2QILA

Toxic shock syndrome toxin-1 at 2.07 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title The refined crystal structure of toxic shock syndrome toxin-1 at 2.07 A resolution.
pubmed doi rcsb
molecule tags Staphylococcal enterotoxin
total genus 58
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qilA01
1CQVA 1SXTA 1SJED 1BXTA 3URYA 4O1NA 1L0XB 1S5DD 2WV6D 4TSSA 1FNUA 1LO5D 1T5XD 1XXGA 3SEBA 1CK1A 4OHJA 1RD9D 2XNAC 1EU3A 1D5ZC 1LT4D 1MD2D 1PTOC 2TSSA 3BVMA 4K6LA 1V1PB 1JCKB 1D6EC 1LTRD 1EFID 1LTTD 3BZDB 1CT1D 4RGNA 1KLUD 1PRTD 1SEBD 2NTSA 5FK9C 3EA6A 1S5ED 1EWCA 1BCPF 4Z9CB 5ELFA 1PZKD 1FGBD 1TY2A 1JR0D 2G9HD 1LTID 1YN5A 5ELCA 1PYWD 1UNSA 2XRQD 1SE3A 1EEID 4C56C 1LLRD 3MC0B 1I4RA 1XTCD 1D5XC 1SJHD 1I4PA 1DYQA 5FKAC 2O2LD 1JWSD 1EU4A 1BCPD 1SBBB 1LT5D 1AW7A 2AQ1B 1ESFA 1TS5A 4DXGA 1JWMD 3OWEB 1PZID 1M4VA 1FNVA 1LT6D 1AN8A 1LTBD 1RF2D 2XRSD 1ET6A 1S5FD 1FD7D 1TS2A 1I4QA 1PTOD 2J4XA 2XN9C 2NTTA 5I4DA 1SE2A 4UDUC 1RCVD 2QEJC 1RDPD 1PZJD 2RDGA 4RGMA 1S5BD 1KLGD 1TS4A 2CHBD 1BCPB 3DWPA 5ELBA 3DWQA 3BYTB 3BVZA 3KLSX 1JWUD 5TSSA 2AQ3B 1PTOF 1LTGD 3TSSA 1PRTB 3R8BA 5ELEA 1V1OA 4RH6A 1GOZA 2IJ0A 1CHPD 3V05A 1QILA 4RHSA 1DJRD 1I4HA 4DXFA 1S5CD 1YN4A 1FNWA 1LT3D 1BCPC 4RHRA 1F77A 1I4XA 4ZYSA 1B44D 1CHQD 1ENFA 1KTKA 3DWAA 4NZLB 3EFXD 1L0YB 4BWGB 2Z8LA 1V1PA 1PRTC 1TY0A 2IPKD 4RCOA 1I4GA 1SE4A 1ET9A 1HTLD 1HXYD 1HQRD 2ICIA 4RFBA 1EEFD 1STEA 5D3IB 3BVGA 1D5MC 5ELDA 1HA5A 1UUPA 2SEBD 4L63B 2AQ2B 3BYYB 3GP7A 3MFGA 4RGOS 1LTSD 5D3DA 3R2IA 4RGTA 1G8ZD 1PTOB 1JQYD 1B1ZA 1TS3A 3CHBD 1PTOH 3W2DA 1YN3A 4L6TB 3R2TA 2RDHA 1LTAD 2QILA 2R61A 1PRTF 3O13A
chains in the Genus database with same CATH superfamily
1CQVA 2A73B 1JJ2A 2WYQA 2CW0C 1KIXA 3RZDH 2A8VA 3QOLA 2IWHA 3CWIA 4DR5L 4KDIC 5D94A 4LCDE 1N34Q 3ZKJC 4LF9L 3DVNU 1JOQA 2FXQA 3CP0A 1SYCA 1V9JA 1SROA 1WCMG 2N9LA 3CSTA 2GN5A 1V8CA 4HJGE 1R4QB 3OHXC 4W9CA 2Q2UA 5JZEB 3SGIA 3HOXB 4KTAA 3H1UA 1OQQA 4UY8C 4MN3A 4A93B 1D6EC 4A3IB 4IG7B 4RGNA 3ULLA 1RYJA 5JJLA 4ITKA 5E6NA 2K33A 3HOXH 1PRTD 4DV3L 2K75A 2UU9L 4A93H 3N1YC 1IHZA 4A3IH 1H9RA 4WWMA 3I4OA 5FJ8G 3EUB2 2F4IA 2LEKA 1RHPA 4QAYA 1BCPF 3FRPB 4QB4A 4YHHQ 3STBC 5AJ3L 3AB5A 4FHJA 3NSWA 1EIGA 3CCMA 4WJ3M 1F9QA 3G6EA 2JA8B 1SE3A 1NEKB 3I4MG 2LRUA 3MC0B 1SRUA 4NKLA 1HR0Q 3CXCA 2F4VQ 2NZOA 5JPMC 2DYBA 1NENB 2NMQA 1KF6B 2KJXA 1TWGB 2GVBA 2BW2A 2OEOA 5AFWA 1E9MA 4B6WA 1IBML 1V8QA 2CCZA 3VUYA 5NUCA 4CJ2C 4K3BA 1N34L 5CV9A 3QOJA 3QJZA 4G4KA 2I46A 4POGA 1C77A 2MJ8A 2KN4A 4AUQC 4YIJA 2D07B 4C4VB 1Y14B 1B9MA 2WU5B 1TS2A 1I4QA 1Q8IA 4W9JA 4IFDG 4LFBQ 2K39A 2B2WA 3PRPB 4R8IA 3P20A 2M0XA 2XWBB 2RDGA 3KF6A 2O6VB 1S5BD 5ELBA 3JAME 1PH7A 1DM0B 1LGRA 2PLPA 2CU1A 4YHHL 3M7GA 1VQIA 1C9OA 2KYWA 3F2CA 2VQFQ 1W2BA 2F0EA 1NTGA 3SDLC 1Z5SB 2K5DA 4D2KA 2JUOA 4HJAA 2B2TA 2RGFA 1BOSA 2XWJB 1F9JA 2KMAA 3V05A 3UF8A 4RHSA 4RNAA 2EYLA 1WTXA 4EQPA 3A33B 2E3TA 3QQ8B 3RD2A 1MSHA 2EELA 1GUGA 1X3FA 1Q0WB 1BCPC 1TWCH 2NVXB 3G48A 1TIFA 1ENFA 1CHQD 4K7WA 3W9CB 3PGZA 1DZ1A 1JMCA 2FHTA 1L0YB 1XNRL 1ZGUB 4HDOA 2JXTA 1Q12A 1TY0A 1XD3B 2WXNA 4LUVA 4XXEA 3G6JB 1EFWA 1PGBA 2LHDA 3VR2A 1HQMC 4NJCA 3B2GA 1C4AA 2YU9B 4CHKA 4KV6A 1N62A 5I6YA 2K5PA 2VQEL 4L63B 3AEDB 5K5PA 2LUEA 1HFGA 2EY6A 4F7XA 2YU9H 2KWDA 3PV0A 3EFUA 2NWGA 2ZJRA 2HCCA 3NELA 2BS4B 1WXMA 2FMMA 3CF6E 1BKBA 3D6WA 2K7VA 4HLEA 2E2DC 3GQBA 3W1BA 3W1YA 1CKNB 1GKHA 2VQFL 2DZMA 2D11A 5EE0A 3AU7A 2YYZA 1E5WA 5AZFA 2WDVB 1VQHA 2JN4A 2KVRA 2PZUA 1YEZA 1H8CA 1IW7D 1K73C 5IYBH 1R9TB 3ZQ4A 3ZIMA 1L0XB 1VQPA 3WA0A 4YSXB 1J7AA 4LW1A 3D4RA 1I94Q 3N3KB 1ZP0B 1Q1OA 1SYFA 4N9TA 1JWBD 5FR6A 2MO0A 1BMLC 1PV4A 1N5XA 3AMUA 1HZ5A 2A4ZA 1MD2D 2MFIA 5M3MG 5C3EG 3GTPB 2F0VA 4FJZA 2UUBQ 3PCOB 1YJJA 3TEZA 1LTRD 3I70A 2KEDA 1GM5A 4B95A 1EY8A 3M4OH 4X65Q 4P16A 4A3KG 2ZPYA 3HG9A 1RM6C 3H91A 3EIVA 4DV6L 1GAQB 2EDGA 3M4PA 3NQIA 1KQSA 3S15B 4Q2JA 3S17H 4Y52H 5KGUA 4X3SA 4NW2A 4ZK9B 3RI7C 3W3AA 2NBFA 3H3VH 3S15H 2NVUI 2A68D 4DV4L 2I0QA 3PZ7A 2ZTEA 3S1RB 4LFCQ 3K6OA 2BS2B 2JEAI 2MBEA 1DYQA 3HVDA 3X3NA 2VZKD 3S1RH 2J42A 4LF5Q 3UDGA 1E3PA 4IUQA 2ATWA 1YQ4B 1GC7A 3DM3A 4I7AA 3K59A 3M7NA 1H9JA 1UEAB 2IO3B 1WXAA 4JLCA 3DEOA 2F0NA 1B2TA 4AJYB 4KGSA 1WGHA 1QNKA 1M4VA 4X3UA 2CQAA 1LTBD 1FD7D 2UUBL 4HIOA 4G57A 5E1FA 1GNUA 2YLMA 2F0DA 2N55A 2BPSA 3AE5B 3V62A 4DDID 2G5DA 3S1QB 4GLAC 2IO1B 4NAWA 3QA8A 1FFVA 4YWGG 4MTNA 2EZVA 1JWUD 2BH2A 1MKHA 3TDQA 3TUOA 3Q3JA 2L05A 1E2WA 3MXNA 4QF4A 3RD4A 1H9SB 4QUFA 4EVOA 1Q7YC 2L7RA 3L16A 1FJGQ 3DBHI 3OOCA 4TQ1A 2MQJA 1H4RA 4ODGA 2V3NA 1EZ6A 2RDFA 2HE7A 1QILA 1B53A 4DXFA 4MGZE 3TZDA 3WWVA 1GVPA 3B0AA 2O4XA 3Q0AA 1C0AA 4LF5L 1V97A 2REXA 3VVWB 1KFYB 2QF7A 2XK5A 3UDFA 5C6AA 2F0OA 1KD1C 2OTLA 4JI7Q 3KDFB 5LMUQ 4YTNB 2H1EA 4JBWA 4JI5Q 3G71A 4N9F4 4AOFA 3AEGB 4EX5A 4JX1C 1STEA 4DR1L 2D5DA 5JOBA 2LFNA 1XO3A 2W9NA 1EUJA 5CORA 1HZ9A 1YNND 4OVUA 1PGAA 2KK8A 5G5GA 3VYSA 4B3ML 4QCLA 4V0BA 2ZVOA 4HPPA 4MM3A 4CYEA 1RKNA 2O5JC 3HOVG 1SNMA 3QC8B 4PS3A 4A3GB 1JICA 2WB1G 3CMEA 3AE7B 1TS3A 2ZXPA 3A9KA 3A5ZB 4A3GH 1QB5D 4W9GA 1FJGL 2Y3AA 