2QILA

Toxic shock syndrome toxin-1 at 2.07 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title The refined crystal structure of toxic shock syndrome toxin-1 at 2.07 A resolution.
pubmed doi rcsb
molecule tags Staphylococcal enterotoxin
total genus 58
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2qilA01
5D3DA 4Z9CB 1EU3A 1SE4A 1JWMD 1XTCD 2IJ0A 1PRTF 1PRTB 3BVZA 1PZKD 1ESFA 2XRSD 1QILA 1LTGD 3R8BA 3W2DA 1DJRD 3DWQA 4RFBA 4ZYSA 2O2LD 5FKAC 2G9HD 1ET9A 1JCKB 1AN8A 1L0YB 1MD2D 1BCPF 1LT5D 5ELCA 1I4RA 1LO5D 1TY0A 3BYYB 1SJHD 1LTAD 5ELDA 2R61A 4RCOA 2QEJC 1V1OA 2NTTA 2XRQD 5TSSA 3MFGA 2Z8LA 4K6LA 1YN4A 1PRTC 1RD9D 1T5XD 1LTID 1D6EC 1S5BD 1PTOB 4L63B 1KLGD 3GP7A 2NTSA 1B44D 2XNAC 1V1PB 3DWPA 2SEBD 1ET6A 1B1ZA 1EFID 1TY2A 4OHJA 4RHRA 1EEID 1HTLD 1SE3A 3O13A 1M4VA 1STEA 1EEFD 2CHBD 2AQ2B 1EWCA 4TSSA 1S5DD 1BCPB 1LTSD 1PTOC 1FGBD 3KLSX 1LT4D 1PZJD 5ELFA 4DXFA 1RDPD 1SE2A 3URYA 3BYTB 1G8ZD 1FD7D 2RDGA 3BVGA 1SEBD 4BWGB 1CHQD 3SEBA 3R2TA 1CHPD 3V05A 1ENFA 1RF2D 1HA5A 1LTRD 1S5ED 3EFXD 4L6TB 5ELEA 1S5FD 1FNVA 1BCPC 1I4GA 1XXGA 1SXTA 1SJED 1CK1A 3CHBD 1JR0D 1PRTD 1KLUD 3BVMA 3EA6A 2IPKD 2AQ1B 1TS5A 3MC0B 1I4QA 1KTKA 1TS2A 2RDHA 1CQVA 1S5CD 4RGMA 5I4DA 1SBBB 2XN9C 1BXTA 1FNWA 1HQRD 4C56C 1BCPD 1D5MC 1DYQA 1D5ZC 2WV6D 1LT3D 3BZDB 4RGOS 4RGTA 5FK9C 1YN3A 2ICIA 1LTBD 1TS4A 1UNSA 4RHSA 1I4HA 1JWUD 1EU4A 5D3IB 1D5XC 1UUPA 4UDUC 1LLRD 1PTOD 4RH6A 1PYWD 1V1PA 2J4XA 1JWSD 1I4PA 1HXYD 1YN5A 1PZID 1I4XA 1F77A 4RGNA 3OWEB 1JQYD 1CT1D 2AQ3B 1FNUA 1TS3A 2TSSA 1LT6D 5ELBA 4NZLB 1PTOH 1RCVD 3R2IA 4O1NA 1AW7A 1L0XB 3DWAA 1GOZA 2QILA 4DXGA 1LTTD 1PTOF 3TSSA
chains in the Genus database with same CATH superfamily
1LYLA 3CSFA 4JVZA 1ZKHA 5C23A 2K25A 1EU3A 5CHWA 1JWMD 3PUZA 1XTCD 1TWFB 3G4SA 5C4HA 4K2LA 1E0BA 1VQOA 1J19A 4XWTA 1KABA 3IFDA 4GNXC 4JW0A 3J7AF 4LWCA 2R92G 3N6RA 4WJ4A 4OELB 1AWDA 3EUB2 4GDLB 4II3B 5L83A 4B3MQ 2BH2A 2F0TA 4POFA 5FKAC 3CPFA 3CMMB 3CSTA 1I94Q 2G45B 4JE3B 1J5EQ 2N9KA 4XGAB 1P8LA 1O7LA 3DBRB 3WANA 1LT5D 1L0WA 3WAOA 1LO5D 1RLFA 3LYYA 5CMDA 3DHHC 3T51B 4HWIB 3N3KB 1IXRA 2CH4W 3CF5A 2NN6I 3AH7A 2GBRA 1GUGA 3QQ8B 4NAWA 1X9NA 2GBMA 1T5XD 3PO3H 4F8MA 1SFOH 4OO1G 1VZ8A 2G1EA 4AQYL 5EGTA 2KQSA 2L4NA 2R2QA 2K1BA 2A68D 3NQIA 1P0RA 2PW9A 4JI5Q 4PMBA 3B6YA 2F0VA 1H4RA 2NTSA 3DMUA 3QIJA 4KX6B 4CDDC 2KT7A 3W5OA 2LHEA 4A9AA 1GHJA 2B39A 3FC4A 1B1ZA 4XC2A 3Q0AA 2EMTA 4DWFA 1XLQA 2K5VA 2KTRA 3LXFA 2Z6KA 3QG1A 1YD8U 1M4VA 2ZJPA 4DR1Q 4REZA 4A3GB 2VRRB 2RCFA 3K6OA 3KDFA 3KLSX 3NRZA 5DPRA 4JI1Q 4DGZA 1VLBA 5EJWA 3E9SA 4ANXA 3JAML 1EFWA 2FINB 2E2JH 3GDEA 4GZYC 4EQOA 2EMSA 3QOJA 2WACA 4C3HG 2R92B 2BW2A 2WDRB 4IPHA 4C1NK 2BYEA 3RNFC 4GOPA 4YHHL 3P20A 2UXBQ 3IT4B 3M62B 1QB5D 1IYJB 2KZRA 3T1HL 4IFDG 2WU2B 4IWQA 4YTPB 4ZRPA 3ZDTA 2PQAA 1DOKA 4BFRA 4R4IA 1MKHA 2L9HA 2EVBA 3C1EA 4DV3Q 4A3IH 3IFWB 4J6HA 2KO3A 1P7EA 3APCA 2RR9A 1MG8A 1EYGA 4OIJA 3L9AX 4UP9A 2IWHA 1A63A 1PLFA 2MUYA 2CCZA 1SBBB 1KM7A 2WXKA 3SFEB 1CQFA 2SNMA 1Q81C 2J0MA 3W5UB 4CYEA 3OPOA 1NDDA 1U5KA 1B3AA 3Q6BA 3PS6A 2ZNVC 4OZCA 4TQ0A 4CBVA 4KV2A 3QWZB 5AZFA 3K0XA 3AE9B 4YTMB 2QIEB 2W3SA 3V61A 4B6WA 4NJCA 4Y7NB 1L0VB 1A5RA 3T16A 2DBYA 3AE6B 2HTME 3NOBA 4HJKA 3CC2A 2LASA 3NHEB 1PZID 4QGUA 5BR8L 1WJUA 1SYBA 1LGRA 1TS3A 2Y0SG 3T3OA 2VS1A 3CRLC 3KBGA 2A5UA 1VQ5A 2F4VQ 3OW7A 2K7VA 2MCNB 4S17A 2N7JA 4DV5Q 4MJSA 1XMQQ 1YHBA 3ABVB 3T3NA 1SYFA 1ZYRD 2IHEA 1PFNA 4H02A 2DYMA 2QILA 4C3HB 1PHJA 4KD3A 3KF6B 1GOZA 1LV9A 3SK6A 2BGFA 2R7DA 5KNBA 1FCCC 4C3JH 2EPBA 2RSOA 4V0BA 4KDLB 4LF9L 2V3NA 4X64L 3FDTA 3NJTA 4YSXB 2LMCA 1EZ8A 4GDKB 4PK1A 4AYBG 2JRIB 1DJRD 4B0EA 2JSOA 1S1QB 3IAYA 3TZUA 1Q46A 2MO0A 1C76A 4O0AA 2IHFA 2JYEA 4DV0Q 3OJ4B 2CFMA 5C3EG 1TGZB 1QOAA 1L1OA 1WCMH 1Y1WH 4C3JG 3PIO3 3MC8A 2BOSA 2HIVA 2RCNA 2F0WA 1J7AA 1F2YA 4PZ8A 2KFKA 4BBNF 3FHWA 2GBNA 1F2LA 3CRKC 1E90A 1A8VA 3VH3B 3RI7C 1T0QC 3ZTCA 1B4OA 4AJYB 3JVZX 2WLBA 1GKHA 3TEHB 4FLHA 4A3KG 1MHHE 5IYCG 1WCMG 1EQVA 2LGSA 1X6OA 5BN4A 1V43A 3HRZC 4ZUIA 2PMVA 3HGBA 1EUVB 1EFID 4RHRA 4LFAQ 2YU9H 2Y0SB 2BYVE 1JE4A 3E0EA 1BT0A 3A1QB 1S3OA 4L8JA 4IALA 1GUAB 3CWIA 4IC7B 2WXPA 2BS2B 1FGUA 4ZK9B 2LFIA 2AKWB 1HNWL 4XDDA 3AMZA 3T56B 5IODA 1GJXA 4N8FA 2MJ8A 2P5ZX 3OMCA 5LMNQ 4IOCA 1EIYB 3HOXB 2UWQA 3P63A 3U8ZA 1D3ZA 4O42A 3HOVH 4IPCA 5IYBH 1KQSA 4BS9A 2E2HB 3DBHI 4KSKC 5L37A 2HDLA 1PXUA 1WM2A 3K81C 4JOIA 2MLBA 2MP1A 1LTRD 2MHVA 4DV7Q 4MT5A 1F0ZA 2VZKB 5C3EB 1IW7C 2NB0A 3AEEB 1NI2A 2GVBA 3UGBB 1IGCA 2MJEA 1I6HB 4MM3B 1PV4A 3WALA 3AXCA 2A5HA 1SMXA 1TZ1A 4D2KA 4A3LH 1XWEA 3AFQA 1N61A 2SAKA 1S5CD 3T13A 2QA4A 4LF4L 2KYWA 1FNWA 3VR9B 3QIAA 4YCWA 4C4VB 2WV6D 4Q2JA 3NE5B 5JHBA 4OWWB 1YN3A 3EQLC 4HKQA 