVXA 1R0AB 2B8PA 1F1BB 4RW7A 4OYAA 3JTNA 4F0MA 2UUAF 3W8GA 2BX6A 1IJEB 3CT9A 1Y11A 2HK3A 5IWAJ 4OYBA 3HKZD 1N48A 4CLPA 4FKYA 4A8WA 2DNHA 2WSFC 2GAHC 2HRTA 1DBDA 4RKUC 1ICEB 3PY8A 4UY85 1SKSA 1YTYA 5KG4A 3W61A 2G4BA 2DTJA 2DNGA 3K17A 2CWKA 1MROA 5AXMA 1S59A 3BSCA 1AYEA 1KOHA 1N56A 4JV2A 5LOQA 5GAHI 2AEJA 3R7BB 2DXEA 3SMZA 4O44B 3AD8C 4ILRA 1FXRA 2XYGB 3QIPB 1UFKA 2DY9A 2JEFA 4IRDA 2WBMA 3FEZA 3PG9A 3MEGA 4UQTA 1VC5A 1GNKA 3QATA 5IT4A 1R8CA 1G3OA 1BWEA 3M8SA 4X4NA 3C6UB 3QT6A 1EKSA 3M7VA 3DRPA 5KFEA 1VRQC 3L7PA 2FZGB 1HBOA 3KK3A 2AEFA 4B17A 1IM6A 2P5VA 4B3RF 3DYAA 4P9SA 4RUAA 1RT7B 2W4PA 5D0GA 5E0OA 2V67A 4IOBA 2BE7D 1HNIB 3NGTA 2DHXA 2OPSA 3IM9A 3NAHA 3KLHB 4L72B 1LV5A 4JI1F 4UZBA 4WU2A 2I38A 4MK7A 4LSLB 5B0CA 3T3FA 3NCQA 1KTQA 2VBYA 2WZ1A 2ZH7A 4GVBB 2A6OA 3HI9A 1YWXA 4ZDNA 1SKWA 4NZ7A 3K5LA 2QN6B 4LBHA 4DQPA 2E1PA 5LJ3Y 2H9ZA 3KDOA 4FF3A 1VLOA 3IR7B 2DXDA 4F0KA 1R6YA 3UNYA 2CQDA 1XQIA 4CYUA 3ISZA 3EWGA 4FYDA 1LK7A 5A0YB 5J2PA 3QAUA 1H74A 1U2CA 4ZPBA 5HSPA 2AMCB 4PYAA 1YSJA 4DR7J 3AB2B 1PCAA 2RE1A 3QZ7A 4I2PB 1LK5A 1N52B 3OFGA 1QAIA 4MKVA 1UVMA 2KFYA 2OSRA 4ZP6A 5MLCV 4LBIA 4P2SA 5KFWA 3KKFA 4O3NA 1N6QA 2BKNA 5KOXA 2DISA 3QGPA 1A7GE 4OX6A 2MZ1A 2W9CA 4WKYA 2PMWA 5HJXA 1GMVA 3OTEA 3MUTP 4Q0BA 2C2OB 5FJ4A 2R7QA 4B3SJ 2XO6A 1OS5A 4OI0A 1RTHB 4ANDA 4MAKA 1UMJA 4YN3B 3UQSA 2LA6A 1PJ5A 4DQRA 1RA6A 1B70B 2V4RA 4PWWA 3QO9A 4YB5A 2I9SA 2VBZA 4GMKA 1SL2A 4I1TA 3EZUA 3A8JA 2NCKL 3SCJE 1IKXB 2KN4A 2ZWOA 1D09B 3M8RA 2OAUA 5HN0A 1NK7A 1RT1B 1EZZB 3UN3A 4LF6J 1QAJA 3HF5A 3ULHA 3MR7A 2WB4A 2FC9A 2AT1B 2IDEA 3PKYA 3N9UC 2LKZA 4I4BA 1N5VA 2DXFA 4ED7A 1M0SA 4RX6A 2Y1IA 4ZPWR 1BD6A 1T7PA 3R1HA 1WORA 2OTLS 3LP2A 2RVJA 3K58A 5BXIA 1HBUA 2GZOA 3U7JA 4KYZA 3V81A 5DQHA 2ASJA 4MIAA 3POTB 4DS4A 4RR5A 3M9OB 4A8QA 5HVGA 2ZH2A 2RT3A 3EDRB 3T6JA 2DHAA 2GGPA 3PV8A 2GMJA 2OEJA 1HR0F 1YZ6A 3JSRA 3MOZA 4CQ1A 5KG5A 1V3SA 3ILJA 1FRHA 4ZVPB 2G0CA 3GV7B 3P6YC 2B9XA 2HNZB 5LSLA 3UCGA 5KT2A 4K59A 5DZ6A 2HS0A 4FN5A 4QR2A 4NLQA 3FBFA 3EDQB 3ITHB 4QR0A 2RUGA 2J6SA 2RRAA 