2M56B 3BK1A 1ENCA 2ALYB 1LTLA 1VDZA 4OO1G 1L6UA 1J5EQ 1KNAA 1VQAA 3K5MA 5IOCA 2ASBA 5JEAH 2VH2A 2B3GA 4B9WA 4P7IA 1FCCC 1TKEA 3PQIA 1HZ6A 2EOTA 3F8TA 3PIPA 4FA6A 3S14B 4OIKA 2WXOA 4JI7L 4K6LA 2BVCA 2KQSA 4W9EA 3HOWB 3S14H 5JVG3 3NVVA 1CT1D 3HOZH 4ZUIA 2CHWA 3L08A 2HQEA 2INPE 1WFQA 3S1NB 3PLUA 3NWTA 1TWHB 2DX5B 3TBLD 2KHWB 3JVZX 5KNBA 1FO4A 2F0MA 4DV0Q 4LNKA 1SYGA 3A0JA 4FDBA 1WD1A 4K2KA 4RMFA 3HRZC 1PFSA 2IZVB 2DUDA 3BINA 4IWOA 4DR7Q 1X3PA 4DBGA 1IBXB 2CJNA 2Z59B 5C1ZA 4BVUC 1SJHD 4GLXA 2ZJDA 2INDC 5C0XJ 2VRRB 3VTWA 4P2CB 3RFZB 3ZJTA 2YTXA 3KLRA 3DBSA 3NTKA 1SIFA 1HHVA 1V1QA 1E0BA 3ITPA 4KSLC 5EE1A 1EY7A 3KJPA 4FXDA 4DK3C 5IGBA 1QZGA 2JWZA 4OZAA 1DGSA 4DAPA 1PZID 4AQYL 2B63B 4TV3A 4A3CH 1CZPA 4ANXA 4YTMB 2ZJPA 3V60A 1HZCA 1VQ5A 2J0KA 1EWIA 5IP9G 3SE0A 4BBRG 3RNUA 2QGQA 4ARCA 1AP0A 3RULA 2OEDA 4A3MB 1H9SA 1CUKA 2JX5A 3D4WA 4ZYNA 4C3JG 1XMOQ 3DWPA 3WAOA 3M85A 4A3MH 3KQ4A 1O78A 1D7QA 4N8X1 1RIPA 1PH4A 2SDFA 2XBBC 1PRTB 2Q2HA 1BUVT 5ELEA 3ZTCA 4B9XA 1KH0A 3IT6B 1N36Q 4K14A 4DR7L 4ME3A 1CZWA 4AYBG 3AEVA 4M0WB 2MEKA 3ZLZA 1X9NA 3TZUA 1DJRD 1VQCA 2V3PA 3NS8A 4HEA1 3A4RA 5JEAG 1I6VC 4F88A 4LNNA 5IGDA 1AARA 1K8AC 2NPTB 1DCZA 1QE6A 2F3IA 2JPHA 1STNA 4HCPB 1EY6A 5IGEA 3R7QA 2MJDA 4FNFA 2FUG1 2E6XA 4IWQA 1H95A 3DBHB 3J80i 1JE5A 1JC7A 4A3BG 4BXXH 4IURA 2Q8RE 4G7HC 4R4IA 3VR3A 1GJXA 2JP1A 1T0YA 1GXDC 5CC4A 1PDXA 1TBEA 1UGJA 3H0GG 1WX7A 2KX0A 3D8GA 4XQNA 4HJ8A 4P6VF 4RGOS 1WZ3A 1UE7A 3C1EA 1HPCA 2KLCA 2LMCA 4KN7C 3RZOB 5D14A 3VR5A 2AEHA 1QOAA 3I7FA 1DOIA 1B1ZA 4DAMA 1TYGB 4N59A 4PZ7A 3CHBD 3RZOH 2L4NA 4IOAA 2DWQA 1VF7A 3BU2A 2FNJB 1WMHB 1N36L 1MJEA 2KZRA 5BO4B 1TVXA 1Q8KA 3AE3B 5J39A 1VCIA 1VQJA 4CJ0B 5H92C 2K5WA 1HFNA 3WCQA 1SXTA 3BZKA 1SJED 1VQEA 5J17A 3URYA 1SFOB 2HT1A 1L4ZB 2EXDA 1YIWA 4XZ4A 5GROA 5C23A 1SFOH 3CC4A 2WU2B 1YQ3B 3HKZE 4C3IB 2WX0A 3RNBC 2EJMA 4C3IH 3NBHA 3RUZA 2EMTA 1EFID 1LTTD 3I5JC 4R8NA 3D32A 3WALA 1B9RA 5HFYA 1MIUA 2R7FA 1Y1WB 1DOXA 3S2DH 4V190 2Z6KC 3EA6A 2KHIA 4K6DA 4BY1G 2R93B 1EWCA 1UGMA 2KTRB 1PFNA 1PVOA 5MPOA 2HHHQ 1K51A 4KHPL 2W55A 3Q6BA 3KLSA 4KY5A 4RG1A 2RPVA 5ELCA 4G3XB 3NHHA 4JOIC 3DHIC 3A7LA 2CQOA 4NP5A 2PEAA 2FINB 1R4NI 1I4RA 3MAQA 3SFDB 2HIXA 1P3QU 1FVIA 2PIAA 4MGYE 4AS1A 4I6PA 2D3AA 1E7UA 2WGSA 3A55A 4YWKA 1XMQQ 4RM8A 1WXQA 1OXXK 2KTFA 3U4VA 4IM0A 4HJ7A 3AE2B 5C4XB 4MELA 4K8JA 4HTHA 2IY1B 3VUWA 2DY7A 2ASQA 3HM3A 3NE5B 4KHVA 5C4XH 3NG0A 2D9UA 2KUMA 1PTOD 4X62Q 3J80L 3KUZA 3KOJA 4BXXG 4N58A 2KMMA 4IKGA 2QEJC 4CGYB 2D0OA 2LXAA 3GTMB 2DAJA 4FVMA 1YX6B 4HCEA 3W1GA 3K9OB 1F2RC 3JYUA 2FIFA 4GDKB 3GTMH 5HURA 4ANVA 1C1YB 4FULA 3PSEB 1L1OB 4M0WA 3PO2G 4DR2Q 3M4YA 3RZFA 4F1SA 2PKOA 3NY5A 2LXKA 3HOYG 1XPRA 3OIPA 2NPTA 2CWAA 2K50A 4GNXC 2MHJA 3DBRB 2G4SA 1Y1VB 2NCNA 2JRIB 3ML9A 4OX9Q 2R3ZA 3MP9A 1HEZE 2EY5A 3DHGC 1UWXA 1YN4A 1Y1VH 1LT3D 1VMCA 2K04A 1WJUA 2L00B 3WOEA 4PG3A 1C48A 1II3A 4UP9A 4ZYSA 1XMQL 3L0WB 4IUMB 1HNZQ 3PO3B 1VD2A 4A3JH 4DNIA 5HI1A 1RJTA 5BMGA 3NTHA 2VZKB 3CQZH 3MXUA 5BR8Q 2WXLA 3NP8A 2FCMA 1I4GA 4DR3Q 2D3BA 1ET9A 1HTLD 1O7IA 1QT9A 1LACA 3LXFA 4IUNA 2AWNA 3AH7A 3TJPA 4MJSB 3TRZA 3TEXA 3ERSX 2JZ3B 3MFGA 3CSFA 3HHMA 3RLNA 3QWNA 1WMHA 2MCNB 4ACFA 5D3DA 1NE3A 4PZ8A 3APFA 4JPBW 2BYTA 5G3LD 2LHEA 3UDXA 2KO3A 3W2DA 2CWPA 2Z0EB 4GXBA 2L11A 1AYFA 2R61A 1PRTF 2N9EB 1E7PB 3QK0A 5JHAA 3T56B 1AFPA 1O80A 3F2BA 3Q69A 3IBEA 3DWGC 2AUKA 4TSSA 2E5LQ 2PMZE 2W54A 1WGKA 2OTJA 4DR6L 1HNZL 2NVTB 3TP6A 4IFDI 1C9FA 1WR1A 5KHQA 1JB3A 2OXPA 1ZYRD 1UWVA 2WX1A 2WAQB 4JE3B 4DR3L 5EPKA 1V81A 1LUZA 3J80c 2QMTA 4HMIA 1VQKA 2I5HA 2L5TA 4UHVA 3BJUA 1T6BX 2DZJA 3DVGX 1X6OA 2IL8A 2YTYA 4O42A 1UF0A 4GDLB 4IUPA 1K0SA 1JORA 4NJ7A 1B7YB 1ONLA 1G6ZA 2MGSA 4GOPB 4JBMA 1WIAA 4IALA 4K5WA 4IDIA 2K14A 3L10B 1PYWD 3HK0A 1T5EA 4KMUC 4GLVB 3SK5A 4LMQD 4C56C 1G91A 5HGQA 4JQWC 3VYTA 1OGWA 3RNEC 3RT3B 1GG3A 1WFYA 2GMIC 2BKRB 3DOWA 3A54A 1XJVA 5FKAC 1TR5A 3P4PB 1K50A 1BNZA 1AEXA 5K36G 1PMRA 3U9OA 3LYYA 1B3QA 1K52A 2KBNA 5D65A 3SD5A 2C9OA 3CCEA 4FXGC 2E5LL 1ZDVA 1CMXB 1TT2A 3IFWB 3T3NA 4A3JG 4P74A 4ANWA 3NOBA 5LMNQ 1U0LA 1NR4A 4LK1C 4WWOA 3OW7A 3N20C 2XN9C 3FEWX 1L1OA 1L0WA 1RDPD 4I7ZC 2WXHA 1CQFA 2I38A 1AE2A 2MLBA 4JI2Q 3PT2B 5EJWA 5LNK1 2MW5A 4GLSC 4LF6Q 3KH0A 5BYRA 3G4SA 4NNJB 2WLBA 1MGSA 1LTGD 4M1UB 1EUVB 2BE5C 2L55A 1FFUA 2KOLA 4YTPB 2F03A 2AUJD 2KECA 2ZEQA 1Y69U 3VXWA 3J7AF 5DPSA 1QF6A 2IW3A 4GKJQ 3J81i 1ZDXA 4W9HA 1GJZA 3IAYA 1FNWA 2PJHA 4K81A 3AFPA 4JV5Q 3UQBA 2HTHA 2B2YA 4JI0L 4WQMA 5C5MA 4LF8L 5GAHC 1W6KA 2B2VC 2C35B 2KKCA 1V1PA 4NY0A 4BZAA 4IQZA 1N9WA 5CV4A 2INCC 1EEFD 4KKIA 3NJTA 4NJ6A 2BA0A 3PUXA 5ELDA 4JWSC 1OXUA 1RTOA 1IYUA 2WDRB 1S72A 1SNPA 3KF6B 1I5FA 2KQ3A 3V2TA 2F0JA 2DYMA 3I4NB 1Q5WB 5M5WB 3LWEA 4JI2L 3HGBA 1LTSD 4DK0A 1E22A 3P1HA 3VTUA 4PMCA 4WJ4A 4LF6L 1G51A 3WAMA 2MRPA 2GRIA 4DR5Q 2B2UC 1YJNA 1MHWC 4LF9Q 1B50A 5BYQA 2B39A 3X0WA 2H88B 4A3DB 4IOIE 4KX6B 5KNCA 1JW9D 3RNCC 3A1QA 2L15A 3I4LA 2UXBQ 2WB1E 1N32L 3RN5A 4A3DH 3VRAB 1YJWA 2HCIA 5F2DA 1SGHA 1WRDB 1Z47A 3CCVA 2QDFA 2UU9Q 4DV3Q 4TQ0A 3S2AA 1MPEA 2IT1A 4BAXA 