2B2YC 5E7NA 4IFDI 5CV8A 5E1FA 1ICFB 1I4HA 2MNAA 4KKTA 3OLMD 1D5XC 4FXCA 1FD6A 3S17B 1WXMA 3WOEA 1JALA 4MH0E 3HUIA 5IY0A 3LDZE 2V1YA 1QWYA 3I8ZA 3RZDH 2XSCA 3PUVA 3EROA 1PH1A 1L4DB 5C3XA 1CZGA 3WDNA 3WWVA 2BPSA 2JU6X 1CT1D 3MHBA 1HFNA 3PO0A 2AQ3B 2WP9B 2ZJRA 2BB6A 2RSNA 1A3VA 4TQUS 1J8CA 4O1NA 3STBD 2M2LA 4RWSC 3SR6A 5IP7G 1ZEQX 1R9TH 4JBWA 3DM3A 4WRDA 1PTOF 1WWTA 4EQNA 2ZCBA 3IXSA 4ZKCB 3H7PB 4KY7A 4US8A 4QMGA 2G4SA 2KHJA 1STYA 1NYQA 1HR0Q 1A0IA 3VH4B 3M3YH 1ESFA 3N9YC 1QE6A 1WOCA 1GC7A 2JA7H 5JHAA 3PGZA 3AU7A 1MGSA 2WXRA 2R6GA 4EZLA 1NR2A 2EDGA 1A3UA 2EIFA 4A3FH 1K8AC 1L0YB 3TS0A 2NVXH 2DUDA 1L2FA 1TKGA 3A0JA 1QUQA 4RM8A 1C4QA 1MSHA 1SJHD 2H5XA 2LUEA 4KZCA 2EYOA 2PVGC 3ZGZA 2B63H 2E2DC 1W2BA 4HEDA 4W9GA 5IO9A 4B3ML 3RYTA 4BKGA 2ZJDA 4B9WA 2KWCA 4A20A 1I94L 1YNXA 1SROA 3NTHA 1J5EL 2K01A 1D6EC 5I9OA 4DK5A 2CHZA 3I56A 1BF4A 1KH0A 1KLGD 2V1CC 2I1JA 1K3BC 3N30A 1KRSA 4A3FG 1RAXA 4K8IA 4CJ2C 2LZ6A 4YCVA 1JMCA 3PSEB 5EAYA 4GOCA 5CHFA 3UDIA 2WAQG 4H0LC 1P9DU 3Q2AC 4OVUA 4P1CC 1EEFD 2CW0C 1WIAA 5M3MB 2RDFA 3NS1A 4LFBQ 2C60A 2XK5B 1DGSA 2PW5A 1R4NB 3TDQA 1EY5A 1ZOYB 2RD0A 2NVUI 3O65B 1YHQA 3MJWA 4QIWE 5EPLA 3V05A 4FA6A 2OTJA 4FADA 4KI0A 3AU5A 2F4IA 1KAWA 2PJHA 3DVGX 3JW0X 2ZZPB 1QOGA 2KDMA 1CSQA 1Z7TA 3H1UA 1SDFA 2VQEQ 2OTLA 1FNVA 1QNUA 5JVG3 4LNOA 1N9WA 4K5VA 4MGZE 3ERSX 2G5DA 3RMHA 1Z5SB 1WI5A 1VQ9A 1C77A 1VDVA 5D2MB 2KMMA 4NW2A 2NVTH 2D11A 3Q22A 1CQVA 3RLFA 4IUPA 2UXBL 5JZEB 1O7ZA 3M7GA 4B3SL 2Q5WD 5I4DA 2C7MB 2WXLA 1BVSA 1WTHA 4FHKA 1S4ZA 1IBKQ 2Q8IB 3GTMH 1LUZA 4KK7A 4GLVB 3N1XC 3V60A 2MEKA 1IYUA 4LF6Q 3CF6E 3KLRA 4EX5A 2F0SA 1JMLA 2GMIC 2CS4A 4GOPC 3ULLA 4WJQA 3K9PB 1IKLA 2E76C 4LUVA 4HVBA 4G4KA 4OGQC 2JEAI 1D4BA 1JWUD 2WAQB 2L32A 2AYOB 3GTJH 3VR8B 3ZTDA 2MWSB 4EQPA 2MBEA 3VR3A 2Q2IA 1PYWD 4GN5A 3KF8A 1EQTA 1E1OA 3OTOQ 4KHZA 2O2VB 3K8AA 3CCRA 4GNXB 3TEXA 5JPNC 5J3BA 5DLQE 3ZRCA 1PTOH 2F03A 4JK1C 2KWDA 2L52A 1I5FA 2QEXA 3CCLA 3N1ZC 1JC7A 4KKSA 4EOYA 2EXZA 1XF5L 3NBHB 2INPE 3Q3FA 1J7BA 1IYFA 3F2UA 3GTOH 2ZEQA 4PV1C 3ENEA 1F9SA 2JVCA 4DR7Q 4YT0B 4JI7L 1VQEA 4GB9A 4HTHA 5I9PA 4WJWA 5C5LA 5K36H 4EKUA 2F3WA 2MRPA 5HI1A 3SK5A 3PIPA 3BVZA 4YWKA 3R8BA 4YSZB 1QILA 1VQIA 1YX5B 3X23A 2L83A 3UE1A 2K5PA 5JPMC 2WHIA 1BBXC 4XQNA 2PYKA 2ZTCA 5EE3A 4K5XA 5D94A 4CHKA 3S2HH 2PNHA 1WVLA 3S1MH 4R4TA 1AN8A 4DN4M 3MJ5A 2B3GA 4DXAB 2A69D 3RULA 2N55A 4X3TA 3LX0A 2MP2A 1CUKA 3GZNB 1HQMC 2JJQA 2R61A 2AEHA 2FUG1 1L6UA 4PQXA 1N5XA 2YTVA 1DGJA 4A8XC 1NTGA 1ONLA 2B2WA 1XTDA 1L5PA 1R4MB 2J0KA 3EGRA 4HPLB 4M01A 4DV0L 2E2IH 3N1YC 4B9KA 3IG3A 4GIVA 1IBXB 1J6QA 3FP9A 2JZPA 1LM0A 3HKZE 2WDQB 1K53A 2L55A 2W55A 5LXHA 1YEZA 4JI0Q 4K14A 1IGDA 1TWGB 5IP9G 4DAMA 3RNAC 1ENAA 4K7SA 4H44C 2DWQA 4K81A 3K5NA 4OHJA 4W9LA 2RA4A 1G91A 2WIIB 5DEHA 3VR5A 2A4ZA 4P6VF 2BQQA 4PZ7A 4HDQA 2ID0A 3V2TA 5BYSA 2XGTA 5HURA 2JEBI 1HJPA 3PRMB 2L1BA 4FF1A 2BKFA 3RR5A 1JB7A 5JEAH 3PV0A 5JVH3 2HHHQ 3R7RA 3TREA 2E74C 2LXCA 3S1QB 3TP7A 2JA8H 1ENFA 4N8X1 3AB5A 3RFZB 3A9KA 2EJMA 1E1TA 3K80C 3OOCA 2KDBA 4EUTA 3DEPA 1WX7A 1H9JA 1JRPA 4OIKA 2ZNVB 4A3BH 1TWAH 4RCNA 4KN7C 1M8AA 1SJED 4HJ8A 5CC4A 2KN5A 5LMNL 5DM63 4PYZA 2Q2TA 1FYCA 2BYTA 4MGIE 3ZDMC 2IPKD 1U9RA 2LJIA 4IG7B 2H1EA 1GM5A 1LXDA 3TIXA 3E6ZX 4QUFA 2BB5A 2JA8G 1L2NA 4YHHQ 2JE6I 4KLKA 3RN2A 4AIMA 2LKVA 3IAS1 3D3RA 3PZ8A 1ILPA 1WGHA 3VHTC 1SYEA 4ZAIA 4PS3A 3PLUA 4JOIC 3EC8A 1ML0D 2YTXA 1YHAA 5CX3A 5BMHA 4AH6A 2X6GA 2JA5G 4ICVA 1KDBA 1EU4A 4A3CH 2QMTA 2V3SA 4IUQA 1KIXA 1MFWA 3I4NB 1A62A 1HZ9A 1JWBD 3VXWA 1GJZA 4ACFA 1K0RA 4K8JA 1NMGA 3GTLH 2DZIA 3I70A 2FUHB 1O7IA 4LFCQ 3L4PA 1JQYD 1FNUA 3J81j 2ASBA 1C4CA 3NP8A 4K6DA 3PF4A 2KLGA 2D2CC 5I6WA 1RCVD 3R2IA 5M3FH 3HOUB 3W9CB 4OWXB 1C9OA 3OSOA 4YY3Q 1HUNA 4QF4A 4R3DA 2IL8A 4A3DG 2BA1A 4X65Q 1R4MI 4XE0A 4H7BA 4ULLA 4DUZL 4JV5Q 3DQVA 3FKYA 1RFKA 5BR8Q 1NEKB 1W3SA 1PDQA 2I2YA 3MZ5A 1PRTF 5AZHA 4EVOA 1C0AA 3RMKC 3S2AA 4KKUA 3P2BA 1CFMA 1H9RA 4IURA 5M3FG 1V5OA 3AE8B 3DWQA 4MHEA 5FO8B 1JCKB 3ND9A 5CV9A 1XPOA 2KN4A 3MHZA 2NN6H 1EWIA 1PFDA 5AUKA 4POGA 3RD4A 4DF7A 1SNCA 1EWYC 2WDVB 3BYYB 2F0MA 5KGUA 3CPWA 4X64Q 4DK1A 1EOVA 1HR0L 1PH7A 2ON8A 3TEYA 2F0JA 1FCLA 2N78A 5CORA 1WXQA 2UUAL 1EY7A 4P16A 4I7ZC 4L5SA 1VF5C 1JJ2A 2ZPYA 4IPGA 1F2MA 1KDCA 1RL2A 3SD5A 1P3QU 4LF5L 1PYBA 2FBWB 1YX6B 4IW0A 5C5MA 3MWYW 4FYDA 3MXPA 4X6AH 2HJ1A 3TEWA 4IM3A 2KDIA 1TY2A 4H13C 3AFPA 1QLBB 2HQEA 3H8HA 3M7NA 3I63C 3G71A 2N1VA 1TT2A 1ZXTA 5IAAC 5AZGA 5FO7B 3CMEA 2B3AA 1R4QB 1EQRA 1UAPA 3VQIA 5AFWA 1M1KC 1LTSD 2PPBC 1FGBD 2IO1B 2WDTB 1PZJD 1UE7A 4HCPB 2EY2A 1STAA 2N9LA 1WGKA 2KAJA 2ASQA 3HVDA 1G8ZD 1SE9A 1QQRA 1FMAD 1S40A 3SDLC 3S15B 3B1LX 1VQ7A 4BBSB 3P1MA 4M8MA 4AP4C 3RCZA 3U58A 