2QILA

Toxic shock syndrome toxin-1 at 2.07 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined crystal structure of toxic shock syndrome toxin-1 at 2.07 A resolution.
pubmed doi rcsb
molecule tags Staphylococcal enterotoxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 58
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qilA01
1I4HA 1FNWA 1EEFD 2IPKD 4DXGA 1SE2A 1D5ZC 3BZDB 5TSSA 1EU3A 1I4GA 2Z8LA 3EA6A 1PZKD 1RCVD 5D3IB 1SBBB 3MFGA 3BYTB 1ENFA 2RDHA 1LTSD 3GP7A 3OWEB 3EFXD 5ELEA 1TY2A 1D5XC 1UUPA 1I4XA 1CK1A 1EFID 1PZID 3R2TA 5I4DA 1PRTB 3TSSA 4K6LA 2SEBD 1CHPD 1L0YB 2WV6D 1S5BD 1PRTF 1LT3D 1ET9A 4OHJA 1EU4A 1SEBD 1L0XB 3BVGA 1I4QA 5D3DA 1CQVA 1UNSA 1MD2D 1LTRD 1LTID 4RH6A 1FD7D 2J4XA 1HXYD 1S5DD 4C56C 5ELCA 1KLUD 1RDPD 3DWPA 1LT6D 3SEBA 2CHBD 1BCPB 1B44D 1SJHD 3V05A 1PTOB 1TS3A 1LTTD 1D6EC 2RDGA 5FKAC 1EWCA 1KLGD 1LT4D 1EEID 1S5ED 1PTOC 4L6TB 1STEA 4TSSA 5ELFA 4RGOS 4RCOA 1SE4A 1BCPD 1YN4A 1ET6A 1S5CD 1TS4A 2XRSD 1SE3A 2AQ2B 4DXFA 1XXGA 1RD9D 3O13A 1TY0A 1M4VA 2XN9C 4RGTA 1FNVA 4RGMA 3BVMA 1DYQA 1LTAD 2R61A 1PYWD 1I4PA 1PRTC 1XTCD 1BCPF 1HTLD 1KTKA 1PTOF 1JR0D 2XRQD 1SXTA 1PZJD 2NTTA 4UDUC 3URYA 5FK9C 1BCPC 1RF2D 3R8BA 5ELBA 4Z9CB 1YN5A 1PTOD 1D5MC 1B1ZA 1JCKB 4RGNA 1CT1D 1LLRD 1DJRD 1F77A 3BVZA 1HA5A 3W2DA 3BYYB 3DWQA 2AQ3B 1TS5A 1AW7A 1JWMD 2G9HD 3MC0B 1JQYD 4BWGB 1V1PB 2TSSA 1BXTA 1QILA 1JWUD 1YN3A 1AN8A 1G8ZD 1GOZA 1PRTD 1JWSD 1LTBD 1TS2A 1LTGD 4RHRA 1PTOH 1I4RA 1T5XD 1V1OA 2NTSA 2O2LD 2XNAC 4RFBA 2ICIA 4O1NA 1FNUA 2AQ1B 3CHBD 1LO5D 2QILA 2IJ0A 1S5FD 4RHSA 3DWAA 1CHQD 2QEJC 5ELDA 1LT5D 1HQRD 4NZLB 1SJED 1ESFA 3R2IA 4L63B 1V1PA 1FGBD 4ZYSA 3KLSX
chains in the Genus database with same CATH superfamily
4G0NB 4QAYA 2WXFA 1Y8RC 5BMGA 3D6CA 3GTQH 2EDGA 5I9OA 4L5RC 4DDID 1I42A 2J52A 1RCVD 1KDCA 2J53A 1DOIA 2UU9L 3H6MA 4WJPA 3D4WA 2YU9B 3NG0A 2XWJB 3MJ5A 3T13A 2KK8A 1D5XC 2G5DA 4LUVA 1OQRA 1WGGA 4N8X1 4DK0A 1SIFA 3B2GA 3ECIA 1WGHA 1QNKA 3Q6SA 1Y1VH 1QQRA 1EO6A 2K14A 5IN7A 4C2MH 2BB5A 5EPLA 2VZAA 1MHXA 1WMHB 2KFJA 3TEWA 1F9SA 1UF0A 1WR1A 5JH5C 1BBUA 4BOSC 4A3LG 1OQYA 3P63A 5C44H 1I6VC 2Z0SA 1V86A 3OJ4B 4H2AA 4DWFA 2J4XA 4BY7G 2NVQB 1UGMA 4HTHA 4UP9A 4B3ML 5IGDA 3DMUA 4UAIA 1LV9A 1I6HH 1UGJA 1K8RB 1EWCA 2KENA 2PI2A 2PW9A 3BINA 3KUDB 1VQIA 4JPSA 3PO2H 1S5ED 2C35B 4YL8A 2JX5A 1WTXA 2NN6G 4ZYNA 2Q2TA 1YN4A 3QA8A 1ET6A 1F2ZA 2ZCBA 3PHXB 3L08A 5J1ZA 2MW5A 2CKZB 2K6DB 5C3JB 1E8WA 4LDTB 2JYTA 4DXFA 1TU2B 3DBHI 1X3FA 1XXGA 3T3OA 3MVVA 4G7ZC 1C1YB 4W9JA 2O2VB 3AQQA 1QLBB 1MSGA 5BYQA 3NVWA 1QJOA 4N8FA 2L9HA 4AYBG 2NMQA 4FP5D 1I4PA 1YX6B 3LWEA 2F0GA 3DVNV 1GHKA 4ZHOA 3JC66 4APVA 3RNBC 4KHPL 3GTJB 1SLJA 2BE5D 1U4PA 2WAQG 4IUPA 3S2AA 2C7MB 2WINB 1LACA 3G6JB 4HIMA 4Z9CB 5C4XG 1EY5A 5M3FB 3NVYA 1OO9B 2JA7B 1HUMA 1E7PB 1NMFA 4LFCQ 2MWSB 2CQAA 2WDQB 3M95A 1Q12A 1WE7A 2D0PA 2X38A 3DEOA 4NQKE 5JXVA 3M85A 2E2HB 1A70A 2KA7A 3Q8DA 4HDQA 4DV5Q 1HTOA 1WI0A 1BVSA 5J17A 4CDFC 2YU9H 1XQQA 3DM1A 4PZ6A 3AU5A 1PH6A 1SROA 4DV7Q 2B3AA 1BF4A 5A2QE 3RYTA 3TBLD 4US8A 3RNCC 3T1HQ 1EQQA 3I4MB 2BT6A 3ML9A 5E6NA 4WWOA 4B3RL 2XNAC 2E2JH 2GBNA 1S1QB 1SNDA 3LXFA 4BKSD 1YX5B 1SGHA 5AZGA 1HCZA 4OWXB 1M90C 4OX9Q 1G6PA 2MJ3A 5E6PA 1VQFA 4CHTB 2ZVOA 2JY6A 2KFKB 1O7IA 4K0KL 2JA6B 4M01A 4W9EA 3K5LA 2DAFA 2IDYA 2DJFC 1FNWA 2KEDA 2F0WA 3QQ8B 4X3KA 2RGFA 3UDXA 4ZKCB 4ALPA 2MP2B 1J8CA 3QCAA 1Y1WH 4A3DG 2N9XA 4J3OD 3SR6A 3K9PB 4KN7C 3A4RA 3ZRFA 2WDRB 2M9VA 1EWIA 1SSOA 3K5NA 1F2LA 5EE1A 3I90A 3IL8A 2RDHA 1V97A 4P1CC 4B0MA 1PV4A 2IY0B 3PIO3 1Q10A 3MXUA 5E4XA 1ISNA 4EQ5A 2A74C 1Q82C 1K83H 2LRWA 1E22A 1PH3A 1QZHA 4LF8Q 1WYGA 2DJGC 2KD0A 1WJJA 4MGIE 1ZKOA 3DBLI 3KDFB 4OO1I 4AQ7A 2KJRA 1MJCA 5D3DA 2XK5A 4P6VF 5IGBA 4GNXB 4ZK9B 4FF2A 1FMAD 3H0GH 1ZE3D 3S15B 3M3YH 2NVXH 4HCNB 4W9FA 4AOFA 4OIJA 1LT6D 2K5QA 3S1MB 1TS3A 1HNXL 2H4OA 2K75A 1YNND 2XVSA 1WJ4A 3I2ZA 3NTHA 3V2TA 2MBEA 1IL8A 1NUCA 3HKZG 1EF1A 4LNFA 4A6QA 4KKJA 5C5LA 3K80C 1PTOC 3DHQA 4L6TB 3J81c 2OTJA 2N9EB 1N36Q 1SE4A 2UUCQ 1UWMA 4EZKA 4JYAQ 3TN2A 3HOVH 1CKOA 3H94A 1LM8B 2NPTB 3KDFA 3E9IA 2V3SA 1EYGA 4C3IG 3A55A 4LUZA 4DK3C 1JMCA 4KK7A 1K8GA 2K1BA 2L1BA 3NELA 4H02A 1KAWA 2H5XA 4A3OA 2EYMA 5CBEE 2GB1A 1SAPA 3HEJA 2RD0A 2DY7A 3E3XA 3A1QB 3JAML 1BCPF 4AYBB 5KYLA 1JR0D 1WZ0A 1ZXHA 2ZTEA 1F9JA 3CCEA 5IODA 3FHWA 1OEYA 4C00A 4V0BA 4UDUC 1VF5C 1PGBA 1XLOA 2JF5A 2JT4B 4F1SA 3BS1A 1GHJA 4KKUA 1WTQA 1JOQA 1D5MC 5M3FG 1JCKB 3D6WA 3NZUA 2MBQA 3Q23A 3AB9A 1SYCA 2BPSA 4IFDJ 5JEAH 1DJRD 4HEA1 4IG7B 2NYZD 1TXYA 3BVZA 4EUTA 2BYTA 4YTPB 4B0EA 3KLSA 1L0WA 2H1EA 3HOWG 5CV7A 2Y5CA 1MBYA 4GLSC 4K1RB 3ZKJC 4M00A 2KJHB 5E7NA 2KACA 4A75A 1NYQA 3RR5A 4A3KG 2F0IA 4PV1C 4XYCA 2AYOB 4WJNA 1XNQQ 2RMMA 2INPE 5LMNL 4X62Q 4AQYL 1FXIA 2KQ3A 5G2NA 2KC2A 3BDCA 2JA5H 2BS4B 4LJZC 3HGBA 1C9FA 2BW2A 1VQLA 2B2TC 3VRBB 5EKLA 1S5FD 2GN5A 2VUMG 2E5LQ 1WJUA 2GBMA 2N49A 2V4DA 4KKIA 3E9HA 4FLHA 3VDZA 2L0FA 1BNZA 4O42A 3A5UA 4K81A 2IT1A 4IZ8A 3SK6A 4X64Q 2UUBQ 2LXKA 3GTKH 4MNOA 3GTGB 4OELB 4A3MG 1J9OA 2ZTDA 5G3LF 1TWHB 2JJQA 3EQLC 1LFDA 3HOUB 1NNXA 