2QIFA

Crystal structure of a metallochaperone with a tetranuclear cu(i) cluster
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
b'MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone copZ
molecule tags Chaperone
source organism Bacillus subtilis
publication title A tetranuclear Cu(I) cluster in the metallochaperone protein CopZ.
pubmed doi rcsb
total genus 21
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qifA00
4FNIA 1CC7A 1FD8A 2OMOA 4A48A 1P6TA 2BYCA 5A6PA 5B0GA 5KAKA 5T7LA 5B08A 1RJJA 2PD1A 4HH1A 2ROEA 2OFHX 2OFGX 2FIUA 2RU9A 2LDIA 2ROPA 3MCSA 4U9RA 2PGCA 2K2PA 1GXUA 1FVSA 3BR8A 4OJHA 5B0AA 1SI9A 1YJTA 1OQ3A 3BF4A 3E8OA 2KYZA 1MWYA 1SB6A 3KG0A 1KQKA 1Q8LA 3BB5A 3HHLB 4HH0A 4YDXA 3VTIA 1GXTA 3BDEA 4A47A 3HFKA 2W4CA 1KVIA 5F0WA 3TRGA 2ROGA 1FE0A 3BGUA 2OD4A 2HFOA 1K0VA 1N5TA 1VQSA 2K7JA 1YJUA 2GGPA 2Q3PA 4HL9A 4QOTA 3UDCA 2IYIA 3FGVA 3HDSA 4DN9A 3T9NA 1N5SA 2GO8A 4OIXA 2OAUA 1KVJA 3MZIA 1Y9OA 2HFNA 1URRA 4DL0C 4HI2A 3CJKB 2K1RB 3LO3A 1N5VA 2HQIA 3FMBA 4Q2MA 1OSDA 1TZ0A 2HLUA 1APSA 1YJRA 3WDOA 4F67A 2XMTA 3F44A 2AJ0A 1TUVA 4Y2KA 3BM7A 2VV5A 2AJ1A 3DCAA 2XMJA 4YEAA 1X0PA 4ZA1A 2G9OA 3LGMA 4OJ1A 5B0EA 1R6YA 5A6WA 4DPOA 3LGNA 2LQ9A 1V3ZA 2N7YA 4ZOSA 1IUJA 2K1RA 3IWXA 2EW9A 3CJKA 4Q2LA 4EFAC 2L3MA 1W2IA 1Y3KA 2FHMA 3QGPA 1TR0A 3HHLD 3HHLC 5B0DA 1Q8BA 1SQEA 2GV1A 2VH7A 1N5QA 3FRYA 2N4DA 1OQ6A 4A4JA 1P8GA 1X8DA 2FTRA 2K7KA 1QUPA 2N4CA 2AW0A 2GFFA 1CPZA 4Y2MA 2HIQA 2ZDOA 3I9ZA 3HHLA 2CRLA 3KKFA 1FVQA 2QYCA 1Y3JA 3KG1A 1FEEA 2KT3A 2XMMA 2IYGA 2LXFA 1S6OA 2BJEA 3DXSX 5B09A 2XMKA 1YG0A 1S6UA 1TL4A 2BUNA 4OJ3A 4Y2IA 1TL5A 1U7LA 3QMQA 2GA7A 4OJGA 1WD6A 2AP6A 2GGPB 5B0BA 2RMLA 2RILA 3BN7A 2BJDA 2XMUA 4NL5A 2ZDPA 1YJVA 2W4DA 3IWLA 2GCFA 2W4PA 2RSQA 2OD6A 1AFIA 3K7RA 2ACYA 1AW0A 2QLXA 5T7LB 1FESA 2KKHA 2QIFA 1YRXA 2ASYA 1JK9B 1FE4A 2XMWA 5IXUA 5B0CA 2FB0A 4NPOA 1OPZA 2QLWA 3HX9A 4FNHA 3TNVA 1JWWA 2KT2A 1XBWA 2IFXA 2XMVA 2OP5A 2OKQA 5B0FA 3GZ7A 5K9FA 1X7VA 1CC8A 2JDJA 2HLTA 1VQYA 1LQ9A 2LQBA 3KNGA 5F0UA 1Q53A 4HI1A 3TOQA 1ULRA 1Y0HA 1AFJA 1Q4RA 3HF5A 1MWZA 4A46A 2BBEA
chains in the Genus database with same CATH superfamily
3RYLA 3OXFA 1YWXA 4O3SA 3KJNB 2YPYA 5G0RB 2UVUA 3JSMA 5AE1A 4Y6IA 1RLCL 2ZBRA 1REGX 5IT0A 3KLEB 2C42A 5I3UB 1X5PA 1VR6A 4YR3A 1LW2B 1IM6A 3AB2B 4EZ9A 3W65A 4OMFG 3T41A 4Y00A 3FK4A 3VAGA 5ETMA 2C2EA 3M1VB 2ZWOA 2B8QA 2HRUA 2WVCA 1KQKA 2CQPA 2MSTA 4O4GA 4A8FA 3LP1B 2LLZA 5F9NA 5CABA 1S48A 3MUTP 1FE0A 4G1PA 2O01C 3IA0A 5T14A 2C2DA 2Q3PA 4HHUA 3RBZA 1VQLS 2JL9A 3WQPA 3VCDA 5DLGA 4X4TA 3O1LA 1NH8A 1U6ZA 2MKYA 2ZE2A 3CWJA 1U25A 2BW7A 1K44A 2F9DA 3C66A 1N34J 2M8DB 2HHPA 1HPZA 1URRA 4WK1A 2FLLA 2VBYA 1I3OB 2YPZA 3PZPA 1SC6A 2VPYB 1Q0NA 3MAQA 1TKTA 4OHWA 3RU0A 4J7CA 4NEZA 3T5HA 3GLJA 1JJ4A 4Y2KA 2CQ3A 4IG3A 2KM8B 4ZN3A 3J7AN 2YQ1A 4P72A 4CQ1A 4NYOA 2DR7A 4W98A 1IKVB 1X0PA 2HBZB 2EK6A 5B0EA 2KHCA 4AT1B 1D9DA 4ZIWA 2UUAF 1RKJA 3A8IA 4WKYA 5KFWA 1GT8A 5LOQA 1H7WA 2XG8A 2V8GA 2EW9A 2B9EA 1JNZB 1WHWA 5HK4A 4LF8F 3I82A 3KK3B 2J6UA 4TYBA 3PJXA 3QAUA 3SYZA 3GG0A 1VGYA 2P6SA 3KG4A 4FF4A 1T9TA 2Y1IA 1MMNA 3V2UC 2XCPA 2HHUA 4QPXA 2LU1A 4UUWA 4M5IA 2RKIA 1PBAA 3TVZA 2GFFA 5D15A 4HLBA 3VHQA 2VPZB 4KRWA 2ZOMA 1NKBA 2A2CA 2I9SA 2GX8A 4DPWA 1RISA 5A0YB 2KI2A 2V4QA 2ZHBA 2YX1A 3UD5A 1FVQA 4L74A 4LRBA 4OX9F 2HAIA 3B8HA 4K8RA 4DR4J 4YQWA 3SI8A 2B5JA 2OUGA 4DV3J 1JLQB 2RQMA 2F4VF 3DOKA 1RT5A 2RUSA 3BGRA 4K0KF 2D3ZA 1BWEA 3MPDA 1YX2A 2FY8A 5J2NA 1JLAA 4RU2A 1HQUB 1LEOA 2GHWA 2C3OA 4BC9A 5IQ6A 2Q66A 2QSWA 4I4BA 2BJDA 3PTWA 3GCXP 2MHEA 1YJVA 1T05B 4XO0A 1VC5A 1U6FA 3QQCD 3QJLA 2W9CB 1T9YA 1X9SA 2NREA 2WCXA 4KB7A 2EXUA 1AUDA 3NOGA 1R8CA 1FJGJ 4UTGA 2ACYA 2EKYA 4ZVGA 3GIIA 2DTJA 2CQIA 1FESA 2QMXA 4CT8A 1VQNS 2V50A 1Q1KA 1JK9B 3G96A 2AEFA 3HHEA 4AQYF 2MDAA 3R5CA 2FVRA 4MAKA 2C2KB 1YHQS 3CPWR 2DT9A 3OR1A 3LANA 1N4LA 3CMES 1Q86T 3VQTA 2PE8A 2F3JA 1K8AT 1DLOA 2IFXA 2O67A 3H90A 4JI0J 4C9DA 1TELA 3KLIB 3GWCA 2EFGA 2F5GA 1X7VA 2ZBCA 4GO5X 2R7UA 3SQOP 5GMKa 3KNGA 2ZD1A 4P10A 1FD2A 2LXUA 4PPZA 3TX0A 3PO4A 2HGMA 3W7BA 4CRJA 3CD0A 4DUYJ 3BPDA 1NJXA 2I0XA 3H5SA 3JS9A 3KTQA 1S76D 2RE1A 4ALZA 4ELUA 2ZJQQ 1GX6A 3IN5A 2IRXA 4K4YA 2AGQA 4PG8A 3A1YG 3R5GA 1I94J 2BOAA 4C8ZA 2Z0GA 2XGQA 4KGMA 1Z1ZA 4WWSA 1IJFB 3DMJB 5KFUA 5CD4A 2OI2A 1S1TB 1RT7B 4J9QA 1XMOJ 2DNQA 1RWXB 2DGXA 3OVAA 2RKIB 3KJVB 2HGNA 3JSRA 4OZNA 3VWSA 4NYPA 4ECSA 3K59A 3K58A 2DISA 4Q0BB 2L9NA 2IBOA 1XR7A 2DGSA 1RT6A 1S6PB 4U7UK 1N34F 1S1TA 2FJWA 3MURP 1JLBA 2NYHA 1TMJA 4DV3F 1F2GA 2DGQA 4DV5F 1NNDA 2R2SA 1N6QA 3K5MA 2RRBA 4NCGA 2IDEA 4OV6A 1S9EA 1RHQB 3R5DA 5DM7Q 4WF9Q 3HSDA 2J8AA 5KG6A 5C42A 2UP1A 1Y9OA 1FWKA 2R42A 4ZVOB 1U09A 3KDOA 4FPIA 1RWKB 3L7OA 2KT5A 5KOXA 2HQGA 2B9XA 2XLIA 1YJRA 3ZZZA 5I3QA 3BS9A 4B9MA 2IIHA 3ISZA 3PYFA 3OUYA 3BSOA 2VBWA 3NGTA 2AGOA 4UUXA 5M2UA 2JJ4D 2M4MA 2MEWA 2DCLA 2QSFA 3JQMA 1SPBP 2CDQA 3G8SA 3JTOA 2MQMA 1FCAA 1JLFB 2JC0A 3TQ1A 3A3OB 1SJQA 5AE2A 3VALA 2YXLA 1WHXA 4NEYA 1CJVB 4X62J 4JI4F 1S0VA 2COLA 4PZVA 4FXWA 1T05A 2L3MA 2MLYA 1QTNB 2H48B 4ID8A 1X4DA 1GK8A 