3STBC 4A76A 3GE8C 2KQ3A 3EFXD 3DUZA 1WTOA 5J39A 1S5FD 5AJ3L 5LNK1 5GAHC 1HNWQ 1B2TA 2NVYH 3UIPB 4JX1C 3EA6A 3SXHA 2C35B 4LW1A 5LL6X 3NWSA 4G7HC 2ZW1A 2I1KA 3IT6B 3F1ZA 2UUCL 3ML8A 1NBWA 1MJDA 1TWFH 2XN9C 1BQQT 2VQEL 2WXQA 5DCNA 3K5MA 2KLCA 2LGDA 4II2B 2UUBQ 1JJGA 4A3JB 2QCPX 4MIUA 2LJ5A 2WXNA 5ISRA 3AEFB 4J6IA 1EY0A 1UBIA 3QA8A 1VQHA 3UDXA 3D31A 2IT1A 2KUMA 2F0OA 2UU7A 3PZDA 2J7QB 3M4YA 1EYCA 4LF4Q 4DV3L 1Y69U 4GN1A 3NVZA 2BYFA 3DBLB 5M5WB 2J4XA 4CDEC 1PGBA 3Q8DA 3J81c 4LF6L 4RGNA 3UI3A 4DR6L 4XT3B 3CCEA 1FIQA 4G0NB 2L00B 4DDGD 1R4PB 2VZAA 4C3IG 1WR6E 2AL3A 2PPHA 1O7YA 4K3BA 3AE2B 3PUWA 4QIWB 1TTNA 2DZMA 2NUCA 3VYSA 1V49A 3PIP3 3OTOL 3CCUA 2K32A 1RYJA 3RPFC 5JAVA 3VUYA 2KCNA 3SHLA 3J81L 3KUDB 4M02A 4OEMB 4DHZE 1E8WA 3K57A 1EQQA 1HZ5A 2RKSA 3CCJA 2BS4B 1AH9A 4LNKA 2V4IB 1XPRA 3T53B 4G7ZC 2EYLA 3H09A 2RDBC 4C1NI 2KCCA 4BY1G 4DAYA 3KH0A 2D3CA 1KLVA 4IUUA 2L05A 1I35A 4K0KL 4W9HA 2R92H 2MGSA 2HQLA 2REXA 3CU7A 3DEOA 1T0YA 3MC9A 1RRBA 1WFQA 4Q0FA 4A3GG 1HZAA 2EKIA 3GOEA 1LTID 3WAPA 2UU9Q 5T1GA 2R2OA 4NAWB 2K39A 3I72A 1I3QH 1WTVA 3HK0A 2PI2A 3TN2A 2YEPB 4G11A 2PTLA 1GUTA 2X6LA 2G9DA 3MXNA 4A93B 4KVGB 3OIQA 3DWPA 3GO5A 3Q24A 1ET6A 3X3MA 3TS2A 1PUTA 3NG0A 1O78A 2NYZD 3GQBA 4IQZA 4C3IB 2WYQA 4B0MA 1HTLD 1TWHB 3KLSA 4OO1H 2YV5A 1N36L 1WXSA 3DDCB 2QCZA 4HCNB 3E3XA 1PH4A 1BNZA 1OXXK 5C0XH 4JI0L 2EY1A 4X3SA 4DXFA 2CHXA 2RSUA 1KRHA 1CM9A 3MTSA 3ZXRA 4B3RL 1P98A 5GXGB 3IHPC 3RNEC 4ANVA 1H9KA 5C4XB 2GBJA 1GUWA 2IY5B 2W82A 4WAAA 5GMVA 4JI6L 1SNQA 4L1BA 2R7FA 3JAMc 1K8OA 2K14A 3AEBB 5H8YE 1FL0A 2UYZB 4FULA 4CKCA 5C0XG 1YJWA 1I4GA 4GXBA 2C7NB 1Y14B 4BY1B 3VAWA 3ITPA 1CI3M 1QVFA 1MVKA 2DAFA 2KJ6A 2HHHL 2VY3A 1PRTD 1EY9A 3S2DH 4MSQB 3D6CA 4NKLA 1C7YA 4C3HH 4LF7Q 2K75A 2LXJA 3AE4B 4E71A 4WJOA 4GN4B 1T0SC 1TS2A 3JC66 1OXVA 4IFDH 2GBKA 3NBIA 3HM6X 3TJPA 3HKZB 1UEBA 1Z47A 4C56C 3VVWB 2LI5A 2K8BA 2IX0A 5CTRC 5BYQA 2M0AA 3T9LA 4PNYA 2WB1E 1UNSA 5CR3A 1PMRA 1Q8KA 1U4AA 1TJEA 2KKCA 2RPQA 2QW7A 1A2UA 1QOHA 1Y8PB 3ZJUA 3VR2A 3FEWX 2LVPA 4OVVA 1Y8NB 4B3SQ 4RH6A 2LGXA 1QG7A 1Q7YC 2F3VA 2K5WA 4IWPA 2Q8TA 5DPWA 1E3PA 1F77A 2PMZE 2R3ZA 4AJWA 3HRDD 4MTKA 2X38A 4P2CB 4JI3L 1E7VA 3CQZH 3BJUA 3CKIB 3CCQA 5EKLA 3I91A 2BTEA 4WQOB 2JA9A 1E22A 3RNBC 2D07B 3C1FA 5E6NA 2UXDQ 1MHXA 5JEAJ 1AE3A 1RWSA 2AX5A 4LF8L 1LFDA 2ONQA 4LFCL 3TSSA 3FKIG 3GD7A 1FRRA 2E5LL 1FXTB 5CBAE 2M19A 2PE9A 1GUSA 2JP1A 1V5TA 1EY8A 1KAAA 1N62A 3PQIA 3QC8B 3GTGB 2DYBA 3NXWA 4ZOHC 1K9MC 5I2YA 4DU9A 4KGTA 1PZKD 2CH4A 2XRSD 1W6KA 4RKLA 2M00A 4YY3L 1E2VA 2GVAA 4X65L 2F0EA 4JV5L 1N33L 2FMCA 3DPDA 4GLXA 1WXVA 3DBRI 3LWUA 3HOXH 1PH8A 5FLMH 3NWTA 4IM0A 4JI7Q 2W54A 4PMWA 2XRQD 1ZGUB 4K6LA 2K5QA 1N5WA 2EY5A 1TXYA 5NUCA 4JYAL 2KQ4X 5C3EH 3KW5B 1STNA 2F0UA 1STGA 4G3XB 1I6HH 1OFFA 1JE5A 3HOXG 4OW0A 2IW3A 3IRBA 5FLMG 2CJOA 2DNEA 2XWBB 5FLXE 1E8YA 1PH3A 2KD0A 4RMAA 4GU2A 3K7AB 4Y52H 3KQ4A 1RHPA 3S14B 3K0YA 1ROEA 4HIMA 1L4ZB 3BIID 3UE0A 2JXTA 2L0TA 3PTFC 4C80A 1DCZA 5IOCA 3I73A 4A3KH 3E5SA 1XLPA 3NENA 5G2NA 5IYCH 5FOBB 2KDFB 2IBIB 1PGXA 2LVOA 2KFJA 3LJ3A 4P7IA 3OHXC 4X57B 3W5VB 3FKIB 2OEOA 2VW9A 3S17H 2LS01 4JLCA 2I07B 3BVGA 1VDZA 4KKIA 1YNND 4FF4A 4C00A 1Q1OA 2MX2A 4HSPA 1FO4A 1X1MA 5EPKA 1SNOA 1WX8A 5CV6A 4L6TB 1WMHB 2IO2B 1NUCA 2Z4IA 2AWNA 1E5WA 1A3TA 2M0XA 4XYOA 4CDFC 1V8CA 5C4JB 3X3NA 3BS1A 1DONA 4YWMA 2MSED 3FAHA 4U68A 1JWAD 2EKEC 2KVZA 2DHZA 1YJIA 2LEKA 1I4QA 2WXMA 2EZVA 2CU3A 3KF6A 1Y8OB 1G2TA 2JQRB 1XT9B 1KL9A 1NR4A 5IT9c 3ECIA 4A3IB 1XPUA 3PSIA 2I38A 1T6BX 4OO1I 2VH2A 2D62A 3I4LA 2JA6G 1T0RC 2WX1A 1MSGA 3W1GA 2RVLA 1YNJD 5IGGA 2JK8A 5C0XI 1TS4A 2JYTA 4ZHOA 1Q1EA 2DNFA 1ZKOA 1WYWB 2F0GA 2V3PA 2EYFA 3BWUD 3NUHB 1UUPA 4N58A 4F8CB 4ARCA 2QF7A 2KJRA 2CQAA 2ZTDA 4GN3B 4B08A 1UWXA 2SOBA 4NY0A 3H7SA 1FM0D 2R7ZB 2UUBL 2TMPA 1XD3B 4F1SA 5IT9L 1F9JA 2QHOA 3D4WA 1PYSB 1QOBA 1PH5A 3V96A 3S1RB 2LD9A 1CKMA 3I57A 4FXGC 4NZLB 4UHVA 3J80E 3ZKJC 2NZHA 4USAA 1CZPA 3CCMA 3AECB 2F0FA 3RNGC 4KZ0A 2O5JC 2YYZA 3SVMA 2BE5C 2CWPA 4N6EB 1WRDB 1ACCA 1K8MA 3A33B 3DVNU 4B3TL 2HIXA 1OQQA 3LGJA 2IJ0A 3A1QA 1ASYA 5IP7H 1SR3A 4PT5A 5M3MH 2G4DB 2J53A 2KNBA 4DBGA 1K0SA 3MHSD 1AP0A 1CKOA 1Q90A 1STHA 1E9MA 3JSVB 3L54A 4DUZQ 2HUGA 4IUVA 5J1ZA 4BBRG 1QT9A 3J80i 4S0RA 4EEWA 2WXOA 2F0KA 2OJRA 3U4VA 1EOTA 2JA6B 2K8HA 2OF1A 1EYAA 1K83B 1YJ1A 1GNUA 4ANUA 4X3UA 1HTPA 5M3MG 5CYUA 3UDFA 1N34L 1GHKA 1VQMA 1FXIA 3HOZG 1B70B 1A15A 1YQ4B 3H6NA 4H2AA 1I42A 2N7EA 1WTQA 2BWFA 2WWZA 3ERQA 1N32L 3R3OA 3EN2A 1V1PB 4P73A 4MM3A 3SHQA 3HOWG 3ZJTA 1B7YB 2V9HA 2L15A 2MW5A 3UINB 2AWOA 1FVIA 3OWFA 2UUAQ 4FN2A 3DWMA 5C1ZA 2UU9L 2NVQB 3SDZA 1WGDA 1RODA 2AQ2B 1JORA 1KXLA 3FILB 4C4VA 2A19A 4R4CA 3AV8A 5E6JA 3KWVA 