1G2TA 1KHIA 2BYVE 4DUYQ 3DPDA 1ACCA 2KQ4X 4K7UA 1TY2A 5EDSA 1XLPA 1HNXQ 2ZJPA 1ASZA 4X66Q 5I4DA 1JB7A 5CHFA 2RHSB 2KTRB 4HPMB 2FHTA 5LXIB 1BDOA 1PH1A 1C8CA 3APFA 1EIGA 3VTWA 1FGUA 2F0SA 1N63A 5AEKB 1CQVA 5BR8Q 4ABNA 4DV6L 1DGJA 3MA2B 3GTLB 5CBAE 3ENEA 3AFPA 1QZEA 1FD7D 3HFZB 3TZUA 3LWUA 1PH5A 2N7DA 2R7ZH 3GS2A 1SMYD 5FO9B 4R8NA 3J80L 3DWPA 4GN3B 4R1JA 3WAMA 5C3EH 1NE3A 3M4QA 2FFKB 5EQ0A 3E0JA 4HSVA 1AEXA 3OYYA 4NP5A 4BXXG 3IFDA 1WTWA 3ITPA 3B1LX 3DVNU 2KLCA 2JN4A 2VY3A 2REXA 2BTEA 2IY5B 1VZ8A 3H6NA 1RM6C 1YMHE 1D8LA 2R92H 1Q90A 1SYDA 3DQVA 3GOEA 4M8NA 2K52A 1X1MA 1F9PA 3NE5B 3SFEB 4C7YA 1V80A 1IW7C 5H92C 3MZ5A 4K2KA 1EY6A 4X65Q 3D0FA 4Y7NH 4XYQA 1K8OA 1EUVB 3NY5A 3QWZB 1VQOA 1N6ZA 3V6EB 2AWOA 2RQXA 1EY9A 4IJHA 1FNVA 4RGTA 2LY7A 3A7LA 1VQNA 2V3PA 4OX9L 1DD2A 1GC6A 4HPLB 1F9RA 3FC4A 4B3SL 1LTAD 3FILA 3DUZA 2KHWB 4S17A 3VDYA 3PQIA 2K9XA 3K6OA 4ITKA 3J7ZC 1NAPA 2E76C 4RCNA 1VQPA 3S14H 2N9PC 4DR7L 1WXVA 3CW2C 1ZOYB 3CF6E 4JI4L 1YN5A 3CRLC 5A2QL 1K50A 3I5JC 2R92G 4QGUA 4AS1A 2K6QA 3TEYA 4BBSB 5EBDA 3QOLA 1LABA 3DVGY 3K5MA 3ND8A 1V1QA 2ZTCA 3S2DH 2AQ3B 3GZNB 4BXXH 2VS1A 4TUUA 4A90A 2K7VA 3MC0B 5C3EG 1HZBA 2DZKA 2Z6KA 3ND9A 1BXTA 1Z47A 2TMPA 5E4WC 1BT0A 2HDEA 3V3XA 1VQAA 1Y14B 3RZDB 5CORA 4DR3Q 4RHRA 1SMXA 4WRDA 1JALA 2E6XA 5FOBB 2W9NA 4OXPA 1N5XA 2O2LD 4IUVA 1XWEA 1WOCA 5GMVA 4DUZQ 4JG2A 5IO9A 2X6GA 4GOPA 4D2KA 3PRPB 3TCAA 3VHTC 1Y1VB 3AE7B 1DOYA 3PVLA 1EZ6A 2N9KA 3OTOL 4ZRJA 3WDNA 4NZLB 1VQ6A 5IAAC 3ONAB 4ANVA 5DPSA 4ASWC 4GKJL 3W9CB 3ETRA 2KLGA 2UXBL 1X6OA 1N62A 4HCSA 1P0RA 1RYJA 4L8JA 5TSSA 1XX8A 3PIP3 3VYUA 1IYJB 1I3QB 2NR2A 1ZEQX 2EYLA 3KVFB 4JV5L 3VA5A 4B95A 2WNMA 3U50C 3ZTCA 3BU2A 4A3MH 1HJPA 2JZ3B 2L8JA 3IG3A 1LGRA 3QHTA 2O6VB 4JX1C 1K9MC 2R2OA 3KW5B 1A15A 1FM0D 4NAWA 2B8FA 3GP7A 3EFXD 2VQEL 4JBWA 2QMTA 3WOFA 3TEZA 4A3JG 3PSEB 1H9RA 4ARCA 1XLNA 2UUAQ 3HOXG 1TKGA 3RZWC 1GB1A 2UYZB 2VUMH 1HE8A 2PE6B 2IX0A 4YWLA 2QDFA 1WGRA 4CYEA 1TWCH 4DV2Q 2G3QB 2M17A 1E2VA 4JOIA 1UZXB 1V8CA 4UPAA 4MIUA 1IYUA 2O2VA 3RNGC 1I4QA 1IBKQ 4OZCA 2ID0A 1SN8A 5IGFA 3STBD 5GQOA 3ZW3A 2W82A 2IGHA 2YYZA 2C9WB 4NJ7A 4DHJD 2F0EA 4RKLA 4OGQC 4I6NB 1WGKA 1TWGB 4DV3L 2VZKD 4IKGA 4A20A 3IRBA 2IBIB 2B2YC 5D65A 1VCBA 2JP1A 4CKBA 3F1ZA 4E3CA 2WXQA 3BK1A 3DBRB 4AIMA 2DY8A 4LF5L 3I73A 4IUMB 2JA6H 4B08A 3Q6BA 1YHBA 1Q1EA 4C3IB 1ZDVA 1B3QA 5IOCA 1R4NI 5KHQA 3O13A 4WJ3M 4DHJB 1B70B 2E74C 1TY0A 2QDBA 3S16B 5IGGA 4R8IA 4QL5A 2WXMA 3P1HA 1BBWA 1W6KA 4LNNA 1G51A 2D9UA 4IM3A 3CWIA 1OEYJ 2B2UA 5M9OA 4NPNA 3L17A 3J7AV 3W5UB 1O7YA 1WZ3A 1SNQA 2DYOA 4CKCA 4LF4L 1E2ZA 3AE8B 4RF0A 2RKSA 2N1WA 4NXNQ 2CW0D 2UXCL 3QJYA 5FK9C 3HOVG 4R4TA 5I6WA 2KMAA 3Q8BA 2D0OA 4KHVA 4OIKA 3FRPB 1Q7YC 2MQHA 3S1QB 5HI1A 2WB1B 2VB2X 3NSWA 4ME3A 4RGNA 1L0VB 5M3MB 3P1MA 4CJ0B 2CJNA 4UY8C 1LLRD 3FKIH 4GLAC 1C4PA 1M94A 2BS2B 3C0RB 3IFTA 2MGSA 2WXPA 2WWZA 2HTHA 2MP1A 2B2YA 4DR1Q 3NWTA 1AW7A 2G9HD 1YIJA 4JBKA 1K3BC 1GJXA 3JVZX 3EIVA 1T9HA 2BWES 1WXAA 3CMMB 3W5OA 2BB6A 5GXGB 1XNRL 1WTRA 1K83B 1ML0D 1AN8A 2JA9A 1PDXA 3KUZA 3P4RB 3ZXRA 1JWSD 3H0GG 3CAMA 1HUNA 2IO0B 4P7IA 1Z7TA 4A3CG 2ENBA 3MP9A 4H0LC 1YQ3B 3AI5A 2CW0C 4JI0L 4E74A 2BE5C 2ICIA 3H91A 4R3DA 5IKCM 2V4IB 5DAUA 1SYFA 1CHQD 3SVMA 4ODGA 3M3YB 3CCMA 2R6GA 4RNAA 3PZ8A 2WACA 4JI6Q 2UWQA 3MXNB 1XMQQ 1HPCA 2JVCA 1I4HA 2V1YA 2B2VA 3B0AA 3AYHB 4DV4L 5IWAQ 4KZCA 1FCCC 1WGYA 1A8VA 1N36L 3I63C 1SDFA 2W55A 1Y1WG 4A3DH 4BY1G 4WWPA 3ERQA 1H4RA 1SBBB 3ZJTA 5KIXA 4XDDA 1CJEA 3FAHA 3WAOA 1EOVA 4LF9Q 2PMVA 3A33B 3UI2A 2VH1A 2R2QA 4JE3B 4C7ZA 1LM0A 2L3ZA 3JSVB 2HE7A 3ZVVA 2LUMA 2MP2A 4K5WA 2ZW1A 3L13A 3VFKA 3DDCB 3CC4A 1CHPD 1RODA 4JI5L 3RZOB 4ANWA 2JRHA 3BDLA 1MKHA 2O6VD 2BGFA 4XT1B 1P9DU 1EU4A 2MO1A 5G3LD 1SNCA 3CD6A 2CWAA 3P4QB 3RMKC 2A69C 4NW2A 3OW2A 1BQQT 1XLQA 2PTLA 2GRIA 2Z9HA 2DYMA 3SEBA 5GROA 1FJGL 3DBHB 3OIPA 3DVGX 1D4BA 1EIHA 4W9HA 2K28A 4V190 4P71A 2A73B 1L1OB 1NBWA 2LMCB 3DOWA 4TVAB 4B9XA 1HR0W 1HEZE 4GN1A 4NAMA 3GTQB 3L10B 2RHQB 5MPOA 3NHHA 4F87A 1PMRA 4GGQA 5GAHC 2D3AA 4GIVA 1I94Q 3P42A 2MJDA 5EPKA 1L1OC 3M4PA 5C4XH 1K8AC 2NCNA 3M7NA 1OTCA 2R93B 2L15A 1KC8C 5LMNQ 5CHWA 2XRSD 1WXMA 1QF6A 3RPFC 1QUQB 4LNOA 3J7YW 2R7DA 1RAXA 1B9NA 4W9GA 2E5LL 2LASA 3CQZB 1M4VA 4RKBA 3Q0AA 5IT9E 4ILWA 1PRTC 3A8KE 1JW9D 2KQSA 2A1AA 4PS3A 1PZJD 4EQOA 3J81i 3U4EG 3PSIA 2XBBC 3U9SA 1EFWA 4QJFA 4II2B 3PGEA 2NN6H 2BYFA 3FKIB 1V5TA 2C7HA 1YZ6A 2NVUI 4KGSA 3PO2G 2AX5A 5M3MH 1X3QA 4EEWA 4FJVB 4FHKA 3SR1A 1UEBA 1GVPA 1S4ZA 3ERSX 4HN7A 4EGVA 1HNZQ 1HNWQ 3KUPA 1LQBA 1GAQB 4TMAB 5D2MB 2JWZA 2RPQA 1E90A 1S40A 1KNEA 3QR8A 4EOYA 3TREA 1KLVA 4BY7H 1JWUD 2NZ1D 1K3RA 4YTNB 4N59A 3UIOB 5E3FA 2K01A 5FO8B 1XPOA 3NQTA 3P20A 4QIWE 3VR3A 2IX3A 1KJTA 2YTVA 4A3LH 3GTLH 3GV6A 2Z59B 4WJOA 3M9BA 1R4QB 2D3GA 1YNNC 1GB4A 4GN4B 3B08A 3HOZH 4LLGM 1TIID 1Q86C 1U4AA 3GZNI 1Y1VG 1CKNB 1KFYB 4CDEC 2EYHA 5ISRA 1V1PA 2LJ5A 4PS7A 1PYSB 3KF8B 4KKSA 2CVRA 1J0GA 3K9OB 2J0TD 4XQJA 1G2SA 3PLVA 2UUCL 1Y56A 2WXLA 1L1OA 2JYOA 2LMCA 2AUKA 2D2CC 2L76A 4NJ6A 2MBOA 5IYBG 4WJQA 2EXDA 4FBJB 1VQ7A 2FIDA 2D3BA 4B6WA 