4RNMA 1FDDA 1HHSA 4LT6A 4W4MA 3UDEA 4GRSA 1RHJB 1ZS6A 1OMSA 2CFXA 1LFWA 5J2NB 3D0GE 1D8ZA 2AJQA 3BEGB 5C2CA 1S57A 4BDPA 4RW9B 3PYDA 5A8RB 5KFFA 3LP2B 2B5JB 3CB4A 2I6WA 3L7UA 2ZH5A 4CCHA 4LQ9A 2V0NA 4JV0A 1MU2B 1CQNA 5D0GA 1WF0A 3OJSA 1JJ2R 4DSJA 3AD7C 3MPUB 3THPA 2UV8A 1OJ4A 4B3SJ 4I2QB 1RHRB 3OFGA 3W61A 4R5PB 7FDRA 3G6VA 2XY6A 2KFNA 2CWXA 4C98A 1JLEA 1S6UA 2JNJA 4WFBQ 2KZZA 3CD7A 2OIHA 3BN4A 3GFYA 4Y2IA 4F25A 2VG7B 5I3PA 3W8PA 4P9SA 1U26A 2V63A 3A4TA 1WSVA 2MZQA 5KFSA 1NKEA 1XERA 2AHOB 2HPUA 2Q43A 3MHYA 4JI1J 2R8JA 2A6MA 4F0HA 5HROA 3NS6A 5K5MA 3EGVA 1IKXA 2VC1A 4HVZA 5L8RC 3H20A 3LAMA 5HVFA 3S7RA 2RQCA 1GMWD 3M32A 3K7RA 1RBLA 3W2VB 3MM6B 1AYEA 2DKOB 2OTLS 3DYAB 2CPJA 3I87A 3NNCA 1JJHA 4Q8FA 1ACMB 1SJRA 2QLWA 3S1TA 1K73T 4CLTA 2IJRA 2MQPA 1NB7A 3RGIA 2Z2ZA 1WTFA 1SUQA 3MR7A 4C6AA 3FBFA 1M5PC 2LFVA 4DZDA 2VQFJ 3ZZPA 2QLBB 2IM3A 2QL9B 1IQTA 3M7VA 4NE9C 2NCKL 5KFIA 5HMXA 4QIWD 3F73A 1HWKA 4BWJA 1K9MT 2R8GA 4OYBA 2RRNA 2BYCA 4U8VA 4IRKA 2B4OA 4H54A 1RWOB 1Y7PA 4B9VA 1K0TA 3GU0A 1KR4A 2BRKA 2LDYA 5ETQA 1WEXA 2JVOA 5B08A 3JYTA 4C3KA 1R0AB 3MWBA 4EYHB 4GKJJ 2DCUB 2UVWA 2PMZD 2ZVIA 3BR8A 4DN0A 4OJHA 1A0OB 3G6ES 4UOCA 2CPIA 3O6QA 5IFMA 2H54B 4RBUA 3Q8QB 3BBBA 2ILYA 2HNZB 1RACB 2UUBF 4BLGA 1TK5A 3W3SA 1LW2A 1RTHA 2YX7A 1PJ6A 1YBAA 3TRGA 4TXSA 2DGVA 2FPHX 2OD4A 2RHQB 2HVDA 3AOCA 2JC1A 4G65A 1QDUB 4DV4F 4TLRA 4QOTA 4GC7A 1M5VC 2W01A 1N48A 4ILMA 1AZSA 1GTHA 3KWMA 1N5SA 2YY3A 1B0VA 4CTAB 4DPXA 3MZIA 2H5JB 2UV8G 5LXYA 2BQRA 4HTJA 4ZPTR 3PX6A 5IZHA 1P9QC 3DKDA 5KG4A 2UVVA 3RAMA 1S1WA 1X5SA 1X4BA 1Y4ZB 3QWUA 5BYQA 2DEIA 3KMSA 2O3DA 2NUUG 1N36J 3L4BC 4F67A 5L9XA 1B64A 1JLFA 5JUMA 1KP6A 3F44A 1EQ0A 1OWXA 1NAQA 2KU7A 4YEAA 1NB2A 3DFEA 3Q8VA 1FXRA 3CDAA 2HFVA 2JZ5A 2NSCA 2QGFB 3M30A 4PG4A 1XIQA 3OUYB 1S1XB 3IR7B 1RSCA 1FNXH 4WIIA 4DPUA 3J7YU 2QA1A 4XDDA 4ZPDA 2J7UA 3NP5A 4TY8B 4DLGA 4LJMA 2ZFHA 4EO6A 3DM2A 3PO5A 2ZEJA 3TJ9A 2YBVA 3QNWB 1RT5B 2HVZA 3BGRB 1LK5A 2FHMA 1JLQA 4EBDA 3ZZRA 5K8OA 3HHLD 4OHXA 2VH7A 3U7JA 1XNQJ 1FRHA 1NSPA 1YRTA 3P5TL 2K3KA 3FFIA 4A4JA 4O0IA 2X3DA 4KFBA 1T9XA 2MYFA 1SKRA 4AE5A 2MJNA 2ZH6A 2VFRA 4IO1A 3MM5A 3KJQB 5C25B 3KKFA 3OFFA 2VJUA 3RB6A 2IY5B 4X2BA 4QU6A 1FJEB 1FHTA 3M8YA 2DXEA 1H73A 2K8GA 1HBOA 3M2VB 1QE1B 4OZ2A 2R7QA 3VAHA 3QWPA 2PEBA 3IC1A 4MH8A 4OZLA 3KK3A 3NL0A 5J1NA 2J8SA 2BE2B 2FC9A 1BXNA 1GMUA 3BBCA 4DG1A 2QEXS 2ZZNA 3QFWA 4L76A 3W60A 4A8SA 4LF9J 4B3TF 2AJ2A 1SVDA 2E7VA 1S6QA 1UTAA 2EKNA 3BH6B 3GP9A 1XJWB 3QT5A 4USVA 5L1KA 1DRZA 4FKXA 8ATCB 1ZTTA 2RSQA 2NUHA 2D7SA 4Z7YA 3R7NB 1NSKL 2OEJA 1N36F 3KLIA 1IXKA 3PJWA 1IBKF 4G6VB 3BYRA 3G6YA 1S0MA 4LMZA 1KLMB 4UT4A 3OTCA 2V69A 2G0JA 1OPZA 1UVKA 3CC7S 3T1HJ 1XR6A 2OEKA 3DLJA 2BJ3A 3LWLA 4KYZA 4PPDA 2BJ8A 4CLYA 5BR8J 4MMOA 4LF1A 3OSNA 1IR1A 2RDDA 3NEKA 4MFBA 4LFBF 1TAUA 3PW0A 3IR6B 1B7YB 2XBPA 4PWUA 2VA3A 1RB0A 3A8EA 4IG0A 3G87A 4BWMA 3TR5A 3CC2S 3L95X 2YNHA 1ROFA 4LF8J 1MWZA 1XQIA 1Z2LA 4RNOA 1FI4A 1JB0C 1OY6A 2D69A 2P8IA 4IH6A 3CCVS 3LGHA 4FNIA 4DUZF 2LQJA 2J7KA 2CZ4A 2NSBA 4EO8A 3ETOA 1U0SA 4KTQA 4FBUA 1AA1B 1TL1B 1WC4A 3HLUA 1HNWJ 2IM0A 2ROPA 4U9RA 2K2PA 3TP2A 2AU0A 3Q2TC 4QR0A 3JSMB 3E8OA 4M5GA 5G0RA 5A8RA 3R97A 2B9YA 4DDFA 2HFZA 4HH0A 4LFCF 2CPHA 3TI0A 1GXTA 3BDEA 3MECA 3TQEA 4DR5F 1R27B 2RJZA 4DV7F 2Y3YA 4LF4F 2HHWA 2D1CA 4C8LA 4JI3F 5HL7Q 2JH3A 5GAHI 2NXCA 1RTIB 2UZAA 2D74B 3UN3A 1O0PA 4AFFA 1PJ5A 2E5JA 2GO8A 3I5AA 4QZVB 5LSOA 1HD0A 3W1YC 5KT3A 1CJVA 2FY1A 4LF9F 2LQ8A 2RQKA 3OBIA 2BJ9A 1DURA 2GHVC 3NGKA 4RWXA 3SFUA 4Q2MA 3CCES 1TKXB 1TUGB 1APSA 4ED1A 2D41A 4Y28C 2IA0A 2PMWA 5A2QU 4NLDA 2W2OP 4H4OA 5HATA 3TYTA 2XZWA 4Z37A 3OSPA 1VS3A 2RVJA 4NXNF 3IXQA 3IWNC 4ZITA 3CJ0A 2U2FA 3DCAA 3MI7X 4JI1F 2MZTA 3HMJG 3PIOQ 1ZH5A 1NSQA 1UW4A 3LOUA 4ES2A 5KFZA 1FFSB 2B4UA 1HBNA 4X66F 2XY5A 1HBMA 2HRTA 3AHPA 1VRUA 2UUCJ 4JI4J 3MMBB 2E7WA 2ASDA 1C1CB 5KFJA 4AD6A 1HPZB 1F9HA 4WXWA 2GVZA 1RKIA 1Y3KA 2DH8A 3GR0A 3ZZYA 2FLPA 3MCOA 2VODA 2Y9HA 3NNAA 4K4VA 3A13A 1R8BA 3DLKB 3KHRA 3HSGA 1JLGB 3BBFA 3EVOA 1QUPA 3SXLA 1I94F 5L38A 1BQNA 3Q8UA 3D6HB 5E41A 3LP1A 2ZDOA 1DAXA 3JSBA 1U0HA 2G1HA 2WBMA 1OY8A 3P96A 1K1QA 2FYXA 2H3EB 4OYIA 2LXFA 4F4AA 2FJAB 3MR3A 3D0HE 4KFBB 4LF5J 1HNIA 1GH8A 2CQGA 5KFNA 1EETB 2FHKA 5D4OA 5ETRA 4L3NA 3R8YA 3THTA 2R7WA 3QBCA 1Q95G 4DV5J 1S0OA 4WFYA 2FC8A 1FKOB 3QRPA 5ETSA 2UU9J 3X1LB 1X4AA 1QJHA 1NHVA 3C6TA 1AXQA 3OR2A 4LSNB 2C2NA 5D78A 2A3JA 3K5PA 1WKKA 3N6MA 3QT7A 5B0BA 1U48A 1T0TV 1UPPA 4NL5A 3MR6A 3L7PA 3KK2A 2WRMA 4DSEA 3G71S 3UVJB 3GPAA 4NCBA 4CNZA 4C8OA 2BKPA 3IGNA 1RT2A 1X4GA 2LVWA 3M8ZA 3GR1A 4CT9A 3W5XA 3BKFA 5T7LB 3T1YJ 3MEDA 3DI6A 4X4OA 1HQ2A 1TL7B 1HL6A 1X5TA 1E6YA 3EGWB 2VPWB 5AXLA 4FNHA 3HX9A 3M6WA 3BQ1A 4B3OB 3NOCA 3HT0A 3B6BA 2RDIA 3PHEA 1PKUA 4TU9A 1CLFA 3RW7A 3GZ7A 1TV6A 3RBDA 3HVAA 3DDIA 4LR7A 1HNXF 1SBRA 3MMCA 1GEHA 2YX4A 4IQMA 3TOQA 2AZ1A 2CA9A 1C0TB 3RRKA 3R7BB 2XCAA 2YNFB 2CPFA 1S49A 4O3QA 5MAOA 3SEOA 5KFXA 1NK7A 4FF3A 1FX2A 3OXGA 4TVAB 4CZCA 2WSFC 3NY0A 4CH7A 3QLHA 4WU3A 2A10A 1NZAA 2PD1A 1NH7A 1YVFA 2J76E 2GMLA 3PRBA 4JV5J 1N88A 3D68A 