4ZRQA 1WTWA 2WXGA 5D6JB 1NAPA 3PZ7A 2OQKA 2KOXA 4LF5Q 3LNNA 2FCQA 3QCAA 5KHQA 4DHZB 3V3XA 1C79A 2MA9B 2VQFL 2K33A 4BY7G 5EKIA 5M5YB 3KK7A 3I4MG 5J2RA 1YOVB 2Z0SA 3AU4A 4KHVA 3M9BA 3MFYA 4TKOB 4HIKA 4HEA1 4WWMA 2MPMA 1WGYA 3L13A 4FF2A 4W9IA 1LACA 4BBRB 3HOVB 1BCPC 4HCSA 5CV4A 1JROA 1QCBD 3K58A 2B2TA 3NUCA 1F2ZA 3BZKA 2ZJQA 2GRIA 3AI5A 1WJJA 2FIDA 3H3VI 2GLSA 4N9PA 2WKCA 3MVVA 1JT8A 1L6VA 5CBEE 4XIGS 1P1AA 3HOZB 4DV2L 3H7PA 3MXUA 1B8AA 5AJ3Q 3M63B 2JQOA 1EY4A 3KUZA 5FK9C 1VQJA 4R8NA 2Y5PA 1C8CA 4LF7L 1WY8A 2LVQA 2AUJD 3HOWB 2I5HA 2OJWA 2B2UA 1FFVA 2C7HA 2UUCQ 3Q14C 1HRJA 1WFYA 1LLRD 4P74A 1SE8A 3R93A 2K6AA 3JYUA 4MGYE 2H4OA 3VRAB 2Z6KC 1EIGA 1I4XA 3L0OA 3KWLA 2OCEA 1WM3A 3ZNID 3NQTA 3OW2A 4JBKA 4QAYA 3ZNZB 2TSSA 4RM9A 3E56A 1JOQA 3WA0A 1U4LA 1NCVA 4NPSA 2ES2A 2PI2E 1IL8A 1TIFA 3B9JA 3S1NH 4BY7B 1H9SA 1STBA 3ULJA 3KVFB 3I4MB 4XYCA 1ICWA 1TWGH 4DXGA 2FFKB 1Q3LA 1MBYA 1SYDA 1HZBA 5DNFA 4RA8A 2QC8A 3ZNHB 1F2RI 1QVGA 3TZDA 1JJCB 4DR6Q 3VFKA 5E4XA 3PHXB 4A3EG 4UPAA 1R9TB 2DGYA 4P75A 1EIFA 2O6VB 3PUYA 1H8CA 1V8QA 4WURA 2ENBA 4XQQA 1N60A 1XLOA 4FO2A 1K52A 1HZ6A 2QJLA 4WJPA 4ZYSA 2UXDL 2XK5A 3OG5A 1ET9A 1SMYD 1YJNA 5D7GA 5COYA 2JZZA 4M00A 2A68C 3HM3A 2L0CA 5EE0A 1YQ3B 4N9F4 4JCVE 2WB1B 2KECA 4IFDJ 4ITKA 1YITA 2QEJC 4KJNA 3UDGA 1YN4A 1PRTC 4YWGG 2K22A 3BDLA 3ALBA 4G50A 2EYJA 4MELA 1II3A 1G6ZA 3CC4A 1XQQA 2C5LC 2WNMA 3T8MA 2B63B 1UE1A 2PMZB 3GTQB 2SNSA 1B44D 3QJYA 2A8VA 4K0KQ 2R93G 4HPMB 1V9JA 2DY7A 1B9RA 1EEID 4ZRJA 2IGHA 3TMPB 2BDNA 4X62Q 3JAMi 1K50A 5H92C 3K9OB 1EWCA 2NZ1D 1SAPA 4PMCA 3IAM1 3AEGB 1XCQL 4HMJA 5IP9H 3IVFA 2C9WB 3Q8EA 3VYTA 2MH7A 1FRDA 1R4NI 2D5GA 3Q8CA 3R7QA 4DHJD 4J3OD 2D2QA 4JI2Q 3VYUA 4A3EB 1CSPA 1S72A 4BWGB 4LJPB 4JWSC 1TT5B 3W1SA 1BR9A 1UGJA 3Q23A 1N36Q 1RF2D 1N63A 2E6XA 4M8NA 4PS8A 3W1YA 1FJGQ 3D6WA 3P75A 2O2VA 3C2PA 4ASWC 4K3CA 4CJ0B 3I55A 4GNXA 3KFUA 3NZUA 3CC7A 1ESRA 5BN3A 1MI2A 4FBJB 4HJ7A 3CP0A 5HGTA 4B3RQ 1EF5A 1TKEA 3C46A 3DVGY 3I4NG 2F0PA 1L1OC 3Q6SA 4HLEA 4KD4A 4JI6Q 3NBHA 3ONAB 2KDEB 1J8IA 2WS3B 4TMAB 1MG4A 3TRZA 2BT6A 1Z9FA 3KJPA 4DK6C 5IGDA 1V80A 3TEZA 1Y56A 4CKBA 3HS0C 1E10A 1DYQA 2HT1A 1Y8RC 2DZJA 4AOFA 4LTUA 4RGTA 3HOUG 4ME3A 2QSDA 1BMLC 2HJ8A 2BA0A 2BF8B 2R93B 5C4ZA 5JH5C 1QVCA 1Q82C 3H6MA 4RG1A 3U52E 3PLVA 3UQBA 4UDUC 1SB3C 1OTRB 1PTOD 2YLMA 3FRPB 4BAXA 1UWVA 1ZYRC 5EBDA 1JWSD 5JJKA 3CW2C 3K7UC 2PO4A 1VQAA 2N3SA 4HR7B 3GTJB 4JI4Q 4DFAA 3H9DA 2JA5H 4LLGM 4NDXA 5HFYA 2D3GA 3NSWA 1T3QA 3CCVA 2VXWA 1IBXA 2CVRA 3ZYYX 4ZKBB 2GB1A 4BOZB 3A8KE 3A5UA 1LM8B 4GLAC 2KEEA 3A7LA 5KNCA 1EYDA 4DK0A 3G7LA 3WAMA 2YEPF 3H94A 1ISNA 3M3JA 3DCGA 1QOFA 1RM6C 3BU2A 4JI3Q 3IBEA 1HNZQ 4S3SA 2IGGA 3EFCA 3SU8X 4BZAA 2OXPA 4A3DH 2MBOA 1O80A 2NPTA 4LJOB 1VD2A 1YNNC 5EE9A 4HROA 5K5PA 4LF8Q 1C78A 3LWEA 4R4QA 2E5LQ 1GC6A 3ZVVA 1PQSA 3S15H 2DZKA 4LK0M 4WJNA 3GZNI 2L1AA 4L5RC 4KV6A 1ZE3D 1VMCA 2DYOA 2EYPA 4KIKB 4IO9A 1VS0A 2L11A 5IWAQ 5G5GA 1V1OA 1BBUA 2NTTA 3NTIA 4FJVB 4ZYNA 2E8GA 4BOSC 2KHIA 1K28A 2M9VA 1U4RA 3NZSA 1N33Q 1K73C 1T5EA 4XTCS 1WI0A 3A9JA 4BKTA 4W9KA 3APDA 1I50H 1PFMA 4A75A 1GUOA 3U9SA 2FAZA 4C7YA 1C1YB 4IZ8A 1ZP0B 4BBSG 1BO0A 2QKIC 2JY6A 3A54A 3HOYG 4JYAQ 2INNE 1AYFA 3J7A5 1SSOA 1WJ4A 4A3JH 1ZUD2 3A4SC 4ID6A 4TSSA 1GG3A 5HKHA 4DR2L 4DQOC 2KJHB 1TWCB 3GTPB 1HUMA 4XT1B 1EWHA 4J8QA 4ANWA 3D8GA 3S16H 5IGEA 1FD7D 2KHWB 2XWJB 4DK3C 4ZCKA 5M5WH 5D14A 1U4MA 4HK2A 1CKNB 1UEAB 4ZQ3A 2N8NA 2MHJA 2L3ZA 2LFNA 4N59A 4FP5D 4A3JG 1S5ED 2EY6A 3OYYA 2K28A 3PO2G 1OQYA 2KWUB 3QO2A 4JQWC 3MXGA 5KEEA 3E9IA 3EBEA 2N7DA 3NZ3A 1BBWA 3BVMA 4IUNA 4KY6A 5FR6A 3DM1A 4GKKL 1CJEA 5G55A 1TS5A 3ZIMA 4A3BB 2PLPA 3PT2B 5FJ8G 1X56A 3V6EB 3IL8A 3BINA 1JICA 1BUVT 1ZXHA 4DKAC 2YVCA 1VMPA 2NBFA 3KBXA 5LMUQ 1HPCA 4CJ1B 2XTIA 4NPNA 1D5MC 3H0GB 2IO3B 2K5HA 3ML9A 3B2GA 4JBMA 1GO3E 1LTBD 4WWNA 2QDLA 2VL6A 2AUKA 2D0OA 3DLLA 2DJFC 4KKJA 3NVYA 1RTNA 4A3OA 5C44G 1IBML 3D0FA 4AUQC 4K2KA 3HOYB 2VUMG 2FIFA 2WXHA 4I6PA 1WZ0A 1Q1BA 4IWOA 4AYBE 2NMQA 4WQMA 4BA2I 2C5CA 3KUCB 2CWAA 1G6PA 1GAQB 2OT2A 5I2XA 1ILQA 1TYGB 2N49A 4CDCC 2KWVB 1HNXL 2PCFB 3BDOA 3TMEA 2KK8A 5GROA 5CHVC 4ZRIA 2GOWA 2WXFA 1HCZA 3M4OB 1X3PA 5DM73 4A93H 4ZRZA 4GSWA 4JC0A 1DOXA 4M0WA 3OIPA 5D3DA 4OZBA 1TIID 5GAEC 4C3IH 1B9MA 3PO2B 4DV6Q 1K3RA 1YBYA 4XQJA 2AL6A 2WGSA 3VYRA 3MP9A 1IP9A 3L2PA 2B8GA 4JPBW 4ME5A 2FJ2A 4JG2A 5C3WA 1ASZA 3RLNA 2HDEA 1LTGD 3ZO5B 2LGIA 1E7ZA 2F0LA 3VA5A 1E6EB 4DNTB 3SR1A 2O2LD 4FXDA 5C3JB 4A93G 4BXXG 3EIVA 4KDIC 5IP4D 3MEFA 2K1FA 5ELCA 5C4XH 5IN7A 1NYRA 2BS3B 4JIOU 4B3TQ 4OVZA 4X66L 3I2ZA 2I5LX 3VUXA 4P71A 1BUIC 4WJ3M 3I5JC 4HJGE 1UD7A 3MFGA 3GS2A 4HJAA 2LXKA 4CQNA 4LNIA 2KTFA 4BY1H 5IYDG 3VDYA 2B2YA 5A2QE 3CIRB 5C44B 