1N61A 1H9KA 4GDLA 2F0PA 1WXSA 4QL5A 3BZDB 2ZZPB 2LGIA 3UGBB 4GOPA 2NBUA 3QR8A 4OZCA 4B0EA 3PRZA 3FHWA 1R4PB 3GTOB 2L83A 3PRMB 3A8IE 5ELFA 4WJQA 1XLPA 3HIZA 5GMVA 4OWXB 1FGBD 1TU2B 3D4DA 5C0XH 3CCUA 1C4PA 2DYOA 4HXDA 3HRDD 4NPNA 2RCNA 3OSOA 2K8BA 1M8AA 3WANA 2PO4A 2PVOD 3BWUD 4EZLA 3GTLH 3RMKC 1IBMQ 4XE0A 3MHBA 2F0LA 4N9PA 1VQ4A 3M3JA 3QARA 4DHZE 3BK2A 4H0LC 2NZHA 2AWOA 4KD3A 1RRBA 2ZM6L 4EE2A 2LGDA 3DM1A 1KHIA 3NEMA 2LRWA 4REZA 3TEWA 4YL8A 1LT5D 3BG3A 3J81L 2UXBL 5G5HA 2AQ1B 1U4PA 1ESFA 1ZKOA 3DEPA 5M5XB 3M95A 3FKIG 1WI5A 4DXGA 2W3RA 4N8FA 2HQLA 2ICEC 2WFWA 2V3SA 5DPRA 1IL8A 5M3FB 4UP7A 4A75A 4M02A 1GO3E 1F9RA 5LXIB 3P1MA 4NMZA 3EFCA 3V61A 4UDUC 1RLFA 3R3MA 4R4OA 3QCAA 1ICWA 3SK6A 2JA5G 4LNQA 1KLGD 4HCSA 3TMEA 2LVOA 1J8IA 2JA8H 2ACZB 3BYTB 4GN1A 5IO9A 2OOBB 3ZO5B 1A62A 1XPOA 1E8ZA 2XVSA 1EQRA 3KJOA 4OO1I 3NVZA 1GUOA 3TSSA 1VQNA 2PYKA 1YNJD 3NBIA 1IGDA 4ZLTF 5ISRA 1BO0A 2YTVA 1T0QC 4MACA 1V1OA 4WQOB 4HKQA 1TWGH 2RCFA 4MNOA 4NAMA 2GBMA 2PW7A 3J80E 1QWYA 3AB9A 1EYCA 1XNRQ 1N8RC 1NDDA 4HPMB 1C79A 3PIO3 4H7BA 2Y0SG 4G7OC 4DQOC 3I8ZA 2OCEA 4JI6L 2PMZB 4LAAA 2I5LX 2LGXA 1FM0D 4I65A 2JF5A 4KDLB 3JSVB 2VQEQ 1NUCA 2Z8LA 1EYDA 3LX0A 3F1ZA 4KK7A 4H2AA 4WURA 5DAUA 4C3HG 4DN4M 3RZWC 5LL6S 4IO9A 1VZ7A 1PH3A 3ENEA 4X66L 5IWAL 4YWLA 3D6CA 1YMHE 2JU6X 1IZ6A 1UUPA 2HDMA 3U8ZA 1Q86C 2AQ2B 1WTVA 1DOKA 1V2YA 1YOVB 2IDYA 2PZTA 2ZJQA 3Q8DA 4NAWB 1UE5A 3ZYYX 2VW9A 1ZUD2 2B76B 4KD4A 5DPTA 3VH4B 4HSVA 4RGTA 5KYIA 1SIJA 3CF5A 1PTOB 1TT5B 2KDFB 1JQYD 3MXNB 2N4FA 2BH8A 3FILA 2KJHB 5CHWA 1E8WA 1PTOH 4LF7L 2JYTA 3A9JA 1C4CA 2EJFC 4C1NK 4GZYC 2IY5B 1DGJA 2KC1A 3SHLA 4HIMA 2CJOA 2KDBA 3A4SC 3I3CA 1E24A 4B08A 1N5WA 2F0FA 2FCSA 4TKNA 2NVXH 1A3TA 4CHTB 1QOBA 5IN7A 3T53B 2NUCA 5JH5C 1ML0D 4P1CC 3J81c 1XXGA 5KIXA 2XK5B 2F1MA 1MSGA 1XYIA 1RD9D 3HOXG 3OMCA 4DV6Q 4EUTA 4EQ5A 1D5ZC 4A93G 4P75A 4A3IG 2IHFA 4KN4C 3J7YW 3AM9A 4LF4L 1L4DB 1FXIA 1QVFA 4FADA 3BY4B 4DAYA 3AEAB 3CMAA 2N88A 3KF8B 4DV4Q 1OFFA 2K8HA 4Z9CB 4YT0B 1PH1A 1JJCB 3AMZA 4MM3B 2G9HD 2ZNVC 3ZNGC 1LTID 3MC8A 3TL5A 4URKA 2K5VA 4PMWA 4GGQA 1GUNA 2QHOA 4NPSA 3DMUA 3Q8CA 4JK1C 3A9KB 4DK6C 3K0YA 2AMCB 4A55A 2J0TD 3NVWA 1QZHA 5CV8A 3ONAB 1E1TA 1R9TH 3S2HB 2EY2A 1NI3A 3RCZA 4MH8A 3V96A 1WH3A 4ARIA 3TIXA 2BCOA 1PUTA 2J7ZA 2WXPA 4FLHA 4ABNA 1WXVA 2EYMA 3GTPH 1EIYB 3ML8A 4LNOA 2KDEB 3NZ3A 3ZXVA 2XEWA 5EGTA 2BBCA 1AN8A 2A5UA 2RKSA 3EHVA 1ET6A 2CKZB 1YNXA 1W3SA 4K5VA 1D1KA 4N6EB 2RSUA 3FMCA 3KFUA 1EM7A 2SNSA 1MJCA 2EY1A 4DA2A 3FC4A 1KRSA 2ZW0A 4YCWA 3ZTDA 5EBDA 2DNCA 3KLSX 4OL7A 4J6HA 1NY4A 1B70B 5IE8A 4J15A 1A3VA 3KWLA 3STBD 2GLSA 4TQUS 2J0MA 3PUWA 3OWFA 3R8BA 1TKYA 3OG5A 4M8NA 1PLFA 1WYGA 2PPHA 4PS8A 2DY8A 1WTWA 1EO6A 4S17A 4X3TA 4DK5A 2HD5B 3K7AB 4HJ9A 3JSVA 1GUAB 1E90A 2EYJA 3T1YL 3U7ZA 5L95C 3QWZB 2N8NA 4DR1Q 2QEXA 2MX2A 2RHQB 3NUCA 4K8IA 1B44D 4G7ZC 2Q8IB 1OEYJ 2Y5PA 1EQQA 3D3RA 2B2WC 1SR3A 2F0TA 4K2LA 4B3MQ 3B08A 4DHJB 2XGTA 5BN5A 1T9HA 2DBYA 2JA7B 5J22A 1FXTB 1JMLA 5D3IB 4RFBA 1HA6A 3VUXA 5J2RA 4A3PA 3QX1A 1D2BA 4RF0A 3S1QH 5E6JA 1N33L 2GBRA 1HA5A 2SEBD 1HJPA 2M00A 1F2YA 1T3QA 1X3EA 2F0SA 1BF4A 5CTRC 2B2TC 4ZRIA 3ZUNA 1P9DU 1C78A 1LABA 1XF5L 4IPDA 3AE6B 3Q8BA 2ZVNA 4A20A 2MP2B 3QIAA 4AP4C 1F2MA 3PO0A 2J7QB 1QUQA 1SN8A 5IYBG 2FIDA 3LB8C 4NQLB 5AZHA 2E75C 1KRHA 1SDFA 2IO2B 3IVFA 4LWCA 4DK1A 1QKZA 2NVQB 4BA1I 2OHFA 4MEMA 2WV6D 1FNUA 2R92B 1P16A 1R4MI 2W82A 3Q8FA 4BA2I 3ND8A 4ZOHC 1DOMA 1L5PA 4WJPA 3EVQA 3BVMA 3DLLA 2R92H 1NI2A 3KF8A 1KXLA 4FXCA 1IGCA 4IPCA 1IUEA 1T0SC 3P75A 1LM0A 5BMIA 4L23A 4OGQC 3AE9B 2JXXA 1HNXL 1A2UA 1RL2A 1A6XA 4AH6A 2G4DB 1UEBA 5EKLA 4A9AA 1L6VA 4CQNA 2LD9A 2EE1A 1JALA 1M1KC 4A76A 3N32A 2WHIA 1VQDA 2LMCB 5J18A 2JZPA 5IAAC 4B3TQ 5I2YA 4WJOA 3KLWA 2VL6A 5A35A 3VDYA 1IBKL 5CHFA 1XTCD 2ZXOA 4RKBA 4IUVA 3O65B 2V0GA 4HSPA 1I4PA 1VQGA 3GDEA 2WINB 4YY3L 4GSWA 1TWAB 1Q81C 2IX3A 3AQQA 4HJ5A 3V6CB 4AQYQ 1TWAH 3L7ZC 5DM73 4JCVE 3CIRB 3MHSD 3RUIB 2JJQA 2K4KA 2EVBA 5CR3A 4ULLA 1YJ1A 3RR5A 3HOWH 1SAPA 5C4JB 2GBJA 1IYJB 2DGYA 2MP1A 4OXPA 4IM2A 2WDTB 2Q5WD 4QGUA 3NBHB 4Y7NB 2M17A 1V6EA 1XT9B 2O2VA 4ID6A 2JVCA 1E1OA 1A8VA 3S1NH 4PK1A 1TWHH 3C0RB 2WNMA 1DOYA 1JRUA 1DONA 1WGDA 1G291 1CFMA 4MZ9A 1STHA 3J81E 4DV2Q 4FF2A 1SSNA 2N9PC 1BBWA 1MHXA 2LXCA 3SHQA 2V4IB 3NQTA 1MVKA 2GBNA 4YSZB 4QY7A 3ONSA 3Q22A 1WJ6A 2VZAA 2IO0B 4B3TL 2QDBA 5AEKB 5FO9B 2DHZA 3TCAA 3AE8B 1CHPD 4BKSA 1WGYA 2KDMA 2PQAA 2UYZB 3OJ4B 5COYA 2BT6A 3VYRA 4IFDJ 3E9SA 3Q3NC 3W5OA 1SNDA 1JROA 4TMAB 1VCBA 1U4RA 4JOIA 4FHKA 1TWFB 3NS1A 3DHQA 1FMAD 1ZEQX 2B63H 2RVLA 3GB1A 4DUZL 2ZXRA 1TWFH 2CFMA 1VR9A 2N7JA 5EDSA 3E9HA 1L0VB 1SE4A 1OTRB 5EQ0A 2ICIA 4JI8Q 4C2MB 4OELB 3U9SA 2L9HA 2LUMA 2N7DA 1IPGA 1OXSC 4DV5L 2WXRA 1Y8OB 2UXDL 3CC2A 2JYOA 1S40A 4GIVA 2LKVA 4KY7A 2UUCL 2N1VA 2QSDA 2MP2A 2MUYA 2ZCBA 4ZRKA 4ZRJA 3ER0A 4YXDB 3ZGZA 4A3GG 1I42A 4KJNA 1GUSA 4HVBA 2FJ2A 4DV2L 3AFQA 3L2PA 5IOIA 4DWFA 2R6GA 3N30A 1T0RC 1YX5B 4OVVA 3E0JA 1EY9A 1E0ZA 1GB1A 4US9A 4WORA 1WGRA 4F87A 5AUIA 5BN4A 1ZKHA 3GTKB 1WTRA 2IX0A 3TEHB 2OJWA 3GZNI 4EEWA 1UE1A 