3ILOA 2OUGA 3QRRA 2IA6A 1S6QA 3N01A 3KG1A 3D4JA 3TA1A 3HHLA 4OI2A 1FRIA 2MB0B 3I9V9 4LBPA 4CNZA 5ETSA 1IKWA 3CF5Q 2ILZA 1RCOB 4J37A 3CJ2A 3I5BA 5FDLA 4DL7A 1U24A 1V9OA 1OPIA 2AF6A 2R7RA 3H5XA 3FGVA 2QLXA 2HFOA 5H9FJ 1HHSA 1ROFA 1YZ7A 5KG1A 2UXBF 1VRTB 1XNQJ 2V2QA 2V8VA 2XZDB 3PCOB 4U67Q 2FJDB 4LF4J 1RWPB 3DLBA 1FE4A 4PG6A 4N76A 1M1HA 1I6JA 2BV3A 1ZZFA 4YQWA 3V6JA 5K8OA 1XTZA 4ZK7M 3BB5A 3JB9k 3ZZUA 4X65F 1WKLA 2BDPA 2ZBRA 2HHWA 3AD7C 3MAHA 1LW2B 4C9DA 1GMWA 3H42A 4CLLA 3M30B 5B09A 1JLFA 2B3TB 7AT1B 3D0HE 1U2RA 1B0VA 2D41A 2VA2A 4LF7J 2NYIA 3TZXA 2IRYA 4IDKA 4M5NA 4GC6A 5L9XA 1IJFB 4TQSA 1IBCB 1SI9A 5T7LA 1MW7A 3TWZA 1VOMA 1F3VA 2FC8A 4CO4A 1WI6A 3MM5B 1SUQB 3V4MA 2M3DA 1TMMA 5HLFA 1G6BA 2YNIA 4Z7CA 4QU6A 2ZBPA 4A8KA 2XSFA 2VG5A 1DLOB 4TLRA 2E9TA 3KUEA 1YJVA 2FB0A 4FZVA 2G0IA 4OJ1A 4JI4J 1CJTB 2UUTA 3I0SA 4OV1A 1FRLA 1HWJA 3UD3P 2MHEA 3SSSA 4HACA 4EYIB 4JYAJ 4K0KF 1JLCB 2QG9B 3ZTPA 1NJWA 2HYIB 4N56A 1P8GA 1U49A 5CYQB 2QA4S 4HTJA 1RWKB 2YKPA 1T03B 2EEYA 3ISNC 4B9UA 3S6EA 1NU4A 2AJFE 2HNDA 5JXSA 2EC2A 1TKDA 4OZ2A 1FJ7A 5F8JA 3QLHB 3A3PB 3N6LA 2PN6A 4JI0F 3TEGA 2XLJA 4QWEA 4KPYA 3BSOA 4OX8A 2KL8A 3CCSS 2FZKB 3G2XA 4RU2A 4TU7A 4EO8A 3P5BP 4PG4A 3BDPA 2DR9A 3GFHA 4A8SA 1F0XA 1HLWA 4O0IA 1UWBA 1IQTA 4ECTA 1NHUA 3DXBA 3WX4A 5G4DA 1QUVA 4WF9Q 1GXTA 2XI2A 4OYOA 1CULA 3ILLA 4KKOB 3HHEA 1S76D 1UP1A 3BGUA 4UZCA 4B9NA 2LECA 2ROPA 4F3MA 4ICLB 3KMSA 4K8RA 2FHOB 2HKEA 3I0RB 2EKNA 5HQMA 4CT9A 5LMNF 4EU0A 4ANEA 4KTQA 2VPZB 3RUBL 2K1RB 4A8FA 3EM1A 1BMQB 1FDNA 4RW4B 1CEZA 3CCZA 3FUYA 2EG2A 2FVQA 4NCAA 5DZ7A 2RDDA 3BGRB 4JV1A 1EETA 2MQOA 2D74B 2DPJA 4QYZK 1EKRA 3MAAA 3QYYA 1U1RA 1A6LA 1VQMS 2XCAA 3JTOA 4H4MA 3CDBA 2M8HA 1YBTA 2FHJD 2HAIA 3VAKA 4IG0A 3TQ1A 4DU7A 1D8YA 2LU2A 3FSXA 4ES1A 3DRXA 3CSKA 1JXEA 1FKOA 1X4DA 3J7YU 2RJZA 4DR4F 4KV8B 3TZWA 1BLUA 2XY6A 3QNWB 4LUBA 1BQMB 1H73A 3V6HA 3QFHA 4CLTA 1HNVB 4ZJLA 4LFCJ 3DFEA 1TFWA 5EWGA 4NA2A 2Q3PA 1TKZA 3BPDA 4Y2MA 3SYZA 5BYSA 2E1RA 1SJ1A 5A8RB 1LFPA 1LWXA 2IIHA 1AFIA 2JC0A 4B3MJ 5GMKa 4K4SA 2M9KA 