4ED3A 2YKNA 1G4CA 2QL5B 3K5LA 4JV5F 1KFDA 2OPRB 3IG1A 4P71A 3PVXA 1SI9A 1B99A 1CULA 4ZLPA 3H0PA 3BKUA 4X4PA 5DDRC 4IFVA 1U1QA 1KVIA 1A7GE 2VZ9A 5H9FJ 5F0WA 2AIRB 3HHNB 4P52A 2VKZG 3HO1A 2YKMB 4X4RA 2K7JA 1YJUA 2GGPA 3FBCA 4DR2J 1FFGB 1MMLA 1S4EA 1FT8A 1HQEA 3DLGA 3Q83A 3R5AA 3ENQA 4URQU 2PI4A 1DQ9A 4OX8A 1JJCB 3BV8A 4ERDA 1NLKL 3FQKA 2J9CA 3RJMB 3I5BA 4CLSA 4CO2A 2NXJA 2HHXA 1HNVB 3NCPA 3CJKB 4ICLB 2VUGA 3LO3A 1N5VA 3T1AA 4YDDB 1XC9A 5E33A 4I2PB 2R8KA 3PY8A 1EX8A 3OTOJ 1IKVA 1N52B 1UZHA 3A8KA 2CVEA 1WWHA 3WDOA 2RS8A 5FJ4A 3RR8A 4FXDA 4X4UA 2QX0A 3HJVA 2VV5A 2FVCA 1F1BB 3W2VA 2XC9A 4RNFA 1VJWA 4QQBA 3MMAB 1WI6A 4YY3F 3QZ8A 3NCRA 3SBMA 4NASA 2AYEA 2YKQA 3QGGA 4U7UD 3OL6A 2EI5A 3CJ2A 1FTCA 4PG5A 3VZHA 3BZQA 3T5JA 1IUJA 2DRBA 3RG6A 1NHUA 2VBZA 1RUSA 3C3LA 5BYSA 5DM6Q 1NKCA 1N56A 1VQKS 3W62A 1MROB 3MM9A 4MIBA 2V4JB 1JLEB 1Q8BA 2VF3A 2DY9A 4ZK7M 1LW0A 3PFOA 5SUHA 1TMMA 4X62F 1U1KA 1P8GA 4OHYA 3QPIA 3N28A 1T3OA 2N4CA 1E6YB 1Q8KA 4ZPBA 5AJ3F 2CQCA 1RAEB 3P5BP 2G2OA 4GVLA 2B7CB 2J9DE 4LSZB 2IVFB 4DV2J 3EWGA 4C8YA 2QT7A 4WFZA 4PCQA 4NA1A 1IWGA 4ZVHA 2HS3A 1YI2S 5I3UA 4CLZA 2CQ4A 4PAAA 2M8HA 3DLEB 4M5MA 1SKUB 1TL3A 2R9LA 1EKSA 2NZ4A 2Z58B 3TW0A 4ELTA 2VG5B 4FS1A 4C97A 5KFBA 4QW8A 2VFVA 5HMWA 3NCQA 1U4BA 1FERA 3CSKA 4ECZA 5E3CA 2R7RA 4ZPWR 2ERRA 4Q7AA 1H72C 2D3O1 1WHYA 4DV6F 4H4KC 4DMZA 3J80U 2XSJB 3HKZD 3EDQB 4C3MA 3M8WA 2X3GA 4P74A 4K4WA 2Y8YA 2QE5A 3FZ2A 3M8QB 5CH7B 1S1UA 2ZDPA 4H4MB 2A2DA 2K3IA 3TA0A 4C3LA 2CYYA 3FSXA 5KT2A 3JSYA 1RHUB 4MIAA 2L41A 3ULHA 3KLVA 3RB0A 3IS9B 4M5LA 2KL8A 5GADI 3KNAA 1FE4A 2J5AA 3ZFVA 3SSQA 3OPKA 1TFWA 1V5VA 1AROP 1VIOA 5I42B 1HA1A 1LNQA 3E3XA 1XBWA 3CT9A 4TKTA 4ZHRB 3NS5A 2DNZA 2PA8D 1GMWA 5DQHA 1UETA 5DETA 4ECVA 2AWZA 4MKAA 4WYWA 1DY3A 3T6JA 2I38A 2W25A 3FBEA 5C42B 1N5YA 4B9TA 4DR6J 3H7HB 5EUHA 2MZ1A 4A8MP 3HULA 2ZH1A 4EBEA 2BXJA 1RTZA 1NO8A 5C24B 2CQBA 3AY0A 2ALYB 2CJ9A 3OTDA 4UW2A 3Q0AA 1KQSR 3HT3A 1RBAA 1X4FA 2F1FA 4JBCA 3X3UA 4U6PA 2DK2A 3PW2A 3EGZA 4Q0BA 2IDLA 2MQ8A 4DOZA 1RWNB 1L3UA 4F0MA 3GILA 1ZYQA 4F3QA 4DSKA 1SIZA 3V6DA 4IRCA 4LUBA 1X9MA 4OZJA 5KT5A 1HMVA 2KN4A 5H9FK 5DLFA 1DTTB 2IVMA 3VQSA 1FJGF 4KIAA 5GAGU 4ZLLA 2A0FB 5FDLB 3TANA 1SQFA 3BDPA 4TQRA 4DSIA 2EEYA 5HJYA 2VG6A 5CQGA 1N32F 4UZBA 4DL3A 4MJKA 3OQ2A 1H2VZ 4R8UA 4YUDA 1MNEA 4FXVA 4PUOA 3C6TB 1RE1B 2K1RB 4O44B 3CCRS 5FDLA 2HQIA 2CNNB 2KJVA 5M2PA 1N54B 3NMRA 1VQ4S 3OR1B 3EE3A 3CC4S 3NNHA 4CO3A 3CVKA 2R7SA 1MSWD 4RU9A 3VAIA 1KN6A 2PC6A 2XMTA 4RUCA 1IKWB 3OFEA 3OHBA 4N76A 1TL1A 5LXRA 2OO4A 3C16B 2IC3B 4LF2A 1S12A 3M8SA 2PDAA 5B0GA 4K4ZA 1RT3B 4DLEA 4HR2A 4BBYA 1BGXT 2PSZA 2LQ9A 1G2EA 2J0XA 1U45A 4EFAC 4Q2LA 3JAMU 4JI6F 5EHHA 3CJRA 4RUAA 3AA8A 3RBEA 4M94A 4N7TA 1ZOTA 3Q2SC 4B02A 1RU2A 4DI6A 3WZ0A 4MKVA 5F3ZA 4EEYA 3TAMB 1SQEA 3IMQJ 1MLAA 1IKWA 1OQ6A 4H4KA 1Z4UA 1KDNA 2RH3A 1VLYA 1Q78A 1HNWF 2P9CA 2XWYA 5E2QA 3VZIA 1O6XA 1TQLA 4O0NA 4E8UA 1RA7A 5KG0A 2DO4A 4P6QA 3KHHA 2VONA 4JP8A 5EX0A 2POKA 5F9LA 2X1FA 3QSYB 4J9KA 3RTVA 4V19X 2HRYA 2F8MA 2DIUA 4OYWA 3M8PA 4NI2B 1N0UA 2E9ZA 4GKJF 3W2WA 1JIHA 3H42A 3I4PA 4XK8C 4ZDNA 5ITHA 2GA7A 4DQIA 2GGPB 4WP3A 2YKMA 3BSAA 3O3LA 5F8HA 5HP1A 4JI5J 2OLWA 3DRSB 4LREA 1PYOB 3Q89A 1JNRB 2CNOB 2IMWP 2F4VJ 3FZBA 3ILLA 4RZRA 3QZ7A 2CXEA 4E0DA 4NLRA 2XZTB 3UCGA 4R0JA 3D5MA 4USUA 1LKZA 1CULB 1YLXA 5KT4A 3MFIA 2QMUB 2J0QD 2DRAA 2V9KA 4WCEQ 4DBQA 1OO0B 4U95A 2VG5A 2XMWA 9RUBA 2OPSB 4DV1J 1L5UA 2QRRA 3H5UA 1TL3B 4MYUA 3T6BA 1TKTB 5EWFA 4IOCQ 1ZETA 2GQ2A 1U1RA 1LWFA 1NXIA 1YJ7A 2CQHA 3LTOA 4X65F 5HVGA 4ECRA 3SQGA 3OTOF 4C8MA 5THWA 1H0HB 1J5EF 2DD8S 1D3WA 2PN6A 1RAHB 3MCMA 2KTQA 5A8KA 2C2RA 1UP1A 3TAMA 4MTPA 1J2VA 1FXDA 4HI1A 1UEKA 1AFJA 1SJ1A 4YHHF 4QYZJ 2ZH3A 1YQHA 4Z2XA 2V5HG 5GVQA 5A6PA 1C1BB 3HD2A 4LVNP 1EIYB 1KFSA 4NZ0A 4DR3F 1WG1A 2C3PA 4KHRA 4O4GB 5AXKA 3D28A 2OFHX 1BC6A 3PM9A 3OL9A 2WONA 3AB4B 4RW8A 2H51B 3EXCX 4LRCA 1WTBA 2H5EA 3AAWB 2AV5A 4ZJOA 4A8QA 2AKWB 3G82A 3L09A 2FD2A 3KG0A 4WFNQ 2R8IA 1UL3A 3ET6A 1B3TA 2HSEB 3C6UB 1KLMA 1FK9A 3IO1A 1G6BA 4YB6A 1KTVA 4CTAA 6FDRA 1L3TA 1RT1B 4X4NA 1G3OA 1VISA 5BJRA 4R8UB 2KVQE 1HWIA 1M0SA 3BYPA 2O1PA 5B7WA 4WFAQ 1MN7A 4B9LA 3QJJA 4FYVB 4RNHA 2AEJA 3ET6B 4M5KA 2NXUA 3W9JA 4X64J 1XTZA 1SL2A 1CVJA 2HBRB 4IH5A 3NAIA 1NM2A 2CDRB 1DTTA 3SSRA 3ZTSA 4C0OC 3BO2A 2V68A 2Y1LB 3OHAA 1Y11A 4TY9A 5LJ3Y 1TZ0A 2HLUA 2QV6A 1VRTA 3GTYX 3P45B 3WX8A 2MKJA 1N0VC 4PWDB 1B70B 1LW0B 2WVFA 1QE1A 2HS4A 4LR8A 3Q24A 2C28A 2ZWPA 2BM0A 4F3OA 3H5XA 2L08A 1SJFA 1JLGA 2ZBPA 3HK2A 3EM1A 1R6YA 1O8BA 3EJMA 3DN9A 4N77A 1U2FA 3U1MA 5T41A 1OPIA 5HAOA 1UWBB 4M95A 5L1JA 2HFSA 4F3MA 2GIRA 1QSYA 3E2EA 1KTQA 4DV0F 2E44A 2F9JA 6FD1A 1L3VA 1MMDA 4XPCA 3CEDA 2CPXA 5K20B 3SDEA 1C0UB 1LV5A 3TJAA 1U1PA 1RWVB 1UWBA 4B3SF 1PYSB 2GQCA 4NX9A 1HI8A 2DB1A 2YWGA 4B3TJ 1CPZA 5ETTA 1R89A 1VRQC 3HHLA 1RCXB 3KG1A 3ZC4A 4ANCA 5IV3A 3K5OA 1RT4A 3MPYA 4V1Ak 5F8JA 1K47A 2BJEA 3DXSX 5B09A 3SCJE 5CD4H 2HWTA 4AXIA 4WP9A 3DLGB 1IWAA 3M6XA 3MEDB 4ZVSB 2EFQA 4H4MA 2JRSA 3TA2A 5F8GA 4K4UA 1I6JA 1QVFR 3DRPA 4C8KA 2AYMA 2ZOFA 3CCZA 3FVYA 2B6AB 