2QILA

Toxic shock syndrome toxin-1 at 2.07 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title The refined crystal structure of toxic shock syndrome toxin-1 at 2.07 A resolution.
pubmed doi rcsb
molecule tags Staphylococcal enterotoxin
total genus 58
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qilA01
2ICIA 3MC0B 1JQYD 5D3IB 3DWPA 5ELCA 1T5XD 1AW7A 4Z9CB 1SEBD 1L0YB 3MFGA 1FNWA 5ELEA 5ELDA 1YN3A 4BWGB 3EFXD 3R2IA 2G9HD 2AQ2B 1FNVA 4RGMA 5TSSA 1I4PA 1D5XC 1LTBD 1I4XA 4TSSA 1SE3A 1LTSD 1S5FD 1JWMD 1BCPB 2SEBD 1LT3D 1RCVD 3GP7A 4UDUC 3SEBA 2J4XA 1EEID 1HXYD 1TS3A 1D5MC 1ET9A 1PRTF 1ET6A 3URYA 1TY2A 1PTOF 4L6TB 2QEJC 2IJ0A 1CHQD 2R61A 2XN9C 4L63B 1PZJD 1S5DD 2QILA 3KLSX 2XRQD 1V1PA 3O13A 1XXGA 1LTRD 1JWSD 1HQRD 1CQVA 1LTAD 1TS5A 2AQ3B 1AN8A 1QILA 3R2TA 5FKAC 1RD9D 1LO5D 2O2LD 1CK1A 1S5BD 1M4VA 5ELBA 1B44D 4OHJA 5I4DA 1GOZA 4NZLB 1FNUA 2CHBD 4RH6A 3CHBD 1TY0A 1BXTA 1L0XB 2TSSA 4RGNA 2RDGA 3DWQA 1RF2D 3TSSA 4DXFA 1EFID 3BVZA 1SE2A 1I4HA 3V05A 3BVGA 1PTOB 1PRTC 1DJRD 1KTKA 1PTOC 4RGOS 5FK9C 1FGBD 1PRTD 4K6LA 1BCPF 1LT6D 5ELFA 1PTOD 4DXGA 3DWAA 1HA5A 2XRSD 3R8BA 1SE4A 1RDPD 1EWCA 1LT5D 1PYWD 1STEA 4RHSA 1LTID 2NTTA 1I4QA 1PTOH 4RFBA 1G8ZD 1UUPA 1ESFA 1TS2A 1B1ZA 1LTGD 2NTSA 1EU3A 1JWUD 1LTTD 1PZKD 1FD7D 1I4RA 1V1OA 3BYTB 1S5CD 1LT4D 1CT1D 1D6EC 2XNAC 3W2DA 1DYQA 3EA6A 1XTCD 1PRTB 1MD2D 4RCOA 3BZDB 4RGTA 2WV6D 4ZYSA 1SBBB 3OWEB 1EU4A 1D5ZC 1KLGD 1YN4A 1SJHD 1YN5A 1I4GA 1SJED 1SXTA 3BVMA 1HTLD 4C56C 4RHRA 1BCPC 1EEFD 1CHPD 1JCKB 4O1NA 2RDHA 3BYYB 1TS4A 2Z8LA 1PZID 1F77A 1BCPD 2IPKD 2AQ1B 1V1PB 1UNSA 1JR0D 1S5ED 1LLRD 1ENFA 1KLUD 5D3DA
chains in the Genus database with same CATH superfamily
2KA7A 5ISRA 2FBWB 1E1OA 2LZ6A 1Q1BA 4UP9A 2C5LC 1T5XD 3L7ZC 3MXNA 1WE6A 3A4RA 1WTOA 2BBCA 3L10B 1L0YB 3MFGA 2ATWA 1IBMQ 1F9RA 1PHJA 3PO3B 1KAWA 3S2HH 3B1LX 4PZ6A 1RLFA 2UXCQ 1Q10A 3LYYA 2MSED 3AXCA 3OG5A 1N33Q 4IM0A 3M63B 1XPUA 4YL8A 1BO0A 2PPHA 3I91A 1N5XA 4A3EB 3IHPC 3CRKC 1LTBD 2DNCA 4IWPA 5KNCA 1FCCC 2K3UA 1BUVT 1Z5SB 3P42A 1T0SC 3PO3H 1HZ5A 2OJWA 2WLBA 1IBML 5IGFA 3UI2A 4HJAA 3CD6A 4DK0A 2UXCL 1HXYD 1TS3A 3D3RA 2F0OA 3FC4A 4BBRB 5CC4A 1N33L 3S17B 4XDCA 5L37A 2X6LA 2ZTEA 1DZ1A 2IJ0A 5DPRA 1EUVB 4ASWC 2R93G 4AWJA 3W3AA 2QIEB 2HD5B 4GNXC 1RODA 1U9RA 3KDFA 4WURA 3QOJA 2IO1B 2WB1G 4IQZA 4GOPA 4US8A 4NXNQ 2EYFA 4BBRH 3S17H 5G5GA 2A1AA 1KRHA 1L1OA 3ND9A 3R93A 1P9DU 4BBNF 4RKLA 4YWKA 4YY3L 2DWQA 3I73A 5I4DA 4OHJA 4XE0A 2K1FA 2CS4A 1ZOYB 2OF1A 4LNKA 5C4JH 1NJIC 4GKJL 3DCGA 5AFWA 4II3B 4NXNL 1E8ZA 2QGQA 3HOVB 1YX5B 1TKGA 5C3JB 4F7XA 2HDEA 3RZFA 1E8XA 2MPMA 4FJYA 5IYBH 2B8GA 4R1JA 2KKCA 1Q90A 4PT5A 2KJ6A 3ZKJC 4HIOA 2K25A 1U4PA 3TS0A 3TRZA 2AWTA 4IJHA 4JPBW 3TJPA 2A74C 4AIMA 1GC6A 3TEXA 5ELFA 4BOSC 2LJ5A 3AFPA 3GV3A 1SE4A 3OHXC 3HOVH 3AMZA 3ONSA 3RN2A 1QQRA 1SYEA 3CF5A 4GDKA 1ENAA 4FO2A 1KFYB 3N1YC 4BY1B 2JX5A 1C77A 4UPAA 2N55A 1CFMA 5FJ8G 2B2TA 4KHPL 3ONAB 3U9SA 2Z0DB 3P4QB 1L2NA 3C2PA 2L76A 1EIYB 2QSDA 3NUHB 2ZJRA 2HTHA 5IP7H 4K6DA 4APVA 2FJ2A 1K83B 3RCZA 2E2JB 2KACA 2GMIC 1RTOA 2AWNA 5I2YA 1HNZQ 1E5WA 4F8MA 4O42A 1TKYA 2INCC 2L00B 2ZPNA 3GZNI 3X3NA 2R7ZB 2FMMA 2WXRA 1ZYRC 2NZOA 3AFQA 5DM63 1XT9B 2RGFA 4DBGA 1ASZA 2IO0B 3ZDMC 3T3NA 1EU4A 4OO1H 3S1MB 5M3MG 3H6NA 4G0NB 4YTMB 5AUKA 4MTKA 1K83H 1YIWA 2B63B 2ZNVC 2E2JH 1VQKA 4B95A 1A3UA 2ZZPB 3MJWA 5C23A 4EQNA 2J7ZA 3KLSA 3KUZA 1TS4A 1HNZL 2D3CA 2CHZA 3RZDB 1LV9A 1ILPA 1WJNA 1TWFB 2LXCA 4X6AH 2QCPX 3SD5A 3MTSA 3S1MH 1JQYD 1IBKQ 5IYBG 3NRZA 2KWCA 1A2UA 5JJLA 3J80i 2E2HB 2SNMA 3ECIA 4ZKCB 3MP9A 3TZDA 4QGUA 1GG3A 4GB9A 2MBBB 3RN5A 3RZDH 1WD1A 2VB2X 4UY8C 4A3LH 1D8LA 4W9FA 3X23A 5E1FA 2HCCA 2JE6I 4HMIA 3SHQA 2BDNA 4DV4Q 2WQYB 4OGQC 1IBKL 2UXDQ 1ESRA 1FL0A 4TSSA 2E2HH 4S0RA 1QOBA 3L08A 1WGRA 2J7QB 1SSNA 1WXAA 2NPTB 3D4DA 4YCWA 1YVCA 4B9WA 4POFA 1MVKA 2R2QA 3HGBA 3AEAB 3ZYYX 1V81A 2JYEA 1EEID 4JG2A 2SOBA 2JSOA 1ET9A 3TIXA 1EIHA 4ZUIA 4JX1C 1EUJA 1A70A 3H09A 1I42A 1OGWA 2F0DA 4OWXB 3MC9A 2MX2A 4A9AA 2UXDL 1PZJD 5FLMG 4PS8A 2C7HA 3MA2B 3TUOA 3N9YC 1TR5A 4S17A 1QB5D 3QIAA 2K8HA 4WJ3M 3I4MH 4IM2A 1GD7A 3VR9B 5E3FA 5CR3A 4OO1G 1LTAD 2E2IB 2A5UA 5HGTA 4JBWA 4CHTB 1XPOA 2WHIA 4C3JG 4IPGA 2NVXB 2KOLA 4KKSA 4NB3A 3ML8A 3TMPB 4DAVA 1B53A 1P16A 4XXEA 3HM6X 5BO4B 1CSPA 2G4SA 1XLQA 3MHBA 4A90A 1F0ZA 2E2IH 1FR3A 4IFDI 4LDTB 4W9HA 3KOJA 3QHTA 3J81i 2NVXH 1D1KA 1WGDA 4A76A 4C3IB 3M3JA 1J0GA 4N9F4 4FXGC 4NXMQ 4PYUA 2K05A 4ARCA 2KQ3A 1GUTA 1N6ZA 5BR8Q 5C4ZA 2RSUA 4RGOS 5EAYA 1C78A 3M62B 1LT6D 3W1BA 4TQUS 5IT9E 4A3JG 3PO2B 1JJGA 1II3A 3U4EG 2LHDA 1SGHA 3N3KB 3NELA 2RSOA 2NVYB 4RMFA 2HJ8A 4JI0Q 4EE2A 3A8IE 1Y1WG 1EIGA 5D65A 4NXML 1WJ4A 5BR8L 1KAAA 1X3EA 2YV5A 1J7CA 3T1YQ 4R3DA 3HIZA 3NWSA 2L52A 3H0GB 2LRWA 3PO2H 4JC0A 3U2SC 4C1NI 1OQYA 2EYLA 2DGYA 2WDTB 1KLVA 2NVYH 2EPBA 3T13A 5EGTA 3V6CB 1MD2D 1Z7TA 3BINA 2PZWA 4S3SA 3H15A 4B9XA 3I4MG 2UXBQ 2EJMA 4RKBA 2GB1A 3OWEB 2L1AA 2PVOD 3HOXB 1WGYA 4ANWA 3T1YL 3J80E 3A54A 1Z47A 3GTJB 3GTOB 1H9SA 1I4GA 5CV6A 1B50A 5DAUA 3G6EA 1JWBD 1XCTL 1XEEA 3PZ7A 4F8CB 1S4ZA 