1Q12A 4ODGA 5M5XB 5KRUA 2VUMB 4EZJA 5C4XG 2ZXOA 1VQBA 1CA5A 2ATWA 1XLNA 2MBBB 3X0WA 4WWOA 1E0ZA 4TRDA 2XIWA 1KF6B 4A3GH 3AE7B 4IOAA 3QK0A 4I7AA 2M4NA 1Z6HA 1CTMA 2Z1CA 4GS3A 5EQ0A 3J7ZC 1N34Q 1WGGA 4HKZE 1GD7A 3I3CA 2PEAA 3QWNA 1VQPA 1BCPB 4EQ5A 2KC1A 4M1UB 2RGFA 1JB3A 1N32Q 2PZWA 5KIXA 4C2MB 3NVVA 3UI2A 4I65A 4LDTB 4JI8L 5FO9B 1F52A 2EJFC 3S9WA 3TP5A 3RZOB 3NVWA 5C6AA 3HKZG 4K5WA 4X62L 1IKMA 3P4QB 1NSNS 3TP6A 2K5DA 1VQGA 4DUYL 3VRBB 1HZCA 2JT4B 1SLJA 1WTPA 4O2DA 4G7OC 2KANA 1LQBA 2ZM6L 4IDIA 5BMGA 2HCIA 3RD2A 4DAVA 1WJ6A 1VCIA 1G291 2EYHA 4JI2L 2Q8RE 2KX0A 1JR0D 2MJ3A 2VQFQ 1WGRA 1X3GA 2L5TA 4FXKC 4BBNC 3MC0B 1G6JA 5IA7A 4XXEA 4DR5Q 1FJGL 1SNDA 2L8JA 2MBQA 2KTRB 2NVYB 3M85A 3GTGH 2B2WC 4A55A 4Y7NH 3CMAA 2PVOD 3MTNB 4RGOS 1SMYC 2A6HD 2DNCA 3W1SC 4A3MB 3FPUB 1DOMA 3KDFB 4RKBA 4ALPA 1D2BA 4L23A 4W9EA 4IJHA 1PA6A 1E7UA 4IN3A 4DV4Q 1Q86C 2RHSB 4LAAA 3HKSA 2N1WA 4DV2Q 3DBLI 3J7YW 2KEDA 3PCOB 2ZXRA 4GOPB 4MH8A 3A4RA 3AMUA 3G6JB 1OXSC 4E6IA 3TBIB 2PQAB 4R4OA 3ER0A 1LT6D 1RFAA 2DENB 4LUOA 3ZJYC 1AW7A 4KSLC 5E4WC 5ELOA 4DR4L 5BO4B 1V6EA 2ACZB 4OONA 5CV5A 4ZDVA 4MTNA 3K7AH 4JI4L 2EQSA 1KC8C 3S14H 1TKYA 4GDLA 3GTKB 2A69C 2F0DA 3WOFA 2KC2A 1J0GA 2EE1A 1EIHA 2UXCL 4IUTA 1PRTB 3U7DA 4AQ7A 4LNFA 3AYHB 5GQOA 4FF3A 2PQEA 2KMAA 2W3RA 4UAIA 1S3SG 3VA7A 4EZKA 3RZFA 5LHY1 2M1MA 2G9HD 2WAQE 3FKIH 1B50A 3HHMA 4HRSA 2F3IA 2K3UA 5GAGC 3PO3G 1DD2A 1OQRA 1WJNA 1Y1VB 2KCMA 1AARA 1XMOL 2MBHA 4LK1C 1PH2A 3K59A 2LWPA 1HNZL 2Y5CA 3U30A 5DPSA 1VQ4A 3AEAB 5KHOA 1FXAA 1QF6A 4MACA 5HY6A 5C4JH 3Q3MC 3RLOA 4MJSB 1L7YA 1SNPA 1YJ9A 4F88A 3NEMA 1IPGA 2LXAA 3D4RA 5IWAL 3BK1A 2JSVX 5E6OA 4WH4A 4AWJA 1EO6A 2JUOA 1I3QB 3DHIC 1JOOA 1OEYA 3R3MA 4I6LB 2LMCB 3AN1A 3VUWA 3ZLZA 2PKOA 3G48A 1PTOC 2K50A 4U673 3P42A 2E2HH 1W6JA 1NNXA 5IE8A 3V62A 4KN4C 5G3LF 1L1OB 4WAFA 3BYTB 1AE2A 3A56A 3F2BA 1C4PA 3T1YL 2D9UA 3A74A 1E2WA 1VQCA 4QUCA 3RNUA 1ZDXA 4A3IG 3A7AB 2VH1A 2R7ZH 3DBHB 1A6XA 2FCMA 2VB3X 2B76B 2KFKB 1SF0A 3WIMA 1QNKA 3S1RH 1SGHA 5ELEA 2KQ7A 3PO3B 2M56B 1SFOB 3ONSA 2OQ0A 3H3VH 1WH3A 3VR6A 4KTAA 3H15A 4TVAB 2D3BA 2N9EB 1U4PA 3BK2A 1NENB 4DR3Q 1HA6A 2RDHA 4A90A 2R7ZG 1XEEA 2XVSA 1ZW7A 3S2DB 1V1QA 4P72A 2EXDA 3PV1A 1D5ZC 4IUMB 2I0QA 3C19A 1IZ6A 2OEDA 4UP8A 3SE0A 3TUOA 3TP8A 3Q69A 4RHSA 2OOBB 4NXMQ 2PIAA 2Z0EB 2D3AA 1KNEA 1PH6A 2E2JB 5LMUL 5J18A 1U0LA 1OO9B 3B2FA 4YTNB 2JA6H 2JZ3B 2KOLA 1K83H 1QZGA 5F2DA 1EF1A 3EECA 3DWGC 3RUZA 1A2TA 3NPPA 4G57A 1TU2B 1WYDA 2J52A 3D32A 4NAMA 3PRZA 1HH2P 2JPHA 3OMGA 3P1HA 4XZ4A 3PGEA 1B9NA 4KGSA 5IIFA 1FPYA 3L0WB 1L0XB 3PREA 1D1KA 3BDCA 4OL7A 4NNJB 5M9OA 4GKJQ 4GDKA 3CQZB 3T4AC 4Z9CB 5EE1A 4UY8C 1NBFC 1EZ6A 2JYOA 2M8SA 2BCOA 2KBNA 1Y1WG 2NVQH 2RMMA 5MPOA 1TKWB 3CD6A 1PDXA 2NBVB 3C8YA 3Q8AA 1V81A 2A74C 2A6ED 4NXNQ 1Q8IA 4RFBA 1UWMA 3SK4A 2E3TA 3PVLA 2F0QA 4DAPA 4US9A 4MZ9A 1WF9A 1HTOA 4DV6L 1QZEA 2VZKD 4PYUA 2N88A 1XNQL 4W9FA 5M5YH 2CHWA 4FJZA 5T8IA 3AE3B 1YZ6A 2O5IC 5TSSA 3U50C 1HHVA 1RD9D 4P1BC 4BBRH 1WMHA 3B08A 1BKBA 4KY5A 1VQNA 4F7ZA 2E75C 4AYBB 4HIOA 4MSMB 3I4OA 4CHTB 5IKCM 4YWLA 1XCTL 2KACA 1XX8A 3DXJC 5IGCA 4FHJA 4LMQD 2HTHA 3I3TB 2WINB 4HN7A 2XEWA 5E6PA 1NE3A 4C3JB 1VRAB 2X8XX 2J7ZA 3HOZH 4QQBX 1MI0A 1V9PA 1WD0A 1XNRL 3KYHC 3HOVG 2OHFA 4KHPL 4IPDA 5IYBG 5BMIA 5JXVA 3ZUNA 4CKEA 1VF7A 2Z6BA 3KLWA 2RHQB 4DV1Q 3HOWH 3SFDB 3QB3A 1WRIA 2FXQA 5I6YA 2N4FA 1LT4D 5ELFA 3L16A 2X69A 1RDPD 1YI2A 2NCNA 4HXDA 5G5HA 2CQOA 3URYA 3DHQA 2B2VA 1F1HA 4A3KB 2K6QA 1QUQB 1WCMB 3I90A 5E3FA 1Y1WB 1CHQD 1RIPA 1CHPD 3A55A 3RNCC 2L0FA 4RAUC 4A3LG 4ZHPA 4DR2Q 5TR5A 1XXGA 4ZUJA 4GMVA 1IBLL 2VNUD 4OX9L 4BY7H 1CK1A 4L2YA 2ZCCA 3VR4A 3I4MH 1DM0B 3APFA 3CXCA 4K1RB 3W3AA 3C3LA 4LNNA 2QGQA 4HCEA 1FFUA 2BWES 1KNAA 1VZ6A 2BKRB 5IOIA 4KJOA 2I46A 2YU9B 1WSPA 2Q2UA 2JRHA 4NQKE 4BKSD 4TKNA 1OXTA 1RJTA 1LT3D 4JWUC 2INDC 3PUXA 2IX3A 2C9OA 2PNRC 1AFPA 2CR5A 2ICIA 3AE5B 4DDID 3JSVA 4GKKQ 4QY7A 2WQYB 3AEDB 2DJGC 3J81E 3CCSA 1TQOA 2I5MX 2MQHA 4DR5L 1SSNA 2DLBA 5D3IB 2L7RA 2LUMA 3ZJVA 3ZXVA 3FMCA 2LHDA 2KMCA 3FPPA 1OEYJ 2ICEC 1I4PA 1YN5A 2AMCB 1NJIC 4ABNA 5DPTA 1XYIA 3V6CB 4I6NB 4IOIE 4APVA 1TZOA 5CV7A 2MQJA 4DV4L 1SIJA 3Q8FA 1IBMQ 3GTQH 2K03A 3R66C 3J81i 1VQDA 3DWAA 2KVRA 1DOIA 1MJCA 1X3EA 1SRUA 4YIJA 2JA7G 2WB1G 1V1PA 2NBWB 4XDCA 3ZW3A 1BDOA 4WWPA 1H9SB 2H89B 2ZW0A 3Q8BA 1SE4A 3I7FA 5G3LD 4W9JA 5AUIA 1HNXQ 3EVQA 3U9OA 4NP5A 4A6QA 3K5OA 5EDSA 1K8GA 4Q5VA 3W2DA 3FILA 4BKSA 1NY4A 2B63G 3U4EG 4ARIA 3AULA 3AEVA 3RT3B 3NTKA 1ENCA 1KOTA 4OWTB 4MGKE 1XO3A 4JI5L 2Z59B 4A3EH 2IZVB 2NS5A 5HG2A 3KF8B 4PS7A 3RZDB 1LTAD 1IUEA 5ELDA 5C0XJ 1F9PA 4RCOA 1GXDC 4TUUA 5J17A 2JF5A 3F2CA 2ALYB 4RMFA 2GN5A 4MN3A 2FNJB 1S5BD 1HE8A 2IY0B 1EL0A 4L63B 