3H59A 4QWEA 3Q8SB 1T03B 4KC5A 1HNZF 7FD1A 2E9TA 5H9EK 2XMUA 2QJ3A 2V9WA 4O3RA 1ZPVA 3LALA 4JB8B 1LWEA 4DPTA 5FD1A 3BSNA 1VQMS 3ILJA 4L72B 1GX5A 2X51A 5CYJA 4PG6A 1RTHB 2GJ2A 1EETA 2HURA 2APOA 2FB0A 1BQMB 2HFUA 3HKWA 3TNVA 2GIQA 3Q86A 2XGPA 4J9LA 3GV5B 3TO8A 4YP3A 2WONB 1QAJA 2OP5A 2YKOA 2YNFA 2ADBA 4P73A 3ILIA 2WK4A 3Q22A 1IBMF 4X4SA 1GFWB 1C1BA 4NMLA 2ZC3A 4OI6A 3IP0A 2DNPA 2HZCA 2V4JA 3LPEA 2MQOA 5C2GA 2DHGA 3ZTOA 2Y1JA 4J9MA 2F7VA 4L6V3 4J9OA 2OTJS 1CC7A 1Q79A 1TL7A 3J7ZT 3OLBA 4DCPB 3A3NB 4PYDA 5T7LA 5L9NA 4XPEA 2FLOA 3AJDA 5CZVA 4YMEA 4ER8A 1KHWA 3G6XA 1QSLA 1CJKA 2PT0A 1FEHA 1PJ7A 5AJ3J 2X1AA 1PYTA 3WIUA 5LMNJ 1XMOF 2MY8A 5B0AA 3VAKA 3PW4A 2JFDA 2EG1A 3MEEB 4K2JA 3HFVA 4B08A 4LF5F 1YTYA 1QAYA 3AA9A 4OYPA 5AXNA 2W1BA 2W9BA 3GFZA 2ROGA 4DR5J 3DC2A 3PKYA 1Y5NB 3HSJA 2UXBJ 3R2CJ 2ZM6J 1DZ5A 4I1TA 5RUBA 2H1YA 4ZVRB 2I8EA 1AUSL 4B3RF 4HHJA 3M4XA 2CQ0A 4P7TA 4TU7A 4DL7A 1JX4A 3NMAA 4KGXB 3W9IA 4J9PA 2PI5A 1XNRF 4DWIA 2ZZTA 5D4NA 2YH0A 3S6EA 4O3OA 1M5SA 2ZH2A 2WOMB 1IKYA 2B56A 5HMYA 1T7PA 1U6BA 3N01A 4ID5B 1TUVA 5DRKA 5KFYA 3QSIA 4J9VA 2VFTA 1O5JA 1RABB 2VFSA 3EICA 4G1QB 3EX7B 3SZ2A 2G9OA 2MLZA 3MR2A 2GVZB 1HIYA 3KUHA 4ZP6A 2VQEJ 1R31A 3I9V9 4PR6A 1FNMA 5J1EA 4K4XA 4N8OA 4ZCMA 3HP6A 1T94A 3FDSA 4J5OA 3BO4A 1NMEB 1WKLA 2ZD1B 2ZKUA 2KO1A 3QFHA 4NLVA 4RW6A 4EU0A 2N7CA 2W9AA 2DR9A 2HYIB 3DLLQ 1H2UX 4MKYA 4R0EA 2KFYA 2ZUAA 4ED6A 2C3MA 1HFEL 1YKWA 3CJ4A 4URSA 4H4OB 1X8DA 2DGWA 2FTRA 1R7IA 3I31A 4ZVFA 4F4XA 3V81B 1HI0P 3BQ0A 4CH1A 1T9UA 1RT3A 5BYRA 4OZ3A 2CJQA 2IC3A 4I64A 2QA4S 1CJUB 3BGLA 1BMQB 1JXLA 1U1OA 5IT9Y 4Y2CA 2YQ3A 3TJ8A 2XYHB 3P6YC 1RT2B 2KDOA 4RX6A 1KHVA 3ENWA 4HDHA 1RTIA 1F2HA 4PXEA 4FF2A 5DDQC 3H2LA 3CCSS 2W2QP 3KK2B 1BLUA 2Y1RI 1Q81T 4LF6J 1UVJA 3N6LA 1TL5A 2ZH8A 4LF6F 1ZA2B 3J81j 4DR1F 3DLEA 4OJGA 4LSLB 4KO0A 1GTEA 3DOKB 3WX4A 3DHWC 2VICA 4ZS6A 1KD1T 2HK2A 2PIIA 3MXHP 1S9GA 2W4DA 3JTNA 4CO4A 5GAEI 4M8LA 5EWGA 3HI9A 4J90A 3T1YF 1ITPA 2BDPA 1HNIB 4G1QA 1WUUA 1UA0A 2E1AA 1SQGA 3OJUA 2Z2MA 1G7CB 3V5RA 4OYAA 2ZZMA 5IXUA 3M2VA 3UFCX 3ZNUA 3JYTB 1R0AA 3CMQA 1VOMA 2MKSA 2YNHB 2XLJA 2CZVC 1NEEA 1W25A 2NYIA 4OZ5A 4RW7B 4OI0A 3NS7B 4PEOA 6AT1B 3SIPB 2VD3A 2G0CA 1W26A 3AJ2A 1X4CA 2HVIA 2EC2A 5E0OA 1FDBA 3FFIB 1VMBA 3T19A 1UWAA 3EPGA 3HVWA 1LXNA 1KNZA 1SUQB 1HR0J 4ED2A 1IR0A 2EK1A 1QUVA 3CJTA 4UF4A 4JYAJ 1PILA 3PRVA 3FC9A 3OXLA 1P1LA 1A6LA 2YWFA 1FA0A 2AX1A 1SH2A 1WDDA 2Q6CA 3LW5C 2SXLA 3N4WA 5CYQA 3TUJC 2MY7A 3TVYA 2RU9A 5DQIA 2IHR1 2OSRA 4ZHRA 3UNGC 1VBYA 1PGZA 4LF7F 1CJTA 5I42A 2RQ4A 4P2XA 3UE2A 1HNVA 2W8LA 3GSDA 2B7BB 2XI2A 1M1HA 4YDXA 4DUTA 1PSDA 3BREA 1NBEB 1NK9A 1HW8A 4ETXA 4RR5A 4DR2F 1Q7YT 2UXCJ 3M6UA 4HHHA 4FP9A 5F3TA 4AUKA 4DV2F 3HDSA 1SJ4P 4NLGA 2CNKB 3O2IA 2KZMA 3T9NA 3KLFB 3N5FA 3W5YA 4CP5A 5K14B 3EPIA 4F4YA 2RAQA 2HVEA 1KSPA 2MMYA 2DIVA 2AZ3A 2GNKA 2GJIA 1VQ5S 3ZTRA 1TAQA 1M1GA 1S1VB 2V6AA 3CD5A 2GMHA 3DRRB 3PYGA 4TLQA 2YKNB 1NCLA 2WVEA 3FMBA 3M1VA 1CS4A 4ELVA 2RRAA 1VC0A 1N33F 4EI2A 3CJ3A 1REVB 4IKAA 4DQPA 1V9OA 3RAQA 4RW9A 3MAHA 2WHOA 3SCKE 1QAIA 4OJ1A 1UFKA 3TZWA 1WSRA 4DL4A 5A6WA 3K5NA 2IMOA 3RB4A 3O44A 3LGNA 3PW7A 1FRLA 4F7VA 4NLXA 2HNDA 2VA2A 3KHGA 3CDEA 3PIPQ 2EG2A 1X4HA 3P49B 4I6WA 3KLGA 2UXDJ 1WI8A 3J81Y 4PKDB 4DV0J 2FJBB 5B0DA 2UUBJ 1HI1A 2GV1A 2QG9B 1U8SA 3AOBA 3WBZA 1RHMB 3DI6B 2G2ZA 2GHPA 4OV1A 3PR4A 3W8GA 2YH1A 1IVZA 1TUWA 2YWKA 2CJBA 3MMAA 1QVGR 2ALZA 3MCNA 2XO7A 3UNYA 4RPFA 3PV8A 3AJ1A 1UMJA 2V34A 1Y5LB 2WW4A 3RRHA 4IQXA 4NMXA 3MM8B 3MOZA 5J2PB 1YJ9S 4EK2A 3QIDA 4DSLA 2C2MB 3BPSP 3OR2B 1YSJA 4LSNA 4LFAF 1CQMA 3LH2S 2DNLA 1EHWA 3D6TB 3TWZA 4QWAA 3CCJS 2J6TA 4KGVB 2D3UA 2JVRA 2KB2A 2A18A 3C14B 5GMDA 5LMNF 2ZVSA 1NPKA 3GE9A 4KHMA 4KSEB 5KG7A 4PQUB 5HANA 3OW2R 1LOUA 1VQ9S 3BSCA 1O51A 2MKIA 1N6QB 2HVHA 1QTMA 4KKOA 2LA4A 1HQEB 3BKTA 4MYTA 3EZ5A 4F50A 3LPYA 3S01A 1U0HB 3VAFA 3JTPA 3MOJB 1P9YA 2DH9A 2WSEC 1YJWS 5HN0A 5CXTA 2OD6A 2UUAJ 3DRXA 3L9ZA 1F5BA 2XMAA 5KTQA 1HNXJ 1HARA 1B0PA 1BD6A 5D0HA 4QWBA 2GJFA 3VAJA 2BZ2A 1RDRA 2KYXA 3DMJA 4I2QA 2E1MC 5E3RA 2QN6B 4OX7A 1KOHA 3D54A 3OVSA 2DBBA 4LRAA 3VVUA 1RAFB 4A8KA 3BR9A 2HHHF 1NK0A 5ETPA 3E01B 4DXLA 2FZCB 1CC8A 4KY3A 1X31C 1EARA 3H2UB 4M5DB 2OH2A 3UPFA 3OL7A 2XNQA 4K50A 3UN2A 2HHVA 4O4RA 3UI3A 2XWXA 1LFPA 1ULRA 1NPPA 4G3IA 1AB8A 1ZBTA 1Q4RA 3HF5A 3H8YA 2LKZA 3FUYA 1SV5B 4CH0S 2KM8C 1IBLF 3DM2B 1ZAWA 1RT1A 3MMCB 1HKAA 1P6TA 3DXBA 1F9FA 3DYAA 3H2VE 4YR2A 1WELA 3CF5Q 4JUZA 4ES3A 4JI2J 5GADU 1J27A 1BQXA 4QIFA 1KC8T 3GYGA 3OL8A 3CCQS 2NXNA 4B3OA 1XMQF 1DFDA 1RTJB 2VOOA 2P2CB 4KH0B 4A8XA 4W92B 3J7A1 4CNYA 2WW8A 2OEMA 4OYOA 2Q79A 3VTIA 3FEYB 4A47A 3KXDA 3TZZA 3DGPB 3D2WA 4ECXA 3ETMA 1KQFB 4N56A 2HFOA 2LEAA 1PBUA 2FGCA 1Y5IB 2I1RA 3F41A 4HL9A 1X0FA 1TFYA 3OFHA 4R5PA 1M1KT 4B9NA 4ED5A 2JEIA 3PEHA 2DGTA 3MECB 3NRBA 2E1RA 5E3AA 2BOPA 1F5CA 3LP0A 1YBTA 4OIXA 2Z56B 2I5JA 5KFOA 1L3SA 3NLCA 4IRDA 4I69A 3IAM9 5ADZA 2HIYA 3GJQB 2CADA 2Q1LA 1RWUA 5JVGQ 2VDIA 4IFYB 3D9BA 5F8NA 3I32A 1VDHA 5IV4A 3VAMA 2MSSA 2J9EA 5IC4B 5H9EJ 1IBKJ 1S6PA 5KFCA 3CE8A 3CTRA 4FYXB 4FYDA 3UR0A 