2LXJA 3ICEA 3RNAC 4L8JA 2KOXA 1HE8A 3NBIA 5GAGC 1JR0D 4W9JA 2UXBL 1PH2A 4HJ8A 2N0SB 3HOXH 4HCEA 1AWDA 4GN3B 4M8NA 3GTJH 3GTOH 2RVLA 3PRMB 1TWHB 4DV5Q 1YQ3B 2O6VA 4WFN3 3AE7B 1B7YB 3JYUA 2FMCA 1WM3A 2B2WC 3HS0C 2PMZE 3RD2A 3K5NA 5LXHA 2NBUA 2PW9A 4RGMA 2NVTB 2PLPA 3VDYA 3APCA 4MIUA 3F2BA 3HOWB 1GUAB 3SGIA 2K5HA 1SNCA 1WZ3A 1TWHH 1J19A 2H1EA 1S5FD 4DV5L 1SNOA 1EWHA 1SMXA 3NQTA 4H7BA 2GBKA 3CC4A 5E6NA 4KDLB 3I57A 1MG8A 1VQ7A 4WWOA 4DF7A 3TEWA 2GA4B 2F0IA 2NVTH 5J2RA 3HOWH 4F7ZA 3CCEA 5HHDG 3S16B 2LVQA 3CF6E 4PS3A 1ZDVA 4HIMA 2BF8B 3NZSA 4IUVA 1CMXB 1YNJD 2M2LA 2HHHQ 2OEDA 1ASYA 3J81E 4NQKE 3I3TB 4WAAA 3NUCA 3R7QA 2H4OA 4B3MQ 1S40A 3OYYA 1PFDA 2M4NA 3S16H 2KFKA 2Z6KA 1VZ7A 2O2VA 1FVIA 2L11A 1EYCA 3Q69A 3GQBA 2WX0A 3DBHI 2KVRA 1STHA 1X3QA 5KYLA 2HHHL 4NAWB 1WX9A 4LUOA 4P1BC 2L3ZA 5EDSA 3CCQA 3DWQA 4K7WA 5IIFA 4B3ML 3A56A 4IJLA 2N1VA 1NDDA 4A3KB 3PIOA 1HZCA 3A1QA 1NAPA 3M95A 3Q14C 2LUEA 2WB1E 1EY5A 5C44B 1HQMC 1PRTD 1JW9D 1DOIA 3L16A 1EWCA 1I50B 4R4CA 3P2BA 1XLNA 3TMEA 4A3KH 2QC8A 3AMUA 3KK7A 3ULLA 3WWVA 2HIXA 2IY0B 2LMCB 3U50C 5D2MB 5C44H 3J7ZC 1GVPA 1FPYA 1UF0A 3NSWA 1WCMB 2NTSA 4WJWA 5EKLA 4E6IA 3J9CA 1QNKA 4AYBG 5JEAG 1NI2A 4A8XC 1KC8C 1I50H 1UEBA 1CT1D 4JI4L 3TEYA 1VCIA 2HE7A 2BWFA 1YJ1A 1GC7A 4ZKBB 2DZMA 3NS1A 4MJSA 3H3VC 1R4PB 1IPGA 2YTVA 2I46A 4JK1C 2XVSA 1WCMH 1X55A 1TTNA 2VNUD 3CCRA 3DBSA 3H7PA 3EC8A 1XMOQ 3G6JB 2F1MA 3QC8B 3W1GA 2MRPA 1K3RA 1EFWA 1BDOA 1H95A 4TRDA 3WCQA 1V43A 5IYDH 2OCEA 4P2CB 1MG4A 2BB6A 3LB8C 4GDLA 3OWFA 4EVOA 1X1MA 3K0YA 5C3EH 3GS2A 1WR6E 4M02A 1UAPA 3A8JE 3RLOA 1K8MA 1E7UA 2WXGA 4DQOC 4KGSA 1VDZA 3U4VA 1I5FA 1ONLA 4A6QA 2BYTA 1AW7A 4C4VA 1XWEA 3J81j 4KY7A 5FR6A 1SAPA 4L5RC 4BBSB 3I4LA 5DPTA 3Q2AC 1WD0A 3PUXA 4DR3L 2PYKA 3NVZA 2JT4B 5CV9A 2NZHA 3STBD 2WDVB 2F0TA 3V61A 4LF9Q 3Q8AA 3FMCA 4JLCA 1O7IA 2PI2E 1E2ZA 3K0XA 1LT3D 3NK9A 2QCZA 1YD8U 4XZ4A 1HEZE 3BIID 1A63A 2XSCA 4BBSH 3P63A 2MBEA 3U30A 4PK1A 2RHQB 2EY1A 5IKCM 1TY2A 4HDQA 1HJPA 5AZHA 2B29A 4IFDH 3KH0A 4C80A 1R4NB 1YNJC 4ZYNA 4K14A 1WXMA 4BKTA 3O13A 4LF9L 1OQQA 5AZFA 5EE9A 3CRLC 4XT3B 3DQVA 3FKIG 4DHJB 2WKDA 2AQ3B 3KJPA 4A3GG 4YSXB 3K7AB 2BYFA 2QDBA 1OFFA 5F2DA 2PCFB 1VQ5A 2VXWA 2RBMA 3N52A 2YTYA 1BBWA 4FXDA 4NZLB 4QJFA 1X54A 1KRTA 1K52A 1FNUA 3G71A 1K3BC 2CHBD 3UGBB 1YQ4B 1N36Q 2TMPA 2ZVNA 3GTPB 1DOMA 2JA8G 3NHHA 4K7SA 3UE1A 5HFYA 3ZJTA 2N9PC 2INNE 5LLIA 1E8YA 4IWQA 4MHEA 2OEOA 4HEDA 1PRTC 5IP9H 1KTKA 3CCSA 3A55A 2NZ1D 1EQVA 2MQJA 4XWWA 3HOYB 1N36L 5GROA 3DHHC 4X3SA 4WWNA 1LT5D 2KN5A 2WU2B 1BQQT 3JAMc 1D7QA 2CVRA 2DZJA 4MGZE 4O2DA 4ZK9B 1TVXA 2XIWA 3HOZB 1T0RC 4OVVA 2GBJA 4P75A 1IHZA 1JRPA 1LTTD 4XC2A 1I4RA 4GOPC 2C9OA 2BWES 2V1CC 5G3LD 4L5QA 4ANVA 2AUJD 5G2NA 1A6XA 3EA6A 4A3IG 4MGIE 2ZW1A 1YEZA 4R4OA 3KF8B 4WJQA 5K5PA 2LGDA 4ZYSA 1HFGA 3WALA 4I6PA 2RR9A 4HIDA 3PIPA 4DN4M 4OL7A 2EELA 2ZJPA 2DBYA 2V9HA 3E56A 3ZNZB 2IX1A 3TZUA 4LMQD 3KUPA 4M1UB 4DV6L 2JA6B 3PSIA 1HTLD 2LGSA 3T8MA 3HRDD 1OXUA 1EEFD 2F0MA 4K5VA 3DBRB 1CQFA 2RDHA 3H3VH 1R4MB 3JSVB 1PZID 3EBEA 2N4FA 1L0VB 3DOWA 2KBNA 2WFWA 2EYOA 1ISNA 2ICIA 4HRSA 3MC0B 4Y52H 3ALBA 2K04A 4BS9A 2L0CA 1JOQA 1W6KA 3RFZB 4PNYA 4EUTA 1ZKOA 3KLRA 2J0TD 3IFTA 3KFUA 3S14H 5IOIA 3ZUNA 5I2XA 2A5HA 5GQOA 3RNEC 4GLAC 1IYFA 5FO9B 2WXLA 2HDMA 2K6QA 5L83A 2B2TC 3STBC 5JXVA 1VLBA 1YJ9A 1PFMA 4ZRZA 3I55A 2BVCA 1WXSA 5C0XI 2N7DA 1P8LA 1D2BA 1K8RB 4K7UA 2PPBC 4UDUC 1ZW7A 2PZUA 1E8WA 2ZCBA 2JEAI 1E24A 2F4VQ 2A6HD 4LWCA 1K8AC 1KIXA 1GB4A 3NP8A 1WGGA 1YITA 1IZ6A 1GAQB 1UZXB 3AH7A 2DNEA 3CU7A 1VMCA 3UIOB 3VR8B 3CCJA 3EFUA 2BCOA 2PW5A 4L63B 1FEHA 1G6ZA 2M17A 4A3OA 2KCMA 5DNFA 2V3NA 1DD2A 1SRUA 4DPGA 1KNAA 2ZM6Q 2D0OA 1WRIA 3ZGZA 3ER0A 4BFRA 4N8X1 1ENCA 3HVZA 2F4VL 4A3CG 3OMCA 2C35B 3A9KA 3VYRA 1ZPSA 3NG0A 2GI9A 1RM6C 4JPSA 1E3PA 2BDOA 2F0FA 1UE1A 1GOZA 4W9IA 3CSTA 2ZM6L 2JK8A 1HZAA 4DUYQ 4A3DB 2WIIB 4J6IA 1SIFA 2K0PA 4ZHPA 4V190 2L83A 1RFAA 2O6VD 3EGRA 5KYIA 1ILQA 1RF2D 2PMZB 3WIMA 2NYZD 2CQOA 1EF5A 2D2QA 3KW5B 4CKBA 4G50A 1QJOA 1I4HA 4R8IA 1SDFA 4NNJB 5JPMC 1NSNS 2K6DB 3TEHB 2JA9A 3QARA 4A3DH 2IWHA 1TKEA 3APDA 3GDEA 1P7FA 3DM3A 2W55A 1NBWA 2ZCCA 1PTOD 1HR0W 3R8BA 4KN4C 2FCNA 3AEEB 1Q12A 1QOHA 2Q8RE 5IGBA 2DHZA 4KKIA 1PYWD 4KY5A 1Q0WB 1KD1C 5I9OA 1YJIA 1GUWA 4I6LB 2WU5B 1TZOA 4K8JA 4JI2Q 2KWUB 4RF1A 5BYRA 4CJ0B 2VQEQ 4KK7A 5BN3A 2F0GA 2MLBA 4TKOB 2JXMB 1R4QB 2JN4A 4BA2I 1FXIA 1NI3A 4EQ5A 5FLXE 1QKZA 1T6BX 2CH4W 4UHVA 4HJGE 1J8IA 4QIWB 1LTLA 5DPSA 2FCQA 2X8XX 3U7DA 4X64Q 4HN7A 3NPPA 4RCOA 1STYA 4JV5L 1PGXA 2AL3A 2MQHA 1C3TA 3SK5A 1JRUA 2AL6A 2UUBQ 1F52A 3NY5A 1OEYJ 2VQEL 2NN6I 1W6JA 4I7AA 5E6PA 2C7MB 1D5ZC 2DZKA 1SJED 2UU9Q 1V8QA 2Y5CA 2MJ3A 4IW0A 3MWYW 4ID6A 5IWAQ 3F2CA 2M1MA 4L23A 1RJTA 2R93B 4X64L 1TKWB 1U4LA 2FFKB 4LW1A 1PH4A 2L15A 1KLUD 1EY7A 2KEDA 4IPHA 4HAEA 3IAS1 2WB1B 4ANXA 4N9TA 2D5DA 2LVOA 2Q5WD 4K3BA 4YTPB 4JVZA 1NMGA 2DYBA 2OWOA 4LCDE 3AEGB 2UU9L 1SEBD 2V3SA 3N32A 3E0JA 4IUMB 5IYCH 4MDKE 3F1ZA 5IWAL 2R93H 4RM8A 3AEDB 3R2IA 3MXGA 2B2UC 5EPJA 1LACA 2BOSA 3RNUA 5TSSA 5CBEE 2OQKA 1SE9A 5EE3A 3CPFA 