2QILA

Toxic shock syndrome toxin-1 at 2.07 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined crystal structure of toxic shock syndrome toxin-1 at 2.07 A resolution.
pubmed doi rcsb
molecule tags Staphylococcal enterotoxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 58
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qilA01
1PTOH 1LT5D 4L63B 1HTLD 3BZDB 4RGOS 1MD2D 2WV6D 1T5XD 1EWCA 1RF2D 1ET6A 4RCOA 1SE4A 1M4VA 4BWGB 1BXTA 2IJ0A 5TSSA 3BVMA 1LT3D 1V1OA 1FNWA 1ENFA 2Z8LA 3OWEB 3TSSA 1EEFD 1RD9D 3EA6A 1AW7A 1LTTD 3DWAA 2R61A 1LT4D 4RGMA 1FD7D 1SXTA 1TS4A 4Z9CB 1I4XA 2NTTA 4DXGA 1I4QA 4ZYSA 1PTOC 1PZJD 1YN5A 2XRSD 4RGTA 1I4HA 1SE2A 2SEBD 2XNAC 1CHPD 1D5XC 1S5ED 1SE3A 1PYWD 1PZID 2QILA 2TSSA 1YN3A 1LTRD 2NTSA 4C56C 1TY2A 1S5FD 1EEID 3O13A 1HQRD 1GOZA 1I4PA 1LT6D 1LTBD 3BVZA 1EU4A 1RCVD 4RGNA 1D5ZC 1LTAD 1LTID 1B1ZA 1LLRD 1I4GA 2XRQD 1LTSD 1PTOB 1XTCD 4RHRA 1CT1D 1V1PA 1B44D 5D3DA 1CQVA 1S5CD 1TY0A 1TS2A 3BYYB 4O1NA 1KTKA 5ELCA 1PRTF 1L0YB 1V1PB 1KLGD 3GP7A 2IPKD 1PZKD 1UNSA 3SEBA 2QEJC 1HXYD 2RDHA 1EU3A 3R2TA 5ELDA 3BYTB 4DXFA 1PTOD 2RDGA 1UUPA 3CHBD 3DWPA 3DWQA 5FK9C 3MC0B 1JQYD 1STEA 5ELFA 2AQ1B 1FNUA 3BVGA 1SJED 4RFBA 2AQ3B 1DJRD 1PRTD 1LTGD 2AQ2B 1LO5D 1L0XB 2G9HD 1G8ZD 5D3IB 3R8BA 1QILA 1ET9A 1RDPD 5ELBA 1PTOF 3R2IA 3V05A 1JCKB 1SBBB 1JWUD 3EFXD 3W2DA 1AN8A 3MFGA 2ICIA 1PRTC 1JR0D 4RH6A 1PRTB 1CK1A 4TSSA 1EFID 4L6TB 1TS5A 1XXGA 1SJHD 2O2LD 1D5MC 1FNVA 1BCPF 1CHQD 1BCPB 1BCPC 1TS3A 1DYQA 5ELEA 3URYA 4OHJA 1YN4A 4NZLB 1KLUD 1S5DD 1D6EC 2J4XA 5FKAC 1S5BD 3KLSX 2CHBD 1JWMD 1HA5A 4UDUC 1F77A 1SEBD 2XN9C 5I4DA 1BCPD 4K6LA 1FGBD 1ESFA 4RHSA 1JWSD 1I4RA
chains in the Genus database with same CATH superfamily
3Q8EA 5J22A 1RL2A 4IOCA 3T9LA 3NTKA 4NXMQ 1MD2D 2WV6D 4A3BB 2BDOA 5CV4A 2HDLA 2LGSA 2JA8B 1JT8A 1V8QA 1M8AA 1WH3A 1WVLA 5BMGA 3L3OC 5IKCM 2O6VB 3J81L 3MP9A 4Q5VA 2QC8A 2H88B 2H89B 1X56A 3PUXA 3DPDA 4JV5L 4NW2A 1P98A 1L0VB 4C3HG 2JF5A 3HOUH 2F4IA 3PV0A 4DGZA 3RZOH 2IO2B 1FD6A 2GBMA 3UIOB 3GO5A 1MJDA 3AEGB 2XEWA 1OEYA 1JICA 2DYBA 2NZ1D 5KHOA 2WNMA 2SEBD 5IOIA 4KTAA 4P74A 1SE3A 3RUZA 1PYWD 4X66L 1T9HA 2QILA 1HTOA 4M0WA 3CPWA 2LJ5A 1STAA 4CQNA 3PIP3 1YJNA 2IX3A 1LTRD 1HR0L 2CR5A 1ZYRC 3CP0A 1N34L 1GOZA 3H6MA 4RGNA 3BJUA 3RLNA 4C1NI 4JBKA 1PYSB 3CD6A 4DAYB 1QVCA 4IFDI 2WLBA 1E10A 4IPDA 4YCUA 4DPGA 2VUMH 5GAHC 3MWYW 1G2SA 3WOEA 4A3GH 4JBJA 2MGSA 2DNFA 3AEBB 3S2DH 2KDMA 3UDXA 4ID6A 4B08A 1N34Q 2M0XA 2CS4A 4W9JA 4CJ1B 4PYZA 1N5XA 3B2GA 2ZZPB 1HJPA 5GROA 3EVQA 4HXDA 5C1ZA 4KK7A 3Q8AA 1B3QA 2K8BA 1Y8RC 4BOSC 2IPKD 4GB9A 3VTVA 1K51A 1N32Q 3DHGC 3NTIA 3R2TA 1VDVA 3PREA 1QG7A 1KOTA 4IUNA 2KWVB 5G2NA 1DXMA 5C0XI 1DZ1A 4LCDE 2Z4HA 3MFYA 5EPJA 3S2AA 1HUNA 2B2UA 2WXGA 1F2LA 4MGYE 4ME3A 4MM3A 3NS1A 2BA1A 1J8IA 3DBHB 1U4PA 2ZM6L 4A3IB 1EOTA 1NBWA 2GA4B 4A76A 1SIJA 1DOLA 4FJVB 3DUZA 4CGYB 3S9WA 4HJAA 1VQ8A 2JY6A 1U4MA 3HOZH 4KV2A 1JE4A 1JB3A 3V05A 3CCQA 2LGIA 2RDFA 2SNMA 2WAQG 2V3NA 3W2DA 3A1QB 4DV4Q 1GUSA 2IHEA 1YHAA 2B29A 3X0WA 4J6IA 1Y1WG 4DFAA 2LRUA 2N9KA 4WAAA 1VQFA 2UU7A 5COYA 1E0BA 3H6NA 4KJNA 2AWTA 2D07B 1WI5A 3QJYA 3F1ZA 1AEXA 3S17B 1C0AA 1ISNA 1M90C 2KMAA 5CBAE 2JSVX 2K5NA 1JB7A 1JROA 1NAPA 1WCMG 3URYA 1BMLC 3JSVA 5AJ3L 4WJWA 2JA6H 2QJLA 1NNXA 2R7ZH 1Q10A 2MO1A 1B50A 2IDYA 4JI4Q 3K57A 1BBWA 4A3BH 1GG3A 2RR9A 4YSZB 1SEBD 2QDBA 3NK9A 1KQSA 1G6ZA 2F0VA 3QWZB 1V9JA 3K9PB 1KIXA 3EN2A 1JE5A 4JI3Q 1KF6B 4P6VF 4URKA 4X6AH 5EPLA 5IYBG 1T0QC 1Q82C 4JI4L 4MGZE 1K8OA 4AJWA 3DMUA 3CW2C 3PO3H 1BKBA 4PZ6A 1WX7A 2J0MA 4DV7L 2NVXH 1H9SA 5EGTA 4DHJB 1YQ3B 3A9KB 2N55A 3IHPC 1P16A 4ZKCB 5LXIB 4N9TA 4G4KA 2R61A 3DHIC 4DUZQ 2KEEA 4OWTB 5GQOA 4ANUA 3TRZA 5DM73 2WACA 2EKEC 3HOVH 4OW0A 1X6OA 4X57B 3WAPA 4XT1B 4TV3A 3JAMi 5DEHA 1QCBD 5IYCG 3VR9B 1G6JA 3PO2B 1KD1C 3HOZB 2AL3A 1EM7A 1IGCA 2L7RA 1ZDXA 4HMJA 5BN4A 1IBLL 1X54A 4NQKE 1B9MA 2KMCA 1EEID 1SFOH 3C19A 2LD9A 4MJSA 4HIDA 2N9XA 4LW1A 5GMVA 2NVQH 4JOIA 2RCFA 3CKIB 1UGMA 2E8GA 4LJPB 5F2DA 2AWOA 4GNXA 2Y0SG 4Y52H 3PF5A 3AEFB 2WU5B 3L4PA 1A0IA 3I4MB 4P7IA 5FR3A 3ML9A 5M9OA 1MPEA 2ZVOA 1HZ6A 3KUCB 1VCBA 4IKGA 4O1NA 2Q2IA 3K7AB 5JEAJ 4EVOA 3IAYA 2JXMB 1JOKA 3KVFB 1QNKA 2AHOB 2FMCA 3GTLH 1XTDA 5L95C 2HD3A 1YBYA 2L8JA 2RDHA 4JQWC 2GVAA 2KCTA 1ZKOA 2HDMA 2VUMB 3Q3MC 3M4PA 5C44G 4LFAL 2E2HH 4MZ9A 1STEA 2FNJB 2UXBQ 3L08A 1B70B 3VA5A 1EY4A 5ELFA 1PVOA 3BVGA 2G5DA 1Q46A 1SJED 3SXHA 3GTMB 1QB5D 2KDEB 3IAM1 3ZRFA 1SE9A 2E2JB 3H0GB 3QOJA 3TS0A 1WTRA 3PPAA 1K53A 4JI6L 4UPAA 2L0CA 3D6WA 2HIXA 1KL9A 4LTUA 3I3TB 1WE6A 5FJ8H 3AEEB 3K0YA 3DCGA 4NP5A 1V81A 4DAVA 1TTNA 3NXWA 3MFGA 1XLOA 1FL0A 1WGDA 4A3FG 2V4LA 4IM3A 3J81E 2BKRB 4POFA 2BW2A 1VMPA 1P9DU 2BBCA 2KVZA 5C3EB 2VS1A 1STYA 3LX0A 1D5MC 3KWLA 5C4JB 3PSIA 4XZ4A 5AZFA 4BZAA 3KUPA 2JA7H 2KWCA 1JRUA 3A33B 4OHJA 1B3AA 1F2ZA 3T1HL 3V6EB 3I55A 1GC7A 3U7DA 4BKGA 3X3MA 4ZUJA 3MJWA 1EY9A 4NPSA 2BTEA 5JHAA 4CYEA 1QUQB 2PZWA 3CXCA 4MIUA 2EY5A 2GN5A 2VL6A 4RF0A 1ENCA 5DLQE 3NUCA 1NUCA 5FLMG 2MQJA 1ENAA 1DOKA 4HPPA 5K36H 3VXWA 5CTRC 1B9RA 4B3RQ 2BH8A 1KC8C 