2AYGA 1BQNB 4F2SA 5I4MA 1NSAA 4ANEA 4CYUB 3A12A 4IG0B 4HT5A 3QO9B 3SSSA 2VKRA 5KFEA 4P2SA 4WE1B 4RL1A 3VV2B 4F36A 2FHJA 4LIWA 5KFQA 4DL5A 2DYAA 2OSQA 2YNIB 2AEMA 3OT9A 4KH1B 4MFBB 2IM2A 2DNNA 2M70A 3QATA 4WXOA 3W2WB 2EVZA 4PRFA 3QIPA 4PQUA 3MMBA 1K1SA 1VRUB 2AF6A 2R2UA 3V6HA 1V6HA 5A76A 1ZA1B 5H1SV 2MGZB 1PO6A 2JLEA 3NBPB 3M05A 1WHVA 2DNKA 3MUMP 2RT3A 2ZBIA 4JOUA 2UXCF 1SH3A 4JV2A 4XTTA 1TVRA 3K8WA 3HSZA 1S6QB 4GMKA 1UAWA 5G4DA 2KT3A 2LXIA 4Q5VA 4Y65A 1M90T 1S6OA 4RLEA 3PX4A 4A8OA 3M32B 4LFCJ 3IGVA 2XMKA 4YB7A 1FDAA 5DJBA 5HROB 5K8PA 2HK3A 3BGFA 1JLCA 5AXMA 3KLHB 1URNA 2BM1A 1JLBB 2LA6A 2FDNA 2GO9A 4CLPA 2W9CA 4OX9J 3CJ8A 3QO9A 1HBOB 4CLWA 4RW7A 4NA3A 3N5BA 2RMLA 2B51A 2GMJA 4HTIA 2XNRA 4LBHA 5E3PA 3KLGB 2RIJA 2GCFA 3VR1A 3A8JA 3MTKA 4NOHA 5D4PA 2DNMA 3KJVA 4ILRA 3MM7B 1NJIT 4UQGA 3IRXA 2CJAA 3C16A 1P1TA 2FVSA 4X4QA 1S79A 3J7YI 2VJVA 2ASYA 5EDWA 1NJYA 3KLEA 2RB7A 2BR0A 1F0XA 2DNGA 1C4CA 3GIMA 1VQ6S 2YKAA 8AT1B 4X65J 1DJ0A 5LMUF 4YOEA 1MWQA 3JB9k 4I68A 4WYLA 4KO0B 4Y34A 3KJFB 5L46A 1TP7A 2RF2B 1WACA 2LQBA 4KE5A 5F0UA 3GYNA 1BHNA 1SC3B 4CI0B 5KFGA 2VPXB 1S1XA 1LWXA 2ZC4A 3FMWA 3J80Y 4AQYJ 2V8VA 2BQ3A 3T9ZA 3MUVP 1U49A 1RYSA 4USJC 4JV1A 2NR0A 1RADB 2R4FA 4F2RA 1HMVB 4CM2A 3JQJA 5AT1B 1T11A 3MEKA 4JI8F 5J1PA 1YITS 1VI7A 1CJUA 2MLXA 2GZOA 2W8KA 3LWMA 4JI7F 3MCSA 1RT4B 5HQ8A 3E51A 2R7OA 1FWPA 5KOWA 1RAIB 2ZHAA 3CUNA 2ZNZA 3V81A 2RU3A 4M5JA 4GKKJ 5KFVA 3ITHA 3G8QA 4UY85 4IOAQ 3B54A 2IA6A 1Q8LA 1FDNA 1TVRB 2DGUA 3HHDA 4S0MA 1NK4A 1OY9A 1CJTB 2VBXA 3HFKA 4OX6A 3CJ5A 4TNOA 4AYBD 4CO0A 3I0RA 4I7FA 3HCXA 3FEXB 2DHAA 1TTHB 1VQSA 2EBEA 4RJVA 3UDCA 3SMZA 4BHQA 4QU7A 1AT1B 5KFKA 4P75A 3B4DA 1HWUA 4DV6J 5C5JA 2HQ3A 5KFLA 3W9HA 4DN9A 1XR5A 2BVZA 3MD3A 4P2MA 1KVJA 1N5YB 2JEFA 3MD1A 4ZPAA 2ZITA 4RKUC 4M5HA 3I96A 4L73A 2JEGA 1UZDA 2YNIA 1GQEA 1WEYA 2LQ5A 5A0YA 5DDPC 2CIMA 5IT4A 2D9PA 4CO5A 3DU6A 4I6AA 1RT6B 4Y0FA 4CYUA 4EGLA 2ZNYA 4NA2A 3R5BA 2AJ0A 2W2NP 3AT1B 3GG1A 5D6GA 5DGBA 5A2QY 2KXHA 4L75A 3LGMA 2V2ZA 3AXKA 3B78A 1T8EA 2FVQA 4W90B 3U27A 4RNNA 3ZO7A 3HPOA 4WIQA 3IRWP 1S10A 5DO2A 4DF4A 1FRJA 1LWCB 1X4EA 3PR5B 2U1AA 2M52A 2XS2A 4X84A 1S9GB 1ZZFA 1W2IA 1PC5A 3K57A 1FRKA 2ACMA 2CPYA 3DNCA 4FVCA 1HWLA 4HT7A 1UKUA 4KPCA 1N8RT 4UY8T 2V67A 1FX4A 4IO9Q 2QFIA 2QYGA 3FRYA 4IG3B 3D6MB 4NLQA 3MM8A 4NLPA 2UUWA 3MM6A 4TY8A 2V4RA 1F5AA 4QR2A 3CXCR 4F4ZA 3PCOB 4CLUA 1SCJB 4OFZA 4DQQA 4RO0A 4OHZA 5DGAA 2BACA 3M30B 2AJFE 2Z2LA 3G82B 3R1HA 2V94A 1IKXB 3FBBA 3FCHA 4I56A 2EBGA 2PMHA 4A8YA 2ATLA 2QYCA 1M5KC 3D0IE 1C2PA 1FEEA 2E1PA 4RW8B 4ED4A 1WJ9A 1RTJA 5FLXY 5FLXU 4WTOB 4MIWA 1DHMA 2CQ1A 5GAGI 5KG1A 3L3CA 5A8WB 2XHWA 5F8IA 2MPUA 2E9RX 2YNGB 2UXBF 1NUEA 5J2QB 1JQGA 4NLUA 5MLCV 1FKAF 1MROA 3MM9B 3SV3A 2FHOB 4RBVA 1YK9A 3C15B 2FJDB 2KJWA 3DGVA 4UQTA 3UQSA 3GIKA 2DRDA 2F8EX 4WK3A 1H38A 2BJ7A 4WZMA 4B9SA 1WDTA 5HI7A 3OTBA 3MMJA 2LEBA 5KT7A 4KPYA 2V8PA 1HW9A 2OHDA 4FDFA 3M9NB 1AFIA 4ZCKA 2ASLA 2WTFA 4ETZA 3E01A 4ZIVA 3KYLA 4B3MJ 1XK8A 2RD5C 4CO1A 2HWHA 1EP4B 2MKCA 4O23A 4OI2A 4QPTA 5EX3A 2KG1A 3G4SS 2HMIA 2LU2A 2QTWA 3W5ZA 3N0VA 2KT2A 1OYEA 2XMVA 1RU1A 2DXDA 5BR8F 4YFUA 2HHSA 4LFBJ 1PCAA 1VK8A 2B6AA 1VBXA 1T03A 4IH7A 4LRFA 4ZPCA 2N3LA 3ZZOA 3DRPB 3KLFA 1VBKA 1OSCA 2IM1A 1NK6A 3TEGA 4DZ6A 4GC6A 4B17A 1TKDA 2FGOA 2DH7A 3O8WA 3D4JA 2BX6A 1S97A 1KOOA 3WC0A 3S8SA 2V2KA 5KG2A 2XQCA 4P2FA 4KGKA 2MHNA 2DR5A 4JI2F 4DX8H 1U02A 2OMOA 2VQEF 2QLJB 2QMWA 1RTDB 3FSIA 1OIAA 4ANDA 2KVIA 1RJJA 2QLFB 2Z4PA 3MF5A 2DGOA 5DS7A 4N47A 2FIUA 1D8YA 4LIRA 4RWWA 4USTA 4ED7A 2IBKA 4B9UA 3CD6S 2DNOA 4ZCLA 3R7SB 2XS7A 5D8HB 4ED0A 5CYQB 2NPFA 5D0RA 4ZP8A 4C11A 2VL1A 5BXIA 2F40A 2DJWA 1RYRA 2CQDA 4FKYA 3T5KA 5D3GB 1DQ8A 2W4CA 3UD3P 1CJKB 4WKRA 4JI3J 2C3YA 2XZDB 1GAOA 3EVMA 4FZVA 1F6TA 1HBUB 2EPIA 3DLBA 5ETVA 2HBQB 4NXMJ 1TK8A 4KHPJ 4J37A 2ZM6F 4J9NA 1NJZA 2XSFA 3TAPA 4PXBA 4M5NA 4KHPF 5IQQA 2CJXB 3W63A 4ED8A 2VG7A 2JLGA 2XO6A 3DRYA 5EGYA 4PYAA 1W7WA 1MW7A 2MQLA 5F8LA 3U1LA 2L9DA 2CUYA 4IR1A 3BGOP 1FO1A 1H74A 4CIOA 2F4FA 3PDNA 4QJVA 2AQ4A 4I67A 3FQLA 1KBRA 4QIVA 3FKBA 3AOAA 5JJBA 3K8VA 5LT5A 3BM7A 2E29A 3NGRA 4NLOA 1U24A 1KEKA 3ZXWA 3NWGA 5DDOC 4IFYA 1U1NA 3D3CJ 1IQZA 1SL0A 2WB1D 1NDPA 1REVA 2CJYB 4X66J 3CCMS 2KRBA 1V3ZA 3OVBA 3GMGA 2EFPA 2I5JB 3G9CA 3CCLS 4O3NA 4EYIB 4ZVQB 1F60B 1S1VA 1VCTA 2D9OA 2KHDA 3CO0P 3DRRA 4ZP7A 3M9OB 2VB6A 4KQZA 5IM0A 1FKOA 3M9MB 3JXOA 1R0BG 2K06A 3OD2A 5HQMA 2XTJP 2N4DA 2BMBA 1FJ7A 2AYBA 4JI7J 2V8DA 2AW0A 3AXMA 1NK8A 1XMBA 2WVBA 2BABA 3CO9A 2HIQA 3I9ZA 3ISNC 3P3DA 2CRLA 4QBUA 3M2RB 3JAMY 5J2MB 3K89A 2AJ4A 3HHKA 5GMEA 3I56S 4HEA9 2CAJA 3T3FA 2BJ1A 4C2MA 2HZVA 1HQUA 5D4LA 1QY7A 3ISND 4Q45A 4RW6B 3K17A 2OPPB 1UEUA 2DVIA 4DV7J 3R5JB 5SZTA 4DEZA 1SV5A 3FSYA 3NG8A 3R3TA 2UU9F 2DNRA 3CDBA 2JX2A 4RBTA 4WZQA 4B3MF 2XB2D 3C19A 4NLTA 3SQGB 1LWCA 2IAJB 2RILA 3QT8A 2R2RA 1S9EB 2DXFA 4M5DA 1N32J 1RBOB 3MEGA 3RB3A 3PG9A 2BQUA 5F41A 3I4HX 4ID5A 5ETKA 3NWRA 3EUNA 2XM3A 3HFZB 1WEZA 4YS2A 3ZTPA 2WAQD 2ZOGA 2QLXA 2CZ9A 2KKHA 2QIFA 4TN2A 4M63A 1UFLA 1HLWA 4PG7A 1UEVA 1DBDA 2BW2A 2J6SA 2MKHA 