5A2QL 2K52A 4KMUC 4DR1L 2GI9A 4L5QA 1A70A 5C2TB 4JI1L 5BYRA 4X66Q 3VDZA 3NELA 2A6HC 2KA7A 4DNRB 2O6VD 2PE6B 3N32A 1B3QA 4E74A 3MAQA 1VR9A 2JXMB 4WIPA 1X32A 3QARA 1Q10A 2NR2A 3M3YB 3MA2B 3P7JA 1S5DD 1VJKA 3GV3A 1UE6A 2JA7B 2R93H 3S1QH 1N6ZA 4N9TA 2A73B 2QDFA 3JAME 3M4QA 2D5DA 1GB4A 1SE2A 5LL6S 4A3FB 2NVXB 3F2DA 4RNAA 4YCUA 4M8AA 2RDGA 3RZWC 3A8JE 3RN5A 2MP2B 3IFTA 3SEBA 2ZPNA 2KJXA 4ICUA 1GPXA 3ULPA 5LMNW 1Q0WB 2F0HA 1KDAA 1V97A 1LABA 5GADC 2RBMA 5T1IA 1K8RB 4BVUC 5KNDA 1NVID 5LLIA 3KJOA 4JI8Q 3CHBD 1R7SA 4XWWA 1WX9A 2F0IA 2AQ1B 1E24A 2IDYA 2J42A 3HIZA 4DUYQ 1TVXA 4XDXA 4L5TA 3I9V1 4RGMA 1MJEA 4PG3A 1IL2A 2ZM6Q 4HJ9A 2JWUA 4QL5A 2O6VA 1OTCA 3I4NH 3N20C 2INCC 2EELA 4JL9A 3WCQA 3DOWA 1V86A 4FNFA 4YXDB 4DR3L 2RPVA 2IO0B 2PZUA 2F4VL 4XYQA 2NBUA 2K5NA 4DV5L 3SGIA 1XMQL 2L12A 4HDOA 3NS8A 2ZVNA 4RF1A 5IGFA 3HOUH 1HXYD 2WFWA 3A9KB 1VZ7A 1D1IA 3K5LA 4EFOA 5AEKB 2J0TD 4DHJB 3Q3NC 4NXML 2FHTA 3QOLA 4HAEA 5K36G 1CMXB 1PGAA 2JX5A 1KD1C 2N9PC 4ZLTF 4GLSC 1YVCA 5J22A 3U4ZA 2N9XA 2K05A 1WXAA 2KXJA 2NVTB 2FCSA 4NJ7A 3MEHA 3L08A 3S1NB 3GV6A 3TCAA 2WKDA 1V2YA 2BDOA 2K8CA 2WXJA 3CAMA 3GTMB 2LY7A 1OGWA 3RUIB 4DNIA 1YJJA 2K6DB 4A4IA 3KOJA 4DR4Q 4RF0A 1HTQA 1VQFA 1H9MA 1TWCH 4F7XA 3GTPH 4GKJL 1NI3A 2MJDA 2B8FA 1C4AA 1HR0W 2XBBC 1MD2D 4AQYQ 1BCPF 1BOSA 1FR3A 2NPTB 1KHIA 3PF5A 2DX5B 1TY0A 4QJFA 5CGKA 3A5ZB 2Q2HA 4V190 2ZTEA 5DAUA 4LUZA 1WZ3A 3KYDD 1C3TA 4W9CA 2UXCQ 1QJOA 1SYCA 1EUJA 4NXNL 4LFAL 2RQXA 2Z9HA 1VQLA 5BN5A 3BZCA 4UP7A 2A1AA 1PTOB 3P4RB 4GGQA 3GP7A 1CA6A 1XMOQ 4R8IA 3A9JB 4EGVA 2SEBD 3DHGC 1C9FA 3GTOB 1UGMA 5EKKA 2AHOB 2SDFA 2V4DA 1NMFA 5D65A 1VQKA 5JEAG 4TV3A 3H0GH 3O13A 2Y5BB 1GVPA 3FVQA 2F1MA 2CHBD 3N52A 2ZT9C 4DPGA 5FLXc 4DV7L 1JW9D 3HP3A 3HZXA 1WYGA 2BH8A 4QCLA 3P4SB 1E8ZA 1MHWC 2G3QB 3T1HQ 1HEZE 4BBSH 1WE7A 3S2HB 5FR3A 3Q3OC 4A3BG 1RKNA 3S1MB 4YSYB 4HMIA 4CO7A 1QKZA 2Z0DB 4WFN3 3HOYH 4NMZA 1SEBD 2L76A 3AQQA 4FJYA 2KENA 4EE2A 1M94A 3E9HA 3L10B 3H0GG 2MFIA 4A3PA 1QZHA 4LNQA 4R9WA 4DV1L 1I7HA 3LB8C 3QAQA 1PFBA 4NJ6A 3UF8A 1WTRA 4BA1I 1F9RA 2W9NA 5FLXL 2E2IB 5IT9E 1ZXIA 1EM7A 3AB9A 3M4OH 1YNJC 3T1YQ 1SN8A 1YIJA 1PFSA 2AWTA 1FEHA 2DN8A 3QJZA 1KTKA 3PO2H 1TBEA 4JBJA 4A3CG 3QHTA 2A6EC 1BXTA 2B2VC 1X55A 2EOTA 5EBCA 1DXMA 1AZPA 4MNOA 2HDMA 1F9QA 2WXIA 3Q3JA 3BZDB 3HVZA 2JN4A 3ETRA 3HEJA 4HJ5A 2F52A 1ZPSA 3BG3A 3HG9A 5FJ8H 2CU1A 2DAJA 3IKJA 1UBQA 1UZXB 2LRUA 4TQ1A 1WR1A 1GB1A 1PH9A 4X3KA 5A35A 3H91A 3H3VC 4OZAA 4F87A 3DVNV 2IYDB 2JA8B 4KIKA 2K9XA 3OJ3A 5JOBA 3OWEB 4FDBA 4FVMA 2V4LA 1MPEA 2IGDA 4JPSA 4LF9Q 3M4PA 1TWAB 5ELBA 2LRWA 5C44H 5M5XH 4CGYB 2VUMH 2Y0SE 2CKZB 4B9XA 3P4PB 2HD5B 1EY6A 3L17A 2JA5B 3BY4B 3NY5A 4K7WA 2FCNA 2YTYA 1DZ1A 1IW7D 3U2SC 2RF4A 2NN6G 2V0GA 3TQYA 3J80c 1G51A 5HGQA 3OAWA 1X54A 4YL8A 1UE5A 1LTLA 3KUPA 3PPAA 5KYLA 4M0WB 3ND8A 1T9HA 4NB3A 3G6EA 1KJTA 3GE3C 1E7PB 2FMMA 2B2TC 1PVOA 4C2MH 4QB4A 2OWOA 2CJNA 2BE5D 1TR5A 2Z4HA 3ICEA 3QX1A 4MEMA 3RZOH 4A3DB 1I4RA 1F2RC 3EFUA 1B53A 1YMHE 2KVMA 2ZXPA 4ZRKA 3GTLB 1CKNA 4IJLA 3J80L 2JXXA 3NK9A 4JGHB 2Z8LA 2LGYA 1IHZA 2MO1A 2WP8J 4BXXH 5JJIA 3C0RB 1AEXA 4ILWA 3GB1A 4XX5A 3UQAA 3PIOA 3DBSA 2BVCA 5M3FB 4DA2A 5L95C 2B2UC 4LFBL 1TWHH 3HFZB 1XNQQ 1X3QA 2K4KA 4B95A 2IY1B 2XNAC 3ZQ4A 5LXIB 1X3FA 3EHVA 2HCCA 1WE6A 1SE3A 3W1BA 1I50B 3S24A 5IYDH 1CZWA 5H1SE 1N8RC 1J9OA 2PZTA 1UELA 1STEA 1KRTA 2Y3AA 4LCDE 3TL5A 2WU5B 1X65A 1YNTE 4A3MH 3D4DA 4HSVA 4C7ZA 1K51A 2H88B 1WTXA 1RTOA 2BBCA 1DOLA 3KYCD 3SK8A 1P7FA 2K0PA 3PMFA 1GUNA 4DAYB 1D7QA 2QDBA 3TBLD 2NWGA 5JJZA 3L7ZC 1M90C 1XNRQ 1YQBA 3R2TA 3ZRFA 4R1JA 4LJZC 4KHPQ 1HA5A 2K04A 1IYVA 3F8TA 4J1MA 5KYIA 1JOKA 1Q5WB 1SIFA 3S16B 3J9CA 4A3MG 2WX0A 1WD1A 1IBKL 3A8IE 1I6VC 5EPJA 4KGRA 3RN9C 3VTVA 1SXTA 4E3CA 1H95A 2ZVOA 2D0PA 2CKHB 3PRPB 1KFYB 1P16A 2D10A 4WORA 2KX3A 1KLUD 3M95A 3MXNB 2EYMA 2J0JA 1G2SA 3EJIA 3L3OC 1Z2MA 2HE7A 1E2ZA 3UIOB 2KHSA 4K7UA 3GTKH 1UF0A 1C48A 1JRUA 1HFGA 1HQRD 3QR8A 1BCPD 2JWZA 5IGBA 1IBLQ 4OX9Q 1SNMA 1D8LA 3NHHA 4LDTD 4W9DA 2F0NA 2FE8A 4OXPA 1VQ8A 1OXUA 3E0JA 2N0SB 2CW0D 3PHWB 3VTUA 1E8XA 4IM2A 1MIUA 1Y1VH 1DOYA 1AZQA 1ZDVA 2M17A 3B0AA 4IKGA 4HIDA 1VQ6A 2HD3A 2VB2X 1J7CA 3ZNGC 2DY8A 4DR7L 5HHDG 4J15A 2KCTA 4NQLB 2PW7A 4AS1A 4MDKE 2O4XA 1UH6A 2GA4B 2IX1A 3U7ZA 4URKA 2NZOA 1XJVA 1YIWA 1SYGA 2B29A 3AE1B 2EJGC 1JQ4A 3VTWA 4PZ6A 1Y1VG 2LSSA 3AM9A 4HPPA 3J7AV 1VCBA 5ELNA 1LTTD 5JJLA
chains in the Genus database with same CATH topology