2V4LA 3GTKH 3N1XC 5C3JB 5EKKA 4HCNB 1VS0A 4O1NA 1VQLA 4USAA 3PZ8A 1Z9FA 2Z4HA 2CHXA 2SAKA 3NHEB 4G50A 1EY5A 3HOZG 2DLBA 1E7ZA 3E5SA 3HOWG 1EQTA 2G45B 1EU3A 3DUZA 1LT4D 2PW5A 2SOBA 1MG4A 2BB6A 2GBKA 2IBIB 2K3UA 1I50B 3U50C 4HROA 4KHPQ 1UE6A 2L0CA 4KSKC 4XTCS 2L1AA 4JI8L 1KLUD 1WI0A 1GB4A 3OTOQ 1PFMA 2Y5BB 2PPBC 2MSED 2EYFA 3IFDA 2KANA 1PHJA 1CZGA 1PZKD 2V1CC 3MTNB 3U52E 1TY2A 1STGA 1JR0D 5GAEC 1X56A 1R4MB 3IAS1 5L83A 3A7AB 4JI3L 3P4QB 3LGJA 2NS5A 1Z7TA 1N63A 1MJDA 2PQEA 4DV1L 3E6ZX 3PHWB 2HUGA 1NVID 4C1NI 2D2CC 2UUAL 3W5UB 4APVA 1KAWA 1K53A 1JOOA 4A3FB 1K28A 4KGTA 5JHBA 1JWSD 4A3FH 4XDXA 2KLGA 1A70A 3PGEA 4HRSA 4A3CG 1DOLA 3KK7A 3H3VC 2B8GA 3IAM1 2A6EC 3T1HQ 3QAQA 2B63G 3U58A 4GMVA 1F2ZA 2WP9B 3UI2A 2AKWB 3Q23A 3ETRA 1J7CA 1QOFA 1Y1WH 3EECA 4WFN3 4PMBA 2EKEC 1ZYRC 4A3MG 1QOGA 2R93H 1V86A 4H02A 1RCVD 3EQLC 4ZAIA 3OTOL 1XCQL 4PT5A 4QQBX 1E10A 3Q8AA 3SR6A 1OXTA 3RNAC 2K5HA 5CV7A 5CMDA 3ZJUA 2QCZA 1AZPA 3HEJA 2KX3A 3KWVA 2RA4A 3W5VB 4CDDC 4NXNQ 4II2B 3LDZE 1D3ZA 3R66C 4BOSC 1NCVA 1J7BA 4R4CA 4DUYL 3DQVA 2K0PA 4GN5A 4RAUC 2C7MB 3TP5A 3VR4A 1C3TA 4WH4A 3ECIA 2BTEA 2FMCA 1CSPA 4GN4B 1SE8A 3RLOA 4A3EB 2OF1A 3K7UC 4RHRA 3CCQA 2ZPNA 1WTHA 4JBJA 1I4XA 5E6OA 4HPLB 4A3EH 1K8OA 4PZ6A 3EFXD 1GHJA 4BWGB 2XIWA 5G55A 3T1HL 1SMXA 2IPKD 1QNUA 2YV5A 2I07B 1EF1A 2Y0SE 2KQ7A 4YCVA 3NTIA 4K7UA 3VA7A 1FL0A 1VQOA 2NZ1D 3P4SB 3PUYA 4IPGA 3AYHB 2KOXA 1PYBA 2IHEA 1CA6A 1QZEA 1ESRA 3KYCD 4JIOU 1JJGA 2O5IC 1F1HA 1VRAB 2B3AA 2Z0SA 3MEFA 2JSVX 3K8AA 4AIMA 1Y8PB 2A6HC 1I6HB 4E71A 2PI2E 1SNCA 1O7LA 1LYLA 4NXNL 5JVH3 1BT0A 2JQRB 3I90A 3DHHC 3UQAA 1CI3M 3FDTA 3R2TA 4DR4Q 1M94A 4ZHOA 3GV6A 4DR6Q 1D8LA 4ME5A 4DU9A 1VJKA 3X3MA 2KWVB 2K6AA 1PDQA 3OIQA 1S5DD 4A8XC 1MI2A 3PO3H 4C3IG 1K8GA 5H1SE 3SEBA 2VUMB 2KJ6A 4W9LA 1K9MC 3JAML 1OQRA 2PVGC 2DENB 2K03A 4KZ0A 1V1PB 3LWUA 4CDEC 1JCKB 2C9WB 5GAGC 1Y1WG 4QUCA 2PE9A 5D7GA 2OWOA 3BZCA 2R93G 3VRBB 4O0AA 3AEBB 3GZNB 2EYOA 5KHOA 1S3OA 1EYAA 3OPOA 2WWZA 2MNAA 3VYUA 1TJEA 1Z6HA 2AYOB 4K1RB 4NQKE 2R7ZB 2Z0DB 1VQMA 2KCCA 2JA6B 2LJ5A 1I3QB 2B2VA 3HM6X 3VAWA 2YVCA 4PS7A 1V80A 1N6ZA 2R7ZH 2KXJA 4BBSB 4W9KA 4A6QA 2JA6H 1I3QH 1UWMA 1VLBA 2L52A 2WXIA 1NAPA 1D5XC 2K05A 2IGHA 2L12A 1PH2A 2O2LD 4DR4L 4II3B 5EPJA 1SE9A 4M8MA 1NYRA 1Q3LA 1MBYA 4HAEA 3A1QB 3ZNHB 5C44B 4EFOA 3L0OA 5C4XG 4JL9A 3HOUB 1C7YA 3GTGB 4LTUA 2NVTH 3H6MA 5EAYA 5JXVA 4MDKE 3HOUH 2B2UA 3GTGH 4DKAC 2FBWB 1ZPSA 4LFAQ 2L76A 1K8RB 3ICEA 1YQBA 4OW0A 4IW0A 4XQJA 4C00A 2KENA 5DM63 1E8YA 2X6GA 2CH4W 3EGRA 1AH9A 1PZJD 4RGMA 1TS4A 4CDCC 1BCPB 1F9PA 4BKSD 4BY7B 1W6JA 1NMFA 1G6JA 3I91A 3AULA 1SMYD 2CS4A 2KDIA 4JPSA 4BY7H 4DHJD 1EIFA 3I56A 1IBLL 4XX5A 4ZKCB 2BDOA 2N7EA 2PMVA 4B9KA 3RYTA 2A74C 1Y1VG 4JI0Q 1TZ1A 4LF8Q 2HJ1A 2F3WA 4MGKE 2V4DA 4IJLA 3W1SC 2N3SA 4JVZA 2K6DB 1S5CD 2B29A 3VR8B 5DNFA 4FF1A 1R4NB 2M1MA 2ID0A 1LFDA 4AWJA 3AECB 3J7ZC 5IGFA 2KFKA 3IHPC 1OO9B 1KM7A 2E2JB 4GKKL 1PRTC 5IGGA 4OEMB 1JOKA 1R7SA 1XNQL 3AU4A 2LS01 4LFAL 2RHSB 3L3OC 2D5GA 2E2JH 2WXKA 1STBA 1IL2A 2D10A 1A3UA 1HH2P 2FFKB 1VQ7A 3AE4B 1V5OA 3BYYB 1C4QA 3OMGA 5JEAJ 4W9IA 3U4ZA 4DDGD 1WYWB 3GTJB 3NZUA 1VQ6A 4B3SL 3KYDD 3F2UA 3AEEB 3UINB 2ZCCA 3IG3A 3I73A 3QB3A 1N32Q 1NJIC 3AU5A 4OWWB 3KVFB 2RSNA 1YNJC 4R9WA 1YN3A 3ZVVA 4L6TB 5IY0A 3FVQA 4GU2A 2IX1A 1GHKA 1G2TA 4DGZA 1LTAD 1ZXIA 4MHEA 3HKZB 3O13A 4JI4L 3J7AV 3ZDTA 1BR9A 1X32A 3M9BA 1YBYA 4CKCA 1RFAA 1LO5D 1K83B 3MEHA 3DVNV 4B3RL 3NWSA 4ZKBB 5HGTA 1SF0A 1IYFA 5HHDG 1HR0W 1F2LA 3GO5A 3OLMD 1K83H 4FBJB 1WX8A 2WAQG 1EY0A 1WCMB 3C8YA 4K3CA 1EOVA 5I2XA 3N52A 2WXFA 4JI1L 4RKLA 1UAPA 1KAAA 1WSPA 1SEBD 3HUIA 3KYHC 3P63A 2PZWA 5CV5A 3I4NH 4E74A 5M5WH 1QVCA 4IWPA 1F9SA 2KAJA 1KRTA 1QOHA 4KKUA 5DCNA 5EE3A 1CSQA 3ZW3A 4KVGB 3APDA 4G0NB 4WWNA 1UNSA 4K7SA 2ZM6Q 5FJ8H 1S4ZA 1ZE3D 1EWHA 4IPHA 3MWYW 3FILB 2D2QA 3C3LA 3UDIA 2WQYB 3CD6A 3I4MB 3M4QA 1X55A 2UXCL 3I63C 3A9JB 1ENAA 1KNEA 3M3YB 3MC9A 1EU4A 3K5NA 5JJKA 1P8LA 2K1BA 1PFDA 3VA5A 1AW7A 4JG2A 4HIDA 5JJIA 4EQNA 3I72A 1QCBD 2AHOB 2PW9A 1L2NA 4EGVA 2V1YA 1K3RA 3NZSA 3R93A 4MSQB 5HG2A 4PYZA 1SE2A 3GTOH 2EJGC 4DAYB 3GE8C 2E2HB 4XC2A 1STAA 1XQQA 2ONQA 4EQOA 1OEYA 2N49A 4HN7A 4GB9A 5C3WA 4A3LH 3C2PA 5C5LA 3DWQA 4JYAQ 2K8CA 3VTVA 2VB3X 2LGYA 2Z4IA 2A69D 2CR5A 3ALBA 4IFDH 3B2FA 3QIJA 4ASWC 1KJTA 3MTSA 4F7ZA 1F0ZA 3ND9A 2BOSA 1TGZB 5LL6X 1WY8A 2IY0B 4JI6Q 1IW7C 3A56A 1BBUA 1NSNS 3A8KE 1G6PA 1YNTE 1NMGA 1Y8RC 2IJ0A 2KFJA 2EYHA 2IGGA 4KY6A 1EZ8A 2NVYB 5FLMH 2EPBA 2JXMB 1YVCA 3B9JA 5M5XH 3PS6A 3VH3B 2RF4A 2KHJA 3RZDB 5IWAQ 4X66Q 1PQSA 1L1OC 3TP7A 1V49A 5M3FH 5LXHA 5IP7H 1UBIA 2JSOA 1YHAA 4RA8A 3MHZA 1HQRD 3H3VI 4NXML 2VH1A 2J53A 1E8XA 3MJWA 2PNRC 3RNFC 3I4NG 2HDEA 4L5QA 3Q8EA 1FPYA 2MJEA 4LF7Q 3T9LA 2A68C 2NN6H 4JYAL 1K8MA 5D2MB 2EYPA 2DNFA 1YIJA 4XT3B 1K3BC 2JYEA 5A2QL 3UE1A 4XQQA 2MQHA 4WWPA 1LV9A 2BB5A 4A3DG 2B2YC 3K5LA 3DVGY 2BE5D 4BBNF 2PCFB 5ELNA 4DV7L 3VR9B 1BXTA 1RTNA 4AYBE 2IYDB 4LF4Q 4XDDA 3IT4B 5JAVA 3EBEA 3B6YA 3E3XA 4YWMA 3L13A 3CC7A 1TKGA 2X8XX 4ZHPA 5E7NA 4XT1B 1HZBA 1UBQA 5M3MB 5C3EB 5C0XG 2CHZA 4K5XA 