1KRSA 2IX0A 4BWGB 1V43A 2L5TA 4TUUA 3Q14C 4APVA 3RMHA 4CHKA 1E8XA 2K5PA 4LFBQ 1UE5A 1G91A 1WOCA 5C5MA 4G7HC 2NN6I 2OXPA 2NR2A 1V5OA 4R3DA 1VF5C 2K03A 1BT0A 1WM2A 1X65A 3G6JB 1FXTB 2RPQA 1K83H 2NTTA 3RD4A 4GMVA 4IG7B 4BBRB 4NAMA 4WRDA 3AMUA 3PRZA 1K83B 3A9JB 3VAWA 1KDAA 2DZJA 3TZDA 1GO3E 1PH4A 3VRBB 4OELB 2NVTH 1H95A 1T0SC 3M85A 3K5NA 3B2FA 1WF9A 1XWEA 2NTSA 3F2CA 2JWUA 2N7JA 1EZ6A 2ZCCA 1YJ9A 3CF5A 1B8AA 3C2PA 1E7ZA 2NWGA 3BS1A 3I73A 1EY0A 4I6LB 2MO0A 4A3GG 3KUZA 4LAAA 2G1EA 1E0ZA 1QOAA 2UUCL 4PQXA 2KKCA 4IWQA 3E0JA 3AV8A 2BVCA 3C0RB 4LF6L 1SYBA 1XTCD 3T13A 2EJMA 4QUFA 1ZYRD 2KJHB 4AQ7A 1WJ4A 1SMYD 4OL7A 1DCZA 2D0PA 2NBFA 1R4MI 4JI7Q 1PMRA 3AB5A 2R92G 1STGA 4DV5L 3LJ3A 1VLBA 4H7BA 4Q2JA 3OJ3A 2B3GA 1L0YB 5I2XA 1UNSA 2WDTB 1E2VA 3U4ZA 4IN3A 2RVLA 5ELDA 3T4AC 2FCMA 2PW9A 2RDGA 3VR3A 3CSTA 3NVYA 1V9PA 2UXDL 1TR5A 1YIJA 5AUIA 2NCNA 1AFPA 4FVMA 4YHHL 4OVVA 1XNQQ 4DV5Q 2UU9L 4JI5Q 1II3A 2NMQA 5H1SE 3S16H 1SLJA 1VQGA 2AQ1B 1EOVA 3M4OH 3ML8A 4C4VB 1GJZA 3OW2A 1FEHA 2B2TA 3ZLZA 2G9HD 3SK4A 5M5YH 1JOOA 4BBNC 1Y8PB 2FE8A 1ML0D 4B9XA 2D0OA 4DUYQ 1VR9A 5FOBB 2BB6A 2CW0C 5HI1A 1EIYB 2KO3A 1Q0WB 2KANA 5IP7H 3OLMD 4DR1Q 1PRTC 1YVCA 4JI8Q 3HIZA 1CA6A 3M62B 2RHSB 2E2HB 2RCNA 4K2KA 5LHY1 1N33L 4F7XA 1K3BC 4DUYL 2LXJA 3VR2A 2AEHA 2LXKA 2MBEA 2M4NA 4PT5A 3KOJA 2W9NA 3FEWX 4BBSB 2R6GA 2JRHA 3AM9A 2KHWB 2J4XA 3G48A 2JYEA 1Y56A 4DV3L 3J80L 2X8XX 2N8NA 4AYBG 2RDBC 2KN4A 3NRZA 1JQ4A 3W9CB 4P71A 1HRJA 4C3IH 1UWMA 4O42A 2XK5B 1NCVA 2F4VL 3Q8FA 3U4VA 3GTGB 4L63B 5JZEB 4K5VA 5KNDA 4K14A 1XPRA 4Y7NH 2J7ZA 4FF2A 1TWFH 4B9KA 5ISRA 2JA5H 5HURA 5FR6A 4ANVA 3ULPA 4GSWA 3MXGA 2KXJA 3WCQA 5JH5C 1KAWA 2UYZB 1FNWA 1LACA 4HIKA 1WTXA 2YU9H 1EUJA 2B2WA 2MQHA 4ITKA 2OQ0A 1NSNS 1W6KA 1Y8NB 2KHSA 3Q6SA 3TSSA 2I5LX 2F3WA 1KDCA 1VF7A 2J7QB 1KRHA 3HUIA 2I46A 1OGWA 3DWAA 1YQ4B 4P1CC 2A6HD 2M8SA 2Q2HA 5CV6A 1IBMQ 1D7QA 2JWZA 3F2DA 2E2IH 3A9KA 3UI3A 1I4HA 1WMHB 3RLFA 1SSOA 3VR4A 3P63A 4ZCKA 3UQAA 2QKIC 1O78A 4I65A 4B3TL 1VZ8A 3M3YH 2BKFA 2BF8B 3D4DA 3P75A 4CDDC 3CCUA 3EFUA 3SE0A 3MVVA 1YN3A 3QG1A 4GN3B 1NI3A 3HHMA 4JI1L 1LT6D 3TN2A 3S15B 3V6CB 4DK5A 3HKZG 3Q3OC 1LTAD 1X3GA 4GLVB 2WHIA 1N61A 4BS9A 1S3SG 3VUYA 5GADC 2JA8H 2R2QA 3U50C 3I56A 1Z6HA 1I4GA 4GN1A 3H91A 4MJSB 3WAMA 3I4NG 1P0RA 2BS4B 3K5OA 1YNJD 2V1YA 3HOVG 5D3DA 1CQVA 4K2LA 3ZJYC 3GTQH 1B9NA 1WGRA 4FP5D 1H9RA 1E2ZA 2D11A 1WWTA 4HMIA 5ELCA 4HVBA 3ZVVA 4XC2A 4EQ5A 4A3MH 1KLGD 4XQJA 1K50A 4XDCA 4NXML 1WXSA 3C1EA 1HXYD 3M4YA 2H5XA 4NB3A 4X3KA 4FHKA 5JJLA 3S17H 2YLMA 5KRUA 2KHJA 2A19A 3J80E 3MC9A 4KIKA 1TWHB 2EVBA 4H02A 4QCLA 4GOPA 1KXLA 2D9UA 4KD3A 4PZ8A 4JK1C 2A69D 3BDLA 1YOVB 3K6OA 4PYUA 3W1YA 3X23A 1LTLA 1YJWA 1VQ9A 3DLLA 1S40A 2E6XA 2JX5A 2KT7A 2NVUI 1C9FA 1D2BA 4N8FA 3LWEA 2H4OA 5BO4B 1J0GA 2NUCA 1AARA 4TQ0A 3J81j 4X3TA 3HOWG 2ZCBA 1JALA 2K3UA 4CDFC 2ZW0A 3APDA 2EXZA 1TBEA 2F0TA 3G7LA 2K5WA 2M56B 3H09A 4K3CA 1HNXL 1FFVA 4A75A 2ZTEA 1H4RA 4WWOA 2PEAA 2K52A 2K4KA 2F0SA 5JJKA 4O0AA 4PK1A 2N9EB 4DV1L 4LF9Q 3MJ5A 5AUKA 2F0KA 1GPXA 1TS3A 2B2YC 3ZNID 3A54A 2GBKA 2F0UA 1ZE3D 1PFDA 1GJXA 3DWMA 2KCNA 4RM9A 1KNEA 4G7ZC 1IBKQ 3HGBA 3N20C 2A5HA 2BWFA 2N9PC 2C5LC 3HM6X 1H9SB 3KK7A 5LL6S 3E6ZX 4FO2A 1HA5A 2BOSA 4IJLA 3EGRA 4LF8L 4DV1Q 5DPSA 2AYOB 3WALA 3A8JE 4LDTB 1EF1A 4G50A 3AE8B 4EOYA 3K81C 1U4LA 2A6EC 2VB3X 3UE1A 1E7UA 4I6NB 2E2DC 4HKQA 1BBUA 5BYQA 1XPOA 1MI0A 2WXQA 3VH4B 2WIIB 1EIHA 2JSOA 3HG9A 1QNUA 5TSSA 1W6JA 1YNJC 3VR5A 3BVMA 3SU8X 1V1OA 4AP4C 1CQFA 1ENFA 2NPTA 5DPTA 1SAPA 3AQQA 2AMCB 3OWEB 4OEMB 4E6IA 4DV2L 2MRPA 2ES2A 5A35A 1L5PA 3VTWA 3T16A 2XVSA 2DZIA 4EQOA 3I4NB 4KZCA 1SXTA 2WX1A 2ZM6Q 4YTNB 4YTMB 4DXAB 3B9JA 1PZJD 2NN6H 2V4DA 4ALPA 3ALBA 3M95A 1RIPA 2EQSA 3C1FA 1C1YB 2MEKA 1J8CA 4IALA 2A69C 5FLMH 1AP0A 4L8JA 3RZDH 3H7PA 3ZGZA 4FJZA 5CORA 2R92H 2CQAA 4MTKA 1JMCA 3OJ4B 5C0XG 1XF5L 2Q5WD 1MSGA 3PRPB 3C8YA 1MHWC 1SYFA 4WQOB 1RFAA 2X6GA 1E8YA 1RCVD 3U9OA 2MH7A 4M00A 5KNBA 1JRPA 1ZXIA 1BOSA 4NJCA 2N4FA 2IW3A 5IGGA 4R4TA 2DX5B 5AJ3Q 2ZJDA 3E0EA 2MUYA 1NYRA 4LF7L 4FXDA 5LMNL 2MW5A 3J80c 3PSEB 4ZQ3A 3OIPA 4EQPA 2IGGA 1F9SA 1KTKA 1WI0A 1NE3A 2Z6KA 3AH7A 1F2YA 5D65A 1FFUA 3AU5A 1EYGA 4JPBW 4DXFA 4TVAB 3BYTB 3CHBD 2PMVA 3S2DB 1X3QA 4DR5Q 2ZXPA 3HOUG 5CHFA 4A3GB 2JJQA 2KYWA 3IT6B 2CCZA 3ERQA 3L7ZC 3J80i 1PA6A 2ATWA 1WYWB 2K14A 1EQVA 1WXAA 1WZ0A 3ZJUA 2L00B 3HM3A 1BDOA 4JW0A 1FPYA 2YU9B 2WXMA 2QHOA 1J6QA 1AYFA 5D3IB 4N6EB 1G2TA 1F9RA 1L6UA 5IYDH 1IL2A 2KTRB 1R4NI 3KFUA 3ZTCA 4E3CA 1OXSC 2INCC 1SNQA 4M8AA 4XYCA 2ICIA 2CVRA 5M5WB 2AUJD 4IQZA 4GKJL 3OG5A 1EQTA 5FLXL 3T1YL 2IY1B 1TS5A 1XXGA 4YIJA 3J7AV 2OQKA 3L9AX 1EF5A 4MELA 1Q1EA 4JBMA 1QZEA 2CW0D 1E3PA 2GRIA 4N58A 1DYQA 4OVUA 3CCJA 2BE5C 3NHEB 2M2LA 1PV4A 4C2MB 3VUXA 2EYHA 2D3BA 3V61A 2V9HA 4HJ7A 3N32A 4LNQA 3IBEA 3D6CA 2Z0SA 1HTPA 3ZNHB 1FM0D 2C7NB 2MHVA 2WDVB 4X64L 3HKZB 4K6LA 1K8MA 4IUTA 1J7AA 1ZUD2 4WAFA 4DR7L 3VDZA 4A3IG 3I90A 2N1VA 3RNBC 2XSCA 5AZHA 2BA0A 5IGBA 3S1MH 1T5XD 1N32L 4AQYL 1TYGB 3HOYH 3WOFA 3A9JA 1SE4A 5IWAQ 3C3LA 4BY1H 2IO3B 2OHFA 4N9PA 2EMTA 3RNGC 