3C6TB 2QMWA 1S77D 3ET6B 2OPQB 4ECQA 1VISA 2OI2A 1IBKJ 3BQ1A 2MQMA 2R8KA 1JLAB 4FF2A 3B78A 2FQQB 2VICA 3ENWA 1S12A 2YWGA 2K7KA 2LMIA 1TFYA 3OT9A 3EX7B 4WFYA 4YB6A 4DZ6A 1CJVA 4GKJF 2EFVA 3AH6A 1RCXB 3MCMA 5I42B 4WPAA 3S7RA 1GFWB 3NWGA 1TKXA 1SV5B 1WF1A 2IAJB 2DIVA 4I6YA 4WTYA 1I5OB 2RMLA 3B4DA 4DG1B 2UUAJ 1Q95G 1PO6A 4ZVRB 1DQ9A 2WTFA 3PFOA 1YJWS 2RF2A 2RB7A 2WOMB 2AV5A 1S1TA 3L09A 4WP3A 2MJUA 4DR6F 2RDJA 5H9EJ 1QE1B 1B7FA 4ZCKA 2WONB 4IO9Q 3RR7A 1RP5A 1J5EF 5JVHQ 1XEZA 2E1AA 2ACYA 4KGMA 2I2YA 2NQPA 1M5KC 4DBQA 1X4BA 7FDRA 5HQLA 4R8UA 5C24B 2COLA 2J6TA 4FXVA 2F65A 4HDGA 3EZOA 1ZS6A 3D6TB 1K1SA 4DOZA 3SSRA 4RW8A 2J9EA 3HSZA 2WVFA 4P2FA 3CDUA 4CLYA 4RL1A 5IC6B 3JQMA 4NWBA 1TL7A 4RW9B 3QSYB 1AB8A 3KK1B 4X4SA 1VHFA 2E7WA 3IWXA 5KFUA 3H25A 2DNQA 4EO6A 3HZEA 1QSLA 4BDPA 2BJDA 3FQLA 2KU7A 3I9ZA 4WTOB 4ZVEA 5GADI 2GX8A 4B3RJ 2MXYA 2HNYA 4YOEA 4I7FB 3OR2A 3LW5C 3DMJA 5HK4A 5CD4A 3M8PB 2IMWP 4DUZF 4U8VA 4ECZA 3DLLQ 5KOWA 4JI1J 1JLEB 2J7KA 2CJYB 4YB1P 2QJ3A 2XWYA 2CWXA 3H0PA 4KB7A 1UVKA 1X4GA 2CJKA 2FJAB 1H2VZ 5J1PA 1IKVB 1F6TA 2K3IA 3A8EA 1SJRA 3RW7A 1Q5YA 4HHHA 3BQ2A 1DAXA 2CZ4A 3PW7A 1YX2A 4WXOA 2E7VA 2B5JB 1AA1B 2A2CA 2ZJRQ 1UW9A 1YK9A 4C8OA 1U1KA 1QVGR 2CJQA 2MQNA 1RHJB 1KVKA 3VAGA 4X64F 4HH0A 3SCLE 1CJUA 3K7RA 1TL1B 1N54B 2DEIA 2XMAA 4JP8A 3MR5A 4QOTA 8RUCA 1XJWB 4WIIA 1KHVA 2CZVC 3RBDA 1RYSA 3F73A 4DV0F 2LP4A 2KVQE 2FUG9 3R5CA 2VODA 3O8WA 2DGVA 4NLXA 3I4HX 3MEKA 2VV5A 4PG8A 2CQGA 3IBCB 3T41A 4P75A 3EJMA 3Q8QB 2BJEA 3LALA 2RQKA 1VLYA 4EGLA 4CDIA 2IJNA 4USUA 1X4EA 2QLWA 3C16B 1FEEA 5L1KA 3R2CJ 2DR6A 4MKBA 4LF2A 1YJ7A 3HCXA 1X8DA 4DQIA 4ITSA 4ZHRB 5KG2A 1S49A 5KFQA 1TR0A 1JLBA 4B9MA 4BBYA 3GCXP 2CNOB 1FNMA 1U1PA 3PJWA 3LP1A 1WEXA 2W1BA 3VAMA 2GJIA 2YWWA 2MSSA 5C7PA 2XMVA 1RJJA 4W90B 2NXUA 3IGVA 1Y7PA 4J91A 3PW2A 4I67A 1KNZA 3GIIA 2E44A 1TAQA 2B9EA 2FGOA 3CB4A 1U7LA 3H2LA 2N3OA 1HWIA 2AX0A 2CQ3A 2CYYA 2W01A 1VJQA 1CQNA 2GAGC 1TK8A 1KVIA 4DFPA 1PYTA 3K5PA 4KO0A 2GHVC 3P5TL 5GMEA 3RRHA 3VVTA 5D8HB 2Z30B 3Q2TC 2B6AB 1S1WA 4GRSA 3DRYA 1R8HA 