1WYDA 1O7YA 2BDNA 1LXDA 4W9FA 2NTSA 4KI0A 2R2QA 5M3MH 5E4WC 5C3EH 2BA1A 3SR1A 4A3KB 3B1LX 3BS1A 3NK9A 4A3LG 1F2RI 1OQYA 2BF8B 3IRBA 2BWES 1FGUA 4ILWA 4A3KH 1XX8A 1HUNA 4LLGM 2KHSA 5IYCH 3HKSA 2DNEA 2XRQD 3A8JE 2VXWA 1LLRD 4ZUJA 2JQOA 2K32A 4R4TA 1WWTA 1QUQB 2FAZA 3KUDB 3V3XA 1WX9A 1HTQA 3H8HA 2RMMA 1QJOA 5ELOA 4JBKA 3H9DA 2D0PA 3MXGA 4P73A 4C7ZA 1J0GA 3N9YC 5FLMG 3K5OA 3T16A 1KL9A 2FUHB 2RQXA 2Q2IA 4IUUA 2M4NA 1HR0L 2F4VL 2F0HA 1BDOA 1XLNA 3WIMA 3M63B 4GOPC 1O7ZA 3PV1A 1JWMD 1TWCB 1WM3A 3Q2AC 2DJGC 5M3FG 4CO7A 5IP7G 5JPNC 4FF3A 3S16B 3M62B 4HK2A 4CKBA 1YNNC 4LUZA 2GI9A 3PHXB 1FIQA 3GOEA 3OAWA 2LWPA 3K0XA 3S16H 2B8FA 2KCMA 4KV2A 1A5RA 2JA8G 2WACA 1EOTA 2NBVB 2RPQA 4BBNC 4PV1C 5T8IA 2VNUD 3ULPA 1C8CA 3SFEB 2PI2A 1A0IA 3VFKA 4XYCA 1NBWA 1ICFB 2NN6G 1EL0A 1HTOA 1RFKA 3EROA 4ZDVA 4O2DA 2N1WA 4EOYA 1SYEA 1VMPA 3BDCA 2RBMA 3PIOA 4FF4A 4LFBL 4KZCA 2A5HA 3QO2A 3T1YQ 2BS3B 4MT5A 1Q10A 1WJ4A 1FYCA 3S2HH 2KWCA 3WAPA 2Y5CA 3VDZA 2CU3A 1PH5A 3KW5B 3VHTC 3QG1A 5IYDH 2UU7A 2CW0D 3L4PA 1I4HA 1LQBA 1TTNA 1IKMA 2MH7A 4BKTA 2ZTDA 3MJ5A 1J8CA 2EKIA 3HS0C 4ZRZA 1C76A 1P0RA 2K9XA 2KVZA 4XIGS 4US8A 2KT7A 3Q3MC 1N33Q 4NZLB 3TREA 4OONA 1HCZA 1SYBA 2RD0A 4RCOA 1JB7A 3ULJA 1VQ9A 1HXYD 2KN5A 2KCTA 2O2VB 5HKHA 4BOZB 4I6LB 4J8QA 3M4OB 1WM2A 2C7NB 4WJNA 4XDCA 3GD7A 1U4MA 2L8JA 2C7HA 2N0SB 4QJFA 4R1JA 1MI0A 3R2IA 2FCQA 1GD7A 1G8ZD 5IYCG 5D6JB 3PMFA 3HOVB 3S17B 2F3VA 3EJIA 1V5TA 2M19A 1XPUA 2WB1B 3HOVH 2EMSA 2QCPX 3K7AH 2LGSA 3K57A 3P7JA 2RDHA 4LUOA 2QILA 1YITA 2PQAB 2K01A 3H09A 2YEPB 3PUZA 5G2NA 5IA7A 3K80C 4H13C 1FRDA 2I1KA 2F0KA 1HUMA 1CM9A 5IP4D 2HIVA 2HTME 4W9DA 1WVLA 4OO1H 4HDQA 1HNXQ 2AL6A 1ZXTA 1WF9A 2JT4B 4TVAB 3APCA 4JGHB 4EZKA 2JA7H 2I1JA 2K1FA 2F0WA 2X69A 2PE6B 5C4HA 4K0KQ 4C4VA 4DPGA 4BFRA 4DNRB 1I94L 1J6QA 3PIP3 3ZRFA 3L17A 2RSOA 5H8YE 2O6VA 1IBKQ 3BIID 4DNTB 5TR5A 5GXGB 3T13A 2GA4B 5IT9L 4ALPA 4L1BA 5AZGA 1Y8NB 2K22A 1Y56A 5I6WA 2AX5A 4J3OD 1YN5A 3MZ5A 4YY3Q 1FRRA 1HNWQ 1WTPA 4X65L 4DHZB 2NR2A 1YJIA 2ES2A 3KBXA 2CVRA 3RLFA 2I2YA 3TQYA 3EN2A 5IYDG 2NVQH 2K5NA 1STYA 5M5YB 1ILPA 1NYQA 2R2OA 4XWTA 4JC0A 4LK0M 1BCPD 1GC6A 1SBBB 3IL8A 5M5YH 1G2SA 2Z9HA 4LFCL 4UAIA 4F8CB 5KYLA 2F52A 1UD7A 2BGFA 2WXMA 1RF2D 2ZT9C 5JJZA 1DD2A 1S5FD 4K0KL 4FP5D 4GNXB 5EE9A 4L8JA 1GUWA 2NTTA 5I4DA 1HRJA 1WGGA 1ZXHA 1VQFA 3CPFA 4G11A 3MXPA 1KLVA 4BBRB 2CHBD 3T3OA 2LI5A 4FXKC 3TP8A 5IP9H 3PREA 4BBRH 4C3JB 3BVZA 3TMPB 1HZAA 3P2BA 2LSSA 4HKZE 1PTOF 1CKNA 3TS2A 4M00A 2F0IA 1HNWL 1FEHA 4C3JH 1UZXB 3R3OA 3IXSA 3U2SC 1TXYA 5CV6A 5CGKA 3MVVA 2QDLA 4KKSA 1PXUA 2OQ0A 3NRZA 5I9OA 3PLVA 1BQQT 1Q90A 1X3GA 2EXZA 4XYOA 4DUZQ 3OW2A 2C60A 2J0JA 5IKCM 3TBIB 2X6LA 4AYBB 4L5TA 3PF5A 2FCNA 4IJHA 2KD0A 4NB3A 1OXVA 4RWSC 1F77A 5L37A 4L2YA 4ICUA 4DV5Q 3ZNID 2UXDQ 5C4JH 2MBHA 4ICVA 2UUCQ 3DWAA 5BYSA 2JA7G 1E2VA 2VB2X 2LFIA 4NDXA 4Y7NH 3IKJA 3C1FA 3SK4A 1AE3A 1J9OA 5BN3A 3Q3OC 3UIPB 1KABA 2A19A 2MBQA 3PVLA 4IC7B 1IP9A 1SSOA 5FO8B 2QKIC 4IUTA 1SNOA 5LMUL 2QA4A 3HOZB 1N60A 4A3BB 3A74A 4JI5L 4OVZA 3ZJVA 5CBAE 4KKJA 3GP7A 5IT9c 3WOFA 4A3BH 5CHVC 3H0GB 3K81C 1VQ8A 2JWUA 2Z6KA 2KJRA 1ACCA 3GV3A 2G1EA 3ABVB 3H0GH 1B3AA 5FLXL 2LY7A 5J1ZA 4QMGA 3CW2C 5C3XA 4I6NB 4HMJA 3T51B 2G9DA 3SVMA 1XCTL 3OJ3A 3PZDA 1GPXA 2JK8A 2WKDA 2E2IB 3I57A 3PSIA 1EF5A 1ZOYB 1ZW7A 2R92G 1YD8U 2QC8A 2E2IH 3OYYA 1FXAA 5G3LF 4DF7A 2PTLA 2W3SA 1ASYA 1KC8C 1J5EL 4OZBA 2TSSA 1PTOC 1BUIC 5C2TB 4C2MH 5A2QE 1CJEA 3ZDMC 3CU7A 2KWUB 1EQVA 2BYVE 3ZXRA 5FO7B 4JI3Q 4KKTA 1A2TA 1Q1BA 3HP3A 4XGAB 3BDLA 3JW0X 4DV1Q 1JQ4A 1TQOA 1GUTA 2OJRA 2WAQE 2UUAQ 1WTOA 4ZCKA 4WJWA 1ILQA 4DFAA 4BY1B 2ENBA 3DBRI 4HWIB 2E76C 3E0EA 3I2ZA 1D1IA 1EEID 4BY1H 4GS3A 2M8SA 1PH6A 2M9VA 1I7HA 4LJOB 4DV0L 1JT8A 3CKIB 4JWUC 4FN2A 2KNBA 3DDCB 5DPWA 3J81j 4QIWE 3Q24A 5GQOA 4R3DA 4GNXA 4U673 3KDFA 1VDVA 4EKUA 2YEPF 1I50H 2Z6BA 2WIIB 3NENA 2CKHB 3DBLI 5CYUA 1WE6A 4WIPA 4GOCA 3I55A 1VF5C 4KJOA 5DLQE 2HDLA 2J4XA 4LDTD 4J1MA 3H94A 3CRKC 5EPLA 1EWYC 4LJZC 4ZRPA 4UPAA 1PYSB 3U30A 2JY6A 3V6EB 4DUYQ 3LNNA 4A90A 3FP9A 2QIEB 1KOTA 3CAMA 2Q8TA 1QQRA 1YZ6A 2MBOA 1D4BA 3WDNA 1WE7A 5J3BA 3RPFC 1E6EB 1K0RA 5E4XA 1XMOL 3PO2B 2G3QB 5FLXc 3U7DA 2KA7A 1CA5A 4L5SA 4FO2A 5T1GA 1S1QB 2H89B 2LASA 3HOYB 1MHHE 3PO2H 1WZ0A 3JAMi 2D3CA 4CBVA 2KMCA 3AE1B 4AJWA 3A5UA 1B4OA 3HOYH 3UI3A 4HR7B 5IGCA 3UE0A 3L54A 1HE8A 1V43A 1MG8A 4M8AA 3T8MA 2RR9A 1ISNA 3AV8A 3GTQB 3NXWA 3E9IA 2M0AA 2AL3A 4ZRQA 3GTQH 1H9MA 5IIFA 4ANUA 4M01A 1EIHA 3UIOB 3BVGA 1D5MC 1CKMA 2XTIA 3H7PB 3GE3C 3S2DB 2ZW1A 4AQ7A 5KRUA 5LLIA 1AZQA 3C19A 1VQBA 3U4EG 2D3GA 1TIID 1F52A 2A1AA 2KQ4X 3CMMB 3N6RA 1SMYC 3VQIA 4C80A 1IBXA 4U68A 2L3ZA 4BS9A 3F2DA 2UWQA 2GB1A 4CKEA 3BDOA 4JW0A 1WOCA 2K52A 2JE6I 5T1IA 1EYGA 1LM8B 3MFYA 1X54A 2F0UA 1WRIA 1U9RA 1IYVA 2I5MX 2MA9B 4RMAA 3ZJYC 2GOWA 1CK1A 4PYUA 3QJYA 2KFKB 2O6VD 2WS3B 2VY3A 4B0MA 1KDCA 2QW7A 4S0RA 1DXMA 1NNXA 1U5KA 2EIFA 1I35A 4R4QA 2PNHA 2KC2A 2Q2TA 1P98A 1FD6A 1WD0A 2MJ3A 3W1SA 3QHTA 4E6IA 5KNDA 5FK9C 2OQKA 1YHBA 2LXJA 3TS0A 2RDBC 4MGIE 2LJIA 1QVGA 3H15A 3FKYA 2MPMA 2KACA 3P42A 