1E7VA 5CV4A 1ENFA 3DBRI 3DWGC 2VRRB 3OWEB 2VH2A 2OF1A 3L3OC 1XO3A 4JK1C 1ENAA 1UUPA 1N33Q 1T0YA 2RPVA 4C3HG 1EFID 4ZDVA 1QOAA 2G45B 2K04A 4C4VB 5KGUA 3KBGA 2KFKA 3HOXB 2X6LA 5JJIA 2K50A 1JT8A 2N1VA 1CI3M 2NBVB 2Y5PA 4XWTA 3K0YA 4DF7A 2K3UA 4LF8L 1UE5A 2LFNA 4DAPA 4PMCA 2BDOA 3UE0A 4FJZA 2BBCA 4LFAQ 2PZWA 3MTSA 3ICEA 2VQFQ 4OVZA 1DOXA 4MHEA 1C3TA 5T8IA 1WFQA 1A3TA 1B44D 3EUB2 1PTOB 5C3WA 3U4VA 3AN1A 1A2UA 3IKJA 3R7QA 5G55A 4YSYB 1WYDA 2VW9A 1ZXTA 1STHA 3GTKB 4KDIC 5M5XH 2NN6I 2B8GA 4J15A 3RUZA 2PPBC 1R7SA 3RNAC 3W1SA 4IOCA 4BBRB 3GTOB 1WFYA 1NVID 2L1AA 4REZA 3SFDB 1ROEA 5AUIA 3FMCA 1TS4A 4X3UA 1SE3A 4JI1L 3A9KB 3DBSA 3MXPA 1RD9D 2GOWA 4GOCA 3RULA 5I9PA 5GAEC 4DV3Q 3R3MA 4FN2A 4PK1A 4IUTA 1P16A 4YWKA 2I0QA 1E8ZA 3PPAA 2MNAA 2HDLA 4IM0A 2PVGC 1F2YA 3J81L 4GKJQ 3S2HB 3FP9A 1QG7A 4M8MA 2HCIA 3OMGA 3TMEA 2SNSA 3DHGC 2XRQD 2EIFA 2QKIC 3UDFA 3U58A 1VQMA 3S1QH 2MSED 3OIQA 3VR2A 2LUEA 3CP0A 2ICEC 4PZ7A 4TKNA 4DV1Q 2MHVA 5FLXc 4MN3A 5C4XB 3G48A 1E6EB 1UWXA 4U68A 2XSCA 1NENB 5EE3A 2F0DA 2JRIB 4DUYL 5IYCH 1F77A 4KTAA 1KDBA 2JXTA 5DPWA 1U5KA 5BO4B 3MXNA 3W1BA 3A8IE 3PF4A 4ZRKA 4USAA 2Y3AA 2KJXA 1YN3A 5IWAL 1LUZA 2M2LA 5JOBA 2YTYA 2J42A 1XMQL 3T3NA 2LGDA 4ZQ3A 1ZYRD 1UD7A 4O1NA 2L55A 5AFWA 2B63G 2Y0SB 4A55A 3K81C 3C8YA 4C3JH 2RBMA 1XT9B 2QEJC 1VDVA 3AE5B 3ZJYC 4DV5L 1C0AA 1XCTL 3I4NH 3BWUD 1E1OA 2HDMA 3IHPC 2LHEA 4FXDA 2K1FA 5M5YB 2K8CA 1N32L 1U4LA 2PW5A 2WAQE 2INNE 1V81A 4DAVA 3ZDMC 5IP7H 3ER0A 4KGTA 2MPMA 4BVUC 3MEFA 2SNMA 5CR3A 1WIAA 1L4ZB 5CYUA 1P98A 2J7ZA 1IUEA 2F0OA 4P74A 1X3GA 4HDOA 4XTCS 4DU9A 4LNQA 1CM9A 1PH7A 1ZW7A 2LJIA 3HIZA 1PRTB 3TSSA 2JE6I 2QJLA 1VQDA 5C3XA 2SEBD 2F0JA 1L0YB 2LGIA 4P73A 1FO4A 1OXTA 3FKYA 5KHOA 2WXIA 3M62B 4JPBW 4A93G 4IC7B 1E8YA 4DR7Q 4HLEA 1VQ8A 5K36H 1WJ6A 3R7RA 5C4JH 4OO1G 2I5LX 1IP9A 4B3TL 3ZDTA 1V9PA 4MSQB 1C48A 4LF6Q 1UBIA 2Q8IB 2R3ZA 4KKTA 2CHBD 4G57A 1FIQA 2F0HA 3R66C 4DR4L 5EE9A 1LTTD 2PNHA 3Q3FA 1KDAA 1X3PA 3IAYA 4ZHPA 2PCFB 3C2PA 1V8QA 1TQOA 2GVAA 1H8CA 3OAWA 3F2CA 3K8AA 3DHIC 1K0RA 4YHHL 3WA0A 4A3IH 1D1IA 3G71A 4MGZE 1HFGA 2R93G 3AFQA 5KNCA 2PKOA 4NAWB 4ME5A 1A63A 1H9KA 1UBQA 1B50A 2YEPB 1KXLA 3W5VB 2NWGA 3PUZA 2XK5B 3X0WA 2EYOA 4BOZB 2FCQA 1ONLA 4P72A 4YWMA 2MBBB 3JAME 1ZGUB 3IVFA 4WJWA 1PA6A 1YBYA 3BVMA 4ANXA 4IQZA 5IP9H 3AE1B 2LWPA 3N1YC 4P1BC 4EFOA 4KHZA 4PNYA 4NDXA 4DR1L 1VQ4A 3HKSA 1PTOF 2Q8RE 1WD0A 1HNZL 1A3VA 5IYDH 4DV2L 2VNUD 2G4DB 1A5RA 1TKWB 2F3VA 1HZ9A 1PGAA 4MDKE 4WQMA 3RN9C 5BMHA 2ZVNA 3S1NH 2EY1A 1EQRA 4NKLA 1TWCB 1VQEA 1XPUA 3PT2B 2OCEA 2AUJD 4XX5A 1L2FA 1KD1C 5L83A 1HA5A 3AEAB 3KF8A 3M4OB 4I7ZC 3CU7A 5KNDA 3P75A 2UU7A 4ZLTF 1X9NA 4HKQA 1JQYD 1R4MB 1YNXA 4FJYA 2JA8G 2TSSA 2PQAB 4GDLA 3NZ3A 1X32A 1XPRA 2IO3B 3ZNHB 1LTGD 1Y69U 3HOUG 4A3GG 1WSPA 4RAUC 4IWQA 1TWAB 4JWUC 4PT5A 2ACZB 4FO2A 3MHBA 3RD4A 5JPMC 2AQ1B 2EY5A 2Y0SG 2HIVA 4YXDB 1FJGQ 2WB1E 2CHXA 4O0AA 3ZRCA 5ELDA 3I4NB 1HQRD 1YQ4B 3AEDB 3ZUNA 2HHHQ 5ELOA 4C4VA 2YVCA 2DX5B 3GTMB 1F2MA 4K5VA 4A3EH 4IFDH 1J7BA 2V3NA 1STYA 4DR3L 4L23A 4A3BH 1TWAH 2H88B 2JPHA 2FAZA 4WQOB 1BOSA 3V60A 2N7JA 4WH4A 2HQLA 1DOLA 2LXAA 4AP4C 1S72A 1JE4A 1AYFA 1C4QA 1VDZA 3AU4A 1OQQA 2Z6BA 5D94A 3TEXA 3VR8B 3S1RB 2DWQA 1RJTA 1AFPA 4HAEA 3J7AF 2OQKA 3G6EA 3L4PA 3BZKA 3R2TA 2F1MA 2B2UC 2D5GA 4C3HB 1P3QU 1WTPA 3SHLA 2PYKA 5IGCA 1PRTF 2YEPF 3QAQA 4US9A 3TP8A 2JZZA 1WXSA 2F52A 1DOKA 1K0SA 3CKIB 1ZXIA 1RL2A 3TJPA 2IX1A 1JC7A 1AZPA 3NEMA 1Q5WB 4C56C 1CMXB 1PXUA 1FFVA 3PUWA 3U7ZA 4DR6L 1VQBA 3HKZE 1NTGA 1MI2A 2RF4A 2QCZA 3QO2A 3S2DB 1XTDA 2KTRA 3EFCA 3H8HA 2MEKA 2K5VA 4KJOA 1PYBA 2LS01 4E6IA 3KWVA 3ZJVA 1ILPA 3RNUA 3PZ7A 4RGOS 5CC4A 2GBJA 4YIJA 1IYVA 3TQYA 3ZNZB 1ESRA 3D3RA 1Q1BA 4HJ5A 1UE1A 3M63B 1SYBA 3ZLZA 2EMSA 2AQ2B 3QWNA 1RLFA 3QJZA 1IW7D 1RTOA 1TWFH 4W9IA 2A68D 4XYOA 2ZT9C 3H09A 1X65A 4DNTB 5JZEB 2EYPA 4RGMA 5L95C 4AJYB 1UEAB 1GJZA 4XGAB 3HRDD 1TT2A 2LEKA 2YLMA 3J9CA 4ZOHC 5EE0A 2CH4W 1WTHA 1W6JA 5FLMH 3HM6X 4XT3B 2NTTA 3CCJA 1XNRQ 3ULPA 4K6DA 1QWYA 2JQOA 2B2VC 1DGSA 1L4DB 3A4SC 1R9TH 2LGXA 3H7SA 2DN8A 1C9OA 5C5MA 3J80c 4X57B 4IDIA 2GVBA 1VLBA 3DM3A 4DHZE 3W2DA 4AUQC 2BWFA 1WVLA 2Z6KC 1UAPA 1SIJA 5LNK1 3TBIB 2CS4A 3MC8A 2LZ6A 2F0VA 4IM2A 4LK0M 3A1QA 3Q2AC 4LF5Q 4ZCKA 1R4NB 4GS3A 1PRTD 3AV8A 4DDGD 2MCNB 1B2TA 2CR5A 1WTVA 3D4DA 5ELNA 4KV2A 4IURA 2N78A 4IUQA 1UH6A 2L83A 2OJRA 3ZXVA 2IL8A 4X65L 4L5TA 4HMJA 4PZ8A 2KN5A 3V61A 1E2WA 2JA7G 2KCMA 1WR6E 2BVCA 1PDQA 1Q0WB 5J2RA 4RHSA 5LL6S 5CV6A 3H3VC 2AEHA 4AH6A 1GUAB 1T0QC 5LHY1 3X23A 3PO0A 5H1SE 1ESFA 3G4SA 2PJHA 3X3MA 3CCUA 2EVBA 2V9HA 3OTOQ 2CQOA 1EEFD 3I4LA 4EZLA 1STNA 1PH9A 2HHHL 3Q69A 4F8CB 4DV7L 3W1GA 4NQLB 1E10A 2K5HA 2Z8LA 1V5OA 4POFA 2KBNA 3L54A 3AE2B 1QT9A 5C1ZA 1I6HB 1C7YA 4CDDC 1MVKA 3I9V1 1HZCA 1E5WA 2RCNA 3KYHC 3SK5A 1FVIA 1PFBA 4GMVA 4ICVA 5AZHA 1Q1OA 2WYQA 3A5ZB 2KO3A 5HURA 3K58A 1C79A 1N8RC 1E9MA 2KDBA 1GUGA 3OMCA 3NPPA 1GD7A 2BS3B 2HQEA 1IXRA 3J80i 5DEHA 1OFFA 3EN2A 2DLBA 5HKHA 3CCLA 4BKGA 3KJOA 1ZDXA 1ZP0B 1GG3A 4QMGA 3HOYH 2RSOA 1EL0A 1B9RA 4QIWB 3EFUA 3KWLA 3KYCD 1SEBD 3GV3A 