2N7DA 3QA8A 3GDEA 2Q8IB 1VCIA 2E5LL 4W9HA 3TEYA 3TEHB 1T3QA 2GB1A 2UXBL 1T6BX 1WJUA 1C4CA 3F2UA 1FD7D 4AQYQ 2DLBA 1FRDA 5IWAL 3I5JC 1VQ4A 2MNAA 2EYFA 3RULA 1TWAB 5AFWA 1YN5A 3RFZB 2D5DA 2XRSD 4RGTA 3P4QB 4KSKC 1R9TH 4R4IA 3TJPA 2X6LA 1A2TA 1CHPD 3L0OA 2O2VB 4BBRH 1A3TA 1S5ED 4HK2A 3UF8A 2B63H 3I8ZA 2J52A 1L7YA 3AULA 4AIMA 4NAWB 1C4QA 2JRIB 3H3VH 3SD5A 1RWSA 1HQRD 2B2YA 2XGTA 4YY3L 2NBUA 1U5KA 2MJ8A 4B3SL 4DV0Q 3T3OA 4R4CA 1Z47A 1HE8A 4W9DA 3JAML 2I1JA 4XYOA 1SNOA 4KY5A 1BR9A 4HCSA 1HNWQ 3ZQ4A 2I07B 3KW5B 3JAMc 1CT1D 2ENBA 5GXGB 2G9DA 2NBWB 2W55A 2W3SA 4N9F4 1AWDA 1PFBA 3P20A 1CM9A 4KJOA 1YNTE 2Y3AA 2N78A 1TY0A 3AEAB 4GIVA 3HKZE 4K7SA 4C3JB 2ID0A 3AN1A 2K1FA 3J7AF 4R8NA 1EWIA 1EY8A 1SN8A 1K52A 1TQOA 2L32A 4W9EA 1Y1VB 1VQOA 4V0BA 4EUTA 5JJIA 1M94A 1V6EA 4GOCA 1Q7YC 2FCSA 2B8GA 2N9LA 5LL6X 1JQYD 2OWOA 5EBCA 4DK3C 1I94L 4LFBL 2I38A 3PS6A 5IAAC 1PGXA 2V0GA 2F0LA 4A3LH 1FR3A 2MX2A 3SVMA 1TWGB 2I1KA 4XWTA 1PH8A 3HK0A 4E74A 1HZAA 3H3VC 2R7ZG 3TCAA 4DAMA 4GS3A 5IYBH 3MXUA 1YJJA 4DK0A 5EE1A 3KDFA 4IPGA 1C79A 3S2HH 2BS2B 3PHXB 5BN5A 3MA2B 3CC4A 1KAAA 1UEBA 5JOBA 1KDBA 2CH4W 1IBLQ 2I0QA 3ICEA 3M7NA 4A3DB 3A4RA 3R66C 4US9A 5LNK1 4MM3B 2C9OA 2OEOA 4GKKQ 1T5EA 2L83A 2QMTA 2Z9HA 3U8ZA 4L5RC 4ASWC 1SFOB 1ZEQX 3A7LA 2KNBA 2R7FA 4A3KG 2BGFA 4GLSC 1C4AA 5EE0A 3N30A 4R4QA 3KH0A 1UEAB 3STBD 2R2OA 1WIAA 3D3RA 4IUQA 4GLXA 3AECB 2K5DA 1NDDA 4JE3B 3VH3B 3RNUA 4B6WA 3CCVA 3V2TA 1QOBA 3R93A 4ABNA 4GKKL 1SGHA 3HOWB 3N1XC 4EFOA 3UQBA 3RYTA 2VQFQ 1ESRA 5C0XH 3BIID 3ZW3A 4XTCS 2JYOA 1VQHA 1OEYJ 2MA9B 4MH8A 3DBHI 1I4RA 1T0YA 4OWXB 4OX9Q 4QIWB 1HTLD 3QO2A 4JC0A 4XQNA 3OW7A 1HPCA 1RAXA 3PV1A 4DBGA 1ET6A 2CU3A 5EE3A 4QL5A 3PO3G 4UAIA 3L54A 1J5EQ 4LFAQ 2RSOA 1K3RA 3AYHB 2PW7A 4XIGS 1FXAA 2HJ8A 5DPRA 4A3OA 1F9PA 2SAKA 5BYSA 2OTJA 1YNXA 1LT4D 4ZK9B 2NPTB 4ZYSA 1B4OA 3N52A 4J15A 4M0WB 3J81c 4YSXB 1RKNA 3AE5B 1I35A 2GI9A 1WGKA 4DR4Q 5K36G 1VJKA 5L37A 2EMSA 1GB1A 1MBYA 1WCMH 4K81A 3CSFA 4DAYA 5EKIA 3CMAA 1BUIC 4J8QA 1VQDA 2TSSA 4JI8L 3A5ZB 5K5PA 4DKAC 2QGQA 1CZWA 5EQ0A 5C4HA 1E5WA 2HQLA 2DHZA 1C3TA 3BVZA 4KMUC 2LVOA 3QQ8B 3D8GA 1E7VA 3L10B 2ON8A 3NBHA 4HEA1 3I57A 4BY1B 4PZ7A 2KMMA 1T0RC 3GZNB 4P73A 3Q3JA 1SB3C 3NUHB 2RPVA 2NN6G 1STBA 1TZOA 1VS0A 1H9JA 3OTOL 1XJVA 1RODA 1HHVA 2Y5BB 1ONLA 1DGSA 3WAOA 2JQRB 3W5VB 3NHHA 4GDLB 2WXNA 1OXTA 2Q8TA 4BAXA 3P4PB 5EE9A 4TKOB 1MHXA 2W82A 2PQAB 4KZ0A 1R9TB 1QOGA 2LFNA 2B2UC 3NTHA 1IZ6A 1J9OA 1LYLA 1MKHA 3OTOQ 4KKJA 2XIWA 1BBXC 4PS3A 1B2TA 2L4NA 4Y7NB 1I6VC 2WAQB 2K1BA 4HJ9A 2ZTCA 2LGYA 4KN7C 4IFDG 3S15H 4P16A 4ACFA 2BCOA 5FO7B 3P1HA 1WFYA 2V3SA 1WGYA 4J3OD 2FINB 2R93G 4D2KA 4RF1A 2E3TA 5CX3A 1CKOA 3A1QA 3K0XA 3HOXH 2VH1A 2N1WA 1N63A 5JJZA 3PLVA 4BY7B 1EY7A 2HCCA 2CKHB 1DD2A 4AYBB 1N6ZA 1B7YB 1JCKB 2L1AA 1Y14B 2W3RA 1Q1BA 3W1GA 4CKEA 3D31A 2Z6BA 5C4ZA 2PO4A 3ZDTA 1UE1A 2CH4A 2QCPX 4B9WA 1TIID 1DOYA 4TSSA 1M1KC 5J2RA 3QC8B 1P7EA 3SDZA 2HJ1A 1VQ6A 3GTOH 3OAWA 1GUOA 4JX1C 1CHQD 4E71A 4FF1A 5DAUA 2NB0A 4GN4B 2M1MA 1JC7A 1ZDVA 4MT5A 2IT1A 3K8AA 3ZO5B 2LGXA 4B3MQ 4ZRZA 4RWSC 5FKAC 4DF7A 2KDFB 3U4EG 3EQLC 3L0WB 4MEMA 3NEMA 1SDFA 4NJ7A 4DWFA 4JI7L 2DUDA 1GVPA 1I3QH 2PQEA 1SNCA 2RA4A 1HUMA 3IFDA 5M5WH 2INPE 2GVBA 4JI0Q 3NSWA 2KA7A 4RHSA 3PIO3 2KOXA 2Y5PA 5LMUQ 3PUZA 5I6YA 2BE5D 4RGOS 3BZDB 3EUB2 1AZQA 3K5MA 3GZNI 3KBGA 2IJ0A 1NTGA 3M9BA 5IT9E 2UXDQ 4FXCA 3PO2G 1OXVA 4JI5L 2UU9Q 3EA6A 2KENA 2M00A 3GD7A 4OIJA 4A55A 3BU2A 2EDGA 3PO2H 4XDXA 1HR0W 2IY5B 2F0FA 4A9AA 3W1SA 1CJEA 4LNOA 3HOVB 5HFYA 3EECA 2WAQE 1GUGA 5M5YB 2KFKA 1WTQA 4P1BC 4C80A 5LXHA 4A3EH 2Z1CA 2A1AA 4EE2A 1NVID 5C4XH 1KM7A 1XPUA 1L1OC 2KWDA 2RSNA 4KDLB 1YIWA 4QQBX 5CV7A 5BR8Q 4OZCA 2I2YA 3LGJA 4JGHB 1G51A 1X3EA 1KABA 4IURA 3GTMH 4KGSA 3RCZA 4NAWA 2VZAA 3ULJA 2FCNA 4TQ1A 3A7AB 1WD1A 2FJ2A 4JBWA 1V2YA 2DZKA 3I4OA 3OHXC 4L5SA 4KKSA 1IBKL 5D7GA 3PF4A 5AEKB 3QCAA 2KACA 3P4RB 4A3JH 4USAA 1FRRA 2F0OA 3D4RA 2PE6B 1Y1WH 1ZOYB 3A0JA 3VYRA 5IP7G 2UXCQ 4JWUC 4JI2L 1YMHE 2FUHB 4RAUC 4DNIA 5LLIA 3PRMB 2QEJC 4QIWE 3CC2A 4C1NK 4LLGM 1CSPA 1VQJA 2N49A 2LFIA 3FPPA 1VDZA 2VZKD 4BOZB 3KUDB 2WKCA 3J7A5 4JI2Q 1GC6A 4HJGE 4IPHA 3QJZA 3TEZA 2PYKA 3KLSA 3A55A 3I3CA 1L0WA 3OPOA 1I50H 1LM0A 4PMBA 2D2CC 4PMWA 2HTME 2RD0A 1IBML 2R7DA 1RDPD 5ELBA 4LJZC 3AE7B 1A3UA 1PTOF 1H9MA 1PGAA 1SBBB 3VTUA 1JWUD 2WP9B 2B39A 3W1SC 2K50A 1SROA 1K8GA 5C6AA 4KKTA 2GBJA 1QQRA 3NJTA 2VQEL 4EKUA 1L2FA 3ZXVA 1VQNA 2MBQA 1R4MB 2F0MA 4HCPB 5T8IA 2I5HA 2VY3A 4A3DH 3ENEA 2KTFA 3N9YC 3FDTA 1TKGA 4FF3A 2N88A 2JA9A 1PFSA 3ER0A 1YN4A 4LWCA 2RSUA 3NBIA 4HJ8A 4BXXG 1DM0B 2M19A 1RTOA 4FNFA 4A8XC 1WM3A 2VZKB 1TWGH 2HIVA 3R7QA 1XLPA 1WR1A 4W9LA 4EX5A 3OMGA 4A3JB 4JV5Q 2N3SA 1E1TA 2MJEA 5G3LD 3S24A 1A62A 3BK1A 4BY7G 1HZ5A 1LGRA 1I7HA 1CTMA 2RBMA 4UP9A 3T53B 1RF2D 2KJXA 1XLNA 1VQBA 2B2VC 2O2VA 4DHZB 4IFDJ 5HGTA 4NNJB 1UH6A 3F8TA 4DR5L 2Z8LA 2N7EA 3KLWA 3ZNZB 4C3HH 1R4NB 3V3XA 3UE0A 1AW7A 4J1MA 2F0PA 1QWYA 3VYTA 2DENB 1FIQA 2LHDA 3UGBB 3TS2A 2NZHA 2UUBQ 2ZNVB 2WXHA 1NENB 2MWSB 3I63C 3QK0A 1SSNA 2E74C 5C44B 2KAJA 3ZXRA 4XX5A 