1EU3A 1JWMD 3PUZA 1XTCD 1TWFB 5C4HA 4K2LA 1E0BA 4XWTA 1KABA 3IFDA 3J7AF 1AWDA 3EUB2 3N6RA 4GDLB 2F0TA 5FKAC 4JE3B 2N9KA 1O7LA 1LT5D 1LO5D 3LYYA 5CMDA 3T51B 3AH7A 2NN6I 1GUGA 1T5XD 4F8MA 4OO1G 1VZ8A 2G1EA 5EGTA 2L4NA 2K1BA 2A68D 3NQIA 2PW9A 4PMBA 2F0VA 4KX6B 2NTSA 3DMUA 4A9AA 2LHEA 1GHJA 2B39A 3FC4A 1B1ZA 3Q0AA 1XLQA 3LXFA 3QG1A 1M4VA 4REZA 4A3GB 3K6OA 3KLSX 3NRZA 4DGZA 1VLBA 5EJWA 3E9SA 3JAML 2FINB 4GZYC 4EQOA 3QOJA 2WACA 4C3HG 2R92B 2BW2A 2WDRB 4C1NK 3P20A 3IT4B 1QB5D 4YTPB 4IFDG 2WU2B 4ZRPA 1DOKA 2L9HA 2EVBA 3C1EA 4J6HA 1P7EA 4OIJA 3L9AX 2IWHA 1PLFA 2MUYA 1SBBB 2WXKA 3SFEB 1CQFA 2SNMA 3W5UB 3OPOA 1B3AA 4OZCA 4TQ0A 4CBVA 3AE9B 4YTMB 2QIEB 2W3SA 4NJCA 4Y7NB 1L0VB 3T16A 2DBYA 3AE6B 2HTME 1PZID 1SYBA 1TS3A 3T3OA 3CRLC 3KBGA 3OW7A 2K7VA 2N7JA 3T3NA 3ABVB 1SYFA 1ZYRD 1PFNA 2DYMA 2QILA 4C3HB 4KD3A 1GOZA 1LV9A 3SK6A 5KNBA 1FCCC 2EPBA 2RSOA 4V0BA 2V3NA 3FDTA 4YSXB 2LMCA 1EZ8A 4GDKB 1DJRD 4B0EA 2JSOA 3IAYA 3TZUA 1C76A 2JYEA 1QOAA 4C3JG 3PIO3 2BOSA 2F0WA 1J7AA 1F2YA 1F2LA 3CRKC 1B4OA 2WLBA 1MHHE 1EQVA 5BN4A 1V43A 3HRZC 4ZUIA 2PMVA 3HGBA 1EFID 4RHRA 2Y0SB 1JE4A 4L8JA 4IALA 3CWIA 2WXPA 2BS2B 4ZK9B 2LFIA 4XDDA 3AMZA 3T56B 5IODA 1GJXA 2MJ8A 3OMCA 3HOXB 3P63A 4O42A 2E2HB 4BS9A 2HDLA 1PXUA 2MP1A 1LTRD 2MHVA 4MT5A 1F0ZA 2VZKB 5C3EB 1IW7C 2NB0A 3AEEB 1IGCA 2MJEA 1I6HB 4MM3B 2A5HA 4D2KA 1XWEA 1N61A 2SAKA 1S5CD 3T13A 1FNWA 3VR9B 3QIAA 2WV6D 4Q2JA 3NE5B 4HKQA 1YN3A 3EQLC 2B2YC 4IFDI 5CV8A 5E1FA 1I4HA 4KKTA 1D5XC 4FXCA 1FD6A 3S17B 3WOEA 1JALA 3HUIA 1QWYA 3I8ZA 2XSCA 3PUVA 3EROA 1L4DB 5C3XA 1CZGA 3WDNA 2JU6X 1CT1D 3MHBA 1HFNA 3PO0A 2AQ3B 2WP9B 2BB6A 2RSNA 1A3VA 4TQUS 4O1NA 2M2LA 4RWSC 3SR6A 1ZEQX 4JBWA 4WRDA 1PTOF 1WWTA 4EQNA 3IXSA 4ZKCB 4KY7A 4US8A 4QMGA 1STYA 1NYQA 1ESFA 3N9YC 1QE6A 3AU7A 1MGSA 2WXRA 2R6GA 1NR2A 2EDGA 1A3UA 1L0YB 1TKGA 1C4QA 1MSHA 1SJHD 2EYOA 2PVGC 3ZGZA 2E2DC 4HEDA 4B9WA 3NTHA 2K01A 1D6EC 5I9OA 1BF4A 1KH0A 1KLGD 4K8IA 4CJ2C 4H0LC 1EEFD 2CW0C 5M3MB 2RDFA 3NS1A 2PW5A 3TDQA 1EY5A 1ZOYB 3V05A 5EPLA 4KI0A 2F4IA 1QOGA 2KDMA 1Z7TA 1SDFA 1FNVA 1QNUA 5JVG3 4K5VA 3RMHA 1C77A 1VDVA 2KMMA 4NW2A 3Q22A 1CQVA 3RLFA 4IUPA 1O7ZA 3M7GA 2Q5WD 5I4DA 2WXLA 1S4ZA 2Q8IB 4KK7A 2MEKA 1IYUA 3KLRA 1JMLA 2F0SA 1D4BA 1IKLA 2E76C 4G4KA 4OGQC 2JEAI 1JWUD 2WAQB 2L32A 3VR8B 4EQPA 3VR3A 1PYWD 3KF8A 1EQTA 4KHZA 3TEXA 5JPNC 1PTOH 2F03A 4JK1C 2KWDA 2L52A 1JC7A 4KKSA 2EXZA 1XF5L 2INPE 1J7BA 3F2UA 4PV1C 1F9SA 4YT0B 4HTHA 5I9PA 4WJWA 5C5LA 5K36H 2F3WA 5HI1A 3SK5A 3BVZA 4YSZB 3R8BA 1QILA 2L83A 2K5PA 5JPMC 1BBXC 4XQNA 2PYKA 5EE3A 4K5XA 1WVLA 1AN8A 4DN4M 3MJ5A 2A69D 2N55A 4X3TA 3LX0A 1HQMC 2R61A 2FUG1 1L6UA 4PQXA 1N5XA 1DGJA 4A8XC 2B2WA 1ONLA 1L5PA 3EGRA 1IBXB 2WDQB 2JZPA 1K53A 2L55A 2W55A 4K14A 1IGDA 1TWGB 1ENAA 4H44C 2DWQA 3K5NA 4OHJA 2RA4A 1G91A 2WIIB 5DEHA 3VR5A 4P6VF 2ID0A 3V2TA 5BYSA 5HURA 2JEBI 2L1BA 4FF1A 5JEAH 3PV0A 5JVH3 2E74C 3S1QB 3TP7A 1ENFA 3AB5A 3RFZB 2EJMA 3OOCA 3DEPA 1H9JA 1JRPA 4OIKA 4RCNA 4KN7C 1M8AA 1SJED 5CC4A 5DM63 1FYCA 2BYTA 2IPKD 1U9RA 2LJIA 2H1EA 3E6ZX 4QUFA 2BB5A 2JE6I 2LKVA 3IAS1 3D3RA 3PZ8A 1ILPA 1SYEA 4ZAIA 1ML0D 5BMHA 2X6GA 1KDBA 1EU4A 2QMTA 4IUQA 3I4NB 1JWBD 4K8JA 3I70A 3L4PA 1JQYD 1FNUA 1C4CA 3NP8A 4K6DA 2D2CC 5I6WA 1RCVD 3R2IA 3HOUB 3W9CB 1HUNA 3OSOA 4R3DA 4QF4A 2IL8A 4XE0A 2BA1A 4H7BA 4ULLA 1RFKA 1NEKB 1PDQA 2I2YA 3MZ5A 1PRTF 4EVOA 4KKUA 1CFMA 1H9RA 4IURA 3AE8B 3DWQA 4MHEA 5FO8B 1JCKB 3ND9A 5CV9A 2KN4A 3MHZA 2NN6H 1PFDA 5AUKA 3RD4A 4DF7A 1SNCA 1EWYC 2WDVB 3BYYB 2F0MA 5KGUA 4DK1A 2ON8A 3TEYA 2F0JA 1FCLA 5CORA 1WXQA 1EY7A 4P16A 4I7ZC 1VF5C 1F2MA 1KDCA 2FBWB 5C5MA 3MWYW 4FYDA 3MXPA 3TEWA 1TY2A 4H13C 1QLBB 3H8HA 2HQEA 3M7NA 1TT2A 1ZXTA 5FO7B 1R4QB 1UAPA 3VQIA 5AFWA 1LTSD 2PPBC 1FGBD 1PZJD 2EY2A 1STAA 2N9LA 1WGKA 2KAJA 3HVDA 1G8ZD 1QQRA 1FMAD 3S15B 4BBSB 3P1MA 2KQ3A 3EFXD 3DUZA 1WTOA 5J39A 1S5FD 5LNK1 1B2TA 4JX1C 3EA6A 3SXHA 5LL6X 3NWSA 4G7HC 2ZW1A 3IT6B 2XN9C 1BQQT 2WXQA 3K5MA 4A3JB 2QCPX 4MIUA 2WXNA 3AEFB 5ISRA 1EY0A 3D31A 2IT1A 2KUMA 2F0OA 3M4YA 1EYCA 1Y69U 3NVZA 5M5WB 2J4XA 1PGBA 4RGNA 3UI3A 4XT3B 1FIQA 1R4PB 4C3IG 1O7YA 3AE2B 3PUWA 4QIWB 2NUCA 3VYSA 3PIP3 2K32A 1RYJA 3RPFC 5JAVA 2KCNA 3SHLA 3J81L 3K57A 1HZ5A 2RKSA 2BS4B 2V4IB 3T53B 4G7ZC 2EYLA 3H09A 4C1NI 2KCCA 4DAYA 4IUUA 2MGSA 3CU7A 3DEOA 4Q0FA 2EKIA 1LTID 5T1GA 4NAWB 3I72A 1WTVA 2YEPB 3TN2A 2PTLA 1GUTA 2X6LA 2G9DA 3MXNA 4A93B 3OIQA 3DWPA 3GO5A 3Q24A 1ET6A 3X3MA 1PUTA 1O78A 2NYZD 3GQBA 4IQZA 4C3IB 4B0MA 1HTLD 1TWHB 3KLSA 4OO1H 1BNZA 1OXXK 5C0XH 2EY1A 4X3SA 4DXFA 1KRHA 1CM9A 3MTSA 5GXGB 1H9KA 5C4XB 1GUWA 2W82A 1SNQA 4L1BA 1K8OA 3AEBB 5H8YE 4CKCA 5C0XG 1I4GA 4BY1B 3ITPA 1CI3M 1MVKA 1PRTD 1EY9A 3D6CA 4NKLA 3AE4B 1TS2A 1OXVA 4IFDH 3NBIA 3HKZB 1Z47A 4C56C 2IX0A 5BYQA 2M0AA 4PNYA 1UNSA 5CR3A 1PMRA 1TJEA 1A2UA 1QOHA 1Y8PB 3ZJUA 3VR2A 3FEWX 1Y8NB 4RH6A 1QG7A 2F3VA 2K5WA 2Q8TA 1F77A 2R3ZA 3HRDD 2X38A 4P2CB 3CKIB 5EKLA 3I91A 2BTEA 3C1FA 1MHXA 5JEAJ 1RWSA 2AX5A 2ONQA 1FRRA 