4JI5Q 1WI5A 2N55A 4B3MQ 5T1IA 4GU2A 4TQUS 3V96A 1UELA 2KMMA 4FF4A 3DBLB 4LJOB 2UUAL 4EZJA 3NRZA 5JVG3 2F0UA 1KLUD 5ELCA 1E0ZA 3BZCA 2WDTB 1BCPB 4HKZE 4ICUA 1N33L 4QQBX 1RFAA 2L7RA 2F0QA 1AWDA 4H13C 4G3XB 4IW0A 3LGJA 1ASYA 3U30A 2NBFA 1EY0A 1KNAA 1LT4D 4IOIE 3NENA 1E1TA 2LD9A 5ELFA 2WFWA 4MSMB 4PMWA 2AKWB 1JORA 1S5CD 4JI7L 2UXDL 2DNFA 3T53B 4FF3A 2I2YA 1WMHA 2EJMA 4LCDE 1OXSC 3AB5A 1CZPA 5IA7A 2ZM6L 2QCPX 2Z4HA 3MXGA 2D5DA 3OPOA 3UDIA 4CGYB 4YHHQ 3L2PA 1WX8A 3GO5A 4X3SA 2LVQA 2EY2A 1DYQA 1CKMA 3I4OA 1S3SG 3NUHB 3BJUA 1VS0A 2YTXA 3MEHA 2CHWA 2RDFA 4X3TA 3AM9A 3I4MG 3R8BA 4C80A 4LW1A 2K0PA 5H8YE 1YNJD 3Q8CA 3RNEC 3HOYB 3ML8A 3NBIA 2WB1G 3SDZA 4OVUA 2K4KA 3Q22A 4L5SA 2CU3A 2JSVX 3QARA 2P5ZX 2E2DC 4MTNA 4DR6Q 4AWJA 1RTNA 4G4KA 5C44B 3PCOB 2LXJA 2VB3X 5T1GA 1C78A 4B3SQ 1VQCA 1J8IA 1J5EL 1KM7A 1TIFA 4IN3A 3TZDA 3AH7A 3APCA 4JI4Q 2UXCQ 1TGZB 3PV1A 2KOLA 3PUXA 4ARIA 3K57A 2K5PA 2MX2A 4HJAA 3LX0A 3Q8FA 1N32Q 1I4RA 3WAPA 3IT4B 3C1EA 2HTME 2XGTA 4A3GB 1RKNA 1A2TA 4K0KQ 1IPGA 3S9WA 3Q3MC 4W9CA 5D7GA 4C1NI 1Y8NB 2OXPA 3DLLA 5LLIA 3AXCA 5C0XG 2JZPA 1W2BA 1VR9A 3QC8B 3U4ZA 5CV9A 1BMLC 2FUHB 4NB3A 2NBWB 3CSFA 2NVQH 4A3KB 4YT0B 2I5MX 1QVGA 3BK2A 1G291 3HS0C 3L0OA 3HHMA 2FE8A 1Y1WB 3FVQA 4NNJB 3D8GA 4A3FG 3LB8C 2WXOA 4CJ2C 4YWGG 2ZNVC 1FD6A 4X6AH 3PRZA 5JAVA 4QF4A 3C3LA 1JWBD 3S24A 4HJKA 1TWHH 4HROA 4MZ9A 1X3EA 1CK1A 1PLFA 4F88A 4TV3A 4FA6A 2XEWA 3P4SB 2BCOA 5JJLA 4PMBA 3G7LA 4HIDA 1QOGA 4GB9A 4YSXB 2XIWA 4E71A 4IFDG 4OZAA 4M8AA 4HJGE 2CJOA 4GSWA 1D7QA 2ASQA 2OT2A 3MTNB 3NK9A 3PZDA 5FLXL 1L0XB 4IUNA 1UNSA 3UDGA 3STBC 4DR5L 1IL2A 1IGCA 1LTID 2LKVA 5FJ8H 3MJWA 5IE8A 2D3CA 2EQSA 3HOZB 3AE4B 2YV5A 5I2YA 4BFRA 1ICFB 3IFWB 3MHSD 2QGQA 3RUIB 3HOUH 1ILQA 3FILB 4Q5VA 3JYUA 4XXEA 4HRSA 2BA1A 3NTKA 4CDCC 1JOOA 4HWIB 3FDTA 3NP8A 2ZJQA 2F0FA 2F3WA 1WH3A 3UQBA 3N32A 3C1FA 2L05A 4IO9A 1EEID 1E8XA 1YQBA 1NY4A 3T1YL 2WU5B 4FXCA 1TKYA 4RCOA 3TP5A 1VQ5A 1CSPA 1GO3E 1VZ6A 4BBNF 2K6AA 2IY1B 4PG3A 1K51A 2BH8A 3GB1A 3PTFC 4OW0A 4CHKA 4JYAL 3T1HL 5EPJA 5IP4D 2B39A 1H9MA 3WWVA 1HTPA 3KLRA 1MJDA 4OEMB 4GKKL 4M1UB 4KJNA 3VYSA 2XN9C 1PUTA 1SE9A 2KANA 3OJ3A 1ZKHA 3UQAA 3Q8AA 2BKFA 1JJCB 1D1KA 2K32A 2BH2A 3UIPB 5IYDG 1TZOA 2QW7A 2EY6A 4ULLA 2JXXA 1MGSA 2Q2IA 2IW3A 4UHVA 4AYBE 4BA2I 1P7FA 3A9JB 2VL6A 1H9SA 3R93A 5IP9G 4ANUA 3J81E 4BBRG 2QDLA 4U673 3KK7A 3PMFA 2L12A 4ACFA 5AJ3L 4TQ1A 2EJGC 4K2LA 3VR4A 4Q2JA 2VQFL 3PV0A 3PO3G 4KMUC 3ZTDA 5FR3A 2GLSA 3W1YA 1EY4A 5DM73 2L4NA 2KN4A 1CT1D 3RZOH 1EY7A 1MJEA 2DAJA 2KHJA 5KYIA 3H15A 2SDFA 5IGEA 3CC7A 3MC9A 3VA7A 4BAXA 2BKRB 3NBHA 4DR2Q 2MBHA 2R93H 2N8NA 1TS5A 3S1RH 2FNJB 1EZ8A 3K7UC 3RT3B 3DEPA 3MWYW 3S16H 2SOBA 4A9AA 2Q2UA 1T5EA 2EYJA 2GA4B 1HNWL 3IXSA 1YJIA 1F2RC 1LTBD 2CWPA 1TS2A 2QA4A 1WJNA 5JHAA 1DM0B 2KXJA 1GM5A 1T5XD 5AUKA 1FYCA 3OHXC 1V1OA 1T0SC 3I56A 4GN5A 2N0SB 2WXHA 3BY4B 2O6VA 3PS6A 4FDBA 2MUYA 2DGYA 3EBEA 4IFDI 4HPPA 1XYIA 2RDBC 4BBSG 4DXAB 3AECB 3NS1A 3S17H 2A4ZA 4LAAA 2WKCA 3TL5A 2DUDA 1LT5D 4OO1H 3T56B 2Z4IA 4J1MA 1SJED 3GDEA 2NS5A 1Z2MA 4G50A 4DN4M 1EYDA 4NJCA 1ICWA 1STAA 4POGA 3ZJUA 3VXWA 1T3QA 4JVZA 3Q14C 5HHDG 2NB0A 1SE2A 1D5ZC 4JI2Q 5L37A 1NI3A 4R4CA 1I4GA 2O4XA 2K5NA 4EVOA 4JGHB 4JI3L 3T1YQ 2EELA 3A8JE 1HH2P 5C6AA 3CIRB 4DV0L 2A6EC 2FCNA 3BG3A 5EBCA 4OWWB 5E6JA 1OXVA 4A3FB 5ELEA 3VR5A 3E5SA 2LSSA 4G11A 2GBKA 5IP7G 2BF8B 1I4XA 4P2CB 1A62A 1PZID 3RLFA 1WTOA 2M56B 4HJ9A 1FRDA 2KDMA 2KJ6A 1PGXA 2JXMB 4OONA 4DV6Q 3EHVA 1LYLA 1RWSA 4ZRPA 4CQNA 3ZYYX 1XJVA 2Y0SE 2I07B 3T4AC 2ZPNA 1T0RC 3A74A 1EYCA 2OEDA 2IO1B 3PLUA 2R7FA 1WCMH 1I35A 1NDDA 2JYEA 3PGZA 2F0LA 1EUJA 2QEXA 2RDGA 1QVFA 3FPUB 3CSTA 4MELA 3KF6A 1PH2A 2DYBA 3CCSA 2KDEB 3KH0A 3TUOA 1KL9A 2FINB 2M8SA 1VZ7A 4JV5Q 2E2HH 1K8MA 1KRTA 2RVLA 4B9WA 1AH9A 1X55A 2A8VA 2RR9A 3DWMA 2L5TA 4K7SA 2E3TA 1VMCA 3B6YA 1Z5SB 3F2DA 4B3RQ 1VQGA 1STBA 4WAFA 2CCZA 3M7GA 1DZ1A 1OGWA 4KX6B 3CXCA 1QCBD 3F8TA 3HUIA 2INCC 2B29A 2PZTA 4MGYE 3NJTA 2E2JB 2X69A 1V2YA 4HXDA 3TP7A 1L2NA 3KQ4A 1CTMA 2KQ7A 4DK1A 4X66L 1D3ZA 1YITA 1CA6A 4WURA 1TT5B 4Q0FA 5J39A 4K3BA 4HIKA 5EAYA 2Y5BB 3B2FA 3E0EA 1VMPA 1I50H 3P7JA 4DK5A 3CQZH 2MO0A 3MHZA 3H1UA 2FCSA 3AEGB 5M5XB 2B63B 3UE1A 3IAS1 3PO3B 2ATWA 3TP6A 2VUMB 1AE2A 1CSQA 2FXQA 2IHEA 4LJPB 1R4PB 5CGKA 3BDOA 3BYYB 3CMEA 3Q3NC 3F2UA 4LUOA 1NYRA 1CA5A 4NXMQ 2OTLA 2DZJA 3HRZC 4R9WA 4BWGB 1V1PB 1WCMG 5IY0A 1BO0A 4MM3B 1O7ZA 4I65A 1RHPA 4A3MB 1V9JA 1GOZA 4KHPQ 3R3OA 3GTPB 1TJEA 4IJLA 3U9OA 4ZUIA 2KAJA 5JPNC 2OHFA 4JI1Q 1PFSA 4ID6A 1YJNA 3EECA 2PO4A 2IJ0A 2VZKB 1ZYRC 4RWSC 2ZW0A 3N1XC 3DWAA 4N6EB 2KDIA 1IKMA 2ZM6Q 5DCNA 1KRSA 2HUGA 3NBHB 2PNRC 1GXDC 1FGBD 2K33A 5EKIA 2J0MA 1KOTA 3CPFA 3H7PB 5CHVC 3RZFA 1BUVT 2NVYH 5HGQA 5HY6A 4DXGA 1SFOB 3RI7C 4OZBA 5DM63 1NSNS 3NQIA 4KI0A 1L6VA 2FCMA 4N9TA 4CJ1B 3SDLC 2D07B 4JC0A 2A68C 4G7HC 2ON8A 3HP3A 3J7A5 2ZZPB 1F52A 1N60A 2BDNA 3CCRA 2CU1A 3B9JA 2XTIA 4XWWA 1NR4A 1WM2A 4HMIA 3APDA 2IGGA 1YHQA 4DV0Q 5IYBH 3ALBA 1VF7A 3HZXA 3VH3B 4HSPA 1JROA 5BN3A 1RFKA 4LK1C 1JOKA 1PHJA 2KZRA 4BBSH 2F0NA 2QC8A 2M0XA 2KCNA 1S5BD 