3PXGa 2Q6BA 1T9VA 5B0FA 5HP1B 2PEHA 2DNHA 4ZCIA 2V2VA 3FCVA 3NAHA 1LQ9A 2ZH9A 2CPDA 2ZJRQ 5CA5A 5M2RA 1Q53A 2HQDA 1J5OA 4J9UE 4UOGA 4V19J 2HW3A 2G2YA 4YHHJ 3TUIC 1SL1A 1RGVA 2O66A 2R3VA 3M8PB 4NI2A 1H6KX 4DPYA 1W2BR 4E98A 1TK0A 4NYZA 2W9BB 2ADCA 2NPIA 3I0SB 1FFWB 3AFGA 4ZLJA 4A48A 2VFUA 1F3VA 4F8RA 3MEEA 2HBYB 2HQCA 1IBMJ 2OELA 4DR6F 2BKOA 4HH1A 1FWLA 2OFGX 3TARA 2XYGB 2WBRA 2XEXA 1FK9B 2PGCA 1SKSA 3C6UA 3Q8PB 1VHFA 4FVMA 2Z2YB 2O5DA 4U96A 5GAEU 4GKKF 3BF4A 1I5OB 2DHSA 1ZM3A 1TKZB 2OMLA 1UFWA 4WJBA 4JI5F 2EWHA 2G0IA 2W7OA 3MPWA 1RP5A 2ZE2B 2W2PP 4LR9A 2QO3A 1NDCA 3P4UB 4PQAA 4CM0A 3BGUA 5CHCB 3MAAA 4DV4J 1FRMA 3EDRB 2IYIA 3J81U 2GIFA 2E5IA 1EAYC 2MKKA 2MQNA 1G1XA 2GAGC 1MN9A 3IM9A 3MAAB 1JLAB 2WZ1A 2HNDB 2HFNA 1BUXA 1S72S 2V2QA 2MZSA 3CNQP 4DL2A 2B43A 3PYEA 2E5LF 1KRPA 4ECWA 3DOLB 4USMA 2OPQB 1TKZA 4EZ6A 1FF2A 2UUTA 2Y0SD 1F3FA 4QIEA 5KFRA 1XN9A 3J7Z5 2FJEB 2MJUA 3Q8YA 3UW1A 5CCMA 2YTCA 3GFHA 3MR5A 4TQSA 2E1CA 2R7XA 1JKHB 1CBKA 5JVHQ 5FIIA 2AJ1A 4O44A 1H98A 4K2XA 2P9GA 1CS4B 2OPSA 4Z7CA 2VHGA 5L1IA 2R7TA 2W24A 2M2BA 4ZN1A 1HYSB 1IKYB 1ZM2A 2P5VA 2VG6B 4YY3J 1PAUB 1VQ7S 8RUCA 4P7VA 4C8NA 4PWWA 5K14A 4UZCA 1VK3A 4GVBB 1U8WA 4URGA 1GMVA 3MDFA 4N8NA 3TVKA 1JLCB 1NDKA 5HBMB 1TR0A 3KLHA 1J5OB 4AL6A 1RXOB 1OS5A 1FXLA 3LF0A 4MK7A 4MK9A 2DHHA 1SKWA 3GJTB 4L3KA 2M0GB 4DFMA 2H5IB 2M3DA 4N41A 2Z8QA 4IDKA 2JLFA 2Z57B 3CCWA 3CCTA 4Q43A 4IFVB 2UVRA 2G13A 4OI1A 3V6KA 1ICEB 1T95A 1FJCA 3W64A 2JOQA 3UO0A 1Y3JA 3R1LA 1IBLJ 2XMMA 2FJVA 2IYGA 5A8KB 5HQLA 4ENOA 3NBPA 1PG5B 2XULA 2VDHA 2ZJPQ 4NCAA 4LBIA 4RW4A 4ZVEA 2CG4A 1JKHA 1UJ5A 2J7WA 4RUBA 3SDEB 3KHLA 2IAJA 1WOSA 3QIPB 5GAHU 3UCUP 2BANB 2DPIA 5E7OB 2CKWA 1I1GA 5DG8A 2GQQA 2IJFA 3DOMA 2YQ0A 1D1UA 1H2TZ 2I2YA 3V4MA 3P8BB 4FBTA 3FNNA 4ECUA 3BN7A 3QYYA 1HNZJ 1YIJS 3HVTA 1WKJA 2MTLA 4DHVA 2PA3A 2W4PA 3UWTA 1A9NB 3TUPA 4N5SA 2R2TA 2IRUA 4PWDA 1UVNA 2VC0A 5EN1A 3AD9C 5LSLA 3PJ9A 1AW0A 3PFEA 2A1BA 4DSFA 2CG8A 3H4BA 4TU8A 4HACA 5DZ7A 5B0CA 4USKA 4DU7A 1PAEX 4ECTA 4MK8A 1KONA 4D3HA 3R27A 3T1HF 3ELHA 2FLNA 1H7XA 2M9KA 2WVDA 2XSJA 3ZTQA 3POTB 5DQGA 2HLTA 3ENVA 3WC2A 2R7VA 4DR3J 3TEHB 3IM8A 4LSLA 1WC3A 2DO0A 1RCOB 4OI4A 3UR3C 2BKNA 4A46A 4XDCA 5HVHA 2R8HA 1UVIA 1NHKL 3AD8C 2BBEA 1NJWA 4ZVPB 1FD8A 5E3QA 3RAXA 2HNYB 2GVDB 3PW5A 3TZXA 2AT1B 2N82B 2ROEA 3G8TA 4HACB 5AE3A 2AMCB 2E7XA 3RR7A 3PKMA 2L9WA 1ZM4A 2WB4A 1R8PA 5C7PA 1RQ0A 1OQ3A 4ZPVR 1XMQJ 1DARA 2KYZA 4ITSA 1UVLA 3GB0A 4JYAF 1SB6A 3O5TB 4DQSA 3KUEA 3HHLB 4FYWB 3N9UC 3VGVA 4IUFA 1SH0A 1YZ6A 3GQCA 3C46A 4QYRA 4DJBA 5CYMA 4PXDA 2IJNA 3HM9A 4DQRA 1S7IA 4BCAA 3D1QA 5L39A 4K5RA 1NZ8A 4MT1A 2ZKTA 3VGUA 4F0KA 1FRXA 3US5A 4C7QA 2IRYA 4ZJQA 3H4DA 2BANA 2VU5A 1S7HA 1X5OA 2DY1A 1X9WA 4LBPA 5J1EB 4YB1P 3FRZA 3KK1B 4DL0C 3ZZUA 1S5ZA 4HI2A 5HLFB 2JHEA 2J9DA 2BRLA 2M5YA 2HHHJ 1T9WA 2HG4A 3CMAS 3RUBL 3DLHA 5KFAA 1VQ8S 1KVKA 3LQVA 3CCUS 2RNEA 2HHTA 5CYMB 5IOLA 1QLNA 4KV8A 4ICLA 3UDVA 2XMJA 3QGHA 3NKYA 1CG2A 1NPRA 4IDKB 3GYXB 4ZA1A 2QL7B 5KFMA 3ZZTA 4QW9A 1UJ6A 1V5IB 3CDUA 2GAHC 4LQ3A 3UD4P 4PXCA 2VQFF 4ZOSA 4I0WA 2RUGA 1WG4A 2YWHA 2H65B 3IWXA 3M2UB 3H25A 2XY7A 4WBFA 1BWVA 3QGPA 1WOOA 1U2RA 3C14A 1NK5A 2X7IA 3HHLC 3I6PA 4KT0C 1WG5A 4ZKAA 3AH6A 4KV8B 4C48A 4LVOP 3UN5A 1S0NA 1IJEB 1RWPB 5LL6d 4LFAJ 4FYYB 4LF7J 2K7KA 2QC3A 3LA0A 2OPRA 3IG1B 4IOBA 4EWTA 1D9FA 2HMIB 1RAAB 4OYXA 4Y2MA 4R25A 5CZXA 1FKPB 2ZH4A 1WC6A 1ZPWX 1P27B 1HR0F 1WC1A 5ETLA 2VIHA 1DQAA 3JQKA 1HWJA 1RLDA 1B4SA 2GC8A 4EBCA 2C3UA 2ATCB 3GSIA 3LAKA 2BE7D 2PFDA 3PEJA 1LXJA 1TL4A 3CW2C 3D66A 4OJ3A 5LM7E 2HEKA 2ZBQA 1WC5A 5LJ5Y 1GNKA 1U7LA 5K8NA 1E6VB 4DX7A 2AP6A 1TV6B 3SFGA 4K59A 2MQQA 2AGPA 4IR9A 5A8WA 4AL7A 1EB0A 2WSCC 3R6GB 1UCNA 4NRTA 4DL6A 3BJYA 3V4IB 1VYAA 2P6TA 1HD1A 2DITA 2MXYA 3IBWA 4K5SA 5KFDA 3RW6A 2YWWA 4F26A 4OYZA 4ZP9A 4DX5A 1TU0B 3B4MA 2DPJA 2F65A 1VIXA 1U1LA 3BQ2A 2E66A 4J91A 1VLOA 4DF8A 3R6LB 1Q16B 1D9AA 2HNYA 4G1IA 2CWKA 3EXYA 3HVRA 4DUYF 4DR7J 1JWWA 5HO4A 1LWEB 2ZHOA 5ETNA 3GIJA 1J5EJ 2YVSA 2XI3A 3AQPA 1R3NA 2KG0A 1JXEA 4F02A 1YJNS 4OHVA 1SIWB 2MZRA 4OLPA 4C0BA 1WF2A 4U67Q 4USIA 1JMTA 4A8WA 2UUCF 4DS5A 3KOAA 3MPVA 4JI6J 2XYPB 2XHCA 3ADAC 3CJQA 4FPRA 4MKBA 4LRDA 3SCLE 5CAAA 2YWEA 3VF0B 3F56A 3UCZP 1QAXA 1XNQF 4KJIA 4QYZK 2NQPA 1T3NA 3C8YA 3HZGA 2ZUGA 3FJ2A 1EZZB 3CIZA 1RA6A 5E5NA 3CJSA 1RHKB 2LDIA 4DU8A 5HSPA 2UXDF 1FVSA 3KDNA 1HYSA 4GO7X 2AD9A 1KQGB 2HGLA 1LK7A 2XS5A 3BB5A 3FEZA 3ILOA 1EP4A 2IVYA 3DOMB 3PHTA 2J0WA 2QZ8A 1D0EA 5EWEA 3RRGA 4HDGA 1C0UA 1KWMA 1R43A 2P9EA 4NLWA 2RHSB 3FGVA 3D1HA 3KK1A 3NGUA 2OPQA 3DOLA 1HBMB 1YZ7A 3CDWA 5KFPA 4NXNJ 3D6FB 4DR1J 3I0RB 4I7FB 1Y00A 2M7SA 1L3KA 2NS1B 3LUYA 1C0TA 1IBCB 4U7CA 1U1MA 5LMUJ 1QSSA 1EKRA 2D3OR 4FS2A 2HAFA 2E5LJ 3T5LA 2LYVA 1UJ4A 2LP4A 1Q7LB 4QR1A 5J2MA 2F8HA 1WC0A 3U02A 2G4BA 2E5HA 2ZH7A 4F04B 5IT9U 2DNYA 3PACA 7AT1B 3IBFB 3PX0A 4YR0A 1YGYA 2JWNA 2PFFB 5CCLA 3OTEA 4ILLA 4F4KA 2X1BA 5HBMA 4GVBA 2N3OA 5ETOA 5L1LA 3H98A 1SC4B 4ZVTB 2XLKA 2N7YA 3D67A 3HJFA 2RS2A 2K1RA 2HQFA 2NLWA 4PUOB 3TAQA 3CULA 2IPOB 2JSXA 1NRKA 3R2DJ 4ATNA 4ZLNA 2MZJA 1RAOA 