1RAGB 4UUXA 1ULRA 2EKYA 2GQCA 1QLNA 1HR0J 4QU7A 4FYYB 4EBCA 1FHTA 4IQXA 1ZA2B 1OYEA 4ID5A 1VDHA 2QGFB 5J2NB 1YRUA 2CKWA 3CJ0A 5F41A 2Q6CA 3PO4A 5FLXU 1AZSA 4LIRA 2VPXB 3CC7S 1EJ7L 2Y9HA 2JVRA 3T5LA 3J7A1 4ZVSB 3MPDA 2HS3A 2DGUA 3OSPA 1S9GA 2BOAA 4NMLA 2NS1B 1D1UA 1I94F 3GWCA 4QYRA 5GAEU 1P9YA 1RE1B 3GIMA 4ECSA 3HFZB 1L3TA 4Y2CA 3JQJA 1S9EB 4GC7A 2VFSA 4DZDA 2UXBJ 3BJYA 1TL3A 4KPCA 3N4WA 2KO1A 3BKFA 2EK1A 2C3PA 3BS9A 4G6VB 3AXKA 3UDCA 3GQCA 3G6XA 1M5OC 2D1CA 1E6VA 2MKJA 4OI3A 2YKAA 3W65A 1T95A 5EN1A 3L7OA 4X4UA 4UOHA 5E33A 2HFVA 1OSDA 4IQMA 5F8LA 2L9NA 2YKMA 3SXLA 4X65J 2AGPA 3EXYA 4UUWA 3DNCA 2FVPA 4JI3F 4J5OA 3QFWA 4LQ9A 1RB0A 3CO9A 4RNFA 1D0EA 2G9OA 4CLKA 4CIOA 1WC5A 3G6YA 1RAHB 1S1UA 3G82B 3PIOQ 1FDDA 4OI4A 4JI6F 5CYMB 1UWAA 3Q8UA 2FHKA 2I5JB 3ETMA 3DHXA 4U95A 3GE9A 3CE8A 4Q8EA 4HKQA 3IAS9 2FLNA 1Y4ZB 4Q43A 4DV5F 3V6DA 1HMVB 2VC1A 3C46A 3HLUA 4XPEA 1RKIA 2BE9B 3TW0A 1UVNA 2EBGA 2W9AA 4F2RA 1FXDA 3MTJA 3P45B 1RK8A 4C98A 2HQIA 4K0KJ 1S1VB 1XK8A 2QX0A 4DX8H 4OI6A 3I82A 3NCPA 4DF4A 1RT6A 4ZVUB 1EHWA 2CG8A 1ZZNA 2DNNA 4OV6A 3QT8A 3AY0A 3RR8A 1HIYA 1UFLA 4HH1A 5B7WA 5IFMA 1RGVA 4IOCQ 5HMYA 3CDAA 2IPOB 1DTQA 4M5GA 4M5MA 2Y8YA 4KGVB 2HZVA 1N34F 3PYDA 3PHTA 3NGRA 4JI0J 1PBUA 1NAQA 4FF4A 2EW9A 3DLKB 3CD6S 1NSKL 4Q8FA 2X3GA 3DU5A 3FDSA 3W5YA 2C42A 2RSQA 1NEEA 4ZVQB 2N4DA 2YNFB 2B56A 3ETOA 3KK2A 4K2JA 5C2GA 3IO1A 2BABA 1X4FA 4HYKA 4LREA 2YVSA 1FFSB 3DM2B 3HVTA 1KWMA 1YVFA 1RLDA 4TY8B 2CPIA 3VGSA 2CG4A 2DR8A 4ZLJA 1G2EA 3CD7A 3TA2A 1PYOB 3MMCB 3OJSA 1Q53A 4MYTA 4ANCA 2M0GB 4DUYF 4IR1A 2ZH5A 2M7SA 2Q1LA 3CCMS 3CJ4A 2A0FB 1KBRA 3KLIB 2WVBA 2QYCA 4P74A 4ZCMA 1FK9A 2HMIB 2Y3YA 5B0FA 1RWUA 2VG7A 1S6OA 3OL9A 1VC0A 1CSJA 4XDDA 2DNOA 2Q79A 4DCJB 1YRTA 1FEHA 3VR1A 2C22A 1Q0NA 2XSJA 3PXGa 5L39A 1V3ZA 1RAAB 1ZH5A 2CVEA 3CCES 2QZ8A 4J9KA 3W9JA 4DV4F 2R3VA 1TUVA 1XWLA 4NLGA 2UUWA 4YMEA 1TAUA 1ZOTA 2W4CA 1CPZA 4F4AA 5D3GB 4NYOA 2YNGB 3ENQA 2CZ9A 3P3DA 5BYQA 3IBFB 2OPRA 5GAGU 1WOOA 2W4DA 5F9LA 2VQFF 3IBWA 2LVWA 1UVLA 4ILMA 3CTRA 3QGHA 1SJ4P 2HAFA 