3N6RA 4KN4C 1VQKA 4H7BA 4A93B 2L52A 4DKAC 1YIWA 3RN2A 1QUQA 2UU9Q 1U9RA 2Z0DB 3I3TB 1GPXA 3HOZG 4GOPC 3A7AB 2EKIA 5AJ3Q 4QUCA 3VUWA 1SJHD 4DBGA 3A54A 2N4FA 2INDC 3GTJH 4K8IA 2WIIB 1WF9A 1L7YA 2PLPA 2WXKA 4KIKA 1V43A 1KLGD 3ULJA 4MH0E 1S3OA 3GQBA 1K53A 1QKZA 4K7WA 2IGDA 1QB5D 4F7XA 4TSSA 3PO3H 4IPGA 1EY8A 1QE6A 2K5DA 4HVBA 4LNIA 3VVWB 4BBRH 3GTOH 1B8AA 3DHHC 4DQOC 4DHZB 5M3MG 4WWMA 4DK6C 1FEHA 1CUKA 3RLNA 4CBVA 2E2IB 4GXBA 4L5QA 1GUOA 2W54A 4DNIA 1YEZA 1WD1A 2D62A 3MFYA 3C46A 3NXWA 1TR5A 1SF0A 2ZJDA 2LRUA 2HCCA 5C2TB 4IPCA 3CPWA 4FNFA 2PE9A 2PIAA 5CMDA 1HTLD 2F4IA 1SRUA 1N5WA 5JHBA 3DCGA 3QX1A 1SE8A 1E3PA 3T51B 3AMZA 2A19A 4NMZA 2IHFA 3URYA 3IBEA 4YTMB 3VR6A 1RF2D 2N9LA 4XE0A 1B9MA 1WGDA 2WXNA 1O7LA 3QG1A 2KWCA 2J0KA 1FL0A 3TIXA 1YOVB 5D6JB 1YJJA 5HG2A 4IPHA 2K05A 4GKKQ 4JWSC 1CZGA 3DXJC 3EGRA 3T9LA 4YCWA 2EOTA 4JLCA 4J6IA 2K8HA 2KWUB 5E6OA 1KQSA 1JWMD 1EWHA 3AEBB 1RIPA 4R4OA 4YCVA 3KJPA 2QSDA 1L5PA 3I3CA 3T16A 4DNRB 3MAQA 1G8ZD 2JA8B 2K5WA 5I6YA 1KAAA 2FIFA 5J18A 2OJWA 5J3BA 4XDXA 5FJ8G 4KDLB 4KY6A 4DFAA 3KFUA 1PFMA 3W3AA 2F03A 1IBML 1R4MI 2LFIA 2CKHB 3CHBD 2G4SA 2QILA 4HR7B 1W3SA 1YNJC 2IYDB 3CF5A 2NVTB 2K22A 2KMCA 2FMMA 4K14A 3E9SA 1DCZA 3U8ZA 2KYWA 4FADA 3H3VI 4Y52H 5E1FA 2PQAA 4GDLB 1HR0Q 3UINB 2MFIA 3J81j 4A3FH 3WOEA 1EQVA 4A3DB 4K5XA 1E7UA 1G91A 3SK4A 4LFCL 1SNMA 2B2WA 3EA6A 5DNFA 2QHOA 2H89B 4H44C 1AP0A 4TRDA 4BY7B 1LTLA 4A3EB 4BBNC 1DOMA 4A3BB 1MIUA 3KLWA 1EIYB 4YSZB 4BY1H 2KHIA 3OG5A 4XIGS 4L1BA 4TKOB 1GUWA 2KNBA 3Q8EA 1H95A 3E6ZX 4I6LB 5C0XH 2SAKA 3ZQ4A 1GKHA 4K6LA 2WXRA 1J5EQ 4DR5Q 2F3IA 3N30A 1JMLA 3D4RA 1ZPSA 1KRHA 2BQQA 2D11A 4XZ4A 1Y8PB 5G5GA 3ZGZA 3FEWX 1VQ9A 4ZRIA 3AEFB 1FCLA 3IT6B 2PMZE 3VAWA 3NHEB 3P4PB 1HXYD 1S5DD 2JA5B 1MHWC 1OXUA 1UE6A 5LMUQ 3V05A 5IT9c 3AEEB 4BKTA 4UP7A 1TKEA 3AE6B 4W9DA 1D6EC 3HKZB 4A3CH 1NI2A 5G5HA 3M4OH 2KWVB 4OWTB 5F2DA 3AULA 5LXHA 3O65B 2EKEC 2BA0A 3VR9B 4JOIC 3I8ZA 3VTUA 4NXNL 2ZNVB 3PRMB 3ABVB 3I4MH 4MEMA 4GZYC 4BKSA 1PH8A 3TMPB 3FKIG 2E2IH 2DENB 4MACA 1FFUA 3K0XA 3GE3C 4JI7Q 2UXDQ 1PVOA 2KCTA 3E56A 3WCQA 1SYEA 1F9QA 3VUXA 2FUG1 3GTPH 2WU2B 3KUCB 1HA6A 2PEAA 4HK2A 3Q24A 3X3NA 2ZJRA 4N9F4 1KTKA 4IOAA 4F7ZA 1SXTA 3H0GB 2PMZB 3KBXA 2AWTA 2KCCA 4I6PA 4KZ0A 1IBLL 3PIOA 4XDCA 4GLVB 4JI3Q 2EMTA 1GUSA 4RG1A 4XQQA 5EJWA 1JICA 3ULLA 2VQEQ 2A6HC 3C19A 2F0KA 1OXXK 1SR3A 2KECA 5BN5A 4FF1A 1Q8IA 3DWQA 2JA6G 1IZ6A 2C60A 5BYSA 1FRRA 3RMHA 3A56A 1SMYC 1DONA 1X56A 2A69D 4MTKA 2C9OA 5C23A 4LFBQ 3A9KA 1STGA 4II3B 2KX0A 4M02A 2FMCA 1XMOQ 4J6HA 1PTOH 2DNEA 3VYRA 1WM3A 4BY1B 1WY8A 2GBRA 2OOBB 2W3RA 2N88A 2Q5WD 4DAYA 5I2XA 1AE3A 4HJ8A 4HEDA 4O2DA 1FNUA 1BBXC 2F4VQ 3HOYG 4K8JA 4DGZA 2NVXB 1JRUA 3V62A 4YCUA 5NUCA 3OLMD 1UWVA 2F0PA 4N58A 1YNTE 1FPYA 1FXAA 1Z6HA 3R2IA 5EGTA 2F4VL 1XEEA 3EC8A 1HQMC 1TWGH 3D31A 1Q81C 1MPEA 4K3CA 1EQTA 1CFMA 3L16A 2L11A 2B2WC 3NWSA 2J7QB 3GE8C 4FVMA 3BZDB 1C77A 4RM8A 2L00B 3HOXH 4F8MA 1EU3A 4KY5A 4A3JH 4G7OC 3QK0A 3N52A 1PZKD 2NVTH 1TBEA 3CC2A 2AHOB 3MFGA 3OSOA 3QIJA 1VQHA 2IZVB 2RSNA 4WFN3 3TS0A 2F0MA 1LTSD 1IBKL 2I5HA 3FPPA 1E0BA 4HJ7A 1AZQA 1YJ1A 3SXHA 5C4HA 2L0CA 2EJFC 4LF7L 1F2RI 3S17B 3GTGH 3L0WB 4WWNA 5JEAJ 2M00A 5J22A 2K25A 2LVOA 3NVZA 1CKNA 5IIFA 4C3JB 4LF7Q 3V6CB 2JA7H 1VCIA 1ET9A 1XMOL 3HM3A 4I7AA 2ASBA 4LFBL 4FULA 2RSUA 1LTRD 3ONSA 3CMAA 4LDTD 4RH6A 5KNBA 5LMNW 4EE2A 2DHZA 2M4NA 1Q3LA 5GADC 2KVMA 4W9LA 3OW7A 5KEEA 3NS8A 3RLOA 4GNXC 1QNUA 1NMGA 2LHDA 1CZWA 5FKAC 1I50B 4QCLA 2UXBQ 3P2BA 4JI6L 2Z0EB 4DPGA 3H9DA 2JWUA 2W3SA 2PVOD 3M3JA 2NVYB 2MA9B 2RCFA 1HHVA 1KF6B 1BCPD 1EOTA 1II3A 1WRIA 2A6HD 1D2BA 4QB4A 5FLXE 5EKKA 1N34Q 3RZDH 4JI0Q 4DAMA 5FLMG 1KH0A 1H9JA 5KRUA 1WE6A 1SNPA 4FXKC 4MM3A 1CQFA 3TS2A 3I70A 3VUYA 2FJ2A 3HOWB 1BR9A 2PPHA 1HZAA 1Q8KA 1V49A 1MG8A 2JQRB 3U7DA 1I5FA 1YVCA 2K39A 4KV6A 2ONQA 3PUYA 5GAGC 5BR8L 3AE9B 3N3KB 5JJZA 4A3IB 5ELBA 4LF6L 2R92B 4RMAA 5JJKA 2C5CA 1QOBA 4P16A 2GMIC 4JBMA 2AL6A 4YY3L 4PYZA 2KOXA 2NPTA 3H7PA 1IBLQ 5CX3A 1DXMA 4ZKBB 1QOHA 2DNCA 4GOPB 3U52E 2KEEA 4LF9L 3VTVA 1K28A 1HTQA 3LNNA 4YY3Q 4S3SA 2CFMA 1O80A 3U2SC 5K5PA 2A5HA 2MJ8A 2KX3A 3Q3OC 3L9AX 1IHZA 2WLBA 1B3AA 1QILA 2ZXOA 4DV4Q 1XD3B 4IWOA 3LDZE 1MFWA 1NCVA 2DBYA 2VXWA 1HZ6A 4PS8A 2OEOA 1RRBA 3S1MH 2ZCCA 2C7NB 1F0ZA 4EX5A 4NPSA 3RFZB 4IPDA 4L2YA 1TVXA 3HG9A 3ZIMA 4KSKC 2ES2A 5CV8A 2R7ZG 2JK8A 2HD3A 1IKLA 4GDKB 3SE0A 3M4YA 1LXDA 2WS3B 3SU8X 4RMFA 4L63B 3VRAB 3K7AH 2Q2HA 2G9DA 3AU7A 3KLSX 5C0XJ 5FO7B 4RA8A 5C3EB 4HIOA 3JSVA 1I7HA 1GUNA 2RA4A 2KKCA 1TZ1A 4XQNA 5A35A 1JWAD 2L0TA 4WAAA 2ZPYA 1FR3A 5LL6X 3NVVA 1YHAA 1C4CA 4S0RA 4W9KA 5D3IB 1V6EA 4EKUA 4J8QA 1X54A 3BYTB 3CCVA 4KY7A 4A3BG 2NBUA 3VQIA 1EYAA 4A3EG 3RD2A 2MRPA 1WXQA 3QIAA 3KYDD 5DPTA 2MQJA 2EPBA 1SYGA 3WANA 2I46A 3I55A 2WV6D 2HIXA 4CO7A 2J0JA 3IAM1 4GDKA 2NZHA 4KIKB 5HGTA 2OWOA 1IYFA 1EM7A 2HJ8A 2XWBB 4R4QA 1LT3D 4LF4Q 1XNQL 1E24A 3KOJA 5CV5A 1G6ZA 2PW7A 2C5LC 2DZIA 4A3GH 4AJWA 2Q8TA 4XC2A 1MD2D 5D14A 4A76A 1UE7A 3S14B 1AARA 3I57A 3UGBB 3AEVA 1SSNA 1JE5A 1RDPD 2JA8H 3K5OA 4DA2A 2JA5G 3EVQA 2LI5A 3JAMc 4JCVE 