4K7UA 3TZUA 4HPLB 4FLHA 4WJ4A 2XWBB 4FN2A 4NPNA 1OXUA 4IC7B 2JP1A 2D3AA 3ZNGC 2HT1A 4L5TA 3MAQA 1Y1WB 4GKJQ 1EQQA 4XWWA 1I4PA 2D2QA 3HZXA 4ZUIA 4M1UB 1KH0A 3IVFA 5BMHA 1LTID 1VD2A 4A6QA 4GLAC 3DWGC 3PT2B 1EYCA 4MSQB 4KHPQ 5C3EH 2VUMG 3Q69A 4YCVA 5GAGC 1EY6A 4A3KH 2LRWA 4U68A 4LNKA 1WTOA 1HR0Q 3GB1A 2WXJA 3B08A 4C3IB 3E56A 3PHWB 3HVZA 4XQQA 5I6WA 2JYTA 3R3OA 1DONA 1VZ7A 2A68D 2LKVA 3J7YW 5HY6A 1PH1A 4CHTB 1PH3A 4JPSA 2YTVA 3HP3A 4N8X1 1TJEA 2KC1A 4RKLA 1RYJA 1L6VA 4C4VA 1P3QU 1XNRL 4A3CH 4GGQA 1PTOD 3FAHA 4GDLA 4X62Q 1MFWA 3ND8A 4H44C 2E5LQ 4RMAA 3AE3B 2PQAA 2R3ZA 4TQUS 4DV2Q 2MHJA 2ONQA 3B0AA 4KX6B 4XE0A 1CZPA 2C7MB 1DJRD 3SK8A 2OCEA 1XEEA 3PO0A 4CJ2C 2WXLA 3PLUA 4S3SA 1CKNA 1DOIA 2D5GA 4GDKA 2M0AA 1IUEA 3S1QB 1OQQA 3MZ5A 2PW5A 1R7SA 1KJTA 2F1MA 2A5UA 1D8LA 2VRRB 1A70A 2JPHA 1L2NA 3IRBA 5CYUA 1PDXA 4GU2A 5C3EG 2WXRA 4C00A 1QF6A 4GOPB 4DR2Q 1EL0A 4IUMB 1GUWA 3MXPA 4RH6A 2L11A 5C5LA 4A3DG 3HVDA 1KLVA 3V60A 1EFID 2C5CA 2EIFA 2FXQA 2DWQA 2V4IB 4IUUA 4HJKA 4KGTA 1AH9A 1SJHD 2O2LD 1FO4A 4B3SQ 1ACCA 1I6HB 4X3UA 1UAPA 1MJEA 2I5MX 4FHJA 3PIOA 2FMMA 5IP9G 1TT5B 4GOPC 3NOBA 1ILQA 1JJCB 3Q3FA 2NZOA 2XK5A 3MTNB 2KCCA 1CKMA 5EAYA 1GHKA 1JWMD 3GTJB 1N36Q 3Q2AC 2B63B 1STHA 4FBJB 4ICUA 3E3XA 3U58A 2WKDA 4JYAQ 4REZA 3ONSA 1SRUA 1BNZA 3QHTA 4LNIA 1ESFA 2UUAQ 2SOBA 3AU7A 1H8CA 1WJ6A 3TIXA 2LASA 4OGQC 4HEDA 3MEFA 2AX5A 5I9PA 5IOCA 1VQMA 3DVNU 5JEAH 3NPPA 1IPGA 2KWUB 4WURA 3VR8B 5J3BA 3M63B 1LT3D 1TWCH 1OTRB 5HG2A 4JYAL 2JEAI 3BG3A 1YJ1A 3P42A 4CJ0B 2UUAL 5C4XB 1A15A 2IGHA 4II3B 1TWCB 1L1OA 1WMHA 3IG3A 1YNND 3K59A 4GZYC 2LY7A 3KQ4A 2D10A 2LJIA 3KF6A 1UGJA 4K7WA 4H0LC 1WE7A 1WCMB 1ROEA 4V190 1PTOC 4BY1G 4TKNA 1JWAD 3NBHB 4QY7A 2ICEC 2LMCB 1SE2A 4LDTD 3N3KB 1VQEA 4BKSD 4NXNQ 3S1QH 1K28A 4HCEA 4ICVA 1C8CA 2PNHA 1MVKA 1PZID 3D0FA 2K05A 1V80A 2BS3B 3T3NA 4DK6C 2DJFC 2F0DA 2Y0SE 3BY4B 2CJNA 3H8HA 3R3MA 2YTXA 1YHQA 3NQIA 5JVH3 2EELA 1AE3A 4ZKBB 4GNXC 4WH4A 1FJGQ 3S14H 2MLBA 2K6QA 1ASZA 1CZGA 3DBRB 3EC8A 1TKEA 2JVCA 4HRSA 3DDCB 4NXNL 4QGUA 1UE6A 2JEBI 4PS8A 2LXCA 4K1RB 4LFCQ 3DBLI 3RN2A 1LLRD 2KUMA 3CCRA 4P2CB 4UY8C 1WZ3A 4WJPA 3VQIA 1PTOB 3QB3A 4RHRA 1KFYB 2M17A 1V1PA 3KJPA 4R9WA 2WFWA 1R4QB 1FJGL 5DCNA 1A5RA 1IBXA 3HOUB 2BH2A 4BKTA 3MXNB 4X65L 4X64Q 4OO1G 1CSQA 2KQ4X 3SFDB 5HKHA 5BN3A 3CCEA 2BYVE 2PI2E 1PFMA 3QARA 4A93G 3GTQB 3JAME 2TMPA 4OX9L 5KHQA 1PZKD 4K8JA 4OXPA 3H9DA 2GOWA 2L3ZA 5EDSA 3AU4A 3GE3C 3HOZG 4R8IA 2MPMA 3DWPA 2PJHA 4DR3Q 4X65Q 3G6EA 4G3XB 2HHHL 3TP7A 4H13C 4DR6L 4ANWA 1TVXA 2F0IA 1MHHE 2RHQB 1K9MC 4OO1H 2JN4A 3RT3B 2HE7A 3ITPA 1P8LA 2Z6KC 3K7AH 4HTHA 1QZGA 1ET9A 3W1BA 4DN4M 4DR3L 1UBIA 2FAZA 2JU6X 4S17A 1J7BA 1C78A 3GE8C 2DY7A 1RJTA 4NDXA 2IL8A 2HHHQ 5JXVA 4KSLC 2CJOA 3I9V1 4C7ZA 4EZKA 4P75A 3T1HQ 2W54A 2A6HC 3FKIG 3QX1A 2K5VA 1PRTB 1SMXA 2K7VA 3Q6BA 1SNPA 1EZ8A 3G71A 1HH2P 1RFKA 4JG2A 1FNVA 1X3PA 4IPCA 1VQPA 5C4XG 1BCPB 1XYIA 2MBBB 1BCPC 2ZPYA 2LZ6A 2KDBA 4RA8A 1RM6C 4YXDB 5E6JA 4NZLB 2ZXRA 2KTRA 3GV3A 3I4MG 1WXVA 3EJIA 4EQNA 5ELOA 3FKIB 1E8WA 3NZ3A 4L2YA 4FADA 5A2QL 5KYLA 3MHBA 1NI2A 4US8A 1I50B 2XN9C 2IBIB 5I4DA 1I5FA 4JVZA 5FO8B 4P72A 1W2BA 2FIDA 4H2AA 5ELNA 1NMGA 1OQRA 3RPFC 2FFKB 1S5FD 1PTOH 1I3QB 1FMAD 4IFDH 3GQBA 1C76A 1NYQA 4W9FA 1N5WA 1DOXA 3K80C 3A56A 1Y69U 5FLXE 4A3CG 3T8MA 1VMCA 3LNNA 3HOXG 5C3JB 2L05A 1FGUA 3ZTDA 2E75C 1CFMA 3NE5B 3BZCA 2INDC 3V96A 3VA7A 5GAEC 4B3RL 2HTHA 5JHBA 4K5WA 5M3MH 4N59A 3BWUD 3EBEA 3H1UA 5BMIA 3A5UA 2FCQA 3E9IA 2LEKA 2LXAA 3FPUB 4DHZE 1WYGA 1HTQA 2PMZB 3DM1A 3W5OA 2XNAC 2PMZE 5JPNC 1TWAH 1Z9FA 3I7FA 3TEXA 3HS0C 2UUCQ 4QB4A 4JOIC 2ASBA 2WDQB 2B3AA 2DJGC 4DNTB 1AZPA 4K0KL 2MP2B 4F1SA 4C56C 3GTKB 3O13A 4G11A 5T1IA 3FKYA 2JUOA 3CRKC 2FBWB 1D5ZC 2OT2A 3ND9A 2AL6A 4DNRB 3NG0A 1U4RA 1X3FA 4DU9A 1K8AC 3U52E 3Q0AA 1B1ZA 4ANXA 1LFDA 3NVVA 4K0KQ 2Z0EB 2D62A 4B3ML 4A3MB 1WTHA 4CKCA 3RI7C 2VQFL 3NVZA 2Z0DB 3A8IE 2F0QA 3BYYB 2KOLA 4QUCA 1HA6A 4YHHQ 3GTJH 1MIUA 2B8FA 1PH6A 2WXOA 1N60A 2K8HA 2PKOA 3IFTA 3SEBA 4FA6A 3UI2A 5FJ8G 2MJDA 2O6VD 3TDQA 1N8RC 2ZNVC 5M3MG 1WD0A 1C7YA 2DZMA 5CHWA 1V5TA 1V8CA 2K25A 2LWPA 4MGIE 2RGFA 5FO9B 2DGYA 1EYAA 4FYDA 1FVIA 4IDIA 3KBXA 2XBBC 4EZLA 1D1KA 2P5ZX 2LUEA 1PRTD 4YCWA 2NVXB 1OFFA 2N0SB 3NWSA 4CDEC 1XT9B 3PZ7A 1VQKA 3PIPA 2F0NA 2WQYB 2AKWB 3K5LA 1WJJA 4JL9A 4ARIA 4WJOA 2V3PA 1XNQL 5TR5A 5EKLA 3J9CA 1GNUA 1RHPA 4TRDA 2QA4A 4LF4Q 3P1MA 4HDQA 1AN8A 1TKWB 1PQSA 4KI0A 4J6HA 5G3LF 4KGRA 3N1YC 3NZUA 1Y1VG 5IT9L 2YV5A 4A3JG 4MGKE 4UHVA 4KD4A 3DHQA 4L6TB 5E4XA 1OTCA 2B2VA 4JWSC 4A3FH 4AYBE 4DQOC 1IGDA 5E4WC 2D3CA 1S3OA 5D2MB 4ZRKA 1UELA 5IY0A 1S5DD 2JA7G 1I6HH 1D6EC 3AB9A 3VR6A 4AH6A 1GD7A 2EKIA 4EGVA 3RZDB 2JZ3B 4B0EA 3ZJVA 2KCMA 5EJWA 1HFNA 3APFA 2RF4A 3JSVB 1OO9B 1JWBD 1SYDA 4IWPA 2CKZB 1YITA 4QJFA 2BQQA 1ZXTA 4ZYNA 1CUKA 2E2IB 5IIFA 2ZXOA 1SF0A 3RUIB 2G4SA 2KJ6A 1GB4A 5FLXc 4BBSH 2G45B 1IYJB 3L2PA 4WJNA 3IL8A 5E1FA 1EEFD 2DAJA 4B3TQ 4KLKA 3I2ZA 1Q12A 2K9XA 5IGFA 1ZXHA 3UINB 1XD3B 5M3FG 4IUVA 4KVGB 1HNZL 4CO7A 3PGEA 4YSYB 3FC4A 1UD7A 4BBSG 1I4QA 2EXDA 2IHFA 3GTGH 2LHEA 