4CO7A 2JJQA 4KY6A 4JE3B 1PH6A 1LTSD 2LS01 4MELA 2K5QA 2RCNA 1NE3A 5CBAE 1IBLL 1FXTB 4PMBA 2A6HC 3D6WA 2B8FA 2IT1A 2LKVA 2KTRA 3B2GA 4DDID 2AKWB 3SU8X 2DNFA 4RF0A 4HTHA 4GKKQ 4ME5A 1PH9A 3PO0A 1JALA 4YCUA 1YNND 4D2KA 2N49A 3HVDA 5COYA 1IKLA 3VR2A 2GVAA 4G4KA 2FIDA 1K8GA 3Q24A 2CR5A 2YEPF 3B2FA 4IG7B 3MZ5A 4W9GA 3D4RA 1WGKA 2BS4B 1IL8A 1C7YA 1TS5A 1I35A 1WYDA 2HQLA 3FPUB 4GKKL 2F0NA 2MA9B 5J18A 4RM9A 1C79A 2M56B 1DONA 5CORA 3BK2A 5K36G 1LYLA 3T51B 4DV3Q 1R9TH 2Z0EB 2UUAQ 3IG3A 4FDBA 2CQAA 4HSPA 5C5MA 3RYTA 4GN5A 5FJ8H 3TSSA 1VQ8A 3ZVVA 1WF9A 3LXFA 1E9MA 2L32A 3OPOA 5M3MB 2L0TA 2N7JA 1PH7A 4HPPA 1KDAA 2KECA 5IYCG 1QZGA 1EM7A 1FD6A 2KX3A 3CSFA 3T1HQ 3PPAA 1PH5A 3WOEA 1PTOC 3PRZA 3ZTCA 4DKAC 1QVFA 4LNIA 4DV3L 1UWVA 1MFWA 5C4JB 2KYWA 2VZKB 4C7YA 1WIAA 2FUG1 2IGDA 1LFDA 3AE5B 4AUQC 5M3MH 3E5SA 3S1QB 4XQJA 5C4XG 1WRDB 2DZIA 2MEKA 2MHJA 2YLMA 3AEFB 5GMVA 3I2ZA 3VA7A 3KBXA 1EO6A 2ONQA 2K7VA 4DV7Q 2CJOA 3K58A 4KIKB 3S24A 1EU3A 1JWUD 2JUOA 4HCSA 4X3TA 3P75A 5IGGA 1ZKHA 1SROA 4EQPA 3AU5A 2EIFA 1E2VA 1EYDA 1YHAA 2PIAA 2V1YA 2B3AA 2CWPA 3A33B 4HPLB 3S1QH 1DYQA 4JWSC 1WJ6A 1K0SA 2DAFA 2JU6X 5M5XB 4E3CA 2B2YC 2Z6KC 3H6MA 4X57B 4IUTA 2WV6D 2JA7H 3DWMA 3NZ3A 2KO3A 3GO5A 2NB0A 1VCBA 2INPE 3PV1A 1U4RA 1MSHA 3F2UA 1KLGD 3I63C 2JEBI 1NMFA 3KYDD 5J22A 3M4OH 5C0XH 5M5XH 2XK5A 1CZWA 3OIPA 1FYCA 3ZJVA 1MKHA 2VH2A 4DU9A 2OTLA 1SYGA 1LGRA 4ME3A 4GOCA 3VR6A 1IYJB 5A2QL 3ZRCA 2G4DB 1KNEA 4LTUA 1WMHB 4ZDVA 2WDRB 3OTOQ 1AZQA 3C19A 5HG2A 5ELEA 3E3XA 2Z1CA 1NBFC 3VRBB 2JQOA 4OONA 5FLMH 4W9DA 1H4RA 2EY2A 4B0EA 2OQ0A 1IYVA 4DR7Q 2Y0SG 2IO3B 3CMEA 5EPKA 3W1SA 4HDOA 3D6CA 1UH6A 3L13A 3VDZA 1U0LA 3VH3B 2IGGA 4OVUA 2FE8A 1IYUA 4C3JH 1HUMA 1HZ9A 3PSEB 3VUWA 2Q8TA 1VQHA 4KHZA 4XDXA 2VH1A 4E71A 3DBLI 1Y69U 4DR7L 1E7PB 1JJ2A 3Q8CA 1YNNC 2K5DA 3CQZH 2MP2B 1E6EB 4DFAA 2XN9C 2HTME 3ZJYC 4A3JB 1OQRA 1H8CA 2KDBA 1N32Q 4U68A 3TDQA 4UAIA 4WWPA 1XXGA 4KMUC 2JA7G 4NPNA 1R7SA 3DEPA 3QWZB 1K53A 1JWSD 1RFKA 1Y1WB 1CQVA 4G7OC 1NNXA 1FM0D 2CW0D 3BU2A 3ITPA 3MEHA 3R2TA 3UINB 4OZBA 1UEAB 3FP9A 1JE4A 4GLXA 1WTXA 1T3QA 4A3JH 2ZVOA 3H9DA 5C0XG 2B3GA 2EQSA 2RA4A 1L0WA 4DAYB 3VUXA 3ZO5B 5J39A 2N9XA 1Y56A 4QMGA 4K3CA 3S1NB 1YNTE 2ZT9C 3TP6A 1Y1WH 1L0XB 1VQFA 3I4MB 3FAHA 2EJFC 3IRBA 2NS5A 2PVGC 2R92G 3TREA 1V6EA 2JYTA 3K6OA 4H02A 3CAMA 3JAML 2QDFA 4DV4L 4AQ7A 4IFDJ 4YT0B 4FLHA 4GNXB 1PTOB 2O4XA 2QW7A 2W9NA 3JAMi 2D3BA 3DMUA 4KV2A 4FF1A 3S1NH 1YMHE 3W5VB 4LUZA 1B4OA 5FK9C 1QE6A 3DEOA 3FKYA 4JW0A 2PQAB 3TN2A 2BA1A 5CHWA 1IGDA 4YWMA 4M8MA 2JXXA 2K52A 1Q3LA 3K81C 2N78A 1PTOH 5L95C 2JSVX 3ERSX 5G55A 4L2YA 3KLWA 3G7LA 3ZTDA 2IX0A 2D2CC 2D07B 4AH6A 2W82A 1IW7D 3BYTB 4BY1G 3TQYA 1S5CD 2LGXA 1DGSA 4CDFC 4EFOA 3W2DA 2CKHB 2B2VC 1L6UA 5D7GA 3NEMA 3BZDB 2J53A 2WAQG 2G9DA 5EPLA 1XJVA 1Q7YC 3R3MA 4NY0A 5M9OA 3PCOB 4H2AA 2K32A 1V80A 2OOBB 3VYSA 4LF4Q 5EE0A 1YN4A 5BN5A 3D31A 2BPSA 2WXJA 1C4AA 1CSQA 3KF6B 4X65Q 4N8FA 1WX8A 2I5HA 2NR2A 2Z8LA 1WTHA 4K8IA 3NVYA 2DN8A 1BCPD 3Q8FA 3TL5A 2EYPA 3FRPB 3I8ZA 1S5ED 5D14A 4MM3B 3VH4B 1LM0A 2B63G 2WX1A 4MT5A 5D3IB 4XX5A 4PYZA 4DNRB 4YSZB 2ZJDA 2NMQA 2N88A 3V60A 3UDGA 4Z9CB 1GXDC 2E3TA 4BAXA 1AE2A 4BXXG 1TT5B 2Z59B 1TWGB 4JI0L 1HA6A 1CJEA 4G57A 3QIJA 4QL5A 2NN6G 1QG7A 2KT7A 1I4PA 1JOKA 3G48A 3QR8A 2A6ED 4LNQA 1FGUA 1QNUA 3MAQA 3CIRB 1VQNA 1G2TA 3IBEA 1TT2A 1SE3A 4MN3A 2ZNVB 4JI8Q 3W5UB 1Q8KA 3J7AV 3RNGC 3GP7A 1DXMA 2I5LX 1Y14B 4C2MB 1TJEA 2DENB 1TWGH 3A8KE 4XDDA 3BWUD 2OTJA 3PGEA 3HEJA 4YIJA 3CMMB 3PIO3 1T0YA 4J1MA 1Z2MA 4X3UA 3DHGC 4M0WB 4LF8Q 3NS8A 4LF6Q 2XRQD 5E7NA 2XTIA 4JI8L 4IOAA 3IFWB 4C2MH 3Q8EA 2CW0C 1TU2B 3MC8A 1LUZA 1AN8A 2RPVA 1CZPA 1FIQA 3PT2B 1C48A 3JAME 1X65A 4YWLA 2PO4A 1T5EA 4AYBB 1NVID 3VXWA 3CW2C 4LF8L 3SXHA 1VR9A 1S1QB 4LF6L 4RA8A 1ZUD2 3SVMA 4MSQB 3B0AA 3X0WA 1XLPA 5GXGB 3P7JA 1DOXA 5J3BA 3V2TA 1N61A 3I9V1 2BYEA 1WR1A 1Z9FA 3AEVA 4W9CA 4ABNA 2OHFA 2NPTA 3E6ZX 4U673 2C7NB 4P6VF 5JEAH 1A62A 2BW2A 3A9JB 4A20A 4A3FH 1K8OA 4QCLA 2LHEA 3GTGB 4LNOA 3LGJA 4IURA 3RI7C 4JYAQ 4GN1A 1A3VA 5KNBA 3KUDB 4YXDB 2JYOA 1XLOA 4QIWE 2UWQA 1P1AA 1XD3B 3AE2B 3ND8A 1FJGQ 2JP1A 2WXOA 4DK1A 3S2AA 3AE9B 3OJ3A 3GD7A 3AI5A 4TV3A 3EHVA 3Q3OC 4NAMA 3GTGH 2K5VA 4C1NK 1ESFA 2E5LQ 3GZNB 1IW7C 1LTGD 4JYAL 2WP8J 1WZ0A 4ZHOA 1X56A 3VTWA 4FULA 1FXAA 1CKMA 1OEYA 2E74C 1FJGL 1AARA 3RNBC 2EY5A 2X6GA 2JZZA 2ZXRA 3IKJA 1ZXIA 3H0GG 4E74A 3QJYA 3Q3FA 4KKJA 3FPPA 2E5LL 3AV8A 3T3OA 2D3AA 2WYQA 1SJHD 1O7ZA 1PMRA 4KJOA 1SYFA 4C56C 4FN2A 4IC7B 4DHZE 4YSYB 4DR6Q 1BCPC 3SK8A 4CDCC 3DHIC 2V3PA 3TCAA 4B3SQ 1SIJA 1V1PB 3SR6A 2WGSA 3PRPB 2VL6A 2K33A 1VQLA 4DR1Q 3VR4A 2ASQA 3SFDB 5T1IA 1XPRA 2F0WA 5KHOA 3FKIB 1YJNA 3FDTA 1FRDA 2C5CA 2ZTCA 5ELCA 2GBRA 4Q0FA 4A3GB 2IO2B 4A3FG 3WOFA 2ZPYA 4QQBX 4DR6L 1YN3A 3GTQB 2OJRA 2LXAA 5EBCA 4MGYE 4OZCA 5I6YA 3U52E 3B6YA 4B3SL 2DX5B 2A6EC 2P5ZX 1FNVA 1GUGA 3I72A 2MBQA 5C3EB 3FKIH 2CCZA 5IGCA 4C00A 5FO8B 2JA8B 4A3GH 3KBGA 1F9QA 4MSMB 5M5WB 2EMSA 1SNDA 2C60A 2YYZA 2BGFA 3GTQH 1EF1A 1PA6A 1WE7A 3BDLA 1RCVD 3R7RA 1B9MA 4PS7A 4P74A 5IE8A 4K2KA 4CQNA 4YTNB 