2ZXRA 4PQXA 2G1EA 4M0WA 1K73C 2KVRA 4P75A 1EF5A 4A3KH 3VYTA 5BN4A 4Y7NB 4A8XC 3OWFA 3I91A 1OTRB 2WQYB 1G6JA 4FYDA 2ZXPA 2LXCA 1C76A 3HOWH 1HFNA 1WRDB 1IBXB 2BYEA 4DUZL 2BOSA 3OOCA 5M5WB 4IUUA 5JEAG 2O5IC 1VJKA 3S2HH 4X62L 4AQYQ 2I1JA 4ZRQA 5M3FH 4KLKA 4JBJA 3K59A 4TQ0A 5C0XI 1NEKB 2CHZA 3N9YC 5C4ZA 3LJ3A 2WP9B 2PI2E 2WX1A 1JJGA 2JU6X 1E7ZA 1PYWD 2R61A 4R4IA 4JI8Q 1I94L 2V4LA 2JEAI 1EIFA 1TWFB 2LGYA 2MHJA 2WP8J 2JEBI 4EQNA 4M0WB 5DLQE 4LMQD 3HVDA 4MGKE 2WAQB 2IO2B 4B3TQ 2HD5B 4DAYB 2WDVB 2WX0A 4LWCA 4A3IG 3N20C 5TR5A 1M8AA 3EROA 2D2QA 1B1ZA 2M1MA 4KVGB 4BS9A 2FBWB 5JVH3 1YJ9A 4C3IH 4WJ4A 1Y8OB 1A6XA 2KTFA 3LYYA 5C4JB 4RM9A 4EQPA 1K52A 1JQ4A 3PIPA 3W1SC 3BIID 3RNFC 3S15H 1J6QA 3JW0X 3L7ZC 2A5UA 1PH4A 3SGIA 3AMUA 3HK0A 2X8XX 3HOVB 4PYUA 1A0IA 5K36G 1N9WA 1JB3A 1MHHE 2EE1A 2AL3A 3TDQA 1WYWB 2MLBA 4A93H 1C4AA 3A9JA 2CH4A 4DR4Q 1TTNA 2MJEA 3NZSA 3PREA 1SB3C 1YI2A 4A3JB 2EXZA 1EWYC 1SNOA 3N1ZC 3QOJA 4KSLC 4ZYSA 4C2MB 5M5YH 3KF6B 1P7EA 2QIEB 3WIMA 1BKBA 2IPKD 5AZFA 4ZAIA 4ZRZA 1Q46A 3I7FA 3PUVA 1B4OA 2IWHA 1U4MA 4KGRA 4URKA 5FR6A 3UF8A 5DPRA 4OL7A 4A4IA 4RF1A 2LGSA 2B3GA 2M19A 1P1AA 1F1HA 2LVPA 3NTIA 2KUMA 3SK8A 2KWDA 2PZUA 1SFOH 4DR2L 1IBXA 3RN5A 2N3SA 4KD3A 3GTMH 1I3QH 5LMUL 1YJWA 3I4NG 1VD2A 3UI3A 4FHJA 4MJSB 4JW0A 1PQSA 2E8GA 1NJIC 2JUOA 4C3JG 4NXML 1N61A 1ZUD2 1HRJA 1J19A 2KDFB 4HCPB 4IWPA 4CKEA 1MI0A 2B63H 1TYGB 2D10A 4OHJA 2Z1CA 1PFNA 3BVGA 4GLXA 2B2TA 2EYFA 4JQWC 3ZO5B 2HJ1A 5BMIA 1B53A 2I38A 3PF5A 1N34L 4DV1L 1J7CA 2K03A 4QUFA 2HT1A 3GD7A 1J7AA 2B76B 4JIOU 2I1KA 2N7EA 2WGSA 2KC1A 2NUCA 2V1CC 3EJIA 2O5JC 3TEHB 4BZAA 3NUCA 1GUTA 3CRKC 4UP8A 2ZEQA 3WALA 1HR0L 1HZ5A 1P8LA 3JAMi 1NBFC 3CCQA 4GNXA 2EZVA 1A3UA 1MSHA 1Z9FA 5IYCG 1XF5L 1VQJA 2WHIA 4LTUA 1KABA 4JL9A 1R9TB 5IOIA 1STEA 3ZNID 3S1NB 4C1NK 1PFDA 4MT5A 4ZUJA 3Q3JA 1IBMQ 3RCZA 3T8MA 2E75C 3SD5A 3J80E 2OQ0A 5HFYA 2PQEA 2GI9A 2WXJA 1B7YB 1L6UA 1NR2A 2MH7A 1JRPA 3ZNGC 2V0GA 2KHSA 3HVZA 2WXGA 1QZGA 3H3VH 1QVCA 1KIXA 2NZOA 1M1KC 1WX7A 1WCMB 1XTCD 5IT9L 4QY7A 4KD4A 1JJ2A 3D32A 2A6ED 3NOBA 1YD8U 5CTRC 3AE3B 4B9KA 3TRZA 1WX9A 2ALYB 2AMCB 4FXGC 1BCPC 1U4RA 4HCEA 4MH8A 4NY0A 1PTOD 2WKDA 1GC7A 1MG4A 4LFAL 2L32A 2QF7A 2KVZA 2JSOA 3F2BA 5M5WH 1XCQL 2K8BA 3I72A 1U0LA 4LNKA 1H9SB 4OVVA 5BYRA 2M0AA 4A3PA 2F0TA 1O78A 1T6BX 4MJSA 4JI2L 2AWNA 4N9PA 3PHWB 3VH4B 2DZMA 4X64L 2UUBL 2NTSA 4RFBA 1GNUA 1WWTA 1VRAB 1ENCA 5COYA 3QB3A 2R7ZB 4BA1I 1LO5D 4WORA 3SHQA 3PO2B 1FXTB 1BUIC 1QOFA 3K7AB 1IGDA 5C44G 2KT7A 4WIPA 4IALA 4C3HH 3A0JA 4JI8L
chains in the Genus database with same CATH topology
2WXFA 5BMGA 3D6CA 2EDGA 5I9OA 2J52A 1RCVD 1KDCA 2J53A 1DOIA 3H6MA 3D4WA 2YU9B 2XWJB 3MJ5A 3T13A 1D5XC 1OQRA 4DK0A 3B2GA 1QNKA 3Q6SA 1QQRA 2BB5A 5EPLA 1MHXA 3TEWA 1F9SA 3P63A 1I6VC 4H2AA 2J4XA 2NVQB 4HTHA 5IGDA 3DMUA 4UAIA 1LV9A 1UGJA 1EWCA 2PW9A 4JPSA 1S5ED 2JX5A 1WTXA 2NN6G 1YN4A 1ET6A 1F2ZA 5J1ZA 5C3JB 2JYTA 4DXFA 1TU2B 1XXGA 3T3OA 3MVVA 4G7ZC 1QLBB 1MSGA 5BYQA 3NVWA 1QJOA 2L9HA 2NMQA 4FP5D 1I4PA 3LWEA 2F0GA 1GHKA 4ZHOA 3GTJB 2BE5D 1U4PA 4IUPA 2WINB 1LACA 3G6JB 4Z9CB 1EY5A 5M3FB 3NVYA 1OO9B 2JA7B 1HUMA 1E7PB 2WDQB 2CQAA 1Q12A 2X38A 3DEOA 5JXVA 3M85A 2E2HB 1A70A 2KA7A 3DM1A 1BF4A 5A2QE 4US8A 3I4MB 2BT6A 2XNAC 1SNDA 3LXFA 1HCZA 2MJ3A 4CHTB 2JA6B 3K5LA 2IDYA 1FNWA 2KEDA 2F0WA 4X3KA 4ZKCB 4J3OD 3SR6A 4KN7C 2WDRB 2M9VA 1SSOA 3K5NA 1F2LA 5EE1A 3I90A 3IL8A 2RDHA 1V97A 4B0MA 3PIO3 1Q10A 3MXUA 5E4XA 2A74C 1WYGA 1ZKOA 4OO1I 4AQ7A 5D3DA 4P6VF 5IGBA 4ZK9B 4FF2A 1FMAD 1ZE3D 3S15B 4OIJA 1LT6D 2K5QA 3S1MB 1TS3A 2H4OA 1YNND 2XVSA 3NTHA 3V2TA 1IL8A 1NUCA 4A6QA 4KKJA 5C5LA 1PTOC 3DHQA 4L6TB 1SE4A 1UWMA 3TN2A 3H94A 4C3IG 3A55A 4KK7A 2K1BA 2L1BA 2EYMA 5CBEE 2GB1A 1SAPA 3HEJA 2DY7A 3JAML 1BCPF 4AYBB 5KYLA 1JR0D 1ZXHA 5IODA 4V0BA 4UDUC 1VF5C 1PGBA 1XLOA 3BS1A 1GHJA 4KKUA 1WTQA 1JOQA 1D5MC 1JCKB 3D6WA 3Q23A 3AB9A 1SYCA 4IFDJ 5JEAH 1DJRD 4HEA1 2NYZD 3BVZA 2BYTA 4YTPB 4B0EA 3KLSA 2H1EA 5CV7A 2Y5CA 1MBYA 4GLSC 2KACA 1NYQA 2F0IA 4PV1C 2RMMA 2INPE 1FXIA 2KQ3A 3BDCA 2BS4B 4LJZC 3HGBA 1C9FA 2BW2A 3VRBB 2B2TC 5EKLA 1S5FD 2V4DA 4KKIA 1BNZA 4O42A 2IT1A 4IZ8A 3SK6A 3GTGB 1J9OA 5G3LF 1TWHB 3EQLC 3HOUB 1G2TA 1ACCA 2KQ4X 1TY2A 1XLPA 5I4DA 2FHTA 1BDOA 1C8CA 1EIGA 2F0SA 1N63A 1CQVA 4ABNA 1DGJA 3MA2B 3GTLB 5CBAE 1FD7D 3TZUA 3LWUA 3GS2A 1SMYD 5FO9B 3J80L 4R8NA 3DWPA 5EQ0A 2FFKB 3E0JA 4HSVA 1AEXA 4NP5A 3IFDA 1WTWA 3ITPA 2BTEA 1VZ8A 1RM6C 1YMHE 1Q90A 1SYDA 3SFEB 1F9PA 3NE5B 4C7YA 1IW7C 5H92C 3MZ5A 4K2KA 1EY6A 4XYQA 1K8OA 2AWOA 2RQXA 1EY9A 4RGTA 1FNVA 2LY7A 3A7LA 2V3PA 1DD2A 1F9RA 3FC4A 3FILA 1LTAD 3DUZA 2K9XA 3K6OA 4ITKA 1NAPA 2E76C 4RCNA 1ZOYB 1YN5A 3CRLC 5A2QL 1K50A 4AS1A 3TEYA 4BBSB 5EBDA 3QOLA 1LABA 3K5MA 3ND8A 2AQ3B 4A90A 2K7VA 3MC0B 2TMPA 1BXTA 1Z47A 3ND9A 5E4WC 2HDEA 3V3XA 3RZDB 5CORA 4RHRA 4WRDA 1JALA 2E6XA 5FOBB 1N5XA 2O2LD 4IUVA 1XWEA 4D2KA 2X6GA 1DOYA 1Y1VB 3AE7B 1EZ6A 2N9KA 3WDNA 4NZLB 3ONAB 3W9CB 3ETRA 1N62A 4HCSA 1RYJA 4L8JA 3PIP3 1XX8A 5TSSA 3VYUA 1I3QB 1ZEQX 2EYLA 3VA5A 2WNMA 4JX1C 1A15A 1FM0D 2B8FA 3GP7A 3EFXD 4JBWA 