1EJ7L 3IAS9 4Y2AA 1N5QA 3QT6A 1H3DA 2H9ZA 1UVMA 1QD1A 1B0TA 2EC0A 4X4VA 1KLNA 3C2PA 4WPAA 2QFJA 4WU2A 3MGJA 4DX6A 1V3SA 4ECQA 3H5YA 2HNZA 4NRUA 2LMIA 2W7AA 2GW8A 5K8MA 1Z2ZA 3D3BJ 3NGSA 5JMNA 4DS4A 3V6DB 1UA1A 2ABYA 2HKEA 3IRXB 4EUVA 3V4IA 4Q8EA 1WNEA 3D7SB 3IR5B 1B7FA 2PO4A 3MM7A 4WP8A 4X64F 3H40A 4OQJA 4KBIA 1E6VA 3CIMA 3GFXA 3RZAA 2B3TB 1YRUA 3ICLA 3TA1A 4D3GA 2X1GA 2EFOA 1IN0A 2BUNA 3K0JA 3DLKA 2L48A 4BC7A 4I6YA 1N33J 5C24A 3QMQA 1BY9A 1HBUA 1WD6A 3EZUA 4DV1F 1C4AA 2E5GA 4FN5A 1RWMB 1R8HA 1I51B 4OZ0A 4UOFA 4WTYA 4CDIA 3NXZA 5HMZA 3MFHA 1C1CA 4LF4J 4OI3A 1RAGB 1SC1B 3GIRA 3M8RA 1GXLA 2B4VA 3GONA 4ZVUB 3AODA 1LWFB 3VGTA 2B0GA 3DDNA 4C11B 1R8AA 4KAIA 4I2PA 1T02A 3Q23A 2WOMA 4OL8A 4NPOA 5LSRA 2J0SD 4F4WA 4OZ1A 5JXSA 3DDKA 4UOHA 3WHIA 2A6OA 3GV7B 4CLFA 4JI0F 3ITHB 2OKQA 3IS9A 3M2RA 3BH7B 3M2UA 5K9FA 2C1EB 3WIVA 3TX8A 2OJ3A 1VQYA 3DRSA 5IC6B 4DFJA 3N79A 1BE4A 1S9FA 2Y0BB 1S1UB 2B9WA 1FNOA 4TYAA 1S4FA 4WE1A 4ES1A 2YKPA 4KGZB 3PRDA 1SJ3P 1HHTP 4K4SA 2M88A 1S99A 2HZAA 1PIEA 4O3PA 3OLAA 5IM0B 4C4WA 2C2OB 2NZCA 1VC6A 2Z30B 3DU5A 2BA9A 2GS8A 3MM5B 5C25A 1VFJA 2H4WB 1F9EB 1NDLA 1RI7A 1JXVA 1MU2A 1GXUA 4E2FB 3VGSA 5DG9A 2RF2A 3AQOA 5KFTA 3F0NA 4QWCA 2QA4G 5HLFA 4QCLA 1YJTA 3QLHB 3QGIA 4EMDA 2JFKA 3LP2A 1MWYA 1X60A 3G86A 3Q8RB 2ASJA 4BS2A 3MTJA 2QA2A 4DR4F 2LECA 4JI8J 4J9RA 4NWBA 2W2MP 1YBUA 4USWA 2AX0A 3LP0B 1K0VA 1N5TA 2G1DA 5IS2A 2OPPA 1FRIA 1KKHA 2KXNB 4B3RJ 5KG5A 3EZOA 3N6NA 2LEPA 3B82A 5J2QA 4RUHA 1MG7A 2LCWA 1XEZA 2DR6A 2YNGA 3GJRB 2OAUA 5DZ6A 1D09B 3UDLA 5D77A 9ATCB 3HXMA 1Q82T 4FF1A 3RBXA 4DCOB 3TZYA 1Q5VA 4DFKA 3ONQA 3KMQA 1XNRJ 2F63A 1OSDA 4HKQA 2DR8A 2BE9B 1BQMA 3QRRA 2VOPA 5F8MA 3A3PB 1VBZA 2BV3A 3TUZC 2W7PA 4K4TA 4DR7F 1M5OC 5D3GA 4ZJLA 1S1WB 1VQPS 1U47A 1WOPA 1FKPA 3HZEA 3R9LA 3THVA 2FZGB 1ZTWA 4Y3CA 4DPOA 4DUZJ 5KAKA 2BEFA 4M1KA 1ZZNA 1R0CB 1VJQA 2KRRA 4QIGA 3I55S 3FCWA 2CJKA 1AZSB 1U2CA 4XIUA 1S59A 1V3RA 3SCIE 5KT6A 2HS0A 1YDLA 2C2ZB 3I0SA 3POTA 5U47A 1WORA 3CJKA 1UPMB 2MGZA 3EVWA 1S77D 2FUG9 2EFNA 4CLLA 2FZKB 4DCJB 3EYZA 4J9SA 1RTDA 4NCGB 2V8HA 1Y10A 3EMTA 2BE2A 5KG3A 2H4YB 1RWWB 4KR0B 3ENAA 2KXFA 4DG1B 1VQOS 4NLSA 1WF1A 4AL5A 2KFZA 1ZM9A 1OYDA 1DTQB 3U1NA 3SV4A 3ZZ0A 4K0KJ 3IBCB 4XAKA 3NGDA 1Q8IA 4NXMF 3IFEA 3HVTB 2CQ2A 4NLYA 4U8YA 1RT7A 4DFPA 3GJSB 4ZMMA 3D1OA 1UW9A 4CWBA 1DTQA 1CEZA 4NZ7A 1VHIA 3GCWP 4NZ6A 2CPEA 1IM4A 2NXEA 2FQQB 3I5CA 3K2YA 4OLOA 1YG0A 4Q44A 4KKOB 2C22A 2FVPA 1PC4A 3MEGB 4YB5A 2JEJA 3HD1A 2CPZA 2B4PA 1ZAXA 2HHQA 3BO3A 1HBNB 2B8PA 2CNLB 2FHJD 2HWIA 4RW4B 3CGIA 3M6VA 4AXJA 4YN3B 3EGNA 4WFXA 2Y8WA 3IWLA 1ZAVA 1RK8A 2CVIA 1M5HA 4K7QA 1QM9A 1R6VA 1NU4A 2DHXA 1RZMA 1Q5YA 1HHQA 2ILZA 1DLOB 3C15A 4IYQA 5D0EA 4C0HA 1RAJA 1EQMA 3QRQA 3KFWX 1YRXA 1TKXA 2EFVA 3DGPA 2RDJA 1FTRA 4CLKA 4ECYA 1VRTB 1SXLA 3V6JA 4PABA 4USHA 5IWAF 2MB0B 3QJPA 1ELOA 5HJXA 5KFHA 2FJXA 2VASA 3QAEA 5IWAJ 3PNIA 4QWDA 3ZNJ1 2JDJA 1IR2A 3OV7A 3M8QA 2GVDA 1KS2A 2DEJA 3UVJA 2KH9A 4HYKA 5J2PA 3DHXA 4OYMA 1Y0HA 3G2XA 1CSJA 3VVTA 3GV8B 5DG7A 1XWLA 2OGUA 3W66A 3KUGA
chains in the Genus database with same CATH topology
3RYLA 3OXFA 1YWXA 4O3SA 5G0RB 2UVUA 3JSMA 5AE1A 4Y6IA 5IT0A 3KLEB 2C42A 5I3UB 1X5PA 4YR3A 1LW2B 3AB2B 4EZ9A 4OMFG 4Y00A 3VAGA 2C2EA 3M1VB 1KQKA 2HRUA 2CQPA 2MSTA 4O4GA 4A8FA 3LP1B 2LLZA 5F9NA 1S48A 3MUTP 1FE0A 4G1PA 2O01C 3IA0A 5T14A 2C2DA 2Q3PA 1VQLS 2JL9A 3VCDA 5DLGA 4X4TA 3O1LA 1NH8A 1U6ZA 2ZE2A 3CWJA 1U25A 3C66A 2F9DA 2M8DB 2HHPA 1HPZA 1URRA 4WK1A 2FLLA 2VBYA 3PZPA 1SC6A 2VPYB 3MAQA 1TKTA 4OHWA 3RU0A 3T5HA 1JJ4A 4Y2KA 2CQ3A 4IG3A 2KM8B 4CQ1A 4NYOA 2DR7A 1IKVB 1X0PA 5B0EA 2EK6A 1D9DA 2KHCA 2UUAF 1RKJA 4WKYA 5KFWA 1GT8A 1H7WA 2XG8A 2V8GA 2EW9A 1JNZB 1WHWA 4LF8F 3I82A 3KK3B 2J6UA 4TYBA 3PJXA 3QAUA 3SYZA 3GG0A 1VGYA 2P6SA 3KG4A 4FF4A 2Y1IA 1MMNA 3V2UC 2XCPA 2HHUA 4QPXA 2LU1A 4UUWA 2RKIA 3TVZA 2GFFA 4HLBA 2VPZB 4KRWA 2ZOMA 1NKBA 2A2CA 2I9SA 2GX8A 2ZHBA 1RISA 5A0YB 2KI2A 2V4QA 2YX1A 1FVQA 4OX9F 2HAIA 3B8HA 4YQWA 3SI8A 2B5JA 1JLQB 2RQMA 2F4VF 3DOKA 1RT5A 3BGRA 4K0KF 2D3ZA 1BWEA 5J2NA 1JLAA 4RU2A 1HQUB 2GHWA 2C3OA 4BC9A 5IQ6A 2Q66A 2QSWA 4I4BA 2BJDA 2MHEA 1YJVA 1T05B 4XO0A 1VC5A 1U6FA 3QJLA 2W9CB 1X9SA 2NREA 2WCXA 4KB7A 1AUDA 1R8CA 2ACYA 2EKYA 4ZVGA 3GIIA 2DTJA 2CQIA 1FESA 2QMXA 4CT8A 1VQNS 1Q1KA 1JK9B 3G96A 3HHEA 4AQYF 2FVRA 2MDAA 3R5CA 4MAKA 1YHQS 3CPWR 2DT9A 3OR1A 3LANA 1N4LA 3CMES 1Q86T 3VQTA 2PE8A 2F3JA 4DQPA 1DLOA 2IFXA 2O67A 4C9DA 3KLIB 3GWCA 2EFGA 4GO5X 1X7VA 2ZBCA 2R7UA 5GMKa 3KNGA 2ZD1A 4PPZA 1FD2A 2LXUA 3PO4A 2HGMA 3W7BA 3CD0A 1NJXA 2I0XA 3H5SA 3KTQA 1S76D 2RE1A 4ALZA 4ELUA 2ZJQQ 1GX6A 3IN5A 2IRXA 4K4YA 2AGQA 4PG8A 3A1YG 4C8ZA 2Z0GA 2XGQA 4KGMA 1Z1ZA 1IJFB 3DMJB 5KFUA 1S1TB 1RT7B 4J9QA 2DNQA 2DGXA 3KJVB 3OVAA 2RKIB 2HGNA 3JSRA 4OZNA 3VWSA 4NYPA 4ECSA 3K59A 3K58A 2DISA 4Q0BB 2L9NA 2IBOA 1XR7A 2DGSA 1RT6A 1S6PB 4U7UK 1N34F 1S1TA 2FJWA 3MURP 1JLBA 1F2GA 4DV3F 2DGQA 4DV5F 1NNDA 2R2SA 1N6QA 3K5MA 2RRBA 4NCGA 1S9EA 3R5DA 5DM7Q 4WF9Q 2J8AA 5KG6A 5C42A 2UP1A 1Y9OA 1U09A 3L7OA 2KT5A 5KOXA 2B9XA 2XLIA 1YJRA 3ZZZA 5I3QA 3BS9A 4B9MA 