3IL8A 2LJIA 2QEJC 4R9WA 3C3LA 1V86A 2SAKA 5E4WC 1JC7A 1KQSA 3C8YA 4I6NB 2NVQB 1K28A 2JA8H 3RMKC 3HOUG 1XMOL 3RUIB 2PNRC 5M5WH 5BN4A 3P1HA 1BBUA 1VQPA 3NE5B 5H92C 1GPXA 2Y0SE 1YJWA 4LJOB 1VQ6A 4KN7C 2QDLA 4KD4A 1L4DB 4A75A 2R6GA 1ACCA 2MBHA 2VRRB 3EVQA 3NWTA 1C4QA 4KJNA 5FKAC 2BH2A 2NVQH 2O2LD 4CYEA 3QG1A 1MIUA 3MJ5A 4XYCA 1IBXB 2D62A 2ZTDA 1RYJA 4ANUA 1VD2A 4FF3A 1CZGA 3NVWA 4W9EA 1B9RA 3BS1A 2K5WA 1E0BA 4DNTB 2PEAA 1E22A 3CHBD 4HSVA 3S1RB 4GLVB 1KF6B 3T4AC 1WXQA 2MP1A 2RDGA 2N8NA 1EFID 2A19A 2J0MA 2N3SA 1AZPA 1E7VA 1CKNB 1CM9A 1AYFA 3PUZA 3PIP3 2YVCA 2E76C 1WSPA 4A3IH 4CDEC 2KWVB 1A2TA 1ZEQX 4K6LA 3AE4B 3KJOA 3S1RH 5IT9c 2XRSD 3UDIA 1V2YA 3V62A 4EEWA 5BMHA 1QUQB 3HRZC 4GGQA 1UE5A 2UUCQ 1VZ6A 3N30A 4LJPB 4YWGG 2PQEA 1Y1VG 1KJTA 1L7YA 1WFYA 2JRHA 2LD9A 1WM2A 1HFNA 2LXKA 4BBNC 4IDIA 1WJJA 4FXKC 1B1ZA 1EWYC 1YI2A 3L17A 1XMQQ 2H89B 1SYBA 4LFAQ 1VZ8A 5I9PA 3QX1A 1FD7D 2BS3B 2KUMA 1VDVA 3RPFC 1GUNA 2E6XA 2KDIA 3TBIB 3K7UC 3TP8A 3ZXRA 4IO9A 2UUCL 3NHEB 4NAWA 1WYWB 5M3FG 4RCNA 3DWGC 1S72A 2KENA 4HEA1 1AFPA 4QAYA 1G6JA 5BMGA 1XMQL 1WYGA 4GIVA 4HXDA 4PMCA 3T16A 3J80c 2LSSA 3E0EA 4MTNA 3I4NG 2KHJA 3OJ4B 3DHQA 4Q2JA 2CU3A 2MO1A 2K50A 2EXDA 2ICEC 3TS2A 2F3VA 1UELA 2KDEB 1JCKB 4O1NA 4P73A 1UWMA 4WAFA 1RIPA 2IPKD 1A15A 3H7SA 4IN3A 4NJ7A 1WWTA 1NY4A 4I65A 3QJZA 1GUSA 2VQFQ 1CA5A 1ML0D 1MI2A 2RDFA 1J9OA 4IPDA 5CV5A 3G4SA 2A68D 1IUEA 3DWPA 1F9SA 4PMWA 1B9NA 1YX6B 2W54A 2LMCA 2WXPA 1L1OC 2KEEA 3L9AX 2RSNA 1F1HA 5IP4D 2WAQE 4K5WA 4N6EB 5ELOA 3O65B 1OXXK 4TMAB 3M3YB 4TQ1A 3L54A 4HROA 1U4AA 4DR2Q 2XWJB 1K9MC 4RG1A 3RLFA 2VQFL 4A3CH 4DWFA 1HNWQ 2MJDA 3UE0A 1E90A 1JWMD 3DDCB 2Z6BA 1NYQA 4JCVE 1OXVA 4XTCS 3UQAA 3HP3A 4IUPA 5C5LA 1PH1A 3S14B 2J4XA 2KANA 3ZW3A 5C0XJ 1EQQA 1VQDA 2GVBA 4JI7Q 3M3YH 2KDMA 1D5MC 5CV8A 1K73C 1HZ6A 1K50A 4L6TB 4DR2L 1DOKA 2DAJA 1O7LA 3NBHB 1HNWL 2EXZA 2KC2A 1EIFA 5CX3A 4CHKA 2IBIB 1LXDA 4RWSC 4NJ6A 2AMCB 3S2DB 1STBA 3ZXVA 2N7EA 2F3IA 4A3MG 3HK0A 3ZNGC 1CTMA 4G7ZC 4A93G 3TBLD 3DBHB 3J81c 3LX0A 2KN4A 4HPMB 2LEKA 5D6JB 4FHKA 1GHKA 1GO3E 1G51A 1CK1A 2O5JC 3RLNA 2YTXA 3S2DH 4HCPB 3U8ZA 1X6OA 4L5TA 3CCVA 3K9OB 3NZUA 1PLFA 4JI5Q 4KVGB 5G5HA 1IKMA 4LK0M 2CHWA 4ZQ3A 3BJUA 1NYRA 2GBMA 3W1SC 3BK1A 1VS0A 3BVZA 3Q23A 2LUMA 1X9NA 4FVMA 4K2LA 4X62Q 1SYDA 1PGAA 1N9WA 1VQIA 2LWPA 1EYAA 4DDGD 3R3OA 3D4WA 1FGBD 2BA0A 1N62A 2GBNA 1JOOA 2E8GA 4FJZA 4JI5L 1CKNA 2RDBC 1IP9A 3UQBA 1KRSA 3UDXA 1RDPD 3ZNHB 3A74A 1PDXA 3VVWB 3AE3B 2J0KA 5KHQA 4OZAA 1D3ZA 4YCVA 2N1WA 4C3HG 4J3OD 3MXNB 1H9MA 4RFBA 4X62L 1M1KC 4NKLA 2KDFB 5EE1A 1EZ8A 3Q3JA 4ULLA 1V9PA 2ZEQA 1XQQA 4II2B 4OELB 1LT4D 4CBVA 3PS6A 3HOZG 1TIID 4EX5A 1A0IA 1XTCD 4WRDA 5CMDA 2F0EA 2CHXA 1PRTB 4W9LA 3VYUA 2FINB 4EGVA 2GLSA 4DUYL 3M4PA 4JI6Q 2K22A 4IUQA 2IY5B 3ZQ4A 1WX7A 4LAAA 1V1QA 3HKZG 4WWMA 4Y7NB 4H13C 1ZP0B 2RF4A 1O78A 4ZRQA 4KLKA 2K9XA 1QLBB 3X3MA 3DVNV 1HTPA 3CKIB 2N9KA 2AQ1B 3E9HA 3AU7A 1UNSA 2EYHA 4XYOA 4LF5Q 2BQQA 3KDFB 3P1MA 2XBBC 2A68C 4XQNA 1YOVB 2I1KA 3P4PB 2AEHA 1MSGA 4GOPB 4AJYB 4LNNA 4JI6L 1WI5A 3AB5A 4Y7NH 2WXNA 1L1OB 1B8AA 2OXPA 2PNHA 2MNAA 3M7NA 1VQCA 3KUCB 1BR9A 1XTDA 2R7FA 2Z0SA 1B3QA 4JI2L 4LF5L 4MGKE 3K9PB 3PF5A 4AP4C 2F0LA 3VQIA 1Y8NB 1W3SA 4YHHQ 4UP8A 1EY0A 5JVH3 4P16A 3KF8A 4FF2A 4HMJA 2RHSB 5A35A 2VUMG 3AECB 3RNCC 2CJNA 3B08A 4CGYB 1F9PA 2FCSA 3TP7A 2KMCA 4JOIA 5CV7A 5K36H 3PREA 1Q81C 1ET6A 4KDIC 3NENA 5LMNQ 2UUBL 4AYBE 4ZLTF 4YHHL 4TVAB 4PG3A 5CHVC 1Q1EA 3IVFA 3JSVA 4JGHB 2BB5A 4BY7H 4BKSA 2KVMA 4GDKB 4DHZB 5C4XB 4A3BG 1WI0A 4DNIA 1HQRD 1MJCA 2Y5PA 3AQQA 1QILA 5LMNL 2KAJA 1M8AA 1LO5D 2KNBA 4NP5A 1WFQA 3PLVA 2FCMA 3PZDA 1FO4A 3GB1A 2JQRB 1DOYA 5C4XH 5LNK1 1N60A 1ZDXA 2JA5G 2SDFA 3KYCD 3L0OA 3PMFA 3PUYA 4RGNA 4HLEA 2Y5BB 4DV1Q 1L4ZB 2IY1B 3C1EA 2EE1A 3HG9A 3T56B 1CKOA 4M8AA 3GV6A 1QOFA 2K4KA 3SE0A 5JHBA 3QWNA 3QCAA 1R9TB 4MNOA 1EL0A 2WXHA 2IW3A 4FXCA 3VR5A 1V97A 4UP7A 2J0JA 1PGBA 4DV1L 1WH3A 2DYMA 3ZNID 2K14A 1LTID 3OAWA 3NTKA 1RHPA 1FFVA 2DJGC 1SF0A 4BVUC 1A5RA 1PFBA 4B08A 4DAMA 3ZRFA 2ALYB 4F88A 3N1ZC 1JORA 1V1OA 2VB3X 2Y0SB 3DM1A 1IXRA 4BY7G 2JZ3B 1Y8PB 2F0PA 2F0KA 4ZRKA 2A69D 5JEAJ 3VA5A 2KMAA 2KWDA 1WTVA 1FFUA 3GE8C 3CXCA 3I4OA 5GADC 2UUAL 2WXKA 2Q2UA 2BS2B 3ZLZA 3DLLA 1NENB 5DEHA 2J42A 2MW5A 2KLCA 1XYIA 3AB9A 4OWWB 3DVNU 2EYJA 3K5MA 2C9WB 2QJLA 4WJOA 3T1HL 2D11A 4DV0Q 2ACZB 4KV6A 2JA7B 3WANA 3QAQA 5T1GA 3W5OA 2M9VA 3U9OA 4A3EH 4YY3Q 2HDLA 5HGQA 3LWUA 1N34Q 3M4OB 4GKJQ 2CKZB 3U7ZA 2AQ2B 4RAUC 4DV0L 1WTPA 4DV7L 2KMMA 2RPQA 3MVVA 2PW7A 2WXQA 1C0AA 4AJWA 3EN2A 1I4XA 1Q8IA 4HJKA 2R92B 4CDDC 3A0JA 3A5ZB 2F0SA 4DXAB 1O7YA 2SEBD 1YQBA 2KC1A 2ZXPA 1I94Q 1WY8A 3PHXB 1CUKA 1N34L 4ZCKA 3SEBA 3A4SC 3B9JA 3FILB 4GXBA 2R2OA 1WGHA 3NXWA 5AUIA 1PRTF 3URYA 2JY6A 4R4IA 1SNQA 1ZE3D 2LVPA 1EOVA 3MTNB 3EQLC 1DGJA 3J7A5 4O0AA 2R92H 4ZRPA 2KXJA 4TQ0A 2D10A 4NDXA 4ZRIA 1JQ4A 4C3JB 4KHPQ 1I94L 2ASBA 2BE5D 3I70A 3PF4A 5BMIA 3ERQA 2J52A 2BH8A 5E4XA 2GRIA 2I38A 1P3QU 2F0UA 2HQEA 4WJ4A 5BYSA 3CQZB 1U5KA 3P20A 1B70B 5EJWA 1YHQA 3PO3G 5IGEA 3VHTC 5EQ0A 1S5BD 4FNFA 4HR7B 1TZ1A 