1WJNA 2BKFA 1I6HH 5LMNW 2DN8A 2E74C 2M2LA 3NPPA 3Q14C 3AEFB 1XLQA 5BMHA 4X57B 3CPWA 4RF1A 4OWTB 4A3FG 1AWDA 2HHHL 3CRLC 3DXJC 1IXRA 2JA9A 4J6IA 3Q3FA 1B9NA 3CCSA 5EKIA 3AN1A 1Q46A 5IT9E 2SNMA 2VUMH 2HJ8A 1PA6A 4A3OA 1OTCA 3K58A 2N9KA 3OWEB 2V9HA 3CCJA 3S24A 2OT2A 5K36H 3SU8X 4XYQA 3MA2B 3GS2A 4A3JB 1FNVA 3H7SA 2Z1CA 2XRSD 4KIKB 3KUPA 3CQZB 4IN3A 2MO1A 4F8MA 2BQQA 2BYFA 2E8GA 1ROEA 1IBLQ 3FPPA 5E3FA 2K25A 4MSMB 4HEDA 3DCGA 3CCRA 1A63A 2DZKA 2NB0A 1BBXC 1TKWB 4HJKA 2K6QA 4BBSH 1FCLA 5TSSA 4X62L 2N78A 2TMPA 4DAVA 2IGDA 3DBLB 3AI5A 5C4ZA 4GN3B 4RH6A 4S3SA 4C7YA 5FOBB 1FR3A 1UH6A 4XWWA 4A3EG 5C44H 1SYDA 1V9PA 4GKKQ 3TN2A 4DR2L 1QG7A 1UELA 3EC8A 3KUCB 5GADC 4LNFA 1VZ6A 1XNQQ 1PH8A 5CX3A 1CKOA 1WJJA 4P72A 2MHVA 2L0TA 4IM3A 1KTKA 5C0XI 3H7PA 4OX9L 1JWAD 4PQXA 1M90C 1SNQA 2A6ED 3SK8A 4B3SQ 5M9OA 2EQSA 2AWTA 3G7LA 3PUVA 4X64Q 1TZOA 1JRPA 2KTRA 1XEEA 2FE8A 5BR8L 3ZNZB 2XSCA 3I3TB 1YJ9A 4WRDA 1S3SG 1SB3C 2LVPA 1IKLA 3RMHA 4KGRA 2A69C 3IFTA 4RCNA 4JI4Q 2F0GA 3R7RA 5I9PA 1VZ8A 3TEYA 3K9PB 4HIKA 2KCNA 1HTPA 3CCLA 1KDBA 1PFBA 1XTDA 3PO3G 3FAHA 4B3RQ 4YSYB 1EY4A 3AXCA 2BYEA 3SDZA 2K5QA 1RAXA 2R7DA 4Q5VA 2WKCA 1YHQA 1J19A 2DJFC 1CTMA 1X65A 2VUMG 1XWEA 2ZTCA 4QIWB 4JI1Q 4CDFC 3JAMc 2ZNVB 1YI2A 2MWSB 1T5XD 1U4LA 4OHJA 2BWFA 1RWSA 3PPAA 2WXQA 2XNAC 5LHY1 3E56A 4UP8A 5FLXE 4CJ1B 1WTQA 3S1MB 1QLBB 5KEEA 2P5ZX 4H44C 1X3QA 2K28A 4KHZA 4POFA 2NN6I 3S1MH 2KVMA 1S5ED 2VS1A 3SXHA 3GTJH 2R7ZG 2N9XA 4WAFA 1BVSA 4X64L 2JA6G 1SLJA 4GDKA 3HFZB 2UXCQ 4RM9A 4BBSG 2C5LC 1Q1EA 3Q6SA 3J9CA 4ZQ3A 2L32A 4E3CA 1PGXA 2H4OA 3J7A5 1NR2A 4TUUA 1E7VA 2A6HD 4P1BC 5C44G 3HOUG 1XLOA 2X38A 5FR3A 3P4RB 3L9AX 3D0FA 4KIKA 4OIJA 1TS5A 5CBEE 3PTFC 1WCMH 2HD3A 4L5RC 1RODA 3FKIB 1KDAA 2F0QA 2MBBB 1LT6D 4KLKA 4A4IA 3ZRCA 3H6NA 2WDQB 1MFWA 2LZ6A 3FKIH 4FJVB 4LJPB 5IODA 2J52A 4MJSA 1JE4A 1U4AA 3RN2A 4BY7G 3S9WA 2KEEA 3ERQA 1PH9A 2WP8J 5LMNL 3HVZA 5DEHA 2DAFA 4TKOB 1L2FA 2JA5B 2CH4A 1ASZA 3NUHB 3NVYA 1P1AA 4DXAB 2AQ3B 2JA5H 3I4MH 2NBWB 3D31A 1NBFC 2INNE 3M3YH 2ON8A 1GOZA 1P7FA 4MH0E 3X23A 3LJ3A 2LVQA 3I9V1 5HY6A 2D62A 4NXMQ 5E6PA 1P7EA 2QJLA 2Y0SB 3C46A 4X3KA 4Q0FA 2C5CA 3VR6A 4GKJL 4X6AH 2NYZD 3DPDA 4LNIA 1A15A 2E2HH 4JV5L 3HZXA 3DWMA 3RN9C 4C3HB 4TRDA 4P71A 2JEBI 5AJ3Q 1Q82C 2GVAA 1Z2MA 2L0FA 2WXJA 4FJYA 2L1BA 4C3HH 1B8AA 3N1ZC 4IZ8A 4MIUA 4PNYA 4FYDA 4DV7Q 2JZZA 1L7YA 4LDTB 5AUKA 1X1MA 4MTKA 4YCUA 2DZIA 2JRHA 4EZJA 1E2ZA 3GTLB 4WAAA 2H5XA 3HKZG 3T4AC 4IOCA 2WXGA 2NVYH 3KBGA 1WR6E 4BKGA 5EBCA 3FPUB 3PF4A 3RNGC 3JC66
chains in the Genus database with same CATH topology
1CQVA 2A73B 2CW0C 3CWIA 3QOLA 2IWHA 1JOQA 1SYCA 2N9LA 1V8CA 4HJGE 1R4QB 3OHXC 3HOXB 4KTAA 1OQQA 4A93B 4MN3A 1D6EC 4A3IB 4RGNA 1RYJA 4ITKA 2K33A 1PRTD 1IHZA 1H9RA 4WWMA 3EUB2 2F4IA 2LEKA 1RHPA 1BCPF 3FRPB 4QB4A 3AB5A 3NSWA 1EIGA 1F9QA 2JA8B 1SE3A 1NEKB 3MC0B 4NKLA 5JPMC 1NENB 2NMQA 1KF6B 2KJXA 1TWGB 2BW2A 2OEOA 5AFWA 1E9MA 1V8QA 5NUCA 4CJ2C 5CV9A 3QOJA 4G4KA 2I46A 1C77A 2KN4A 2MJ8A 4YIJA 1B9MA 2WU5B 1TS2A 1I4QA 1Q8IA 4IFDG 2B2WA 4R8IA 3P20A 2XWBB 2RDGA 1S5BD 5ELBA 3JAME 1DM0B 2PLPA 3M7GA 2F0EA 4D2KA 2K5DA 2B2TA 1BOSA 2XWJB 3V05A 4RHSA 4RNAA 2EYLA 1WTXA 4EQPA 2E3TA 1MSHA 2EELA 1GUGA 1BCPC 2NVXB 1ENFA 1CHQD 3W9CB 1DZ1A 2FHTA 1L0YB 2JXTA 1Q12A 1TY0A 2WXNA 4XXEA 3G6JB 1PGBA 2LHDA 3VR2A 1HQMC 4NJCA 3B2GA 1C4AA 2YU9B 4KV6A 1N62A 5I6YA 2K5PA 3AEDB 4L63B 5K5PA 1HFGA 2EY6A 4F7XA 2KWDA 3PV0A 2NWGA 2BS4B 2HCCA 2FMMA 3D6WA 2K7VA 2E2DC 3GQBA 5EE0A 3AU7A 2YYZA 2WDVB 2PZUA 1IW7D 1R9TB 3ZQ4A 1L0XB 4YSXB 1J7AA 3D4RA 1ZP0B 1SYFA 4N9TA 1JWBD 1BMLC 1N5XA 3AMUA 1HZ5A 1MD2D 3GTPB 2F0VA 3TEZA 1YJJA 1LTRD 3I70A 2KEDA 1EY8A 4P16A 3HG9A 1RM6C 3H91A 1GAQB 2EDGA 3NQIA 3S15B 4Q2JA 5KGUA 4X3SA 4NW2A 4ZK9B 3W3AA 2NBFA 2A68D 3PZ7A 3S1RB 3K6OA 2BS2B 2JEAI 1DYQA 3HVDA 3X3NA 2VZKD 2J42A 4IUQA 1YQ4B 3K59A 3M7NA 1H9JA 1UEAB 3DEOA 2F0NA 1B2TA 4KGSA 1QNKA 1M4VA 4X3UA 2CQAA 1LTBD 1FD7D 4G57A 5E1FA 2F0DA 2N55A 3AE5B 3S1QB 1FFVA 4YWGG 2EZVA 1JWUD 3TDQA 3TUOA 1E2WA 3MXNA 4QF4A 3RD4A 1H9SB 4QUFA 4EVOA 3OOCA 4TQ1A 4ODGA 2V3NA 1EZ6A 2RDFA 1QILA 1B53A 4DXFA 3TZDA 2O4XA 3Q0AA 1V97A 1KFYB 2QF7A 5C6AA 2F0OA 4YTNB 2H1EA 4JBWA 3AEGB 4JX1C 1STEA 2D5DA 5JOBA 2LFNA 1XO3A 5CORA 1YNND 1PGAA 5G5GA 3VYSA 4QCLA 4V0BA 1RKNA 2O5JC 1SNMA 4A3GB 1JICA 3AE7B 1TS3A 2ZXPA 1QB5D 2Y3AA 2M56B 1ENCA 1VDZA 4OO1G 1L6UA 1KNAA 3K5MA 5IOCA 5JEAH 4B9WA 1FCCC 1TKEA 1HZ6A 2EOTA 3S14B 4OIKA 2WXOA 4K6LA 3HOWB 5JVG3 3NVVA 1CT1D 4ZUIA 2HQEA 2INPE 3S1NB 3NWTA 1TWHB 1FO4A 5KNBA 2F0MA 1SYGA 1WD1A 4K2KA 3HRZC 1X3PA 1IBXB 2CJNA 1SJHD 5C0XJ 4P2CB 3RFZB 3ZJTA 3KLRA 3NTKA 1HHVA 1E0BA 3ITPA 5EE1A 1EY7A 4FXDA 5IGBA 4OZAA 4DAPA 1PZID 2B63B 1CZPA 4YTMB 3SE0A 4ARCA 1AP0A 2OEDA 4A3MB 1H9SA 2JX5A 3D4WA 4C3JG 3DWPA 3M85A 3KQ4A 1O78A 2SDFA 1PRTB 1BUVT 5ELEA 4B9XA 1KH0A 3IT6B 4K14A 1CZWA 2MEKA 3TZUA 1DJRD 2V3PA 4HEA1 5JEAG 1I6VC 4F88A 5IGDA 1DCZA 1QE6A 1STNA 1EY6A 5IGEA 2MJDA 4FNFA 2FUG1 2E6XA 1JC7A 4IURA 2Q8RE 4G7HC 1GJXA 3VR3A 2JP1A 1UGJA 1GXDC 5CC4A 1PDXA 3D8GA 4XQNA 4P6VF 4RGOS 3C1EA 2LMCA 1HPCA 4KN7C 