1U1OA 3CEDA 3IRXB 5KFJA 2DRBA 2ALYB 2ZZMA 2CQHA 1WTFA 1Z2ZA 2Y1JA 1LQ9A 3I5CA 3IWLA 2N3LA 3BZQA 1WACA 4JI7F 2E5HA 4O23A 3FK4A 2VOPA 2XYPB 4PXCA 2XG8A 2BJ3A 1UVJA 1RACB 1F5CA 4DJBA 1MU2B 1UZHA 1QDUB 1R8AA 4JV0A 2XMJA 1VQ5S 3R7SB 4E2FB 2OEMA 2AU0A 5D4NA 3IG1A 3QBCA 4B9LA 3Q86A 1Q1KA 1PYSB 2M2BA 2FZCB 4KAIA 4NYPA 2G2YA 4J9PA 1UPPA 2D9PA 1LWCA 5A2QU 2VIHA 4GKJJ 4RW6B 4BHQA 1HPZB 4ZVTB 3K5NA 1U1QA 4A8MP 3UD5A 5A8KA 2MQQA 3GIJA 4I6AA 1SQFA 1PJ7A 3J7YI 1VMBA 4USVA 1SC1B 3T19A 4TU9A 5CABA 4C97A 3X3UA 1EP4B 3GJSB 2KVIA 3CJKB 1OYDA 4NLVA 4CLFA 5CQGA 4DR6J 5GAHU 3VQSA 1X5TA 3GP9A 1YBAA 3DOKB 4BWJA 1BC6A 1J5EJ 4DR5F 1O5JA 3SZ2A 4ATNA 2BM1A 4RBVA 2E7XA 2ALZA 2WVEA 2C2RA 1IVZA 3W2WA 3WQPA 3BR8A 3ZZZA 3F44A 4IH6A 1NMEB 2KRBA 1WOSA 2NXEA 1GQEA 4KFBB 4LSNB 4IRKA 2Y8WA 2B0GA 1BY9A 4JI8F 2OELA 1JLGB 3R27A 3QWPA 3EE3A 3B54A 1UEVA 1T9XA 1YGYA 2NPFA 2CPXA 4DWIA 3NAIA 1JK9B 1JJHA 4NL5A 4TLQA 1OWXA 5ETLA 1CJKB 3B6BA 3TYTA 3TZZA 4DI6A 1SJQA 2O67A 6AT1B 4YR2A 3FCWA 4J90A 4ALZA 2EPIA 4IG3B 1HI1A 5DJBA 5K14A 3NL0A 2ZH4A 4PABA 3I5AA 4Y3CA 1N33J 1B4SA 2MKCA 1TKTA 1HNXF 1S6UA 4DL5A 1LOUA 4UTGA 5L1IA 4FS2A 3HSDA 2RIJA 4ERDA
chains in the Genus database with same CATH topology
2HRUA 2O3DA 1NNDA 2PA3A 3ULHA 4ZPCA 3G86A 1OIAA 2WB4A 3EGZA 2BE2A 2FC9A 1TKZB 3GG0A 4MFBA 4XDCA 3SV3A 2DCUB 3OFHA 3PKYA 4ZOSA 3N9UC 2LKZA 4I4BA 2R7OA 2W9BA 1N5VA 1WEYA 3PACA 4QJVA 1VRUA 4K4VA 4KRWA 5F9NA 1VGYA 4ED7A 1M0SA 4RX6A 4ED3A 4Y2IA 2Y1IA 1Z2LA 2ZD1B 4ZPWR 3PNIA 1DQAA 4ZS6A 1BD6A 1CC7A 4PXDA 2YWFA 1T7PA 1K0TA 2XI3A 3R1HA 3QAEA 4HT7A 5G0RB 2OTLS 4ED2A 1W25A 2OMLA 3LP2A 2IFXA 3EGWB 1RTDA 2R8JA 2RVJA 2M70A 3K58A 2VC0A 2JHEA 3CPWR 3FMBA 1VQPS 2HGNA 3DLGA 1RT5B 1KEKA 3U27A 4F26A 2C2EA 1T05B 1HBUA 3U7JA 4OJHA 3JSYA 1FCAA 3M2RB 2XO7A 5DLGA 1PILA 3V81A 5DQHA 2JC1A 4AYBD 2ZE2B 4NRUA 3RAXA 3D1HA 2ASJA 4MIAA 3POTB 3MD3A 2R7WA 1NO8A 4ED6A 2UV8A 4DS4A 2VFVA 2VZ9A 4J9RA 1T8EA 1CVJA 3ZC4A 3S01A 2M4MA 4MIBA 3ZZRA 3M9OB 4A8QA 4CZCA 3SI8A 2BQRA 2B43A 4ZP8A 2ZH2A 2CPEA 2RT3A 2W24A 3T6JA 2MGZB 1VQ8S 