1B44D 3OTOL 1HRJA 2D5GA 4DR5Q 1VQBA 4RH6A 2QA4A 4DUZQ 3H94A 4A55A 4KGTA 4LNFA 1KL9A 3M85A 1MI0A 5IT9L 4A3EG 2OT2A 2PTLA 2TSSA 5JJZA 2E2DC 2WAQB 2FXQA 4DXFA 2KZRA 1XCQL 2V4IB 5T8IA 4DK3C 1UE6A 5LMUQ 4GMVA 3BDOA 2MBOA 2MWSB 4BY1H 2EZVA 1H9SB 2RQXA 3BVGA 1QCBD 3HKSA 1RRBA 4DR5L 5DM73 1HZBA 3SHLA 2L55A 4BBRG 3Q6BA 2CWAA 4DUZL 1QWYA 1SE8A 3PTFC 5DCNA 1E1TA 2X69A 1TGZB 1VQJA 2A8VA 4WJPA 1E0ZA 5LMUL 4ACFA 3PLUA 3QB3A 4N9PA 4DK6C 2R7ZH 2O6VB 1N32L 1GHJA 4HK2A 2KHIA 3ETRA 3ABVB 1SMYD 3APFA 1I3QB 2HIVA 1V49A 2KFJA 3J80L 3S9WA 4X66Q 1PZKD 4GS3A 2N9EB 1Q46A 4ARIA 1TQOA 5FLXc 3GTMB 1EQRA 2B63H 4NQLB 1FRRA 2A69C 1XNQQ 1XO3A 1WOCA 3OMGA 3DVGX 3OW2A 1TWFH 2K6AA 5GAEC 3HOVG 1IL2A 1PH3A 1N5WA 2D0PA 3M7GA 1I3QH 4BXXH 5E6OA 3FVQA 4X66L 3ENEA 2QMTA 1SNMA 1VQ9A 2B39A 2NN6H 3GTMH 1SXTA 3EUB2 3TEZA 2E75C 2LY7A 4JBKA 1CHPD 4OX9Q 1XNQL 2L7RA 4TKNA 1NCVA 3BYYB 1WVLA 3RZWC 1JE5A 2PI2A 1OXSC 4J8QA 1WXVA 3PZ8A 2G45B 1VF7A 4JI1Q 4JL9A 4IOIE 3AYHB 4XWTA 5IP7G 3QK0A 3ZIMA 4EZLA 3RMHA 1TYGB 1X3GA 4POGA 2RMMA 4P71A 4KZ0A 2FAZA 1H9KA 4KIKA 4OX9L 1XNRQ 2KFKB 3A7AB 2O2VB 1G6PA 5KNDA 1YIJA 4IM3A 5CTRC 3MFYA 2EOTA 4JI1L 1EQTA 1UGJA 2BKFA 2EDGA 5A2QE 4MEMA 3HKZE 4DHJD 5C2TB 2F0VA 2IDYA 2L4NA 2IZVB 3Q3NC 1TXYA 2R7ZG 3ZDTA 1BOSA 1XNRL 3A1QB 3J81L 4HWIB 2Q2IA 2KTFA 5MPOA 1EY4A 1RTNA 2WXFA 1HPCA 1E2WA 2SNSA 1AE3A 2R61A 3QQ8B 4LF4L 5JZEB 3FILA 1RAXA 4N59A 5C3WA 4A3LG 2BE5C 3SFEB 2WS3B 1Q1OA 4X65L 1AP0A 1LTRD 1G2SA 2WXMA 4IALA 1WMHA 1B3AA 4ILWA 1Q82C 1HCZA 1C9FA 4KHVA 3W1YA 3RZOB 1R4NI 4A3PA 3CCLA 3E9SA 2FIFA 3L4PA 4KI0A 2DY8A 5EKIA 4C3IH 1HTOA 3MEFA 5G3LF 2B2UA 2WWZA 4IOCA 2KQSA 3MHSD 2NBFA 1BXTA 4LUVA 4K0KQ 4LJZC 2L12A 2INDC 4MJSB 2VY3A 3RZOH 2DYOA 2KK8A 5IGDA 2EYMA 4P1CC 3AEBB 3CCMA 4WH4A 5I6WA 4HJ5A 1VMPA 2AYOB 3OIQA 3C0RB 2Z4IA 3H7PB 1L2FA 3V3XA 2AWOA 3QOLA 3I90A 4JBJA 3K80C 2MP2A 4XGAB 3NQIA 1PYSB 1BVSA 1X32A 3H0GH 4GN4B 4DXGA 4K0KL 2WDQB 4GDLB 1ZXTA 4HJ7A 1K51A 3PUWA 4JWUC 3PGZA 2LASA 4RHSA 3I3CA 3SK6A 3ULJA 1BF4A 1SMYC 2H5XA 1V5OA 3R66C 3ULPA 4A3FB 4US9A 1UUPA 3CPWA 3WAOA 4C4VB 3VYTA 3CP0A 4LLGM 5BYQA 1PXUA 4X3KA 3UF8A 2KVZA 1W2BA 4DAYA 4BKSD 1EWIA 1N63A 4W9KA 1EYGA 2I07B 3RR5A 5AEKB 1RKNA 4RGTA 3D8GA 1BT0A 2LFIA 5C4HA 2I5MX 2F03A 1B2TA 2KLGA 4C7ZA 1NR4A 3P4SB 1E7ZA 1SNPA 1NEKB 3W9CB 3CMAA 1PDQA 4C3IG 2IL8A 1F2RI 3F8TA 1YN5A 3PHWB 5IOCA 2XWBB 3BVMA 4GNXA 3H3VI 5IODA 2K8BA 2RD0A 3RNFC 1Z6HA 2N9LA 4JQWC 2UYZB 3T9LA 1UBQA 3HOUB 1D4BA 3L0WB 1F77A 2PQAA 2KJRA 1MBYA 2QHOA 3PO2G 2K01A 4OIJA 1JB7A 4EOYA 1ZXHA 1S3OA 3PUVA 3N6RA 3F2DA 2BT6A 4J15A 5NUCA 1JT8A 1QZEA 2JPHA 2HJ1A 5IO9A 1T0QC 3KYHC 1BKBA 2WACA 4J6HA 3DBRI 1R4MI 2FHTA 1OXTA 5JVG3 3J7YW 4KD3A 2AX5A 1FCLA 4QY7A 3GE3C 3HOUH 1QOGA 1ICFB 5AZGA 4MH8A 3IFDA 2G9HD 4NW2A 1F2LA 2XEWA 1J6QA 3QO2A 2KX0A 2NUCA 3BG3A 4KKTA 3DBLB 3FEWX 2F52A 2G5DA 2B2YA 3HFZB 2KCCA 3OSOA 4ALPA 1WTWA 1P98A 2FNJB 3UI3A 3V6EB 4HKQA 1SR3A 3NTIA 2JZPA 5IN7A 2DUDA 4OIKA 1I7HA 4K5XA 1JB3A 1BMLC 2QEXA 1MHHE 3HOXG 2ID0A 1SB3C 2PMVA 1QZHA 2W3RA 3D32A 3DPDA 1MGSA 4BZAA 2ZJQA 2LI5A 4P7IA 1J8CA 4ZAIA 1D1IA 3OW7A 5KGUA 3CC7A 1PTOF 1C4CA 2GOWA 2V4LA 2ZXOA 4M00A 3KF6A 4EZJA 3Q8DA 1PQSA 4OXPA 1CHQD 1V5TA 3BY4B 3PV0A 4XYQA 5TR5A 2WP9B 2L9HA 4MM3A 1I6HB 1FMAD 1G91A 2L8JA 4RNAA 1Y1VB 3N20C 3Q6SA 3K57A 3IT6B 1SN8A 1GUOA 4FF4A 2KQ7A 4JI4Q 4ODGA 4DR1L 1M90C 1AH9A 1JICA 1RD9D 1QF6A 2G3QB 1KXLA 4R8NA 1GM5A 1M4VA 5ELBA 3BDCA 1I6HH 1HTQA 1L5PA 3NTHA 2K39A 1E10A 1UE7A 1Y1VH 1EOTA 1TY0A 5M3FB 3HOWG 2W3SA 3WDNA 4G11A 2WKCA 1QOAA 2LGIA 4ICUA 1C4PA 4FJVB 3AN1A 5FO7B 2Q2TA 2IYDB 1RL2A 4PZ7A 2M8SA 4AOFA 2GN5A 2AHOB 3V05A 2KCTA 1N8RC 1F2RC 3I4NB 5HURA 1MJDA 3GTKB 1Y8RC 2K28A 2BYVE 2HT1A 3RN9C 5FR3A 2BTEA 1F9JA 1OTCA 5M3FH 5DPWA 2NVUI 2MUYA 4M0WA 1KM7A 4JOIC 5LL6S 3RT3B 3I7FA 2Z9HA 4OEMB 2YU9B 4NMZA 2MGSA 1STEA 1QT9A 5IY0A 1I4QA 3I4NH 2F3WA 1XX8A 3GTKH 4KSKC 1MJEA 1Q5WB 3EROA 3K5OA 4ICVA 4BKGA 4A3IB 2JWZA 4DR3Q 5IA7A 5J1ZA 4N58A 3KWLA 4WIPA 2YU9H 5GAHC 4PV1C 1D6EC 1C9OA 2HUGA 1RWSA 2D3GA 3QA8A 4IWOA 1KOTA 1JROA 4L1BA 5C3XA 3RD4A 4WORA 4IKGA 4GU2A 5C1ZA 3CC2A 2CU1A 3SK4A 2R3ZA 3H1UA 4DAPA 2Y3AA 1NUCA 3AM9A 4A3KG 2RCFA 3A9JA 2EMTA 1F2MA 1KDBA 1XF5L 2M00A 3MXUA 5C44G 4OVZA 2Q2HA 1TWCB 3H91A 1UBIA 4HIKA 2MCNB 4GZYC 1KHIA 2X38A 2MHVA 1H9JA 1LLRD 4A3MB 3LDZE 1KDCA 4B6WA 2K5PA 3KVFB 4A93B 4URKA 1GB1A 3EJIA 1GNUA 2KQ4X 3HUIA 1PUTA 1A3TA 3A9KB 1VQMA 3VFKA 3VTVA 5ELDA 3GTLB 2IHFA 1TWCH 1JJCB 1C76A 1WCMG 1WTRA 3EFXD 5M5YB 2MJEA 4FP5D 5FOBB 3LNNA 2QKIC 4A3MH 3A5UA 3I56A 2EKEC 5JJIA 4A93H 1X3PA 4IUNA 2B2VA 1V9JA 3HHMA 3NVVA 1D5XC 4LFAL 3VUYA 4FHJA 1BCPB 4H0LC 4NPSA 5EBDA 3JVZX 5IYDG 3GTLH 1LQBA 4KSLC 4TUUA 5IAAC 1MHXA 5M5YH 5C3EG 1VJKA 2CH4A 4EKUA 1U4MA 5JJKA 1UGMA 3A7LA 3M4QA 2NBVB 1VQAA 5H8YE 2EJGC 4CJ2C 3K7AH 4KZCA 3WA0A 3KQ4A 1EY8A 2G1EA 1J7BA 4PZ8A 1JWAD 4EZKA 1K0RA 4HJ9A 2KHSA 3CWIA 1VQEA 3KLSX 4Q5VA 1KH0A 3H8HA 3I5JC 1V1PA 2F0HA 2JXTA 3GTPH 4C3HB 4PQXA 3EIVA 2IGHA 2DY7A 4DGZA 1UWXA 2A73B 2VZKD 1I6VC 4G3XB 4CJ1B 1NR2A 3VRAB 4BBSG 2MJ8A 3Q3MC 3HOYH 2AUKA 2UU7A 4C3HH 