3NY5A 4B95A 2EJFC 4JI1Q 3D4WA 1TU2B 4LNFA 3SFEB 3F2BA 4A3MG 1SIFA 3L13A 3WANA 3P2BA 4KY7A 4C3IG 3QAQA 2VNUD 4YWMA 2VQEQ 4XDDA 4HSVA 2LMCA 2EPBA 3CPFA 3B1LX 4DDID 3M4OB 5CC4A 4EZJA 2EJGC 2Z59B 3H0GH 3RN9C 3B6YA 4A3PA 2ASQA 2DBYA 3U9SA 2ALYB 3S1MB 2JA8G 2JXXA 2B63G 1WY8A 5E3FA 2X69A 2JK8A 2KD0A 4NY0A 2ACZB 1LABA 3VDYA 3NP8A 1XMOQ 1MI2A 1RTNA 1O80A 1SR3A 1Y1VH 1IYVA 1S5CD 1VQAA 3GTLB 1WR6E 5KNCA 2MCNB 2R92B 4JI0L 2BYEA 2JA6B 2MBOA 1TT2A 2WINB 5LMUL 1CKNB 1EWYC 1PRTF 1V1PB 5I9OA 4I7ZC 2L0TA 5E6NA 1IBXB 3HFZB 5KIXA 1XCQL 1QVFA 2NS5A 3AE6B 1ILPA 2PZUA 2GBRA 5DNFA 1EYDA 2OJWA 2KQSA 2KEDA 3LYYA 5E6OA 1Z7TA 1JORA 1IHZA 3GTKH 3KYCD 2EY2A 4RFBA 1EFWA 2EYPA 1HNXQ 2OF1A 2EY6A 2CWAA 4RG1A 2IX1A 4A3BG 2F0GA 2UUBL 5JEAG 3HOYG 1E24A 5H92C 5EPKA 3R2IA 1UWVA 5IO9A 3W5UB 2O5JC 4RM8A 1ICFB 3K7UC 2INNE 3DQVA 3GS2A 3QOLA 1IL8A 4K6DA 3GTPH 4IM2A 2WB1G 3IXSA 4MDKE 4EEWA 1JR0D 1E9MA 2REXA 4KHVA 1SNDA 4X3SA 3OMCA 5CGKA 1SYCA 2BT6A 3SK6A 3H94A 1SMYC 5KGUA 3ONAB 1F1HA 4ZRPA 3NQTA 3DVGY 2F0HA 3VFKA 2IY0B 4AUQC 4F7ZA 3TUOA 2KC2A 5NUCA 2A6ED 3ZKJC 1QT9A 2GLSA 4HAEA 2QSDA 2ZW1A 3PO3B 2VH2A 5CV5A 3ECIA 4OZBA 4PG3A 2R93B 3M3YB 2BPSA 3M4QA 2L76A 2MJ3A 2WS3B 4YTPB 2NVTB 2K32A 4ZDVA 3TBLD 4OO1I 3PGZA 1WSPA 3WA0A 2MBHA 3E9HA 1LXDA 4DHJD 1BCPD 1FGBD 4DA2A 3TL5A 2YTYA 4LUZA 1SYEA 3DHHC 3CU7A 2A4ZA 4HN7A 4KKIA 1MGSA 1M4VA 4JIOU 4UP7A 3PQIA 4L1BA 4KHZA 3D32A 4LF8Q 4HROA 1O7YA 2X38A 2GBNA 4WJQA 1HEZE 4A20A 4IWOA 3MEHA 1TWFB 1Q81C 2K39A 3KF8B 3DXJC 4HJ5A 3L16A 1F9JA 1I4XA 3CMEA 4ARCA 2QDFA 2F0WA 2GMIC 2QDLA 1AE2A 1UE7A 3SHLA 2C60A 1XCTL 1NBFC 3VUWA 2JA6G 3HEJA 2WXKA 1CMXB 2Q2UA 4W9KA 4M8MA 1U0LA 1BUVT 4ZHOA 2IGDA 1K73C 2Y0SB 4YL8A 4ME5A 1Q5WB 3Q24A 4MACA 3L17A 3MXNA 3T56B 3ZJTA 3FRPB 1N62A 1EU4A 2LVPA 2ZTDA 1YHBA 3OYYA 4LF5Q 2A8VA 2O5IC 1ZW7A 3Q3NC 1LQBA 1FYCA 2L55A 3QIAA 3IAS1 3CAMA 3DVGX 3FILB 4CKBA 2EYOA 2Q2TA 4KDIC 4JLCA 3M3JA 4WWMA 2KJRA 5HHDG 3S2HB 1N36L 4LF5L 4AS1A 3PMFA 1KHIA 2R93H 5D14A 1TS2A 3I91A 4ODGA 3AFQA 3HOXB 1C4PA 3CQZH 4HWIB 2B2TC 2K22A 3RZWC 3S1RB 1PFNA 1UF0A 4FULA 1EWHA 1EU3A 1V1QA 5A2QE 1O7IA 3ULLA 1Q1OA 2YVCA 5FK9C 4DV7Q 1BF4A 2KFJA 3KLRA 1OQYA 1YEZA 1FNUA 3AE1B 1VZ6A 4W9GA 2WDRB 2AQ3B 4WFN3 1PH5A 3JYUA 4DUZL 5J17A 3R8BA 3TP6A 1E2WA 3T1YQ 3OIQA 1MG8A 2R7ZB 4C2MH 1TGZB 3NVWA 2JXTA 5MPOA 5J1ZA 4ZRIA 4BY7H 4LNNA 2MSED 1VQ5A 1SE8A 4FDBA 1TIFA 4X66Q 2L0FA 2BWES 1X9NA 1WX9A 4DK1A 3G4SA 3K58A 3Q23A 2MP1A 3U2SC 1ZPSA 2UWQA 4WORA 1I42A 3I4NH 4RKBA 2DYMA 2KZRA 3T51B 5M5XB 3TQYA 3WWVA 4RMFA 4YWKA 2EZVA 5E7NA 1JW9D 2G4DB 4WWNA 4KHPL 3J81i 1DOMA 4DR7Q 5C3WA 1KLUD 3I72A 3OOCA 3KYDD 3VYSA 2K04A 4A3FB 1J7CA 2NVYH 1EQRA 1VQLA 3ZUNA 2CHBD 3APCA 1TZ1A 1NY4A 1BVSA 4WJ3M 3DVNV 4R1JA 5H8YE 2K6DB 1QZHA 1XO3A 2K28A 2ZVNA 3RLOA 4PNYA 3S1NB 3JW0X 1PHJA 5M3MB 1X55A 2CU1A 4Q0FA 4LK0M 1EUVB 2J0JA 2K75A 3ETRA 2FIFA 1WFQA 4RCOA 2KK8A 1QLBB 1XNRQ 1IYFA 1BXTA 1HFGA 2L15A 3EROA 3QWNA 3BDCA 5IE8A 4X62L 3LDZE 1WGHA 1HZ9A 1PGBA 4A90A 1XMQQ 2MP2A 4OZAA 1ASYA 1F2RC 4RGMA 1TS4A 2EYLA 2KFKB 3AEVA 4XGAB 3AE2B 1NR4A 4LUVA 4C3JG 4DXGA 4XXEA 3ZIMA 1PLFA 3E5SA 1Q86C 3GOEA 5EKKA 2HUGA 1XMQL 3R7RA 4L23A 1DGJA 1D5XC 1KNAA 4DV4L 2PPHA 4FF4A 3VRAB 4DR2L 1PH2A 2KVRA 3FP9A 2SDFA 3FVQA 1F2RI 4NJ6A 4BFRA 4KY6A 1STNA 2IZVB 1UBQA 3H0GG 3UIPB 3SR6A 4KKUA 2PZTA 1GHJA 2AUKA 3X3NA 2JA5B 2K0PA 3TEWA 4K8IA 1A6XA 2ZJQA 2MFIA 3C46A 1OXXK 5C23A 3SGIA 1VQIA 4MHEA 1EIFA 4HIMA 2OTLA 5IA7A 3AE4B 1GUNA 3AE9B 4HLEA 4YY3Q 3DBSA 4HSPA 4QAYA 3GV6A 4DV0L 3RZOB 2K6AA 3PZ8A 5CHVC 1GUAB 3ZRCA 5M3FH 1I94Q 5DPWA 4JI3L 1HNWL 1K0RA 3GP7A 4BBRG 1C77A 2J0KA 2PIAA 3LXFA 1NR2A 2M9VA 3DBLB 1G6PA 1V49A 4A3KB 4OWWB 1W3SA 5IODA 3A8KE 1WXMA 1ZKHA 3RNEC 1QE6A 1IP9A 2L1BA 2KX0A 3RR5A 2LVQA 5HGQA 2IO1B 4W9CA 3N6RA 2J0TD 5IP4D 3CC7A 5L83A 4IOAA 5BYRA 1BQQT 1S4ZA 3OWFA 3W3AA 1UWXA 1F2MA 3HRDD 1LTGD 2AQ2B 4C7YA 1L0XB 1G8ZD 1GAQB 1WJNA 1YX6B 1WRIA 4DV6L 5IGEA 4A3EB 2Z4IA 1QJOA 4IO9A 2HCIA 4IUPA 2KBNA 3MTSA 3EFXD 2PVGC 1S1QB 1F0ZA 4DDGD 3AI5A 2C35B 5LMNW 2CHXA 4OVZA 4QMGA 4OONA 1BO0A 4M01A 3PUYA 2HQEA 5CMDA 5I2YA 2B2WC 4CDCC 1N9WA 5EBDA 4WQMA 1IXRA 2QF7A 5JAVA 4DV6Q 1XQQA 4C3HB 4BA2I 2HD5B 2DN8A 2KN5A 2WXPA 1GXDC 4GDKB 4A3EG 4LMQD 1H9KA 2KECA 2QEXA 3CCLA 3EFCA 4S0RA 4LFCL 1Z5SB 4F87A 3CWIA 3Q8CA 2BDNA 3HKSA 1QVGA 3MHZA 3UDIA 2OJRA 4G7OC 1E1OA 3DEOA 3KLSX 3ABVB 2D3GA 2JZPA 4FXGC 2VB2X 3DBRI 4C3JH 1WRDB 3RNFC 1J5EL 4F8CB 5D94A 3TREA 2IO0B 4WWPA 2LUMA 1Q3LA 3J7ZC 1P1AA 2O6VA 3TBIB 3STBC 1YQBA 2HDEA 2K01A 2WGSA 1B53A 1EWCA 5IYDG 4TMAB 2KQ7A 2PVOD 2JA5G 1G291 2J53A 4IOIE 2FUG1 2E2JH 3M7GA 1WGGA 1A3VA 3AFPA 4DR4L 3QIJA 4DR6Q 1RD9D 4HPMB 3NS8A 3RMKC 1E90A 4Z9CB 3P7JA 4JI6Q 4BVUC 2WB1B 3S1NH 2IWHA 3HRZC 3H7SA 4BBNF 3KF8A 4MTNA 3SR1A 3H15A 1MG4A 1U4AA 4LK1C 1XLQA 2NVYB 1PXUA 2ZT9C 3CIRB 1WX8A 1SNMA 1J19A 4DR1L 1S72A 1EIGA 1WYDA 1JMLA 4AOFA 4PV1C 5IT9c 1FXIA 2ZEQA 3RN5A 4ZRJA 1LTBD 4BXXH 3KF6B 1QKZA 1ICWA 1E7PB 3I4MH 2BYFA 2CHZA 1PH7A 4IW0A 2WU2B 5E6PA 2NBVB 3SHQA 3LB8C 1TWHH 1PUTA 4MSMB 1HQMC 1Q8IA 1PH9A 4KIKB 1D4BA 4F8MA 2J42A 1LTSD 1JOQA 