1KR4A 2DHAA 2ATLA 2GGPA 1WHXA 3M6XA 3IR5B 2GMJA 3PV8A 1S4FA 3AAWB 5F8MA 2N7CA 3FSIA 1HR0F 2R4FA 3JSRA 2ABYA 1REVA 3M6WA 3MOZA 3E01B 4FVMA 5GVQA 3TR5A 3U1MA 4CQ1A 1HQUB 2X1AA 1V3SA 3DLKA 1FRHA 4UOCA 4ETZA 2FVSA 4DLGA 4EUVA 2G0CA 4IFYA 2A3JA 4NZ0A 3GV7B 2DNYA 3P6YC 2B9XA 2DJWA 5L8RC 2HNZB 3K0JA 5LSLA 3OR1B 3UCGA 2GNKA 5KT2A 4K59A 4OZNA 1W2IA 3K5MA 2AYEA 2HS0A 5KAKA 1TKXB 2DHSA 4FN5A 4HHJA 2BVZA 4QR2A 2RS2A 1B64A 2YNFA 4NLQA 3V2UC 4RNOA 3PIPQ 3DHWC 3ITHB 3KG0A 3FQKA 4DL0C 3G8TA 2ZDOA 4QR0A 5LMUF 1N5YA 4FBTA 2B4PA 2GV1A 2FJEB 5I4MA 1XMQF 3WBZA 2RUGA 2DGOA 3TO8A 1FRJA 2DGXA 2MKSA 5L1JA 2J6SA 3HK2A 3GMGA 2RRAA 4G1QA 2ZC4A 3I31A 2CQPA 3PW5A 2IA6A 2GQ2A 3GR1A 3TVYA 1S6QA 2RQ4A 2EI5A 3N01A 4WFXA 3GZ7A 2RF2B 4TY8A 3KG1A 4QIWD 1C0UB 2HRYA 3HHLA 4N47A 2LU1A 4FPRA 3TA1A 3H40A 3MM9A 1VQ9S 4OI2A 1JLQB 5B0BA 1FRIA 1S1TB 1FJGF 1TQLA 2MB0B 2ZH3A 1D9AA 5KFAA 3KJVA 3I9V9 4CNZA 5C42A 2LLZA 3HHDA 4KGKA 2DH9A 5J1EA 1IKWA 2IVYA 4NLDA 2MQPA 2FHMA 3C8YA 4F4XA 3CF5Q 2ILZA 3MMCA 4EEYA 1ZAVA 4J37A 3CJ2A 3I5BA 3O2IA 5FDLA 2ZC3A 1C4AA 3SDEA 3TVZA 4B3OA 5KFCA 3RAMA 1U24A 1V9OA 4DL7A 1D8ZA 1OPIA 1IBMF 2AF6A 5D4OA 2R7RA 3EYZA 1ZPWX 3FGVA 3FEXB 3OJUA 2J6UA 2QLXA 4R8UB 3H5XA 2HFOA 4O4RA 1MSWD 4ED0A 2R7UA 5H9FJ 1HHSA 1ROFA 2R7TA 1VQKS 2RH3A 2XZWA 5H1SV 5KFOA 3EUNA 5KG1A 2UXBF 3P96A 2VPYB 4KQZA 3M2VA 1VRTB 1FERA 3GIKA 2QRRA 1S97A 4ZPDA 2V8VA 1NB7A 4C0BA 3M2UB 2LEBA 4RW8B 3KLIA 4R5PB 4U67Q 2FJDB 3TVKA 2DHGA 4XAKA 3DLBA 1K0VA 1FE4A 1S1XA 4PG6A 4N76A 2PA8D 2SXLA 2VA3A 1KONA 3MHYA 1I6JA 3IRWP 2R7SA 5IT9Y 2HMIA 4TYAA 2E5JA 3MMJA 4GO5X 2BV3A 2Q43A 3PRDA 1L3KA 3BF4A 1ZZFA 2PI4A 1KQKA 5IM0B 4YQWA 4O3QA 3V6JA 5K8OA 1XTZA 2ZJQQ 4Z2XA 5DO2A 2ZOGA 2XULA 1LXJA 4ZK7M 4ECXA 2E1MC 2FPHX 4NLOA 3BB5A 5AXKA 3JB9k 1HW9A 2YNHA 3DLJA 4P6QA 3VTIA 1MMLA 3ZZUA 4I6WA 3T5HA 3RAQA 4IUFA 3MM6B 1PC4A 4X65F 5F3ZA 2U2FA 1N5SA 5HO4A 1RAJA 5LL6d 1TV6B 5THWA 3PW0A 2XC9A 3ISND 4QPTA 3KLEB 2E29A 2XY5A 2BDPA 2PMZD 2HHWA 4DV3F 4B9VA 4PR6A 5DG9A 2W25A 4KSEB 2XMTA 4R25A 3MAHA 5DQGA 1LW2B 3JSMB 5K5MA 