3ISZA 3OUYA 3BSOA 2VBWA 2AGOA 4UUXA 5M2UA 2JJ4D 2M4MA 2DCLA 2QSFA 3G8SA 2CDQA 3JTOA 2MQMA 1FCAA 1JLFB 2JC0A 3TQ1A 1SJQA 5AE2A 3VALA 4JI4F 1WHXA 1S0VA 2COLA 4FXWA 1T05A 2L3MA 4RNMA 4ID8A 1X4DA 1FDDA 1HHSA 4LT6A 2CFXA 1LFWA 5J2NB 3D0GE 1D8ZA 2AJQA 3BEGB 4BDPA 4RW9B 5A8RB 5KFFA 3LP2B 2B5JB 3CB4A 2ZH5A 4CCHA 4LQ9A 2V0NA 4JV0A 1MU2B 1CQNA 1JJ2R 1WF0A 3OJSA 4DSJA 3THPA 2UV8A 4I2QB 3OFGA 4R5PB 7FDRA 3G6VA 2XY6A 2KFNA 4C98A 1JLEA 1S6UA 4WFBQ 2KZZA 3CD7A 2OIHA 3BN4A 3GFYA 4Y2IA 4F25A 2VG7B 5I3PA 1U26A 2MZQA 5KFSA 1NKEA 1XERA 2HPUA 2Q43A 3MHYA 2R8JA 5HROA 3NS6A 5K5MA 4HVZA 1IKXA 2VC1A 5L8RC 3H20A 3LAMA 3S7RA 2RQCA 3M32A 3K7RA 3W2VB 3MM6B 2OTLS 3DYAB 2CPJA 3I87A 3NNCA 1JJHA 4Q8FA 1SJRA 2QLWA 3S1TA 1K73T 2MQPA 1NB7A 1WTFA 1SUQA 1M5PC 3ZZPA 2IM3A 1IQTA 5KFIA 5HMXA 3F73A 4QIWD 1HWKA 4BWJA 1K9MT 2R8GA 2RRNA 2BYCA 4IRKA 2B4OA 4H54A 1Y7PA 4B9VA 1K0TA 1KR4A 2BRKA 2LDYA 5B08A 1WEXA 2JVOA 3JYTA 1R0AB 4C3KA 4B3TF 3MWBA 4EYHB 2DCUB 2UVWA 2PMZD 4DN0A 3BR8A 4OJHA 3G6ES 4UOCA 2CPIA 3O6QA 5IFMA 3Q8QB 4RBUA 2UUBF 3CULA 2ILYA 2HNZB 1TK5A 3W3SA 1LW2A 1RTHA 2YX7A 1YBAA 3TRGA 4TXSA 2OD4A 2DGVA 2FPHX 2JC1A 4DV4F 1M5VC 4GC7A 4TLRA 4QOTA 1N48A 4ILMA 1GTHA 3KWMA 1N5SA 2YY3A 1B0VA 4CTAB 3MZIA 2UV8G 5LXYA 2BQRA 4HTJA 4ZPTR 3PX6A 5IZHA 1P9QC 5KG4A 2UVVA 3RAMA 1S1WA 1X5SA 1X4BA 1Y4ZB 3QWUA 5BYQA 3KMSA 2O3DA 2NUUG 4F67A 5L9XA 1B64A 1JLFA 5JUMA 3F44A 1OWXA 1NAQA 2KU7A 4YEAA 3DFEA 1FXRA 3CDAA 2JZ5A 2NSCA 3M30A 4PG4A 3OUYB 1S1XB 3IR7B 1FNXH 4WIIA 3J7YU 2QA1A 4XDDA 4ZPDA 2J7UA 3NP5A 4TY8B 4DLGA 4LJMA 2ZFHA 4EO6A 3DM2A 3PO5A 3BGRB 1RT5B 2HVZA 1LK5A 2FHMA 1JLQA 4EBDA 3ZZRA 5K8OA 3HHLD 4OHXA 2VH7A 3U7JA 1FRHA 1YRTA 3P5TL 2K3KA 3FFIA 4A4JA 4O0IA 4KFBA 2MYFA 1SKRA 4AE5A 2MJNA 2ZH6A 2VFRA 4IO1A 3MM5A 5C25B 3KKFA 3OFFA 3RB6A 4X2BA 4QU6A 1FJEB 1FHTA 2K8GA 1HBOA 3M2VB 1QE1B 2R7QA 3VAHA 3QWPA 3IC1A 4MH8A 4OZLA 3KK3A 3NL0A 5J1NA 2BE2B 2FC9A 4DG1A 2ZZNA 2QEXS 4A8SA 1S6QA 5L1KA 1DRZA 1ZTTA 2RSQA 2NUHA 2D7SA 1N36F 3KLIA 1IXKA 3PJWA 1IBKF 4G6VB 3G6YA 1S0MA 4LMZA 1KLMB 3OTCA 1OPZA 1UVKA 3CC7S 1XR6A 3DLJA 3LWLA 4PPDA 1QVGR 4LFBF 4MMOA 3OSNA 4MFBA 1TAUA 3PW0A 3IR6B 2XBPA 4PWUA 2VA3A 4IG0A 3A8EA 3CC2S 4BWMA 3TR5A 3L95X 2YNHA 1ROFA 1MWZA 1Z2LA 4RNOA 1JB0C 4IH6A 3CCVS 4FNIA 4DUZF 2LQJA 2J7KA 2CZ4A 2NSBA 4EO8A 3ETOA 4KTQA 4FBUA 1TL1B 3HLUA 2IM0A 2ROPA 4U9RA 2K2PA 3TP2A 2AU0A 3Q2TC 4QR0A 3JSMB 3E8OA 5G0RA 5A8RA 2B9YA 4DDFA 2HFZA 4HH0A 4LFCF 2CPHA 3TI0A 1GXTA 3BDEA 3MECA 4DR5F 1R27B 2RJZA 4DV7F 2HHWA 4LF4F 2D1CA 4C8LA 4JI3F 5HL7Q 2JH3A 5GAHI 1RTIB 2UZAA 2D74B 4AFFA 1O0PA 3QJJA 2E5JA 2GO8A 3I5AA 4QZVB 5LSOA 1HD0A 5KT3A 2FY1A 4LF9F 2RQKA 3OBIA 1DURA 2GHVC 3NGKA 4RWXA 3SFUA 4Q2MA 3CCES 1TKXB 1APSA 4ED1A 2D41A 4Y28C 2IA0A 4NLDA 4H4OA 3TYTA 2XZWA 4Z37A 4NXNF 1VS3A 2RVJA 3IWNC 3IXQA 3CJ0A 3DCAA 2U2FA 3MI7X 4JI1F 2MZTA 3HMJG 3PIOQ 1ZH5A 1UW4A 3LOUA 4ES2A 5KFZA 2B4UA 1HBNA 4X66F 2XY5A 1HBMA 3AHPA 1VRUA 3MMBB 2E7WA 2ASDA 1C1CB 5KFJA 1HPZB 4WXWA 3GR0A 1RKIA 1Y3KA 2DH8A 3ZZYA 2FLPA 2VODA 3NNAA 4K4VA 1R8BA 3DLKB 3KHRA 1JLGB 1I94F 1QUPA 3SXLA 5L38A 1BQNA 5E41A 3LP1A 2ZDOA 1DAXA 3JSBA 2WBMA 3P96A 1K1QA 3MR3A 2LXFA 2FJAB 3D0HE 4KFBB 1HNIA 1GH8A 2CQGA 5KFNA 1EETB 2FHKA 5D4OA 2R7WA 4L3NA 3THTA 1S0OA 4WFYA 2FC8A 1FKOB 3X1LB 1X4AA 1QJHA 1NHVA 3C6TA 1AXQA 3OR2A 4LSNB 5D78A 5B0BA 2A3JA 3K5PA 3N6MA 1U48A 4NL5A 3MR6A 3L7PA 3KK2A 2WRMA 4DSEA 3G71S 4CNZA 4C8OA 3IGNA 1RT2A 1X4GA 2LVWA 3GR1A 4CT9A 5T7LB 3MEDA 3DI6A 4X4OA 1HL6A 1X5TA 1E6YA 3EGWB 2VPWB 5AXLA 4FNHA 3HX9A 3M6WA 3BQ1A 4B3OB 2RDIA 3PHEA 4TU9A 1CLFA 3RW7A 3GZ7A 1TV6A 3RBDA 3HVAA 1HNXF 1SBRA 3MMCA 2YX4A 4IQMA 3TOQA 2XCAA 3RRKA 1C0TB 2YNFB 2CPFA 1S49A 4O3QA 5MAOA 3SEOA 5KFXA 1NK7A 4FF3A 3OXGA 4CZCA 2WSFC 4CH7A 3QLHA 4WU3A 2A10A 1NZAA 2PD1A 1NH7A 1YVFA 2J76E 2GMLA 3PRBA 1N88A 4ED3A 2YKNA 3K5LA 4JV5F 1KFDA 2OPRB 3IG1A 3PVXA 1SI9A 4ZLPA 1U1QA 4X4PA 5DDRC 4IFVA 1KVIA 1A7GE 2VZ9A 5H9FJ 5F0WA 3HHNB 3HO1A 2VKZG 2YKMB 4X4RA 2K7JA 1YJUA 2GGPA 2UXCF 1MMLA 1M1KT 1FT8A 1HQEA 3DLGA 3R5AA 2PI4A 3ENQA 4URQU 4ERDA 1DQ9A 4OX8A 3FQKA 2J9CA 3I5BA 2HHXA 4CO2A 1HNVB 3NCPA 3CJKB 4ICLB 2VUGA 3LO3A 1N5VA 3T1AA 4YDDB 1XC9A 5E33A 4I2PB 2R8KA 3PY8A 1IKVA 1N52B 3WDOA 2CVEA 1WWHA 2RS8A 5FJ4A 3RR8A 4FXDA 4X4UA 2VV5A 2FVCA 3W2VA 2XC9A 4RNFA 1VJWA 4QQBA 3MMAB 1WI6A 4YY3F 3QZ8A 3NCRA 2AYEA 2YKQA 3QGGA 3OL6A 2EI5A 3CJ2A 1FTCA 4PG5A 3VZHA 3BZQA 3T5JA 1IUJA 2DRBA 1NHUA 2VBZA 3C3LA 5BYSA 5DM6Q 1NKCA 1N56A 1MROB 3MM9A 4MIBA 2V4JB 1JLEB 1Q8BA 4ZK7M 1LW0A 3PFOA 5SUHA 1U1KA 4X62F 1P8GA 4OHYA 3QPIA 3N28A 1T3OA 2N4CA 1E6YB 4ZPBA 5AJ3F 3GIJA 2CQCA 2IVFB 2B7CB 2J9DE 4C8YA 2QT7A 4WFZA 4PCQA 4NA1A 4ZVHA 2HS3A 1YI2S 5I3UA 2CQ4A 2M8HA 3DLEB 2R9LA 1TL3A 3TW0A 4ELTA 2VG5B 4FS1A 4C97A 5KFBA 4QW8A 2VFVA 5HMWA 3NCQA 1U4BA 1FERA 3CSKA 4ECZA 5E3CA 2R7RA 4ZPWR 2ERRA 4Q7AA 1WHYA 4DV6F 4H4KC 4DMZA 2XSJB 3HKZD 4C3MA 4K4WA 2X3GA 2QE5A 3FZ2A 3M8QB 5CH7B 1S1UA 2ZDPA 4H4MB 2A2DA 2K3IA 3TA0A 4C3LA 2CYYA 3FSXA 5KT2A 3JSYA 4MIAA 2L41A 3ULHA 3KLVA 3RB0A 3IS9B 5GADI 3KNAA 1FE4A 2J5AA 3ZFVA 3SSQA 3OPKA 1TFWA 1VIOA 1AROP 5I42B