3NJTA 3PQIA 4IFDG 1J7AA 4OW0A 1ZGUB 4DV6Q 1YJJA 3IT4B 2EVBA 3VTUA 2L05A 3MHZA 5HKHA 4BA1I 4K81A 5KEEA 2L5TA 1SE2A 1P0RA 1H9RA 3HKZB 5JPNC 1HUNA 5LHY1 1DJRD 2HCIA 5KIXA 3HOZH 1SSOA 1C8CA 4REZA 4ITKA 3SDZA 3T53B 4XT1B 2VW9A 5AJ3Q 3DWAA 5FLXL 4JI7L 4KKUA 2YEPB 4JI3Q 4KX6B 3DXJC 4QF4A 2B2WA 4FA6A 1DCZA 1F2ZA 3HZXA 3AE8B 2V4DA 1PH8A 1PFSA 1JMCA 1STGA 1QVGA 5E6JA 3N1XC 2M0XA 1L6VA 4AS1A 3SDLC 3OLMD 3UIPB 1VQ4A 1DOLA 1SYCA 3JC66 5AJ3L 3Q22A 2JA6H 2M19A 2KJHB 2ZW0A 3S15B 3AU4A 1IBXA 3GOEA 2JRIB 5IP9G 4JI3L 5EKKA 2F0JA 1PV4A 4IPCA 5JH5C 4WQMA 2VUMB 2ES2A 4QUFA 5JAVA 2BKRB 4LFCQ 1LM8B 4BOZB 2LFNA 2PZTA 3L2PA 2KTRB 3FHWA 1BBXC 1TBEA 1BUIC 3J7AF 3S15H 1F2YA 3AE6B 4QB4A 4H44C 2O5IC 1OO9B 2NCNA 3TP5A 4RHRA 2WNMA 1O80A 4B3RQ 1HHVA 2MH7A 1ICWA 3DVGY 1LABA 3KWVA 1TWAB 2K75A 3U58A 1PYBA 3HOYG 2IHEA 2XGTA 2VUMH 2WXIA 2PE6B 1QUQA 4B3TQ 4HCNB 4LFCL 3HM3A 5D3DA 4A3BB 3LJ3A 5HY6A 3EECA 1HR0Q 2ENBA 2KHWB 2LGYA 2ON8A 2PE9A 3AE1B 4DR4Q 1A8VA 4LF7Q 2JVCA 2M0AA 2PJHA 3UDFA 1EY6A 1FNWA 1TWAH 4B3RL 2EKIA 4ZRJA 1EY9A 4BWGB 3JW0X 3V96A 2VZAA 4IZ8A 4EQOA 4WJNA 2MFIA 2NBWB 3DUZA 1WTQA 4OO1I 4DA2A 4B3TL 4A3BH 5LXIB 2EY6A 1CA6A 2WINB 4R4QA 2JA5B 2KJXA 4AQYQ 2VS1A 1HR0L 2I1JA 4L5SA 1S3SG 4GLSC 2MO0A 4XQQA 4LF7L 4DR4L 4DV2Q 1BNZA 4DK5A 3SR1A 1HNXQ 5CGKA 4LFBQ 2JA6G 2D9UA 1VRAB 1C1YB 2RKSA 3BZCA 2JA5H 1CI3M 5ELNA 1YBYA 2H88B 4HKZE 2Q8IB 4AQYL 1VQGA 1S5DD 1YNXA 1EZ6A 2QILA 2FUHB 4FADA 1OTRB 3E9IA 4DV2L 4MH0E 2REXA 2CFMA 4WQOB 3ZJUA 1HNXL 4LFBL 3IAM1 4P72A 3U4ZA 1T9HA 3Q0AA 5HI1A 1STAA 4MZ9A 2A4ZA 4QUCA 3CCUA 3RUZA 1P7EA 2JF5A 2I2YA 3VR3A 3C1FA 4I7ZC 4JV5Q 1GKHA 5LL6X 4G7HC 2Z4HA 3NOBA 2K1BA 3M9BA 1TIFA 3AULA 4BY7B 1Y8OB 5KRUA 4FBJB 2L1BA 4F87A 3ML9A 2B76B 5CHFA 1HH2P 1G291 3K8AA 1STNA 1MPEA 1SFOB 3MXPA 1J5EQ 1KABA 2I0QA 1AEXA 2JWUA 3K5LA 4LDTD 5J17A 2HD3A 5H1SE 2R7DA 1X3FA 2K5NA 4JBMA 4A4IA 1GJXA 4JIOU 3IXSA 2K8CA 2XK5B 3PVLA 1BCPF 1M94A 1YHBA 4F1SA 1HA5A 3NBHA 3WAMA 2K03A 3EFCA 1SFOH 1ROEA 2DLBA 4IUUA 3BZKA 3LWEA 1VF5C 2PKOA 2F4IA 2F0QA 1QVCA 3OOCA 4KTAA 3C46A 1J5EL 2L0FA 2LRUA 4M01A 4ZUJA 2NTTA 1GJZA 3K59A 3P4RB 5D94A 4B0MA 1YZ6A 1MHWC 4MACA 3RULA 1G8ZD 1TS2A 1JMLA 3L3OC 5JOBA 3IAYA 5C6AA 1IGCA 2QF7A 1PFNA 4USAA 4CKEA 4KGRA 1V8CA 5CYUA 3WAPA 1IBLQ 1DM0B 2XNAC 4FYDA 4LK1C 4XIGS 1Q86C 4A3DG 1WJUA 4NJCA 3VAWA 4V0BA 2IX3A 4R4TA 5JHAA 4K1RB 5LMNW 1VQOA 1SBBB 5DLQE 1NTGA 1ZYRD 3D0FA 4OWTB 4CKCA 4B9KA 4GSWA 4ZOHC 2V0GA 4HVBA 3Q8BA 1PVOA 3M4YA 2NWGA 3S2HB 2KCNA 1SLJA 5CV4A 2KD0A 2DJFC 1UD7A 1ENFA 4RMAA
chains in the Genus database with same CATH topology
2KA7A 5ISRA 2FBWB 1Q1BA 1T5XD 3L7ZC 3MXNA 1WTOA 2BBCA 1L0YB 3MFGA 1F9RA 3PO3B 3LYYA 1Q10A 1BO0A 3I91A 1N5XA 4A3EB 3CRKC 1LTBD 2DNCA 5KNCA 1FCCC 2K3UA 1BUVT 3P42A 2WLBA 1HZ5A 5IGFA 3UI2A 4DK0A 1HXYD 1TS3A 3D3RA 2F0OA 3FC4A 4BBRB 5CC4A 3S17B 4XDCA 2X6LA 1DZ1A 2IJ0A 3W3AA 2QIEB 1RODA 1U9RA 4WURA 3QOJA 4IQZA 4US8A 2EYFA 5G5GA 1KRHA 3ND9A 3R93A 4RKLA 2DWQA 3I73A 5I4DA 4OHJA 4XE0A 1ZOYB 2OF1A 5AFWA 5C3JB 3HOVB 1TKGA 4F7XA 2HDEA 2MPMA 2B8GA 4PT5A 1Q90A 1U4PA 2A74C 3TEXA 5ELFA 3GV3A 3OHXC 1SE4A 3AMZA 1QQRA 1SYEA 1ENAA 4FO2A 1KFYB 4BY1B 2JX5A 1C77A 2N55A 1CFMA 2B2TA 3ONAB 3U9SA 3P4QB 3C2PA 2QSDA 3NUHB 4K6DA 2FJ2A 1K83B 2E2JB 2KACA 1RTOA 2AWNA 5I2YA 1TKYA 4F8MA 4O42A 3X3NA 2R7ZB 2FMMA 2WXRA 1ZYRC 5DM63 3T3NA 1EU4A 4OO1H 3S1MB 4YTMB 5AUKA 2B63B 1A3UA 4EQNA 2J7ZA 3KLSA 1TS4A 3RZDB 1LV9A 1ILPA 1TWFB 2QCPX 3MTSA 1JQYD 3NRZA 1A2UA 2E2HB 2SNMA 3MP9A 4ZKCB 3TZDA 1WD1A 2VB2X 5E1FA 2HCCA 2JE6I 4HMIA 2BDNA 2WQYB 4OGQC 1ESRA 4TSSA 1QOBA 1SSNA 3AEAB 3D4DA 4B9WA 1MVKA 3HGBA 3ZYYX 2JYEA 1EEID 2SOBA 2JSOA 1ET9A 1EIHA 4ZUIA 4JX1C 1A70A 3H09A 2F0DA 4A9AA 1PZJD 3MA2B 3TUOA 3N9YC 1TR5A 1QB5D 3QIAA 3VR9B 5E3FA 5CR3A 4OO1G 1LTAD 2E2IB 5HGTA 4JBWA 4CHTB 4C3JG 2NVXB 2KOLA 4KKSA 4DAVA 1B53A 4XXEA 4A90A 1XLQA 3MHBA 1F0ZA 1FR3A 4IFDI 1D1KA 4C3IB 4FXGC 4ARCA 2K05A 2KQ3A 1GUTA 5C4ZA 4RGOS 1C78A 1LT6D 4TQUS 5IT9E 3PO2B 1II3A 3U4EG 2LHDA 2RSOA 2NVYB 4EE2A 3A8IE 1EIGA 5D65A 1KAAA 1J7CA 4R3DA 3NWSA 2L52A 3H0GB 3U2SC 4C1NI 2EYLA 2EPBA 3T13A 5EGTA 1MD2D 1Z7TA 2PZWA 4S3SA 4B9XA 2EJMA 4RKBA 2GB1A 3OWEB 2L1AA 2PVOD 3HOXB 3J80E 3A54A 1Z47A 3GTJB 3GTOB 1H9SA 1I4GA 5CV6A 1B50A 5DAUA 1JWBD 1XEEA 1XCTL 3PZ7A 1S4ZA 4L8JA 3NBIA 1JR0D 2N0SB 4HCEA 1AWDA 2RVLA 1TWHB 1YQ3B 4WFN3 3AE7B 2FMCA 2B2WC 3HS0C 3K5NA 2PW9A 4RGMA 2NVTB 2PLPA 4MIUA 3HOWB 1SNCA 2H1EA 1S5FD 1SNOA 1EWHA 3NQTA 4H7BA 3I57A 4DF7A 3TEWA 2GA4B 2F0IA 5HHDG 3S16B 1ZDVA 4IUVA 1YNJD 2M2LA 2OEDA 3J81E 3NUCA 2H4OA 1PFDA 1VZ7A 2L11A 1EYCA 3Q69A 3GQBA 1STHA 1X3QA 5KYLA 4NAWB 3DWQA 5IIFA 3A56A 4A3KB 1NAPA 1EY5A 5C44B 1HQMC 1PRTD 1JW9D 1DOIA 1EWCA 1I50B 1XLNA 3TMEA 3AMUA 3KK7A 2LMCB 3NSWA 1WCMB 2NTSA 4WJWA 5EKLA 4E6IA 3J9CA 1QNKA 5JEAG 4A8XC 1CT1D 3TEYA 1VCIA 4ZKBB 3NS1A 3H3VC 1R4PB 2I46A 4JK1C 2XVSA 2VNUD 3G6JB 2F1MA 1BDOA 3WCQA 4TRDA 1V43A 4P2CB 2BB6A 3LB8C 3OWFA 4EVOA 3K0YA 3GS2A 1UAPA 3A8JE 2WXGA 1K8MA 4DQOC 4KGSA 1VDZA 1ONLA 4A6QA 2BYTA 1AW7A 1XWEA 4KY7A 1SAPA 4BBSB 3I4LA 1WD0A 3PUXA 2PYKA 3NVZA 5CV9A 