3NWTA 4XT3B 1K8RB 5D6JB 1B44D 4YWLA 4HR7B 1MSHA 2F0EA 1QOFA 1IKLA 1YD8U 3FKIH 1LV9A 3FILA 2DAFA 2NYZD 4B0MA 2KLCA 2DYOA 3WIMA 4K5XA 2BB5A 1FCLA 2SNSA 2OEDA 2KX3A 2YYZA 1Q90A 2PLPA 4RNAA 1TKYA 5C4JH 2CWPA 1IW7D 5G5HA 1UZXB 3OSOA 1UUPA 1YJIA 4KN4C 2EOTA 2K5QA 2EE1A 3DWQA 5CV9A 1YI2A 3ZDMC 4ZLTF 1A2UA 1L4DB 2PTLA 3DM3A 4IJHA 1GKHA 4LUOA 2PNRC 4CBVA 5C3XA 4AJYB 3FMCA 1NEKB 2KVMA 1WTPA 1LO5D 4ULLA 1D3ZA 4U673 2AWNA 1QILA 2A74C 4F88A 1WXQA 1X1MA 4LJOB 4DAPA 1RLFA 4YWGG 3EHVA 3HOYB 2WP8J 5JVG3 2XTIA 1KRTA 2YEPB 5CV8A 3BINA 1NJIC 3Q22A 3A74A 3I70A 2L52A 3DEPA 4G0NB 3ZYYX 5CBEE 4GN5A 3CCSA 3GTOB 1A8VA 2DNCA 4R4OA 1CK1A 3SK5A 3WDNA 4K3BA 1EY5A 2CFMA 2BYTA 3BZKA 4FJYA 3AMZA 4II2B 4A4IA 1RRBA 1E22A 2DNEA 3I4LA 3MHSD 2KLGA 3PTFC 3PVLA 4I6PA 5IN7A 5J18A 1LM8B 3NENA 5M3FB 4LF6Q 2XWJB 3CQZB 1S5BD 3NELA 1V97A 3TP8A 3LWUA 3IKJA 4ILWA 4GXBA 3PCOB 1VQ7A 4A3LG 1IKMA 2L9HA 1YX5B 2PE9A 3P4SB 1JWSD 1LT5D 3Q8BA 4OIKA 2B76B 2WX0A 2G3QB 3HOWH 4NQLB 4HCNB 2NVQB 3DOWA 1L1OB 3TMPB 3H3VI 2RKSA 3PUWA 4IZ8A 2Y5CA 2LS01 2O4XA 4XYQA 5JPMC 2C9WB 2K5HA 3H7PB 1TXYA 1LUZA 4M8NA 2A68C 4PMCA 3K9OB 4L5QA 1WTVA 1EO6A 2WXFA 4BA1I 1LTTD 3PUVA 4POGA 2JT4B 4YT0B 4O2DA 2FHTA 1Z2MA 2EY1A 1IW7C 4PS7A 5G5GA 4MNOA 1VRAB 2VXWA 3ERSX 1Y8OB 4RCNA 4HIOA 2KDIA 2YEPF 3IT4B 2KQ3A 4WIPA 3S1RH 4LF4L 1X32A 2WWZA 2PCFB 1A63A 2LGDA 3JVZX 4MN3A 4I7AA 3SDLC 4GNXB 5C0XJ 1TY2A 2CQOA 5IGCA 1N33Q 4BKSA 1HZBA 2RQXA 4AWJA 3RZFA 4JCVE 1C9OA 2LSSA 2WXIA 3U30A 4ZHPA 4LF9L 2A73B 5IGDA 3BK2A 2UXCL 1SYGA 3CCMA 3Q8DA 1NMFA 4W9IA 1L4ZB 2H1EA 3JC66 1IYUA 1GM5A 3RNCC 2XRQD 3KJOA 1O7LA 3CMMB 3NZSA 2F3IA 3FHWA 3TP5A 4DV3Q 5BR8L 3IFWB 4HDOA 1F9QA 1GUTA 2QW7A 1HZCA 3RNAC 1VQCA 3CRLC 2RMMA 2C7HA 1V86A 4HKZE 2F0JA 3VHTC 2F4VQ 5J39A 1P7FA 4G57A 5IYCH 1C48A 3AEDB 5C44H 5C2TB 4IM0A 4A93B 5M5XH 5T1GA 1O7ZA 2VW9A 1PYBA 2QIEB 4NKLA 3S16B 2L12A 3O65B 2JE6I 3MC0B 1JJ2A 3VYUA 4ZRQA 5G55A 1D1IA 1YZ6A 2E76C 2KHIA 4FXKC 3UDFA 1HCZA 4A93H 1JJGA 2K8CA 2PPBC 1ZGUB 1E8ZA 1Q8KA 1WTWA 1CI3M 1R4PB 1HNZQ 3S14B 2CHWA 3MC8A 3BDOA 3PZDA 2EYMA 3GTPB 2PI2A 5KEEA 2F3VA 1MJCA 3V62A 2F03A 3AXCA 1F52A 2WYQA 4A3IH 3RD2A 5CR3A 3QR8A 2F52A 3U7ZA 1YNNC 2JA7B 2LI5A 2ZPNA 4ZOHC 1PDQA 2JZZA 5DM63 3CF6E 5AZGA 2V1CC 3TMEA 2WB1E 3KDFB 4QF4A 2QCZA 3KWVA 1K0SA 1BCPF 3KYHC 5IP9H 2JQOA 3VVWB 1XX8A 5ELEA 4MH0E 1CA5A 4M02A 1QOHA 1QUQA 2K33A 2Q8RE 2ZJRA 1ZP0B 3N1ZC 1XMOL 2IYDB 4LF7Q 3UDGA 3EIVA 3E9SA 5LMNQ 4KV6A 2OOBB 3A4SC 4UP8A 4ZAIA 2DY8A 4UDUC 1F77A 1U9RA 1FCCC 2EYJA 1E6EB 5KYIA 2ZJPA 4NMZA
chains in the Genus database with same CATH topology
3Q8EA 5J22A 3NTKA 1MD2D 2WV6D 4A3BB 2BDOA 5CV4A 2HDLA 2JA8B 1V8QA 1M8AA 5BMGA 1WVLA 3L3OC 3J81L 3MP9A 4Q5VA 2H88B 2H89B 3PUXA 4NW2A 1L0VB 4C3HG 2F4IA 3PV0A 4DGZA 1FD6A 3GO5A 3AEGB 1JICA 2NZ1D 2WNMA 2SEBD 4KTAA 3RUZA 1SE3A 1PYWD 2QILA 4M0WA 1STAA 4CQNA 3PIP3 2IX3A 1LTRD 1ZYRC 1GOZA 3H6MA 4RGNA 4C1NI 4IFDI 2WLBA 3MWYW 1G2SA 3WOEA 3AEBB 2MGSA 2KDMA 4ID6A 4B08A 4CJ1B 1N5XA 3B2GA 3EVQA 4KK7A 3Q8AA 2IPKD 1K51A 3NTIA 3R2TA 1VDVA 1QG7A 4IUNA 1DXMA 5C0XI 1DZ1A 2Z4HA 3MFYA 5EPJA 1HUNA 2B2UA 2WXGA 1F2LA 3NS1A 2BA1A 1J8IA 1U4PA 4A3IB 1EOTA 1E10A 2GA4B 1SIJA 1DOLA 3DUZA 4CGYB 3S9WA 1U4MA 1JE4A 1JB3A 3V05A 2LGIA 2RDFA 2SNMA 2V3NA 3W2DA 1GUSA 4DFAA 2N9KA 5COYA 1E0BA 4KJNA 3QJYA 1AEXA 3S17B 5CBAE 2JSVX 1JROA 1NAPA 3URYA 1BMLC 4WJWA 2QJLA 1Q10A 2IDYA 1B50A 3K57A 4YSZB 1SEBD 2QDBA 3NK9A 1G6ZA 2F0VA 1KF6B 4P6VF 5EPLA 1K8OA 3DMUA 1H9SA 5EGTA 1YQ3B 2N55A 4ZKCB 4N9TA 4G4KA 2R61A 2KEEA 5DM73 2WACA 4OW0A 4XT1B 5DEHA 1QCBD 3VR9B 3PO2B 3HOZB 1EM7A 1IGCA 1ZDXA 4HMJA 5BN4A 1B9MA 1EEID 3CKIB 5F2DA 2AWOA 3AEFB 3L4PA 2WU5B 5FR3A 3I4MB 5M9OA 1MPEA 1HZ6A 4IKGA 4O1NA 3K7AB 5JEAJ 4EVOA 3IAYA 2JXMB 1JOKA 1QNKA 2FMCA 2RDHA 1ZKOA 2HDMA 2VUMB 1STEA 3VA5A 1EY4A 5ELFA 3BVGA 1SJED 3SXHA 3GTMB 3IAM1 1QB5D 2E2JB 3H0GB 3QOJA 1WTRA 1K53A 2L0CA 3D6WA 4LTUA 3AEEB 3K0YA 4NP5A 4DAVA 3NXWA 3MFGA 1XLOA 3J81E 2BW2A 1VMPA 2BBCA 5C3EB 3LX0A 1STYA 1D5MC 3KWLA 5C4JB 3KUPA 4OHJA 1B3AA 1F2ZA 3X3MA 4ZUJA 1EY9A 2BTEA 2PZWA 4MIUA 2EY5A 4RF0A 1ENCA 3NUCA 1NUCA 1ENAA 1DOKA 1B9RA 5K36H 2IX0A 4BWGB 1V43A 2L5TA 3RMHA 2K5PA 1G91A 5C5MA 4G7HC 2NN6I 2OXPA 4R3DA 1VF5C 2K03A 3G6JB 2NTTA 3RD4A 4BBRB 4NAMA 4WRDA 3AMUA 1K83B 1KDAA 3TZDA 3VRBB 3M85A 3K5NA 3B2FA 1XWEA 2NTSA 2JWUA 2N7JA 1EZ6A 3C2PA 2NWGA 3BS1A 3I73A 1EY0A 1E0ZA 4LAAA 2G1EA 1QOAA 4PQXA 3E0JA 3AV8A 1SYBA 1XTCD 3T13A 2EJMA 4QUFA 1ZYRD 4AQ7A 1SMYD 4OL7A 1DCZA 2NBFA 1PMRA 3AB5A 1STGA 1VLBA 4H7BA 4Q2JA 1L0YB 5I2XA 1UNSA 1E2VA 4IN3A 2RVLA 5ELDA 3T4AC 2PW9A 3VR3A 2RDGA 3NVYA 1TR5A 5AUIA 1AFPA 4FVMA 2NMQA 3IT6B 1II3A 2AQ1B 1FEHA 2B2TA 2G9HD 3SK4A 1JOOA 1Y8PB 2FE8A 1ML0D 4B9XA 1VR9A 5FOBB 2BB6A 2CW0C 5HI1A 1PRTC 1CA6A 2E2HB 4K2KA 5LHY1 4F7XA 3VR2A 4PT5A 3FEWX 4BBSB 2R6GA 3AM9A 2J4XA 2JYEA 1Y56A 3J80L 2KN4A 3NRZA 1JQ4A 3W9CB 1HRJA 1UWMA 4O42A 1NCVA 3Q8FA 3GTGB 4L63B 4K5VA 5KNDA 4K14A 2J7ZA 4FF2A 5ISRA 5HURA 3WCQA 3MXGA 1FNWA 1LACA 1WTXA 2B2WA 4ITKA 3TSSA 1NSNS 1W6KA 1Y8NB 2KHSA 3Q6SA 2F3WA 1KDCA 1VF7A 1KRHA 3HUIA 