3PHEA 3GILA 3VAIA 4CO3A 3DI6A 4C9DA 3QGIA 3VAFA 2J0WA 2HNYB 3M30B 5B09A 1JLFA 2BRLA 3MURP 3KLFA 2B3TB 2BXJA 1R0AA 2A10A 4Y00A 4B08A 2EBEA 4C2MA 3TAQA 3HX9A 3D0HE 3OR2B 2UU9F 1U2RA 3CCWA 4M63A 1X5SA 2GIQA 1B0VA 2D41A 2N4CA 3FZBA 3DMJB 5E3PA 2YH0A 2VA2A 1JMTA 2WSCC 1TK0A 2NYIA 3KNAA 1WHYA 3CGIA 2IRYA 4IDKA 3PEJA 1CQMA 2JWNA 3E8OA 4GC6A 4DL3A 5L9XA 3CCQS 5D3GA 1IJFB 2YNGA 2B51A 4NXMF 4LJMA 1Y5NB 4TQSA 1SI9A 5T7LA 1MW7A 4HDHA 1VOMA 2PC6A 2WW8A 2CFXA 4QCLA 2FC8A 4CO4A 1V3RA 1WI6A 3MM5B 2YKNA 2QIFA 1AXQA 1SUQB 2JEGA 3V4MA 2M3DA 2VL1A 2BACA 3MECA 4QW8A 3RB4A 2NZ4A 3RB0A 5HLFA 1G6BA 4CI0B 3TP2A 2YNIA 1UL3A 3NP5A 5B0GA 4WYWA 2AYGA 4QU6A 2XHWA 3CXCR 3RRKA 4A8KA 5B0DA 3MFHA 5IQQA 2XSFA 3UW1A 2VG5A 1RTJA 4ECYA 1DLOB 3IRXA 4TLRA 2E9TA 2W8LA 3OSNA 1YJVA 2FB0A 3LP0B 4FZVA 4X4PA 5K8NA 2ZOMA 4OJ1A 1Q78A 3WC2A 3BN4A 2UUTA 2IM2A 3FJ2A 3I0SA 2KFNA 2Q66A 3OTOF 3NKYA 4OV1A 5KFXA 2YQ3A 5IQ6A 1FRLA 3R5BA 3AHPA 1HWJA 4A8XA 2PEHA 4E8UA 4O44A 2V4JB 2N82B 3UD3P 3K2YA 2MHEA 5BYRA 3SSSA 4AXJA 1J5OB 4EYIB 4PRFA 4K0KF 1JLCB 3QIPA 5KT7A 1NJWA 4OX9F 1P6TA 1C0TA 5B0EA 4C11A 2DVIA 2QA2A 1FTRA 4Q2LA 3H4BA 3BSNA 2HYIB 4RLEA 4N56A 3NNCA 1P8GA 4DN0A 4AQYF 1U49A 5DDQC 3HXMA 2X51A 5CYQB 3TAMB 3FMWA 2QA4S 4CTAB 3FFIA 2JL9A 4K50A 2X1GA 4HTJA 1K73T 3W7BA 1MU2A 2O5DA 4BWMA 4JI2F 5EHHA 2YKPA 3EZ5A 2E5IA 1T03B 3I6PA 4G1PA 1NK9A 2KT3A 3C6UA 3D54A 3ISNC 1RA7A 1XERA 3ONQA 4B9UA 2XB2D 3S6EA 4KHRA 4NLPA 5A2QY 1NU4A 5HROB 2AJFE 2HNDA 5JXSA 2ADBA 1N36F 2JSXA 2XCPA 5KFBA 5M2PA 1TKDA 4OIXA 5K8MA 1M5HA 2ZKTA 3OW2R 2C2DA 2DIUA 1FXLA 1FJ7A 1T3NA 3OTCA 1CG2A 5F8JA 3QLHB 2PD1A 4QWBA 5DM7Q 4RW6A 1RT7A 3HO1A 1R89A 1Z1ZA 4LF5F 3FZ2A 3R3TA 2GW8A 3N6LA 1S79A 1HPZA 3SCKE 2PN6A 3NCRA 3MR2A 4JI0F 3VZHA 1HNIA 2I0XA 2XLJA 2R7XA 5KT5A 4OLPA 2VB6A 4QWEA 1F5BA 4OX8A 3I96A 3MFIA 3K57A 1Y9OA 3BSOA 4KPYA 2HVZA 3KLHA 4KC5A 4N77A 2ZJPQ 4EZ6A 2FIUA 5J1NA 1UFWA 2LXUA 3QJJA 3WZ0A 3BDEA 1JJ2R 1HWKA 1LXNA 2Z8QA 3GV5B 2VBXA 3UNGC 1JNRB 1Q8LA 2HQ3A 2VPWB 3CCSS 1VQYA 2XEXA 2MZSA 4WZMA 4WE1B 1HBMB 4LSLA 3FRZA 