2WDVB 2F0TA 3Q8AA 3FMCA 1E2ZA 3NK9A 1LT3D 1HEZE 3BIID 2XSCA 3P63A 2EY1A 1TY2A 4IFDH 4C80A 1YNJC 4K14A 3O13A 1OQQA 5EE9A 3CRLC 4XT3B 2WKDA 2AQ3B 4YSXB 3K7AB 2QDBA 1OFFA 5F2DA 2PCFB 2VXWA 2RBMA 3N52A 4FXDA 4NZLB 1K52A 1FNUA 2CHBD 1YQ4B 2TMPA 3GTPB 1DOMA 5HFYA 3NHHA 3ZJTA 2INNE 4MHEA 2OEOA 4HEDA 1PRTC 1KTKA 3A55A 2NZ1D 1EQVA 4XWWA 3HOYB 4X3SA 1LT5D 2WU2B 1BQQT 2CVRA 4ZK9B 1TVXA 2XIWA 3HOZB 1IHZA 1JRPA 1LTTD 1I4RA 2C9OA 5G3LD 2AUJD 1A6XA 3EA6A 2ZW1A 5K5PA 4ZYSA 1HFGA 2EELA 4DN4M 4OL7A 2DBYA 3E56A 2IX1A 3TZUA 4LMQD 3KUPA 4M1UB 2JA6B 1HTLD 3HRDD 1OXUA 1EEFD 2F0MA 4K5VA 1CQFA 2RDHA 1PZID 1L0VB 4HRSA 2EYOA 2ICIA 3MC0B 2K04A 4BS9A 2L0CA 1JOQA 1W6KA 3RFZB 4PNYA 1ZKOA 3KLRA 2J0TD 3IFTA 5I2XA 2A5HA 5FO9B 2WXLA 2HDMA 2B2TC 5JXVA 1VLBA 1PFMA 4ZRZA 5C0XI 1D2BA 2PPBC 4UDUC 2PZUA 2JEAI 2A6HD 1GB4A 3NP8A 1GAQB 3AH7A 2DNEA 3CU7A 1VMCA 3VR8B 2BCOA 2PW5A 4L63B 1FEHA 1G6ZA 5DNFA 2V3NA 1DD2A 1KNAA 1WRIA 3ZGZA 1ENCA 3HVZA 3OMCA 3VYRA 1ZPSA 2GI9A 1RM6C 4JPSA 2BDOA 2F0FA 1GOZA 4A3DB 2WIIB 4ZHPA 2K0PA 4V190 2L83A 3EGRA 5KYIA 1ILQA 1RF2D 2PMZB 2NYZD 4CKBA 1QJOA 1I4HA 4R8IA 1SDFA 5JPMC 1NSNS 2IWHA 1TKEA 1P7FA 2W55A 1PTOD 3R8BA 4KN4C 3AEEB 1Q12A 1QOHA 2Q8RE 5IGBA 4KKIA 1PYWD 4KY5A 5I9OA 1YJIA 1GUWA 2WU5B 1TZOA 4K8JA 4RF1A 5BYRA 4CJ0B 4KK7A 5BN3A 2F0GA 4TKOB 2JXMB 1R4QB 4BA2I 1FXIA 1NI3A 5FLXE 1QKZA 1T6BX 4HJGE 1J8IA 4QIWB 4HN7A 3NPPA 4RCOA 1STYA 1PGXA 3SK5A 2NN6I 1W6JA 1D5ZC 1SJED 1V8QA 2Y5CA 2MJ3A 3MWYW 4ID6A 4L23A 1RJTA 2R93B 1TKWB 1U4LA 2FFKB 1KLUD 1EY7A 2KEDA 4HAEA 3IAS1 2WB1B 4N9TA 2D5DA 2Q5WD 4YTPB 3AEGB 1SEBD 3E0JA 3AEDB 3R2IA 3MXGA 2B2UC 5EPJA 1LACA 2BOSA 5TSSA 5CBEE 5EE3A 4KY6A 4JE3B 1LTSD 2LS01 2K5QA 5CBAE 4PMBA 2A6HC 3D6WA 2B8FA 2IT1A 2LKVA 3B2GA 4RF0A 4HTHA 4ME5A 3PO0A 1JALA 1YNND 4D2KA 3HVDA 5COYA 1IKLA 3VR2A 4G4KA 3Q24A 3B2FA 2YEPF 3MZ5A 3D4RA 1WGKA 2BS4B 1IL8A 1TS5A 3FPUB 2F0NA 1C79A 2M56B 1DONA 5CORA 3BK2A 5K36G 3T51B 2CQAA 4HSPA 5C5MA 3TSSA 3LXFA 1E9MA 2L32A 3OPOA 5M3MB 2N7JA 1KDAA 2KECA 1EM7A 1FD6A 3WOEA 1PTOC 5C4JB 2VZKB 4C7YA 2FUG1 2IGDA 3AE5B 3E5SA 3S1QB 4XQJA 2MEKA 3AEFB 3VA7A 3KBXA 2ONQA 2K7VA 2CJOA 3K58A 1EU3A 1JWUD 4HCSA 4X3TA 3P75A 5IGGA 4EQPA 1E2VA 1EYDA 2PIAA 1DYQA 4JWSC 2JU6X 5M5XB 2B2YC 3H6MA 4IUTA 2WV6D 3DWMA 3NZ3A 3GO5A 2NB0A 2INPE 1U4RA 1MSHA 3F2UA 1KLGD 2JEBI 5J22A 5C0XH 1CZWA 3OIPA 1FYCA 3ZJVA 4DU9A 1SYGA 3VR6A 5A2QL 1KNEA 4LTUA 2WDRB 1AZQA 5HG2A 5ELEA 2Z1CA 3VRBB 2EY2A 4B0EA 1IYVA 5EPKA 3W1SA 3D6CA 2IGGA 2FE8A 1IYUA 1HUMA 2Q8TA 4KHZA 4XDXA 1Y69U 1E7PB 3Q8CA 1YNNC 2K5DA 1E6EB 4DFAA 2XN9C 2HTME 4A3JB 1OQRA 4U68A 3TDQA 4UAIA 1XXGA 4KMUC 1R7SA 3DEPA 1K53A 1JWSD 1RFKA 1Y1WB 1CQVA 4G7OC 1FM0D 2CW0D 3MEHA 3ITPA 3R2TA 4OZBA 1UEAB 1JE4A 1WTXA 1T3QA 5C0XG 2RA4A 5J39A 1Y56A 4QMGA 3S1NB 1YNTE 2ZT9C 3TP6A 1L0XB 3I4MB 3FAHA 2EJFC 2PVGC 2JYTA 3K6OA 3JAML 4AQ7A 4IFDJ 4YT0B 1PTOB 2O4XA 3W5VB 3DMUA 4FF1A 1YMHE 1B4OA 5FK9C 1QE6A 3DEOA 3TN2A 2BA1A 1IGDA 1Q3LA 1PTOH 2JSVX 4L2YA 3G7LA 2IX0A 2D2CC 2W82A 1IW7D 3BYTB 1S5CD 3W2DA 2B2VC 1L6UA 5D7GA 3BZDB 2J53A 5EPLA 2G9DA 5M9OA 4H2AA 2K32A 5EE0A 3VYSA 1YN4A 5BN5A 3D31A 2WXJA 1C4AA 2Z8LA 4K8IA 3NVYA 3Q8FA 2DN8A 1BCPD 2EYPA 3FRPB 3I8ZA 1S5ED 5D14A 4MM3B 4MT5A 5D3IB 4DNRB 4YSZB 2NMQA 2N88A 2E3TA 4Z9CB 1GXDC 1TWGB 1CJEA 1HA6A 4G57A 2NN6G 1QG7A 1I4PA 1JOKA 2A6ED 1QNUA 3MAQA 3CIRB 1G2TA 1TT2A 1SE3A 4MN3A 3W5UB 3J7AV 3GP7A 1DXMA 4C2MB 1TJEA 4XDDA 3A8KE 3BWUD 3HEJA 4YIJA 3PIO3 4J1MA 4X3UA 2XRQD 3Q8EA 2CW0C 1TU2B 1AN8A 2RPVA 1CZPA 1FIQA 1C48A 3JAME 2PO4A 1T5EA 4AYBB 1NVID 3SXHA 1VR9A 1ZUD2 4RA8A 3SVMA 1XLPA 5GXGB 3P7JA 1DOXA 3V2TA 1N61A 3I9V1 4ABNA 2OHFA 3E6ZX 4U673 4P6VF 5JEAH 2BW2A 1K8OA 4QCLA 2LHEA 3GTGB 4IURA 1A3VA 5KNBA 4YXDB 2JYOA 1XLOA 3AE2B 3ND8A 2JP1A 2WXOA 4DK1A 3AE9B 3GD7A 4NAMA 4C1NK 1ESFA 1IW7C 1LTGD 2WP8J 4ZHOA 1FXAA 2E74C 2EY5A 2X6GA 2ZXRA 3IKJA 1ZXIA 3QJYA 4KKJA 3FPPA 3AV8A 3T3OA 1SJHD 1O7ZA 1PMRA 4KJOA 1SYFA 4C56C 4YSYB 1BCPC 3SK8A 2V3PA 1SIJA 1V1PB 3SR6A 2K33A 3VR4A 3SFDB 5T1IA 2F0WA 3FKIB 3FDTA 1FRDA 2C5CA 5ELCA 4Q0FA 4A3GB 3WOFA 1YN3A 3GTQB 5EBCA 4OZCA 5I6YA 3U52E 2A6EC 1FNVA 1GUGA 3I72A 5C3EB 5IGCA 5FO8B 2JA8B 3KBGA 1F9QA 5M5WB 1SNDA 2YYZA 3BDLA 1RCVD 1B9MA 4CQNA 4K2KA 4YTNB 3IL8A 2LJIA 2QEJC 4R9WA 3C3LA 2SAKA 5E4WC 1JC7A 3C8YA 2NVQB 2PNRC 5BN4A 3P1HA 5H92C 3NE5B 1GPXA 4KN7C 1L4DB 4KD4A 1ACCA 2R6GA 3EVQA 3NWTA 1C4QA 4KJNA 5FKAC 2O2LD 3QG1A 3MJ5A 1IBXB 2D62A 1RYJA 4FF3A 1CZGA 3NVWA 1B9RA 3BS1A 2K5WA 1E0BA 4DNTB 3CHBD 4HSVA 3S1RB 1KF6B 3T4AC 1WXQA 2MP1A 2RDGA 1EFID 1AZPA 1CM9A 1AYFA 3PUZA 3PIP3 2E76C 1WSPA 3AE4B 1A2TA 1ZEQX 4K6LA 2XRSD 5BMHA 3HRZC 1VZ6A 4YWGG 2PQEA 1HFNA 4IDIA 4FXKC 1B1ZA 1EWYC 2H89B 1SYBA 1VZ8A 5I9PA 1FD7D 2BS3B 2KUMA 1VDVA 3RPFC 1GUNA 2E6XA 3TBIB 3TP8A 4RCNA 3DWGC 4HEA1 1AFPA 5BMGA 1WYGA 4PMCA 3T16A 3DHQA 4Q2JA 2CU3A 2ICEC 2F3VA 1JCKB 4O1NA 4WAFA 1UWMA 2IPKD 1A15A 4IN3A 1WWTA 4I65A 1GUSA 1CA5A 1ML0D 1MI2A 2RDFA 1J9OA 5CV5A 2A68D 1IUEA 3DWPA 1F9SA 4PMWA 1B9NA 2W54A 2LMCA 2WXPA 2KEEA 3L9AX 2RSNA 4K5WA 4N6EB 1OXXK 4TMAB 3M3YB 4TQ1A 4HROA 2XWJB 3RLFA 