3RZOB 5D14A 3VR5A 1QOAA 1DOIA 1TYGB 1B1ZA 4N59A 3CHBD 2L4NA 2DWQA 1VF7A 1TVXA 3AE3B 5J39A 1VCIA 4CJ0B 5H92C 2K5WA 1HFNA 3WCQA 1SXTA 1SJED 3URYA 1SFOB 1L4ZB 2WU2B 1YQ3B 4C3IB 2EJMA 3NBHA 3RUZA 1EFID 1LTTD 1DOXA 4R8NA 1B9RA 5HFYA 1Y1WB 4V190 3EA6A 4K6DA 2R93B 1EWCA 1PFNA 5MPOA 1K51A 2W55A 3KLSA 4KY5A 2RPVA 5ELCA 3NHHA 3A7LA 4NP5A 2FINB 1I4RA 3MAQA 3SFDB 2PIAA 4AS1A 3A55A 1WXQA 1OXXK 3AE2B 5C4XB 4K8JA 4HTHA 2DY7A 3NE5B 4KHVA 2D9UA 2KUMA 1PTOD 3J80L 4N58A 2KMMA 4IKGA 2QEJC 4CGYB 3GTMB 4FVMA 4HCEA 1F2RC 4GDKB 5HURA 4M0WA 3M4YA 2PKOA 3OIPA 1Y1VB 2R3ZA 3MP9A 1HEZE 2EY5A 1UWXA 1YN4A 1LT3D 1VMCA 2K04A 4CQNA 3WOEA 1C48A 1II3A 4ZYSA 3PO3B 5HI1A 5BMGA 1RJTA 3NTHA 2VZKB 3MXUA 2WXLA 3NP8A 1I4GA 1ET9A 1HTLD 1QT9A 1LACA 3LXFA 4IUNA 2AWNA 3AH7A 3TEXA 3MFGA 3QWNA 5D3DA 2BYTA 5G3LD 2LHEA 3W2DA 2L11A 1AYFA 2R61A 1PRTF 1E7PB 3T56B 1AFPA 1O80A 3Q69A 3DWGC 2AUKA 4TSSA 2W54A 1WGKA 2NVTB 3TP6A 4IFDI 1C9FA 1JB3A 2OXPA 1ZYRD 2WAQB 4JE3B 5EPKA 2QMTA 4HMIA 2L5TA 1T6BX 4GDLB 2IL8A 4O42A 4IUPA 1JORA 1ONLA 1G6ZA 2MGSA 4IALA 4K5WA 4IDIA 1PYWD 1T5EA 4KMUC 3SK5A 4LMQD 4C56C 1G91A 3VYTA 3A54A 5FKAC 1TR5A 3P4PB 1K50A 1BNZA 1AEXA 5K36G 1PMRA 3U9OA 3LYYA 1K52A 5D65A 2C9OA 4FXGC 1ZDVA 1TT2A 3T3NA 1NR4A 4LK1C 3OW7A 2XN9C 3FEWX 2WXHA 1RDPD 4I7ZC 1CQFA 2I38A 5EJWA 5LNK1 4GLSC 5BYRA 2WLBA 1MGSA 1LTGD 4M1UB 2BE5C 2L55A 1FFUA 2KOLA 4YTPB 2F03A 2AUJD 2KECA 1Y69U 3J7AF 1QF6A 2IW3A 1ZDXA 3IAYA 1FNWA 2B2YA 4WQMA 5C5MA 1W6KA 2B2VC 1V1PA 4IQZA 5CV4A 1EEFD 4KKIA 2BA0A 3PUXA 5ELDA 4JWSC 1OXUA 1RTOA 1IYUA 2WDRB 1SNPA 2KQ3A 3V2TA 2F0JA 2DYMA 3I4NB 5M5WB 3LWEA 3HGBA 1LTSD 4DK0A 3P1HA 4PMCA 2GRIA 2B2UC 1B50A 5BYQA 2B39A 2H88B 4A3DB 4IOIE 4KX6B 5KNCA 1JW9D 3I4LA 3VRAB 2HCIA 5F2DA 1Z47A 4TQ0A 1MPEA 2IT1A 1N61A 1H9KA 2F0PA 3BZDB 2LGIA 4OZCA 4B0EA 3GTOB 1R4PB 2L83A 3A8IE 5ELFA 1XLPA 1FGBD 1TU2B 3D4DA 5C0XH 1C4PA 2DYOA 3HRDD 3OSOA 1M8AA 2PO4A 2PVOD 3BWUD 4XE0A 3MHBA 2F0LA 4N9PA 3BK2A 4H0LC 2AWOA 4KD3A 4EE2A 3DM1A 3TEWA 4REZA 1LT5D 3BG3A 3J81L 5G5HA 2AQ1B 1U4PA 1ESFA 1ZKOA 3DEPA 5M5XB 4DXGA 2W3RA 2ICEC 1IL8A 5M3FB 1F9RA 3P1MA 4NMZA 4UDUC 1ICWA 3SK6A 1KLGD 4HCSA 3TMEA 1J8IA 2ACZB 3BYTB 2XVSA 3NVZA 4OO1I 1GUOA 3TSSA 2PYKA 1YNJD 3NBIA 1IGDA 4ZLTF 5ISRA 1BO0A 4MACA 1V1OA 4HKQA 4NAMA 2PW7A 3J80E 1QWYA 3AB9A 1EYCA 1C79A 3PIO3 4H7BA 4G7OC 4DQOC 3I8ZA 2PMZB 4LAAA 1FM0D 4I65A 1NUCA 2Z8LA 1EYDA 3LX0A 4KK7A 4H2AA 4WURA 5DAUA 4C3HG 4DN4M 5LL6S 1VZ7A 3D6CA 1YMHE 2JU6X 1UUPA 2HDMA 2AQ2B 1WTVA 1DOKA 2IDYA 2PZTA 4NAWB 3ZYYX 1ZUD2 2B76B 4KD4A 4HSVA 4RGTA 5KYIA 1SIJA 1PTOB 1JQYD 3FILA 1PTOH 2JYTA 1C4CA 2EJFC 4C1NK 4GZYC 1DGJA 3SHLA 2CJOA 3I3CA 4B08A 1N5WA 2F0FA 1A3TA 4CHTB 1QOBA 3T53B 2NUCA 1ML0D 1XXGA 5KIXA 2F1MA 1MSGA 1XYIA 1RD9D 3OMCA 1D5ZC 4KN4C 3J7YW 3AM9A 1L4DB 1FXIA 4DAYA 3AEAB 2N88A 1OFFA 4Z9CB 4YT0B 3AMZA 4MM3B 2G9HD 1LTID 4PMWA 1GUNA 3DMUA 3Q8CA 4JK1C 3K0YA 4A55A 2J0TD 3NVWA 5CV8A 3ONAB 3S2HB 2EY2A 1NI3A 4MH8A 3V96A 4ARIA 2BCOA 1PUTA 2J7ZA 2WXPA 4ABNA 2EYMA 3NZ3A 5EGTA 2BBCA 1AN8A 2RKSA 1ET6A 4K5VA 1D1KA 4N6EB 3FMCA 1EM7A 2SNSA 2EY1A 4DA2A 3FC4A 2ZW0A 5EBDA 2DNCA 3KLSX 4OL7A 4J6HA 3KWLA 1A3VA 4TQUS 3PUWA 3OWFA 3R8BA 1TKYA 1PLFA 1WYGA 2DY8A 1WTWA 4X3TA 3K7AB 2EYJA 3U7ZA 4K8IA 3NUCA 1B44D 4G7ZC 2Q8IB 2Y5PA 3D3RA 2B2WC 4K2LA 2F0TA 5BN5A 2DBYA 2JA7B 5J22A 1JMLA 5D3IB 4RFBA 1HA6A 1D2BA 4RF0A 5E6JA 1HA5A 2SEBD 2M00A 1F2YA 1T3QA 2F0SA 1BF4A 2B2TC 1C78A 1LABA 1XF5L 3AE6B 3Q8BA 3QIAA 1F2MA 3PO0A 3LB8C 2E75C 1KRHA 1SDFA 1QKZA 4DK1A 2NVQB 4BA1I 2OHFA 2WV6D 1FNUA 2R92B 2W82A 3Q8FA 4BA2I 3ND8A 4ZOHC 1DOMA 1L5PA 3EVQA 3BVMA 3KF8A 4FXCA 1IGCA 1IUEA 3P75A 5BMIA 4L23A 4OGQC 3AE9B 1A2UA 1A6XA 5EKLA 4A9AA 1L6VA 2EE1A 1JALA 2LMCB 2JZPA 5I2YA 5A35A 1XTCD 2ZXOA 4RKBA 4IUVA 2V0GA 4HSPA 1I4PA 2WINB 1TWAB 2IX3A 3L7ZC 5DM73 3CIRB 2EVBA 5CR3A 4ULLA 1SAPA 5C4JB 2MP1A 2Q5WD 4Y7NB 4ID6A 2WNMA 1DOYA 1DONA 1G291 1CFMA 4FF2A 1STHA 3J81E 1SSNA 1MHXA 2V4IB 3NQTA 1MVKA 4YSZB 3Q22A 2QDBA 5FO9B 3AE8B 1CHPD 2KDMA 5COYA 2BT6A 3VYRA 4IFDJ 3E9SA 1SNDA 1JROA 4TMAB 1U4RA 1TWFB 3NS1A 3DHQA 1FMAD 1ZEQX 2RVLA 3GB1A 2ZXRA 1VR9A 2N7JA 1L0VB 1SE4A 5EQ0A 2ICIA 4C2MB 3U9SA 2L9HA 2LUMA 2WXRA 1OXSC 1Y8OB 2JYOA 2LKVA 4KY7A 2QSDA 2MUYA 4YXDB 3ZGZA 4KJNA 1GUSA 2FJ2A 2R6GA 3E0JA 1EY9A 1E0ZA 4US9A 4WORA 5AUIA 4F87A 5BN4A 3GTKB 1WTRA 2IX0A 5C3JB 5EKKA 4O1NA 4USAA 3PZ8A 2Z4HA 2SAKA 1EY5A 2DLBA 3E5SA 1EQTA 1EU3A 3DUZA 1LT4D 2PW5A 2SOBA 2BB6A 2K3UA 1I50B 4HROA 2L0CA 4XTCS 2L1AA 1KLUD 1GB4A 1PFMA 2PPBC 2EYFA 3IFDA 1CZGA 1PZKD 3U52E 1TY2A 1STGA 1JR0D 3IAS1 3A7AB 3P4QB 1Z7TA 1N63A 2PQEA 3E6ZX 2HUGA 1NVID 4C1NI 2D2CC 3W5UB 1K53A 1JOOA 4A3FB 4KGTA 1JWSD 4XDXA 1A70A 4HRSA 1DOLA 3KK7A 3H3VC 2B8GA 3IAM1 2A6EC 1F2ZA 2WP9B 3UI2A 3Q23A 3ETRA 1J7CA 1QOFA 4WFN3 4PMBA 1ZYRC 1QOGA 1RCVD 3EQLC 4ZAIA 1XCQL 4PT5A 1E10A 3Q8AA 3SR6A 1OXTA 5CV7A 5CMDA 3ZJUA 1AZPA 3HEJA 3KWVA 2RA4A 3W5VB 1NCVA 1J7BA 2K0PA 4RAUC 3TP5A 3VR4A 4WH4A 2BTEA 2FMCA 4A3EB 2OF1A 4RHRA 1I4XA 1K8OA 3EFXD 1GHJA 4BWGB 2XIWA 2IPKD 1QNUA 2I07B 3NTIA 3VA7A 3P4SB 2NZ1D 3PUYA 1CA6A 1ESRA 2O5IC 