2QMTA 3WOFA 3TEZA 1H9RA 4ARCA 1XLNA 1TKGA 1GB1A 2IX0A 1E2VA 1V8CA 4MIUA 1IYUA 1I4QA 4OZCA 2ID0A 5IGFA 2W82A 2IGHA 2YYZA 2F0EA 4RKLA 4OGQC 1WGKA 1TWGB 2VZKD 4IKGA 2B2YC 5D65A 2JP1A 4CKBA 2WXQA 3BK1A 2DY8A 3I73A 4B08A 1Q1EA 4C3IB 1ZDVA 5IOCA 3O13A 2E74C 1TY0A 2QDBA 3S16B 5IGGA 4R8IA 2WXMA 3P1HA 1W6KA 2D9UA 3CWIA 2B2UA 5M9OA 3J7AV 3W5UB 1O7YA 1SNQA 2DYOA 4CKCA 3AE8B 1E2ZA 4RF0A 2RKSA 2CW0D 3QJYA 5FK9C 5I6WA 3Q8BA 4KHVA 3FRPB 4OIKA 3S1QB 5HI1A 2WB1B 2VB2X 3NSWA 3P1MA 4RGNA 1L0VB 5M3MB 4CJ0B 2CJNA 1LLRD 1C4PA 2BS2B 3IFTA 2MGSA 2WXPA 2MP1A 2B2YA 3NWTA 1AW7A 2G9HD 1GJXA 5GXGB 2BB6A 1WTRA 1K83B 1ML0D 1AN8A 1PDXA 3P4RB 1JWSD 1HUNA 1Z7TA 3MP9A 2ENBA 4H0LC 1YQ3B 2CW0C 2BE5C 2ICIA 3H91A 4R3DA 2V4IB 5DAUA 1SYFA 1CHQD 3SVMA 4ODGA 3M3YB 2R6GA 4RNAA 3PZ8A 2WACA 1HPCA 1I4HA 2B2VA 1FCCC 1SDFA 2W55A 3ERQA 1SBBB 3ZJTA 5KIXA 4XDDA 1CJEA 3FAHA 2PMVA 3UI2A 4JE3B 4C7ZA 2LUMA 4K5WA 2ZW1A 1CHPD 1RODA 3RZOB 3BDLA 4XT1B 1EU4A 5G3LD 1SNCA 3P4QB 2A69C 4NW2A 1XLQA 1BQQT 2PTLA 2GRIA 2DYMA 3SEBA 3OIPA 1D4BA 1EIHA 2K28A 4V190 2A73B 2LMCB 4NAMA 1HEZE 4B9XA 5MPOA 3GTQB 3NHHA 4F87A 1PMRA 3P42A 2MJDA 5EPKA 3M7NA 2R93B 2XRSD 1QF6A 3RPFC 3J7YW 1B9NA 3CQZB 1M4VA 4RKBA 3Q0AA 5IT9E 4ILWA 1PRTC 3A8KE 1JW9D 1PZJD 4EQOA 3U4EG 3U9SA 2NN6H 3FKIB 4KGSA 2AX5A 1X3QA 3SR1A 1S4ZA 4HN7A 4EGVA 4TMAB 3KUPA 1GAQB 1KNEA 1JWUD 2NZ1D 4YTNB 4N59A 5E3FA 2K01A 5FO8B 2IX3A 3NQTA 3P20A 3VR3A 3GV6A 1GB4A 1R4QB 1YNNC 4LLGM 1TIID 1KFYB 2EYHA 5ISRA 1V1PA 4KKSA 2CVRA 2J0TD 4XQJA 1G2SA 1Y56A 2WXLA 2JYOA 2LMCA 2AUKA 2D2CC 5CV4A 1ENFA 3DWGC 3OWEB 2OF1A 3L3OC 1XO3A 4JK1C 1ENAA 1UUPA 2RPVA 4C3HG 1EFID 1QOAA 2K04A 5KGUA 3KBGA 3HOXB 2X6LA 1CI3M 2Y5PA 4XWTA 3K0YA 4DF7A 2K3UA 4DAPA 2LFNA 4PMCA 2BDOA 2BBCA 2PZWA 3MTSA 1DOXA 4OVZA 4MHEA 5T8IA 1A3TA 1B44D 3EUB2 1PTOB 5C3WA 3AN1A 1A2UA 3IKJA 4YSYB 1ZXTA 1STHA 3GTKB 2PPBC 2NN6I 2B8GA 3RUZA 1R7SA 3W1SA 4BBRB 3GTOB 1NVID 2L1AA 4REZA 3SFDB 1ROEA 5AUIA 3FMCA 1TS4A 4X3UA 1SE3A 3MXPA 1RD9D 5I9PA 4IUTA 2HDLA 2PVGC 1F2YA 3J81L 3S2HB 1QG7A 2HCIA 3OMGA 3TMEA 2SNSA 2XRQD 2QKIC 3OIQA 3VR2A 2ICEC 2MHVA 1UWXA 4MN3A 5C4XB 1E6EB 4U68A 2XSCA 1NENB 5EE3A 2F0DA 1F77A 4KTAA 1KDBA 2JXTA 3MXNA 3A8IE 4USAA 2Y3AA 2KJXA 1YN3A 2M2LA 5JOBA 2J42A 3T3NA 4ZQ3A 1ZYRD 4O1NA 2L55A 5AFWA 2Y0SB 4A55A 3C8YA 2RBMA 1VDVA 2QEJC 3AE5B 1XCTL 3BWUD 2HDMA 2LHEA 4FXDA 5M5YB 1U4LA 2PW5A 2INNE 4DAVA 4KGTA 2MPMA 2SNMA 5CR3A 1L4ZB 5CYUA 2J7ZA 1IUEA 2F0OA 4XTCS 4DU9A 1CM9A 2LJIA 1PRTB 3TSSA 2JE6I 2QJLA 2LGIA 5C3XA 2SEBD 2F0JA 1L0YB 1FO4A 1OXTA 2WXIA 5K36H 4OO1G 1C48A 2Q8IB 2R3ZA 4KKTA 2CHBD 4G57A 1FIQA 2F0HA 5EE9A 1LTTD 1KDAA 1X3PA 3IAYA 4ZHPA 2PCFB 3C2PA 1V8QA 1TQOA 1D1IA 1HFGA 5KNCA 2PKOA 4NAWB 4ME5A 2YEPB 1H9KA 1B50A 3W5VB 2NWGA 3PUZA 2EYOA 1ONLA 3JAME 4WJWA 3BVMA 4IQZA 3AE1B 4KHZA 4PNYA 4NDXA 1PTOF 2Q8RE 1WD0A 1A3VA 2VNUD 1TKWB 2F3VA 1PGAA 5BMHA 4WQMA 2EY1A 4NKLA 1TWCB 2AUJD 1HA5A 3AEAB 3KF8A 3M4OB 4I7ZC 3CU7A 5KNDA 3P75A 4ZLTF 4HKQA 1JQYD 2TSSA 3NZ3A 1X32A 1LTGD 1Y69U 4JWUC 1WSPA 4RAUC 1TWAB 4PT5A 2ACZB 4FO2A 3MHBA 3RD4A 5JPMC 2AQ1B 2EY5A 4YXDB 5ELDA 3I4NB 1HQRD 1YQ4B 3AEDB 3GTMB 1F2MA 4K5VA 1J7BA 4IFDH 2V3NA 1STYA 4L23A 2H88B 1BOSA 2N7JA 4WH4A 1DOLA 1JE4A 1AYFA 1C4QA 1VDZA 1OQQA 3TEXA 3VR8B 3S1RB 2DWQA 1RJTA 1AFPA 4HAEA 3J7AF 3L4PA 3R2TA 2F1MA 2B2UC 2D5GA 4C3HB 1WTPA 3SHLA 2PYKA 5IGCA 1PRTF 2YEPF 4US9A 3TP8A 1DOKA 1ZXIA 3CKIB 2IX1A 1JC7A 1AZPA 4C56C 1PXUA 1FFVA 3PUWA 3U7ZA 1MI2A 3H8HA 3QO2A 3S2DB 2MEKA 4KJOA 2LS01 4E6IA 3KWVA 3ZJVA 1ILPA 3PZ7A 4RGOS 5CC4A 4YIJA 1IYVA 1ESRA 3D3RA 1Q1BA 1SYBA 2AQ2B 3QWNA 1IW7D 1RTOA 2A68D 4XYOA 2ZT9C 3H09A 4DNTB 2EYPA 4RGMA 1UEAB 3HRDD 1TT2A 2LEKA 3J9CA 4ZOHC 5EE0A 1W6JA 4XT3B 2NTTA 1QWYA 4K6DA 2B2VC 1L4DB 2DN8A 5C5MA 4IDIA 1VLBA 3W2DA 1WVLA 1UAPA 1SIJA 5LNK1 3TBIB 2F0VA 4LK0M 1PRTD 3AV8A 1B2TA 1WTVA 3D4DA 4IURA 4IUQA 2L83A 2IL8A 4HMJA 1E2WA 1PDQA 4RHSA 5LL6S 5CV6A 3H3VC 5LHY1 3PO0A 1ESFA 3X3MA 2EVBA 1EEFD 3I4LA 1STNA 3Q69A 1E10A 2Z8LA 3AE2B 1QT9A 1I6HB 1MVKA 3I9V1 3SK5A 1PFBA 5HURA 3K58A 1C79A 1E9MA 1GUGA 3OMCA 3NPPA 2BS3B 2HQEA 2DLBA 5DEHA 1OFFA 1ZDXA 1ZP0B 4QMGA 2RSOA 1EL0A 1B9RA 4QIWB 3KWLA 1SEBD 3GV3A 2N55A 5T1IA 4TQUS 3V96A 2KMMA 4FF4A 3NRZA 5JVG3 2F0UA 1KLUD 5ELCA 1E0ZA 1BCPB 4HKZE 2F0QA 1AWDA 4H13C 2NBFA 1EY0A 1KNAA 1LT4D 4IOIE 5ELFA 4PMWA 1JORA 1S5CD 3T53B 4FF3A 2I2YA 2EJMA 1OXSC 3AB5A 1CZPA 2QCPX 2Z4HA 3MXGA 2D5DA 3OPOA 4CGYB 3GO5A 4X3SA 2EY2A 1DYQA 3NUHB 3MEHA 2RDFA 4X3TA 3AM9A 3R8BA 4C80A 2K0PA 5H8YE 1YNJD 3Q8CA 3HOYB 3NBIA 3SDZA 3Q22A 2CU3A 2JSVX 2E2DC 1RTNA 4G4KA 5C44B 2VB3X 5T1GA 1C78A 1J8IA 4IN3A 3TZDA 3AH7A 4ARIA 2KOLA 3PUXA 3K57A 2K5PA 3LX0A 3Q8FA 1I4RA 3IT4B 3C1EA 2HTME 4A3GB 1RKNA 1A2TA 3S9WA 5D7GA 4C1NI 1Y8NB 2OXPA 5C0XG 2JZPA 1VR9A 5CV9A 1BMLC 4A3KB 4YT0B 3BK2A 1G291 3HS0C 2FE8A 1Y1WB 3FVQA 3D8GA 3LB8C 2WXOA 4CJ2C 4YWGG 1FD6A 5JAVA 4QF4A 3C3LA 1JWBD 4HROA 1CK1A 1PLFA 4F88A 3P4SB 2BCOA 4PMBA 3G7LA 1QOGA 4YSXB 2XIWA 4IFDG 4OZAA 4M8AA 4HJGE 2CJOA 2OT2A 3NK9A 5FLXL 1L0XB 4IUNA 1UNSA 1IGCA 1LTID 2LKVA 3HOZB 3AE4B 5I2YA 3FILB 1ILQA 4Q5VA 