4RU2A 4BC9A 4TU7A 2V0NA 1E6YB 2VG6A 4EO8A 5DGBA 4PG4A 2NLWA 4PUOA 4O4GB 2YKOA 2R9LA 3VALA 2UVUA 2KZZA 5T14A 3BDPA 1EP4A 2BQ3A 3CJKA 1HI8A 2Z4PA 3ENVA 1X0PA 3GFHA 2DR9A 3W2VA 3LWLA 2FJBB 1R43A 2PFFB 4A8SA 1NJXA 4DV1F 1F0XA 4O0IA 2VD3A 5FLXY 2ASLA 3Q2SC 1UEUA 1SJ3P 3CMAS 1JLBB 2K3KA 1UWBA 3L95X 2FJWA 3H8YA 5F0WA 4X62F 4ED1A 1IQTA 4L3NA 4NLTA 4ECTA 4DFKA 3DOKA 3MWBA 2JLGA 1NHUA 3DXBA 5GAEI 3OUYB 2ZVSA 3WX4A 3ZZTA 2CPFA 1NHVA 2CQ4A 5G4DA 4M8LA 3NGDA 3BREA 3IS9A 3VF0B 2BQUA 4F4WA 1TK5A 1QUVA 3LP1B 4LF8F 4WF9Q 3SQGB 1GXTA 2XI2A 1QTMA 4J9NA 3PJXA 5E3RA 4K4TA 1NK0A 5A0YA 5KFHA 3PDNA 5HMWA 4MKYA 4KKOB 1JKHA 4DV7F 2CRLA 3HHEA 1S76D 1UP1A 3BGUA 4B9NA 2LECA 1NH8A 1XN9A 3OL7A 1FNXH 2ROPA 4F3MA 4ICLB 2QA1A 1HD1A 4OJ3A 3KMSA 4XK8C 2FHOB 2KXNB 3I87A 4M1KA 3I0RB 3QWUA 4CT9A 5LMNF 4EU0A 3HVAA 4I2PA 1ELOA 4RNHA 1SC6A 4KTQA 2VPZB 4PWDB 3OLAA 3DYAB 2K1RB 3AQPA 3N28A 4ZP7A 3G9CA 5C25A 1N5TA 4A8FA 4KFBA 1R3NA 4M5DA 1FDNA 4RW4B 1KQFB 3M32A 1HW8A 5B08A 3CJ3A 3RTVA 5J2MA 1VIXA 1CEZA 3CCZA 1OQ6A 1JLGA 2EG2A 1OO0B 2HPUA 1O8BA 2AYBA 3MPVA 3C3LA 4KO0B 3CCRS 2HHHF 4C8ZA 2F4VF 2FVQA 4NCAA 3LGMA 5DG7A 1IBLF 1P1TA 2WRMA 1YJRA 3U02A 2J9DE 4E0DA 3BGRB 1GAOA 1NK6A 2E5LF 4N41A 2FJXA 4JV1A 5EGYA 1HA1A 1EETA 2MQOA 1SH2A 2D74B 1S1WB 1JXLA 2DPJA 1C2PA 3TUJC 4DSKA 2KJWA 2RS8A 2KRRA 1KLMB 2VUGA 1S72S 3QYYA 5LJ5Y 1U1RA 1U1MA 1A6LA 1RTHA 2PE8A 4QZVB 2XCAA 3DRRB 2RQCA 1VQMS 2R2TA 3JTOA 1APSA 5DRKA 3DU6A 4H4MA 1ZAWA 2KB2A 1WHWA 4KE5A 2AGOA 4IG3A 4ID5B 3CDBA 2M5YA 2GFFA 3CWJA 2M8HA 3THPA 1P9QC 2FHJD 1NK4A 1VBZA 2HAIA 3HFKA 3VAKA 2DR5A 3LUYA 4IG0A 4ZVGA 2HLTA 3TQ1A 4WK3A 1ZM9A 3MXHP 1D8YA 3X1LB 4K4ZA 2LU2A 2JZ5A 2IM3A 2DGSA 4F3OA 1H6KX 2O1PA 3LAKA 1N0UA 3FSXA 5LXRA 1UAWA 4L6V3 4ES1A 1S9FA 3DRXA 5DLFA 2FLLA 3CSKA 1JXEA 2FHJA 2ZZNA 1LWEB 1FKOA 1X4DA 3J7YU 1IKXA 2BW2A 2RJZA 3MDFA 4DR4F 4KV8B 3JTPA 1JB0C 2HLUA 3HJFA 2EFNA 3O1LA 1BLUA 2XY6A 2KJVA 4LUBA 4M95A 1M1KT 4CCHA 1BQMB 1RT1A 4H4OB 3MAQA 1KC8T 3PEHA 3V6HA 4URQU 3NG8A 1HNVB 3DFEA 4NLYA 5KTQA 1TFWA 5HBMB 2HHTA 2ZNZA 4JV5F 5EWGA