1VRAB 2JSVX 1Y8PB 2A6HC 1I6HB 1SNCA 1O7LA 2JQRB 5JVH3 3I90A 1CI3M 3FDTA 3R2TA 4ZHOA 3GV6A 4ME5A 4DU9A 1VJKA 3X3MA 2K6AA 1PDQA 3OIQA 1S5DD 4A8XC 1MI2A 4C3IG 3SEBA 2VUMB 3JAML 1OQRA 2PVGC 2K03A 1V1PB 3LWUA 1JCKB 4QUCA 5D7GA 3VRBB 3AEBB 2EYOA 1EYAA 3OPOA 3VYUA 1TJEA 1Z6HA 2R7ZB 2KCCA 2JA6B 1I3QB 2B2VA 4BBSB 4A6QA 1UWMA 1VLBA 2L52A 2WXIA 1NAPA 1D5XC 2K05A 2IGHA 2L12A 2O2LD 5EPJA 1NYRA 1Q3LA 1MBYA 4HAEA 5C44B 3HOUB 3GTGB 4LTUA 3H6MA 5JXVA 2B2UA 2FBWB 1ZPSA 4OW0A 4XQJA 5DM63 2X6GA 3EGRA 1PZJD 4RGMA 1TS4A 1BCPB 1F9PA 4BY7B 1W6JA 3I91A 4JPSA 1SMYD 4ZKCB 2BDOA 2PMVA 2A74C 2F3WA 2V4DA 1S5CD 3VR8B 5DNFA 4FF1A 2ID0A 3AECB 5IGFA 1OO9B 2E2JB 1PRTC 5IGGA 1JOKA 1R7SA 2LS01 3L3OC 2D5GA 2WXKA 1STBA 3AE4B 1A3UA 2FFKB 3BYYB 1C4QA 3OMGA 5JEAJ 3GTJB 3F2UA 3AEEB 3I73A 3QB3A 2RSNA 1YNJC 4R9WA 1YN3A 4L6TB 3FVQA 2IX1A 1GHKA 1G2TA 4DGZA 1LTAD 1ZXIA 4MHEA 3HKZB 3O13A 3J7AV 1BR9A 1X32A 4CKCA 1LO5D 1K83B 3MEHA 3NWSA 4ZKBB 5HGTA 1SF0A 5HHDG 1F2LA 3GO5A 1EY0A 1WCMB 3C8YA 5I2XA 3N52A 2WXFA 4RKLA 1UAPA 1KAAA 1WSPA 1SEBD 3HUIA 3P63A 2PZWA 5CV5A 1F9SA 2KAJA 1QOHA 4KKUA 5EE3A 1UNSA 1S4ZA 1ZE3D 1EWHA 3MWYW 3FILB 3C3LA 2WQYB 3I4MB 1ENAA 1KNEA 3M3YB 1EU4A 3K5NA 2K1BA 1PFDA 3VA5A 1AW7A 4EQNA 3I72A 1QCBD 2PW9A 4EGVA 3R93A 5HG2A 1SE2A 2EJGC 2E2HB 1STAA 2ONQA 4EQOA 4HN7A 5C3WA 3C2PA 5C5LA 3DWQA 2VB3X 2Z4IA 2A69D 4IFDH 3B2FA 3MTSA 1F0ZA 3ND9A 2BOSA 5LL6X 1IW7C 3A56A 1NSNS 3A8KE 1YNTE 2IJ0A 2EYHA 2IGGA 4KY6A 1EZ8A 2NVYB 2EPBA 2JXMB 3B9JA 3RZDB 3TP7A 2JSOA 4RA8A 3MHZA 1HQRD 2J53A 2PNRC 2HDEA 3Q8EA 2MJEA 2A68C 2NN6H 1K8MA 2EYPA 4XT3B 2JYEA 5A2QL 4XQQA 1LV9A 2BB5A 2B2YC 3K5LA 2BE5D 2PCFB 3VR9B 1BXTA 1RTNA 4XDDA 3IT4B 5JAVA 1TKGA 4ZHPA 4XT1B 5M3MB 5C3EB 5C0XG 4K5XA 1O7YA 2BDNA 2NTSA 4KI0A 5E4WC 2BA1A 3SR1A 4A3KB 3BS1A 3NK9A 1F2RI 4ILWA 1HUNA 1XX8A 4LLGM 2KHSA 2DNEA 2XRQD 3A8JE 2VXWA 1LLRD 4ZUJA 2K32A 1WWTA 3V3XA 3H8HA 2RMMA 1QJOA 3MXGA 4C7ZA 3N9YC 3K5OA 3T16A 2RQXA 4IUUA 2F0HA 1BDOA 1XLNA 1O7ZA 1JWMD 1TWCB 1GB1A 5JPNC 4FF3A 3S16B 4CKBA 1YNNC 2GI9A 1FIQA 2B8FA 2WACA 1EOTA 4PV1C 5T8IA 2VNUD 1C8CA 3SFEB 1EL0A 2NN6G 1RFKA 3EROA 1SYEA 1VMPA 3BDCA 2RBMA 4FF4A 2A5HA 3QO2A 2BS3B 4MT5A 1Q10A 1FYCA 2Y5CA 2CU3A 3QG1A 2CW0D 3L4PA 1I4HA 2MH7A 1IKMA 3MJ5A 2EKIA 3HS0C 4ZRZA 1C76A 2K9XA 4US8A 4XIGS 4NZLB 1HCZA 1SYBA 4RCOA 1HXYD 4J8QA 3M4OB 4XDCA 3GD7A 1U4MA 2N0SB 1MI0A 3R2IA 1G8ZD 3PMFA 3HOVB 3S17B 2F3VA 3EJIA 2M19A 2WB1B 2QCPX 3K57A 3P7JA 2RDHA 2QILA 2K01A 3H09A 2YEPB 3PUZA 4H13C 1FRDA 2F0KA 1HUMA 1CM9A 2HTME 1WVLA 4OO1H 1ZXTA 2F0WA 2X69A 5C4HA 4DNRB 3PIP3 2RSOA 5H8YE 3BIID 4DNTB 5GXGB 3T13A 2GA4B 5IT9L 4L1BA 1Y8NB 2K22A 1Y56A 5I6WA 2AX5A 4J3OD 1YN5A 3MZ5A 1FRRA 1WTPA 1YJIA 3KBXA 2CVRA 3RLFA 2I2YA 1NYQA 1ILPA 5M5YB 1STYA 4XWTA 4LK0M 1BCPD 1SBBB 3IL8A 1G2SA 4UAIA 5KYLA 2WXMA 1RF2D 2ZT9C 5JJZA 1DD2A 1S5FD 5EE9A 4FP5D 4L8JA 1GUWA 2NTTA 5I4DA 1HRJA 1ZXHA 3MXPA 4BBRB 2CHBD 3T3OA 4FXKC 3TP8A 4C3JB 3BVZA 4HKZE 1PTOF 2F0IA 1FEHA 3IXSA 3U2SC 3R3OA 5CV6A 5CGKA 3MVVA 4KKSA 1PXUA 3NRZA 5I9OA 1BQQT 1Q90A 2EXZA 4XYOA 3TBIB 2X6LA 4AYBB 1OXVA 4RWSC 1F77A 4L2YA 5BYSA 3DWAA 1E2VA 2VB2X 2LFIA 4NDXA 3IKJA 3C1FA 3SK4A 1J9OA 5BN3A 1KABA 1SSOA 5FO8B 2QKIC 4IUTA 1SNOA 1N60A 3HOZB 4A3BB 4OVZA 3ZJVA 5CBAE 4KKJA 3GP7A 3WOFA 3H0GB 2JWUA 1ACCA 3GV3A 2G1EA 3ABVB 1B3AA 5FLXL 2LY7A 5J1ZA 4QMGA 5C3XA 4HMJA 3T51B 2G9DA 3SVMA 1XCTL 1GPXA 2WKDA 2E2IB 3I57A 1ZOYB 1FXAA 5G3LF 4DF7A 2PTLA 2W3SA 4OZBA 2TSSA 1PTOC 1BUIC 5C2TB 5A2QE 1CJEA 3CU7A 1EQVA 5FO7B 4KKTA 1A2TA 1Q1BA 3HP3A 3BDLA 1JQ4A 1TQOA 1GUTA 1WTOA 4WJWA 1ILQA 4DFAA 4BY1B 2ENBA 2E76C 1D1IA 1EEID 2M9VA 1I7HA 3CKIB 4JWUC 3Q24A 4R3DA 4U673 1VDVA 2YEPF 2WIIB 5CYUA 4WIPA 1VF5C 4KJOA 2HDLA 2J4XA 4J1MA 3H94A 3CRKC 5EPLA 1EWYC 4LJZC 4ZRPA 3LNNA 4A90A 2QIEB 2Q8TA 1QQRA 1D4BA 3WDNA 3RPFC 1E6EB 5E4XA 3PO2B 2KA7A 1CA5A 4FO2A 5T1GA 2H89B 3HOYB 1MHHE 3AE1B 4CBVA 1B4OA 3UI3A 4HR7B 5IGCA 1V43A 4M8AA 3AV8A 3GTQB 3NXWA 2M0AA 4ZRQA 1H9MA 5IIFA 1EIHA 3BVGA 1D5MC 3S2DB 2ZW1A 4AQ7A 5KRUA 1AZQA 3U4EG 1TIID 2KQ4X 3N6RA 1SMYC 3VQIA 4C80A 1IBXA 4U68A 4BS9A 2GB1A 4CKEA 3BDOA 5T1IA 2JE6I 3MFYA 2F0UA 1WRIA 1U9RA 1IYVA 1CK1A 3QJYA 2WS3B 4B0MA 1KDCA 1DXMA 1FD6A 1WD0A 2MJ3A 3W1SA 4E6IA 5KNDA 5FK9C 2LJIA 2MPMA 2KACA 3P42A 2DN8A 2E74C 2M2LA 3NPPA 3AEFB 1XLQA 5BMHA 4RF1A 1AWDA 3CRLC 3DXJC 1B9NA 5EKIA 3AN1A 5IT9E 2SNMA 3K58A 2N9KA 3OWEB 5K36H 2OT2A 4XYQA 3MA2B 3GS2A 4A3JB 1FNVA 2Z1CA 2XRSD 3KUPA 3CQZB 4IN3A 4F8MA 1ROEA 3FPPA 5E3FA 4HEDA 2NB0A 1BBXC 1TKWB 1FCLA 5TSSA 2TMPA 4DAVA 2IGDA 5C4ZA 4S3SA 4RH6A 4C7YA 5FOBB 1FR3A 4XWWA 1SYDA 3TN2A 1QG7A 1VZ6A 2MHVA 1KTKA 5C0XI 1JWAD 4PQXA 1SNQA 2A6ED 3SK8A 5M9OA 3G7LA 3PUVA 1TZOA 1JRPA 1XEEA 2FE8A 2XSCA 4WRDA 1SB3C 1IKLA 3RMHA 4KGRA 2A69C 3IFTA 4RCNA 3TEYA 2F0GA 5I9PA 1VZ8A 2KCNA 1HTPA 1KDBA 1PFBA 3FAHA 4YSYB 1EY4A 3SDZA 2K5QA 4Q5VA 2WKCA 1CTMA 1XWEA 4QIWB 1T5XD 1U4LA 4OHJA 1RWSA 2WXQA 2XNAC 5LHY1 3E56A 5FLXE 4CJ1B 1WTQA 3S1MB 1QLBB 5KEEA 4H44C 1X3QA 2K28A 4KHZA 2NN6I 2KVMA 1S5ED 3SXHA 4WAFA 1Q1EA 3Q6SA 3J9CA 4ZQ3A 2L32A 1PGXA 2H4OA 1NR2A 2A6HD <