2I46A 3DWAA 1YQ4B 2A6HD 5CV6A 3UI3A 1I4HA 3RLFA 1SSOA 3VR4A 3P63A 2QKIC 1O78A 4I65A 1VZ8A 3D4DA 3P75A 3SE0A 3MVVA 1YN3A 3QG1A 1NI3A 1LT6D 3TN2A 3S15B 1LTAD 1N61A 4BS9A 1Z6HA 1I4GA 3H91A 2BS4B 3K5OA 1YNJD 5D3DA 1CQVA 4K2LA 1B9NA 4FP5D 1H9RA 1E2ZA 1WWTA 4HMIA 5ELCA 1KLGD 4XQJA 1K50A 4XDCA 3C1EA 1HXYD 3M4YA 4X3KA 5KRUA 3J80E 1TWHB 2EVBA 4QCLA 2D9UA 4KD3A 4JK1C 2A69D 3BDLA 3K6OA 1C9FA 2E6XA 2JX5A 1D2BA 3LWEA 2H4OA 2NUCA 4TQ0A 4X3TA 1JALA 2K3UA 2ZW0A 2EXZA 2F0TA 3G7LA 2K5WA 2M56B 3H09A 1FFVA 2F0SA 3MJ5A 5AUKA 1GPXA 2F0KA 1TS3A 2B2YC 3A54A 2F0UA 1ZE3D 1PFDA 1GJXA 3DWMA 2KCNA 1KNEA 4G7ZC 3HGBA 2A5HA 1H9SB 3KK7A 5LL6S 3E6ZX 4FO2A 1HA5A 2BOSA 3EGRA 3A8JE 3AE8B 1U4LA 2A6EC 2VB3X 4HKQA 2E2DC 5BYQA 1MI0A 2WXQA 2WIIB 1EIHA 2JSOA 3HG9A 1QNUA 5TSSA 1W6JA 1YNJC 3VR5A 3BVMA 1V1OA 1CQFA 1ENFA 1SAPA 3OWEB 4E6IA 5A35A 1L5PA 3T16A 2XVSA 4EQOA 3I4NB 1SXTA 4YTNB 4YTMB 3B9JA 1PZJD 2NN6H 2V4DA 2MEKA 3C1FA 4IALA 2A69C 1AP0A 4L8JA 3ZGZA 5CORA 2CQAA 5C0XG 1XF5L 2Q5WD 1MSGA 3C8YA 1SYFA 2X6GA 1RCVD 3U9OA 2MH7A 5KNBA 1JRPA 1ZXIA 1BOSA 4NJCA 2IW3A 5IGGA 2MUYA 1NYRA 4FXDA 4ZQ3A 3OIPA 4EQPA 2IGGA 1F9SA 1KTKA 3AH7A 1F2YA 5D65A 1FFUA 4DXFA 3BYTB 3CHBD 2PMVA 3S2DB 1X3QA 2ZXPA 4A3GB 3ERQA 3L7ZC 1EQVA 3ZJUA 1BDOA 2YU9B 2WXMA 1AYFA 5D3IB 4N6EB 1G2TA 1F9RA 1L6UA 1OXSC 1SNQA 4M8AA 2ICIA 2CVRA 5M5WB 2AUJD 4IQZA 1EQTA 5FLXL 3J7AV 1TS5A 1XXGA 4YIJA 3L9AX 3VRAB 1Q1EA 2CW0D 4N58A 2GRIA 1DYQA 2BE5C 2M2LA 4C2MB 2EYHA 3D6CA 1HTPA 1FM0D 2MHVA 2WDVB 3HKZB 4K6LA 1K8MA 4IUTA 1J7AA 1ZUD2 4WAFA 3I90A 2XSCA 2BA0A 5IGBA 1T5XD 1TYGB 3WOFA 1SE4A 3C3LA 2OHFA 4N9PA 3TEYA 2Q8IB 1VCIA 1T3QA 2GB1A 1T6BX 1C4CA 3F2UA 1FD7D 2DLBA 1FRDA 2EYFA 1TWAB 5AFWA 1YN5A 3RFZB 2D5DA 2XRSD 4RGTA 3P4QB 2X6LA 1A2TA 1CHPD 1A3TA 1S5ED 3I8ZA 2J52A 4NAWB 1C4QA 1RWSA 1HQRD 2B2YA 2MJ8A 3T3OA 1Z47A 3JAML 4XYOA 1SNOA 4KY5A 1BR9A 4HCSA 3ZQ4A 2I07B 1CT1D 2ENBA 5GXGB 2G9DA 2W55A 2W3SA 1AWDA 1PFBA 3P20A 1CM9A 4KJOA 1YNTE 2Y3AA 3AEAB 1TY0A 4C3JB 2ID0A 3AN1A 3J7AF 4R8NA 1EY8A 1K52A 1TQOA 2L32A 1Y1VB 4V0BA 2B8GA 2N9LA 5LL6X 1JQYD 5EBCA 2I38A 1PGXA 2V0GA 2F0LA 1FR3A 3SVMA 1TWGB 4XWTA 3H3VC 3MXUA 1YJJA 4DK0A 5EE1A 1C79A 2BS2B 5BN5A 3MA2B 1KAAA 5JOBA 4A3DB 1KDBA 3M7NA 4US9A 5LNK1 4MM3B 2C9OA 2OEOA 1T5EA 2L83A 2QMTA 1SFOB 1ZEQX 3A7LA 4GLSC 1C4AA 5EE0A 1UEAB 3D3RA 4IUQA 3AECB 2K5DA 4JE3B 3V2TA 1QOBA 3R93A 4ABNA 3HOWB 3BIID 1ESRA 5C0XH 4XTCS 2JYOA 4MH8A 1I4RA 4QIWB 1HTLD 3QO2A 4XQNA 3OW7A 1HPCA 1ET6A 2CU3A 5EE3A 4UAIA 2RSOA 2PW7A 4XIGS 1FXAA 1F9PA 2SAKA 5BYSA 1LT4D 4ZK9B 4ZYSA 1B4OA 3N52A 4YSXB 1RKNA 3AE5B 2GI9A 1WGKA 5K36G 1VJKA 1GB1A 1MBYA 4DAYA 5EKIA 1BUIC 4J8QA 2TSSA 5K5PA 5EQ0A 1CZWA 5C4HA 3BVZA 4KMUC 3D8GA 2ON8A 3NBHA 4HEA1 3I57A 4BY1B 2KMMA 1SB3C 3NUHB 2RPVA 2NN6G 1STBA 1TZOA 1H9JA 1RODA 1HHVA 1ONLA 2JQRB 3W5VB 3NHHA 4GDLB 2WXNA 1OXTA 2Q8TA 3P4PB 5EE9A 4TKOB 1MHXA 2W82A 1R9TB 1QOGA 2LFNA 2B2UC 3NTHA 1J9OA 4KKJA 1BBXC 2XIWA 1B2TA 2L4NA 4Y7NB 1I6VC 2WAQB 2K1BA 4KN7C 4IFDG 4P16A 2BCOA 5FO7B 3P1HA 4J3OD 2FINB 4D2KA 4RF1A 2E3TA 1N63A 5JJZA 4BY7B 1EY7A 2HCCA 1DD2A 4AYBB 1JCKB 2L1AA 2W3RA 1Q1BA 4CKEA 3D31A 5C4ZA 2PO4A 4B9WA 2QCPX 1TIID 1DOYA 4TSSA 1P7EA 3SDZA 1GUOA 4JX1C 1CHQD 4FF1A 5DAUA 2NB0A 1JC7A 1ZDVA 4MT5A 2IT1A 4ZRZA 4RWSC 5FKAC 4DF7A 3U4EG 3EQLC 1SDFA 3ETRA 2PQEA 2RA4A 3IFDA 1SNCA 2INPE 1HUMA 3NSWA 2KA7A 4RHSA 3PIO3 2Y5PA 3PUZA 5I6YA 2BE5D 4RGOS 3BZDB 3EUB2 1AZQA 3K5MA 3KBGA 2IJ0A 5IT9E 4FXCA 1OXVA 3EA6A 2M00A 3GD7A 4OIJA 4A55A 2EDGA 4XDXA 2F0FA 4A9AA 3W1SA 1CJEA 3HOVB 5HFYA 1GUGA 5M5YB 1WTQA 4C80A 2Z1CA 4EE2A 1NVID 2KWDA 2RSNA 4OZCA 5CV7A 2I2YA 4IURA 1KABA 4KGSA 4TQ1A 3A7AB 1WD1A 2FJ2A 4JBWA 3OHXC 5D7GA 4KKSA 2KACA 3P4RB 4USAA 1FRRA 2F0OA 3D4RA 1ZOYB 4JWUC 3VYRA 1YMHE 4RAUC 2QEJC 4C1NK 4LLGM 2LFIA 3FPPA 1VDZA 2VZKD 2WKCA 4HJGE 3TEZA 2PYKA 3KLSA 3A55A 3I3CA 3OPOA 4PMBA 4PMWA 2HTME 2D2CC 1RDPD 5ELBA 4LJZC 3AE7B 1A3UA 1PTOF 1H9MA 1PGAA 1SBBB 1JWUD 2WP9B 2B39A 5C6AA 4KKTA 1QQRA 2F0MA 5T8IA 3N9YC 3FDTA 1TKGA 4FF3A 2N88A 1YN4A 3NBIA 1DM0B 2M19A 1RTOA 4FNFA 4A8XC 2VZKB 1XLPA 4A3JB 3OMGA 3NVWA 2MJEA 5G3LD 3BK1A 1HZ5A 1I7HA 1CTMA 2RBMA 3T53B 1RF2D 2KJXA 1XLNA 2B2VC 4IFDJ 5HGTA 2Z8LA 3V3XA 1AW7A 4J1MA 2F0PA 1QWYA 3VYTA 1FIQA 2LHDA 2WXHA 1NENB 1SSNA 2E74C 5C44B 2KAJA 3TZUA 2XWBB 1OXUA 2JP1A 3MAQA 1Y1WB 4XWWA 1I4PA 3HZXA 4ZUIA 4M1UB 1KH0A 5BMHA 1LTID 4A6QA 3DWGC 1EYCA 3Q69A 1EY6A 4U68A 3GB1A 2WXJA 3E56A 4C3IB 3HVZA 4XQQA 5I6WA 2JYTA 3R3OA 1DONA 1VZ7A 2A68D 2LKVA 3J7YW 4CHTB 4JPSA 3HP3A 1TJEA 4RKLA 1RYJA 1L6VA 1PTOD 3FAHA 3ND8A 4H44C 3AE3B 4TQUS 2R3ZA 2ONQA 4KX6B 4XE0A 1CZPA 1DJRD 3SK8A 3PO0A 1XEEA 4CJ2C 2WXLA 4S3SA 1DOIA 2D5GA 2M0AA 1IUEA 3S1QB 1OQQA 3MZ5A 2PW5A 1R7SA 2F1MA 1A70A 5CYUA 1PDXA 1QF6A 2WXRA 1EL0A 1GUWA 3MXPA 4RH6A 2L11A 5C5LA 3HVDA 1EFID 2C5CA 2DWQA 2V4IB 4IUUA 4KGTA 1SJHD 2O2LD 1FO4A 1ACCA 1I6HB 4X3UA 1UAPA 2FMMA 1ILQA 2KCCA 1GHKA 1JWMD 3GTJB 2B63B 1STHA 4REZA 2WKDA 1BNZA 1ESFA 2SOBA 3AU7A 4OGQC 4HEDA 2AX5A 5I9PA 5IOCA 5JEAH 3NPPA 4WURA 3VR8B 1LT3D 5HG2A 2JEAI 3BG3A 3P42A 4CJ0B 5C4XB 1A15A 2IGHA 1TWCB 