4XXEA 4HRSA 2BA1A 3NTKA 1JOOA 3FDTA 3NP8A 2F0FA 2F3WA 3C1FA 1EEID 2WU5B 4FXCA 1TKYA 4RCOA 3TP5A 1VZ6A 2K6AA 1K51A 3GB1A 4OW0A 5EPJA 2B39A 1H9MA 1HTPA 3KLRA 4M1UB 4KJNA 3VYSA 2XN9C 1PUTA 3Q8AA 1D1KA 2K32A 1TZOA 2EY6A 4ULLA 1MGSA 1P7FA 2IW3A 4BA2I 1H9SA 3R93A 3J81E 4U673 3KK7A 3PMFA 2L12A 4TQ1A 2EJGC 4K2LA 3VR4A 4Q2JA 3PV0A 4KMUC 5FR3A 1EY4A 5DM73 2L4NA 2KN4A 1CT1D 1EY7A 5KYIA 2SDFA 5IGEA 3VA7A 3NBHA 1TS5A 1EZ8A 3DEPA 3MWYW 2SOBA 4A9AA 1T5EA 2EYJA 2GA4B 3IXSA 1YJIA 1F2RC 1LTBD 1TS2A 1DM0B 1T5XD 5AUKA 1FYCA 3OHXC 1V1OA 2WXHA 2N0SB 2MUYA 4IFDI 1XYIA 3AECB 3NS1A 4LAAA 2WKCA 4OO1H 1LT5D 3T56B 2Z4IA 4J1MA 1SJED 4DN4M 1EYDA 4NJCA 1STAA 1ICWA 3ZJUA 1T3QA 5HHDG 2NB0A 1SE2A 1D5ZC 1NI3A 1I4GA 2O4XA 4EVOA 2EELA 3A8JE 5C6AA 3CIRB 2A6EC 3BG3A 5EBCA 5E6JA 1OXVA 4A3FB 5ELEA 3VR5A 3E5SA 1I4XA 4P2CB 2M56B 1PZID 3RLFA 1WTOA 1FRDA 2KDMA 1PGXA 2JXMB 1RWSA 4ZRPA 4CQNA 3ZYYX 2I07B 3T4AC 2OEDA 1EYCA 2JYEA 2F0LA 2RDGA 3FPUB 3TUOA 2FINB 1VZ7A 1K8MA 2RVLA 4B9WA 3DWMA 2L5TA 2E3TA 1VMCA 1STBA 4WAFA 1DZ1A 3M7GA 4KX6B 1QCBD 3HUIA 2PZTA 2E2JB 2X69A 3TP7A 3KQ4A 1CTMA 4DK1A 1CA6A 4WURA 4Q0FA 5J39A 3B2FA 1VMPA 3P7JA 3MHZA 3AEGB 5M5XB 2B63B 3IAS1 3PO3B 3TP6A 2VUMB 1R4PB 5CGKA 3BDOA 3BYYB 3F2UA 1NYRA 1CA5A 3HRZC 4R9WA 4BWGB 1V1PB 1BO0A 4MM3B 1O7ZA 1RHPA 4I65A 4A3MB 1GOZA 3R3OA 3GTPB 1TJEA 3U9OA 4ZUIA 2KAJA 5JPNC 2OHFA 4ID6A 2PO4A 2IJ0A 2VZKB 1ZYRC 4RWSC 2ZW0A 3DWAA 4N6EB 1IKMA 2HUGA 2PNRC 1GXDC 1FGBD 2K33A 5EKIA 1BUVT 4DXGA 1SFOB 4OZBA 5DM63 1NSNS 3NQIA 4KI0A 1L6VA 4N9TA 4CJ1B 2ON8A 2A68C 4G7HC 3HP3A 1N60A 2BDNA 3B9JA 4XWWA 1NR4A 4HMIA 2IGGA 1VF7A 3HZXA 4HSPA 1JROA 5BN3A 1RFKA 4LK1C 1JOKA 2F0NA 2KCNA 1S5BD 3N6RA 4KN4C 4H7BA 4A93B 2L52A 1U9RA 1GPXA 3A7AB 2EKIA 4QUCA 1SJHD 3A54A 2PLPA 4K8IA 2WIIB 2WXKA 1V43A 1KLGD 3GQBA 1K53A 1QKZA 2IGDA 1QB5D 4F7XA 4TSSA 1EY8A 1QE6A 2K5DA 4DQOC 4WWMA 1FEHA 4CBVA 2E2IB 1GUOA 2W54A 1SF0A 1WD1A 3C46A 2D62A 3MFYA 3NXWA 1TR5A 2HCCA 5C2TB 4FNFA 2PIAA 5CMDA 1HTLD 2F4IA 1N5WA 3AMZA 3T51B 3URYA 4NMZA 4YTMB 3VR6A 1RF2D 2N9LA 4XE0A 1B9MA 2WXNA 1O7LA 3QG1A 1YJJA 5HG2A 2K05A 4JWSC 1CZGA 3DXJC 3EGRA 2EOTA 1JWMD 1EWHA 3AEBB 2QSDA 1L5PA 4DNRB 3MAQA 3I3CA 3T16A 2JA8B 1G8ZD 2K5WA 5I6YA 1KAAA 4XDXA 4KY6A 4DFAA 2F03A 1PFMA 3W3AA 2LFIA 3CHBD 2QILA 4HR7B 1YNJC 2K22A 2NVTB 3E9SA 2FMMA 4K14A 1DCZA 5E1FA 4GDLB 3WOEA 1EQVA 4A3DB 4K5XA 1G91A 3SK4A 1SNMA 2B2WA 3EA6A 5DNFA 2H89B 4H44C 1AP0A 4TRDA 4BY7B 4A3EB 1DOMA 4A3BB 4YSZB 4XIGS 4L1BA 4TKOB 1GUWA 3Q8EA 3E6ZX 5C0XH 2SAKA 3ZQ4A 4K6LA 2WXRA 1JMLA 3D4RA 1ZPSA 1KRHA 3ZGZA 1Y8PB 5G5GA 3FEWX 3AEFB 1FCLA 3IT6B 3P4PB 1HXYD 1S5DD 2JA5B 1OXUA 3V05A 3AEEB 1TKEA 3AE6B 1D6EC 3HKZB 5G5HA 5F2DA 2BA0A 3VR9B 3I8ZA 3ABVB 4GZYC 4MACA 1FFUA 3E56A 3WCQA 1SYEA 1F9QA 2FUG1 2WU2B 1HA6A 3Q24A 3X3NA 1KTKA 1SXTA 3H0GB 2PMZB 3KBXA 2KCCA 4XDCA 1GUSA 4XQQA 5EJWA 1JICA 2A6HC 2F0KA 1OXXK 2KECA 5BN5A 4FF1A 1Q8IA 3DWQA 5BYSA 1FRRA 3RMHA 3A56A 1SMYC 1DONA 2A69D 2C9OA 1STGA 2FMCA 4J6HA 1PTOH 2DNEA 3VYRA 2W3RA 4BY1B 2N88A 2Q5WD 4DAYA 5I2XA 1BBXC 2NVXB 4HEDA 1FNUA 4K8JA 4DGZA 5NUCA 4N58A 2F0PA 1YNTE 1FXAA 1Z6HA 3R2IA 5EGTA 1XEEA 1HQMC 3D31A 1MPEA 1EQTA 1CFMA 2L11A 2B2WC 3NWSA 4FVMA 3BZDB 1C77A 4F8MA 1EU3A 4KY5A 4G7OC 3N52A 1PZKD 3MFGA 3OSOA 2RSNA 4WFN3 2F0MA 1LTSD 3FPPA 1E0BA 1AZQA 3SXHA 5C4HA 2L0CA 2EJFC 1F2RI 3S17B 5JEAJ 2M00A 5J22A 3NVZA 5IIFA 4C3JB 1VCIA 1ET9A 1LTRD 4RH6A 5KNBA 4EE2A 1Q3LA 2KVMA 3OW7A 5KEEA 1QNUA 2LHDA 1CZWA 5FKAC 1I50B 4QCLA 2JWUA 2W3SA 2PVOD 2NVYB 1HHVA 1KF6B 1BCPD 1EOTA 1II3A 1WRIA 2A6HD 1D2BA 4QB4A 5FLXE 5EKKA 1KH0A 1H9JA 5KRUA 1SNPA 4FXKC 1CQFA 3I70A 2FJ2A 3HOWB 1BR9A 2JQRB 4KV6A 2ONQA 3PUYA 3AE9B 5JJZA 4A3IB 5ELBA 2R92B 2C5CA 1QOBA 4P16A 4ZKBB 1DXMA 1QOHA 2DNCA 3U52E 2KEEA 3LNNA 4S3SA 1O80A 3U2SC 5K5PA 2A5HA 2MJ8A 3L9AX 1IHZA 2WLBA 1B3AA 1QILA 2ZXOA 2DBYA 1NCVA 2VXWA 1HZ6A 1F0ZA 2OEOA 3RFZB 4L2YA 1TVXA 3HG9A 5CV8A 1IKLA 4GDKB 3SE0A 3M4YA 2WS3B 4L63B 3VRAB 2G9DA 3AU7A 3KLSX 5C0XJ 5FO7B 4RA8A 5C3EB 1I7HA 1GUNA 2RA4A 4XQNA 5A35A 1JWAD 1FR3A 5LL6X 3NVVA 1C4CA 5D3IB 4J8QA 3BYTB 4KY7A 3VQIA 1EYAA 1WXQA 3QIAA 2EPBA 1SYGA 2I46A 2WV6D 3IAM1 5HGTA 1EM7A 2XWBB 1LT3D 5CV5A 1G6ZA 2PW7A 2Q8TA 1MD2D 5D14A 3S14B 3I57A 1SSNA 1RDPD 3K5OA 4DA2A 3EVQA 2ZXRA 4PQXA 2G1EA 4M0WA 3VYTA 5BN4A 4Y7NB 4A8XC 3OWFA 3I91A 2WQYB 4FYDA 2ZXPA 1C76A 1HFNA 1IBXB 2BOSA 3OOCA 5M5WB 5JEAG 4IUUA 2O5IC 1VJKA 4ZRQA 3K59A 4TQ0A 5C0XI 1NEKB 3N9YC 5C4ZA 2WP9B 2JU6X 2R61A 1PYWD 2JEAI 1TWFB 2WP8J 2JEBI 4EQNA 4LMQD 3HVDA 2WAQB 2WDVB 1M8AA 3EROA 1B1ZA 4BS9A 2FBWB 5JVH3 1Y8OB 1A6XA 3LYYA 5C4JB 4EQPA 1K52A 1JQ4A 3BIID 3L7ZC 3AMUA 3HOVB 5K36G 1JB3A 1MHHE 2EE1A 3TDQA 1C4AA 2MJEA 1SB3C 4A3JB 2EXZA 1EWYC 1SNOA 3QOJA 4ZYSA 4C2MB 1P7EA 2QIEB 2IPKD 4ZAIA 4ZRZA 3PUVA 1B4OA 2IWHA 1U4MA 4KGRA 4OL7A 4RF1A 2M19A 3NTIA 2KUMA 3SK8A 2KWDA 2PZUA 1IBXA 4KD3A 3UI3A 4C3JG 1N61A 1ZUD2 1HRJA 4CKEA 1MI0A 1TYGB 4OHJA 2Z1CA 1PFNA 3BVGA 2B2TA 2EYFA 5BMIA 1B53A 2I38A 1J7CA 2K03A 4QUFA 2B76B 3GD7A 1J7AA 2NUCA 3EJIA 2O5JC 3NUCA 1GUTA 3CRKC 1HZ5A 2EZVA 1XF5L 1A3UA 1MSHA 4LTUA 1KABA