2MJDA 1JWMD 1NYQA 1OXVA 4XTCS 3HP3A 4IUPA 5C5LA 3S14B 2J4XA 5C0XJ 2KDMA 1D5MC 5CV8A 1HZ6A 1K50A 4L6TB 1DOKA 1O7LA 2EXZA 4RWSC 3S2DB 1STBA 1CTMA 4G7ZC 3LX0A 2KN4A 2LEKA 1GHKA 1CK1A 2O5JC 1PLFA 5G5HA 1IKMA 4LK0M 4ZQ3A 1NYRA 3BK1A 3BVZA 3Q23A 2LUMA 4FVMA 4K2LA 1PGAA 1SYDA 1EYAA 3R3OA 3D4WA 1FGBD 2BA0A 1N62A 1JOOA 1RDPD 1PDXA 3AE3B 4OZAA 4J3OD 4C3HG 1H9MA 4RFBA 4NKLA 5EE1A 1EZ8A 4ULLA 4CBVA 1LT4D 1TIID 4WRDA 1XTCD 5CMDA 2F0EA 1PRTB 3VYUA 2FINB 4EGVA 2K22A 4IUQA 3ZQ4A 4LAAA 4WWMA 4Y7NB 4H13C 1ZP0B 1O78A 4ZRQA 2K9XA 1QLBB 3X3MA 1HTPA 3CKIB 2N9KA 2AQ1B 4XYOA 3AU7A 1UNSA 2EYHA 3P4PB 3P1MA 2A68C 4XQNA 1MSGA 3AB5A 2WXNA 2OXPA 3M7NA 1BR9A 2F0LA 3VQIA 1Y8NB 1EY0A 5JVH3 4P16A 3KF8A 4FF2A 4HMJA 5A35A 3AECB 2CJNA 4CGYB 1F9PA 3TP7A 5CV7A 5K36H 1ET6A 4ZLTF 1Q1EA 2BB5A 2KVMA 4GDKB 5C4XB 1HQRD 2Y5PA 1QILA 2KAJA 1M8AA 1LO5D 4NP5A 1FO4A 3GB1A 2JQRB 1DOYA 5LNK1 1N60A 1ZDXA 2SDFA 3PMFA 3PUYA 4RGNA 1L4ZB 3C1EA 2EE1A 3HG9A 3T56B 4M8AA 3GV6A 1QOFA 3SE0A 3QWNA 1R9TB 1EL0A 2WXHA 2IW3A 4FXCA 3VR5A 1V97A 1PGBA 2DYMA 1LTID 3NTKA 1RHPA 1FFVA 1SF0A 1PFBA 4B08A 4F88A 1JORA 1V1OA 2VB3X 2Y0SB 3DM1A 1Y8PB 2F0PA 2F0KA 2A69D 5JEAJ 3VA5A 2KWDA 1WTVA 1FFUA 2WXKA 2BS2B 1NENB 5DEHA 2J42A 1XYIA 3AB9A 2EYJA 3K5MA 2QJLA 2ACZB 4KV6A 2JA7B 5T1GA 2M9VA 3U9OA 2HDLA 3LWUA 3M4OB 3U7ZA 2AQ2B 4RAUC 1WTPA 2KMMA 2PW7A 3MVVA 2WXQA 1I4XA 1Q8IA 2R92B 2F0SA 1O7YA 2SEBD 2ZXPA 3SEBA 3B9JA 3FILB 5AUIA 3NXWA 1PRTF 3URYA 1SNQA 1ZE3D 3EQLC 1DGJA 4ZRPA 4TQ0A 4NDXA 1JQ4A 4C3JB 2BE5D 3I70A 5BMIA 3ERQA 2J52A 5E4XA 2GRIA 2I38A 5BYSA 2F0UA 2HQEA 3CQZB 3P20A 5EJWA 5IGEA 5EQ0A 1S5BD 4FNFA 4HR7B 1B44D 1HRJA 2D5GA 4RH6A 4A55A 3H94A 4KGTA 3M85A 1MI0A 5IT9L 2OT2A 2PTLA 2TSSA 5JJZA 2E2DC 2WAQB 4DXFA 1XCQL 2V4IB 5T8IA 3BDOA 2EZVA 1H9SB 2RQXA 3BVGA 1QCBD 5DM73 3SHLA 2L55A 1QWYA 2X69A 1E0ZA 3QB3A 4N9PA 1GHJA 3ETRA 3ABVB 1SMYD 1I3QB 3J80L 3S9WA 1PZKD 4ARIA 1TQOA 3GTMB 1FRRA 2A69C 1XO3A 3OMGA 2K6AA 1N5WA 3M7GA 3FVQA 2QMTA 1SNMA 2B39A 2NN6H 1SXTA 3EUB2 3TEZA 2E75C 2LY7A 1CHPD 1NCVA 3BYYB 1WVLA 1OXSC 4J8QA 3PZ8A 1VF7A 4XWTA 4IOIE 3RMHA 1TYGB 2RMMA 1H9KA 3A7AB 5KNDA 3MFYA 2EOTA 1EQTA 1UGJA 2EDGA 5A2QE 5C2TB 2F0VA 2IDYA 2L4NA 1BOSA 3J81L 5MPOA 1EY4A 1RTNA 2WXFA 1HPCA 1E2WA 2SNSA 2R61A 3FILA 4N59A 5C3WA 2BE5C 3SFEB 2WS3B 1AP0A 1LTRD 1G2SA 2WXMA 4IALA 1B3AA 4ILWA 1C9FA 1HCZA 4KHVA 3RZOB 3E9SA 3L4PA 4KI0A 2DY8A 5EKIA 5G3LF 2B2UA 2NBFA 1BXTA 4LJZC 2L12A 2DYOA 5IGDA 2EYMA 3AEBB 4WH4A 5I6WA 1VMPA 3OIQA 2Z4IA 3V3XA 2AWOA 3QOLA 3I90A 3NQIA 1X32A 4DXGA 2WDQB 4GDLB 1ZXTA 1K51A 3PUWA 4JWUC 4RHSA 3I3CA 3SK6A 1BF4A 1SMYC 4A3FB 4US9A 1UUPA 3VYTA 4LLGM 5BYQA 1PXUA 4X3KA 4DAYA 1N63A 2I07B 1RKNA 4RGTA 3D8GA 2LFIA 5C4HA 2F03A 1B2TA 4C7ZA 1NR4A 3P4SB 1NEKB 1SNPA 3W9CB 1PDQA 4C3IG 2IL8A 1F2RI 1YN5A 5IOCA 2XWBB 3BVMA 5IODA 1Z6HA 2N9LA 1D4BA 3HOUB 1F77A 1MBYA 2K01A 4OIJA 1ZXHA 2BT6A 3PUVA 3N6RA 5NUCA 2WACA 4J6HA 2FHTA 1OXTA 5JVG3 3J7YW 4KD3A 2AX5A 1FCLA 1QOGA 4MH8A 3IFDA 2G9HD 4NW2A 1F2LA 3QO2A 2NUCA 3BG3A 4KKTA 3FEWX 1WTWA 2B2YA 2KCCA 3OSOA 3UI3A 4HKQA 3NTIA 2JZPA 4OIKA 1I7HA 4K5XA 1JB3A 1BMLC 1MHHE 2ID0A 1SB3C 2PMVA 2W3RA 1MGSA 4ZAIA 1D1IA 3OW7A 5KGUA 1C4CA 1PTOF 2ZXOA 1CHQD 3PV0A 4XYQA 2WP9B 2L9HA 1I6HB 1FMAD 1G91A 4RNAA 1Y1VB 3Q6SA 3K57A 3IT6B 1GUOA 4FF4A 4ODGA 1JICA 1RD9D 1QF6A 4R8NA 1M4VA 5ELBA 3BDCA 1L5PA 3NTHA 1E10A 1EOTA 1TY0A 5M3FB 2W3SA 3WDNA 2WKCA 1QOAA 2LGIA 1C4PA 3AN1A 5FO7B 3V05A 1F2RC 3I4NB 5HURA 3GTKB 5FR3A 2K28A 2BTEA 2MUYA 4M0WA 5LL6S 2YU9B 4NMZA 2MGSA 1STEA 1QT9A 1I4QA 2F3WA 1XX8A 3EROA 3K5OA 4A3IB 5J1ZA 4N58A 3KWLA 4WIPA 4PV1C 1D6EC 2HUGA 1RWSA 1JROA 4L1BA 5C3XA 3RD4A 4WORA 4IKGA 3SK4A 2R3ZA 4DAPA 2Y3AA 1NUCA 3AM9A 1F2MA 1KDBA 1XF5L 2M00A 3MXUA 4OVZA 3H91A 1TWCB 4GZYC 2X38A 2MHVA 1H9JA 1LLRD 4A3MB 1KDCA 2K5PA 4A93B 1GB1A 3EJIA 2KQ4X 3HUIA 1PUTA 1A3TA 5ELDA 3GTLB 1C76A 1WTRA 3EFXD 5M5YB 2MJEA 4FP5D 5FOBB 3LNNA 2QKIC 3NVVA 1X3PA 4IUNA 2B2VA 1D5XC 1BCPB 4H0LC 5EBDA 1MHXA 1VJKA 1U4MA 3A7LA 5H8YE 2EJGC 4CJ2C 3KQ4A 1EY8A 2G1EA 1J7BA 1JWAD 3CWIA 2KHSA 3KLSX 4Q5VA 1KH0A 3H8HA 1V1PA 2F0HA 2JXTA 4C3HB 4PQXA 2IGHA 2DY7A 4DGZA 1UWXA 2A73B 2VZKD 1I6VC 4CJ1B 1NR2A 3VRAB 2MJ8A 2AUKA 1J7AA 4IFDG 4OW0A 1YJJA 3IT4B 2EVBA 3MHZA 4BA1I 5KEEA 2L5TA 1SE2A 1H9RA 3HKZB 5JPNC 1HUNA 5LHY1 1DJRD 2HCIA 5KIXA 1SSOA 1C8CA 4REZA 4ITKA 3SDZA 3T53B 4XT1B 3DWAA 5FLXL 4KKUA 2YEPB 4KX6B 3DXJC 4QF4A 2B2WA 1DCZA 1F2ZA 3HZXA 3AE8B 2V4DA 1STGA 5E6JA 4AS1A 1L6VA 1SYCA 1DOLA 3Q22A 2M19A 2ZW0A 3S15B 1IBXA 5EKKA 2F0JA 4WQMA 2VUMB 4QUFA 5JAVA 2LFNA 2PZTA 1BBXC 1BUIC 3J7AF 3AE6B 1F2YA 4QB4A 4H44C 2O5IC 1OO9B 3TP5A 4RHRA 2WNMA 1O80A 1HHVA 2MH7A 3KWVA 1ICWA 1LABA 1TWAB 2WXIA 5D3DA 4A3BB 3AE1B 2ENBA 2ON8A 2M0AA 1EY6A 1FNWA 2EKIA 1EY9A 4BWGB 3V96A 4IZ8A 4EQOA 3DUZA 1WTQA 4OO1I 4DA2A 2EY6A 1CA6A 2WINB 2JA5B 2KJXA 4GLSC 4XQQA 1BNZA 3SR1A 5CGKA 2D9UA 1VRAB 2RKSA 1CI3M 2H88B 4HKZE 2Q8IB 1S5DD 1EZ6A 2QILA 3ZJUA 3IAM1 3Q0AA 5HI1A 1STAA 4QUCA 3RUZA 1P7EA 2I2YA 3VR3A 3C1FA 4I7ZC 5LL6X 4G7HC 2Z4HA 2K1BA 4BY7B 1Y8OB 5KRUA 2L1BA 4F87A 2B76B 1G291 1MPEA