1YNND 3K59A 4GZYC 2LY7A 3KQ4A 2LJIA 1UGJA 4H0LC 1WCMB 1ROEA 4V190 1PTOC 1JWAD 2ICEC 2LMCB 1SE2A 4HCEA 3T3NA 1C8CA 1MVKA 2BS3B 1PZID 2K05A 2F0DA 2CJNA 3H8HA 3NQIA 5JVH3 2EELA 4ZKBB 1CZGA 1TKEA 4HRSA 2JEBI 1LLRD 2KUMA 4P2CB 3VQIA 1PTOB 3QB3A 4RHRA 1KFYB 1V1PA 4R9WA 1R4QB 1IBXA 3HOUB 4OO1G 3SFDB 2KQ4X 5BN3A 1PFMA 3GTQB 3JAME 2TMPA 1PZKD 4K8JA 4R8IA 2MPMA 3DWPA 3TP7A 4H13C 1TVXA 2F0IA 1MHHE 4OO1H 3ITPA 4HTHA 1ET9A 4DN4M 2JU6X 1J7BA 1C78A 5JXVA 2DY7A 1RJTA 4NDXA 2IL8A 2CJOA 3I9V1 4C7ZA 2W54A 2A6HC 1PRTB 2K7VA 1SNPA 1EZ8A 1RFKA 1FNVA 1X3PA 1BCPB 1XYIA 1BCPC 4RA8A 1RM6C 4YXDB 5E6JA 4NZLB 2ZXRA 3GV3A 3EJIA 4EQNA 3NZ3A 3FKIB 4L2YA 5A2QL 5KYLA 3MHBA 4US8A 1I50B 2XN9C 5I4DA 5FO8B 4H2AA 3RPFC 1OQRA 2FFKB 1S5FD 1PTOH 1I3QB 1FMAD 4IFDH 3GQBA 1C76A 1NYQA 1DOXA 1N5WA 3A56A 1Y69U 5FLXE 1VMCA 3LNNA 5C3JB 2E75C 1CFMA 3NE5B 3V96A 3VA7A 4K5WA 4N59A 3BWUD 5BMIA 2LEKA 3FPUB 1WYGA 2PMZB 3DM1A 2XNAC 5JPNC 3TEXA 3HS0C 4QB4A 2WDQB 4DNTB 1AZPA 4C56C 3GTKB 3O13A 5T1IA 3CRKC 2FBWB 1D5ZC 2OT2A 3ND9A 4DNRB 1U4RA 4DU9A 3U52E 3Q0AA 1B1ZA 3NVVA 2D62A 4A3MB 4CKCA 3NVZA 3A8IE 2F0QA 3BYYB 2KOLA 4QUCA 1HA6A 2B8FA 2WXOA 1N60A 2PKOA 3IFTA 3SEBA 3UI2A 2MJDA 3TDQA 1WD0A 1V8CA 5FO9B 4FYDA 1EYAA 4IDIA 3KBXA 1D1KA 1PRTD 2NVXB 1OFFA 2N0SB 3NWSA 3PZ7A 2F0NA 2WQYB 3K5LA 4ARIA 2V3PA 5EKLA 3J9CA 1RHPA 4TRDA 3P1MA 1AN8A 1TKWB 4KI0A 4J6HA 5G3LF 4KGRA 5IT9L 5E4XA 4KD4A 3DHQA 4L6TB 4JWSC 4DQOC 2B2VA 1IGDA 5E4WC 1S5DD 1D6EC 3AB9A 3VR6A 2EKIA 4B0EA 4EGVA 3RZDB 2EYJA 3ZJVA 5EJWA 1HFNA 1OO9B 1JWBD 1SYDA 1ZXTA 2E2IB 5IIFA 2ZXOA 1SF0A 1GB4A 3IL8A 5E1FA 1EEFD 2K9XA 1Q12A 5IGFA 1ZXHA 4IUVA 4YSYB 3FC4A 1I4QA 2LHEA 2EJFC 3D4WA 1TU2B 3SFEB 4KY7A 4C3IG 2VNUD 4XDDA 4HSVA 2LMCA 2EPBA 3M4OB 5CC4A 2EJGC 2DBYA 3U9SA 3S1MB 5E3FA 2X69A 2ACZB 1LABA 3NP8A 1MI2A 1RTNA 1O80A 1IYVA 1S5CD 3GTLB 5KNCA 2R92B 2JA6B 1TT2A 2WINB 1EWYC 1PRTF 1V1PB 5I9OA 4I7ZC 1IBXB 5KIXA 1XCQL 3AE6B 1ILPA 2PZUA 5DNFA 1EYDA 2KEDA 3LYYA 1Z7TA 1JORA 1IHZA 2EY2A 4RFBA 2EYPA 2OF1A 2EY6A 2IX1A 2F0GA 5JEAG 5H92C 5EPKA 3R2IA 3W5UB 2O5JC 3GS2A 2INNE 3QOLA 1IL8A 4K6DA 3IXSA 1JR0D 1E9MA 4KHVA 1SNDA 4X3SA 3OMCA 5CGKA 1SYCA 2BT6A 3SK6A 3H94A 1SMYC 5KGUA 3ONAB 4ZRPA 3NQTA 2F0HA 3TUOA 5NUCA 2A6ED 1QT9A 4HAEA 2QSDA 2ZW1A 3PO3B 4OZBA 5CV5A 2R93B 3M3YB 4YTPB 2WS3B 2MJ3A 2NVTB 2K32A 4OO1I 1WSPA 1BCPD 1FGBD 4DA2A 1SYEA 3CU7A 4HN7A 4KKIA 1MGSA 1M4VA 4L1BA 4KHZA 4HROA 1O7YA 2X38A 1HEZE 3MEHA 1TWFB 3DXJC 1I4XA 4ARCA 2F0WA 3SHLA 1XCTL 3HEJA 2WXKA 1BUVT 4ZHOA 2IGDA 2Y0SB 4ME5A 3Q24A 4MACA 3MXNA 3T56B 3ZJTA 3FRPB 1N62A 1EU4A 2O5IC 1FYCA 2L55A 3QIAA 3IAS1 3FILB 4CKBA 2EYOA 4WWMA 5HHDG 3S2HB 4AS1A 3PMFA 5D14A 1TS2A 3I91A 4ODGA 3HOXB 1C4PA 2B2TC 2K22A 3S1RB 1PFNA 1EWHA 1EU3A 5A2QE 5FK9C 1BF4A 3KLRA 1FNUA 3AE1B 1VZ6A 2WDRB 2AQ3B 4WFN3 3R8BA 3TP6A 1E2WA 3OIQA 2R7ZB 2JXTA 5MPOA 5J1ZA 4DK1A 3K58A 3Q23A 2MP1A 3U2SC 1ZPSA 4WORA 2DYMA 4RKBA 3T51B 5M5XB 1JW9D 2EZVA 1DOMA 5C3WA 1KLUD 3I72A 3OOCA 3VYSA 2K04A 4A3FB 1J7CA 2CHBD 5H8YE 1XO3A 2K28A 4PNYA 3S1NB 5M3MB 4Q0FA 4LK0M 4RCOA 1QLBB 1BXTA 1HFGA 3QWNA 3EROA 3BDCA 1PGBA 4A90A 4OZAA 1F2RC 4RGMA 1TS4A 2EYLA 3AE2B 1NR4A 4C3JG 4DXGA 4XXEA 1PLFA 3E5SA 5EKKA 2HUGA 4L23A 1DGJA 1D5XC 1KNAA 4FF4A 2SDFA 3FVQA 1F2RI 4KY6A 1STNA 3SR6A 4KKUA 2PZTA 1GHJA 2AUKA 3X3NA 2JA5B 2K0PA 3TEWA 4K8IA 1A6XA 3C46A 1OXXK 4MHEA 3AE4B 1GUNA 3AE9B 4HSPA 3GV6A 3RZOB 2K6AA 3PZ8A 1C77A 3GP7A 2PIAA 3LXFA 1NR2A 2M9VA 4A3KB 5IODA 3A8KE 1QE6A 2L1BA 3N6RA 2J0TD 5BYRA 1BQQT 1S4ZA 3OWFA 3W3AA 1UWXA 1F2MA 3HRDD 1LTGD 2AQ2B 4C7YA 1L0XB 1G8ZD 1GAQB 1WRIA 5IGEA 4A3EB 2Z4IA 1QJOA 2HCIA 4IUPA 1F0ZA 3MTSA 3EFXD 2PVGC 4OVZA 4QMGA 1BO0A 2HQEA 3PUYA 5CMDA 5I2YA 2B2WC 5EBDA 4WQMA 2QF7A 5JAVA 4C3HB 4BA2I 2DN8A 2WXPA 1GXDC 4GDKB 4LMQD 1H9KA 2KECA 3CWIA 3Q8CA 4F87A 2BDNA 3MHZA 4G7OC 3DEOA 3KLSX 3ABVB 2JZPA 4FXGC 2VB2X 2LUMA 1Q3LA 3TBIB 2HDEA 2K01A 1B53A 1EWCA 4TMAB 2PVOD 1G291 2J53A 4IOIE 2FUG1 3M7GA 1A3VA 1RD9D 4Z9CB 3P7JA 2WB1B 2IWHA 3HRZC 3KF8A 1XLQA 3SR1A 4LK1C 2NVYB 1PXUA 2ZT9C 3CIRB 1SNMA 1EIGA 1JMLA 4PV1C 1FXIA 1LTBD 1QKZA 1ICWA 1E7PB 2WU2B 3LB8C 1PUTA 1HQMC 1Q8IA 1D4BA 4F8MA 2J42A 1LTSD 1JOQA 3NWTA 4XT3B 1B44D 4HR7B 1MSHA 2F0EA 1QOFA 1IKLA 3FILA 1LV9A 2NYZD 4B0MA 2DYOA 4K5XA 2BB5A 1FCLA 2SNSA 2OEDA 2YYZA 1Q90A 2PLPA 4RNAA 1TKYA 5G5HA 1IW7D 3OSOA 1UUPA 1YJIA 2EOTA 2K5QA 2EE1A 4KN4C 3DWQA 5CV9A 4ZLTF 1A2UA 1L4DB 2PTLA 2PNRC 4CBVA 5C3XA 3FMCA 1NEKB 2KVMA 1WTPA 1LO5D 4ULLA 4U673 2AWNA 1QILA 2A74C 4F88A 1WXQA 4YWGG 4DAPA 3HOYB 2WP8J 5JVG3 2YEPB 5CV8A 3Q22A 3I70A 2L52A 3DEPA 4WH4A 3ZYYX 5CBEE 3GTOB 2DNCA 3WDNA 1CK1A 3SK5A 1EY5A 2BYTA 3AMZA 2DNEA 3I4LA 5M3FB 2XWJB 3CQZB 1S5BD 1V97A 3TP8A 3LWUA 3IKJA 4ILWA 1IKMA 2L9HA 3P4SB 1JWSD 1LT5D 3Q8BA 4OIKA 2B76B 2NVQB 2RKSA 3PUWA 4IZ8A 2Y5CA 2LS01 2O4XA 4XYQA 5JPMC 2A68C 4PMCA 1WTVA 2WXFA 4BA1I 1LTTD 3PUVA 4YT0B 2FHTA 2EY1A 1IW7C 5G5GA 1VRAB 2VXWA 4RCNA 1Y8OB 2YEPF 3IT4B 4WIPA 2KQ3A 1X32A 2PCFB 4MN3A 5C0XJ 1TY2A 5IGCA 2RQXA 2WXIA 4ZHPA 2A73B 5IGDA 3BK2A 1SYGA 1L4ZB 2H1EA 1IYUA 2XRQD 1O7LA 3TP5A 1F9QA 1GUTA 3CRLC