3TSSA 3GD7A 2M19A 5CBAE 1GUSA 2JP1A 1EY8A 1KAAA 1N62A 3GTGB 3NXWA 4ZOHC 4KGTA 5I2YA 4DU9A 1PZKD 2XRSD 4RKLA 1W6KA 2M00A 1E2VA 2F0EA 2FMCA 3LWUA 3NWTA 2W54A 4PMWA 2XRQD 4K6LA 2K5QA 1N5WA 2EY5A 5NUCA 2KQ4X 1STNA 2F0UA 1STGA 1OFFA 4OW0A 2IW3A 2CJOA 2DNEA 2XWBB 5FLXE 3K7AB 3KQ4A 1RHPA 3S14B 3K0YA 1ROEA 1L4ZB 3BIID 2JXTA 4C80A 1DCZA 5IOCA 3I73A 3E5SA 1XLPA 5FOBB 1PGXA 3OHXC 3W5VB 3FKIB 2OEOA 2LS01 2I07B 3BVGA 1VDZA 4KKIA 1YNND 4FF4A 4HSPA 1FO4A 5EPKA 1SNOA 5CV6A 4L6TB 1NUCA 2Z4IA 2AWNA 1A3TA 4XYOA 1V8CA 5C4JB 3X3NA 3BS1A 1DONA 3FAHA 4U68A 1JWAD 2LEKA 1YJIA 1I4QA 2WXMA 2EZVA 2CU3A 1Y8OB 1G2TA 2JQRB 1NR4A 4A3IB 2I38A 1T6BX 4OO1I 2D62A 3I4LA 1MSGA 2RVLA 1YNJD 5IGGA 2JYTA 5C0XI 1TS4A 4ZHOA 1Q1EA 1ZKOA 2F0GA 2V3PA 2EYFA 3BWUD 3NUHB 1UUPA 4N58A 4ARCA 2QF7A 2CQAA 1UWXA 4B08A 2SOBA 1FM0D 2R7ZB 2TMPA 5IT9L 3D4WA 1QOBA 3V96A 3S1RB 3I57A 4FXGC 4NZLB 3J80E 4USAA 1CZPA 3AECB 2F0FA 2O5JC 2YYZA 3SVMA 2BE5C 4N6EB 1ACCA 1K8MA 1OQQA 2IJ0A 4PT5A 2J53A 1AP0A 1STHA 1Q90A 1E9MA 2HUGA 4IUVA 5J1ZA 1QT9A 2WXOA 2F0KA 1EOTA 2JA6B 2OF1A 1EYAA 1K83B 4X3UA 1HTPA 5CYUA 1GHKA 1FXIA 4H2AA 1A15A 1YQ4B 1WTQA 3ERQA 3R3OA 1V1PB 3ZJTA 2AWOA 3OWFA 3DWMA 2NVQB 3SDZA 3FILB 1RODA 2AQ2B 1JORA 3AV8A 5E6JA 3KWVA 4ZRQA 1WTWA 2WXGA 1NAPA 3PZ7A 3LNNA 3V3XA 1C79A 2K33A 5EKIA 5M5YB 3KK7A 4KHVA 4TKOB 3MFYA 4HEA1 4WWMA 2MPMA 4FF2A 1LACA 4BBRB 3HOVB 1BCPC 4HCSA 5CV4A 1JROA 1QCBD 3K58A 2B2TA 3NUCA 1F2ZA 2GRIA 4N9PA 2WKCA 3MVVA 1L6VA 5CBEE 4XIGS 3HOZB 3MXUA 1EY4A 5FK9C 4R8NA 2Y5PA 1C8CA 2AUJD 3HOWB 2B2UA 1FFVA 1HRJA 1LLRD 3R93A 2K6AA 3VRAB 2H4OA 1EIGA 1I4XA 3KWLA 3NQTA 2TSSA 3E56A 1JOQA 1U4LA 1NCVA 1IL8A 3B9JA 4BY7B 1H9SA 1STBA 3I4MB 1ICWA 4DXGA 2FFKB 1MBYA 1Q3LA 1SYDA 5DNFA 4RA8A 1F2RI 3TZDA 5E4XA 1R9TB 3PUYA 1V8QA 4WURA 2ENBA 4XQQA 1N60A 1XLOA 4FO2A 1K52A 1HZ6A 2QJLA 4ZYSA 1ET9A 1SMYD 5D7GA 5COYA 2A68C 2L0CA 5EE0A 1YQ3B 2WB1B 2KECA 4IFDJ 4ITKA 2QEJC 4KJNA 1YN4A 1PRTC 4YWGG 2K22A 3BDLA 2EYJA 1II3A 1G6ZA 2WNMA 2B63B 2PMZB 3GTQB 2SNSA 1B44D 3QJYA 2DY7A 1B9RA 1EEID 2IGHA 2BDNA 1K50A 5H92C 1EWCA 2NZ1D 1SAPA 4PMCA 3IAM1 3AEGB 1XCQL 4HMJA 3Q8EA 3VYTA 2MH7A 1FRDA 2D5GA 3Q8CA 4J3OD 3VYUA 4A3EB 4BWGB 4JWSC 3W1SA 1BR9A 1UGJA 3Q23A 2E6XA 1RF2D 1N63A 3D6WA 3P75A 3C2PA 4CJ0B 1ESRA 5BN3A 1MI2A 5HGTA 1TKEA 3C46A 2F0PA 3Q6SA 4KD4A 3NBHA 3ONAB 1J8IA 2WS3B 4TMAB 2BT6A 5IGDA 3TEZA 1Y56A 4CKBA 3HS0C 1E10A 1DYQA 4LTUA 4RGTA 2QSDA 1BMLC 2BA0A 2R93B 5C4ZA 3H6MA 3U52E 4UDUC 1SB3C 1PTOD 3FRPB 1ZYRC 5EBDA 1JWSD 4HR7B 2PO4A 3GTJB 4DFAA 4LLGM 4NDXA 5HFYA 3NSWA 1T3QA 2VXWA 1IBXA 2CVRA 3ZYYX 4ZKBB 2GB1A 3A8KE 2KEEA 3A7LA 5KNCA 1EYDA 4DK0A 3G7LA 2YEPF 3H94A 1QOFA 1RM6C 4S3SA 2IGGA 2OXPA 1O80A 1YNNC 5EE9A 4HROA 5K5PA 1C78A 3LWEA 4LK0M 2L1AA 4KV6A 1ZE3D 1VMCA 2DYOA 2EYPA 2L11A 5G5GA 1V1OA 2NTTA 3NTIA 2M9VA 1U4RA 1T5EA 4XTCS 1PFMA 1GUOA 3U9SA 4C7YA 4IZ8A 1ZP0B 1BO0A 2QKIC 3A54A 2INNE 1AYFA 1SSOA 1ZUD2 4ID6A 4TSSA 4DQOC 1TWCB 3GTPB 1HUMA 4XT1B 1EWHA 4J8QA 3D8GA 5IGEA 1FD7D 2XWJB 5D14A 1U4MA 1UEAB 4ZQ3A 2LFNA 4N59A 4FP5D 1S5ED 2EY6A 2K28A 3QO2A 3MXGA 5KEEA 3NZ3A 3BVMA 4IUNA 4KY6A 3DM1A 1CJEA 1TS5A 4A3BB 2PLPA 3IL8A 1JICA 1BUVT 1ZXHA 1VMPA 2NBFA 3KBXA 1HPCA 4CJ1B 1D5MC 3H0GB 3B2GA 1LTBD 2AUKA 4KKJA 3NVYA 1RTNA 4K2KA 3HOYB 2WXHA 4WQMA 1Q1BA 2NMQA 4BA2I 2C5CA 1GAQB 2OT2A 5I2XA 1ILQA 1TYGB 2PCFB 3BDOA 3TMEA 2WXFA 1HCZA 3M4OB 1X3PA 5DM73 4ZRZA 1DOXA 4M0WA 3OIPA 5D3DA 4OZBA 1TIID 3PO2B 1B9MA 4XQJA 3VYRA 3MP9A 2HDEA 2B8GA 4ME5A 2FJ2A 5C3WA 1LTGD 2LGIA 2F0LA 3VA5A 1E6EB 4DNTB 3SR1A 2O2LD 4FXDA 5C3JB 5ELCA 1NYRA 2BS3B 4OVZA 1BUIC 4HJGE 3MFGA 3GS2A 4CQNA 2B2YA 5A2QE 3CIRB 5C44B 1Q12A 4ODGA 5M5XB 5KRUA 2VUMB 2ZXOA 1XLNA 1CA5A 1E0ZA 4TRDA 2XIWA 1KF6B 3AE7B 1Z6HA 1CTMA 2Z1CA 5EQ0A 4HKZE 3I3CA 3QWNA 1BCPB 4M1UB 1JB3A 2PZWA 5KIXA 4C2MB 3NVVA 3UI2A 4I65A 5FO9B 2EJFC 3S9WA 3TP5A 3RZOB 3NVWA 5C6AA 4K5WA 1IKMA 3P4QB 1NSNS 3TP6A 2K5DA 3VRBB 1WTPA 4G7OC 4IDIA 5BMGA 2HCIA 4DAVA 1VCIA 1G291 2EYHA 2Q8RE 1JR0D 2MJ3A 2L5TA 4FXKC 3MC0B 4XXEA 1SNDA 2NVYB 3M85A 2B2WC 4A55A 2PVOD 4RGOS 1SMYC 2A6HD 2DNCA 4A3MB 3FPUB 1DOMA 4RKBA 1D2BA 4L23A 4IN3A 4LAAA 3J7YW 2KEDA 2ZXRA 4MH8A 3AMUA 3G6JB 1OXSC 4E6IA 3TBIB 1LT6D 1AW7A 5E4WC 2ACZB 5CV5A 1TKYA 3GTKB 2A69C 2F0DA 3WOFA 2EE1A 1EIHA 4IUTA 1PRTB 4AQ7A 4FF3A 2PQEA 2W3RA 4UAIA 3VA7A 5LHY1 2G9HD 1B50A 4HRSA 2K3UA 1DD2A 1OQRA 1Y1VB 4LK1C 3K59A 2Y5CA 3AEAB 1FXAA 1QF6A 4MACA 1SNPA 4F88A 3D4RA 3BK1A 2JSVX 4WH4A 1I3QB 1JOOA 2LMCB 3AN1A 2PKOA 1PTOC 4U673 3P42A 1W6JA 4KN4C 5G3LF 4WAFA 3BYTB 3A56A 1C4PA 2D9UA 1E2WA 4QUCA 1ZDXA 3A7AB 1A6XA 2VB3X 2B76B 1SF0A 1QNKA 5ELEA 3PO3B 2M56B 1SFOB 3VR6A 4KTAA 1U4PA 3BK2A 1NENB 1HA6A 2RDHA 4A90A 1XEEA 2XVSA 3S2DB 1D5ZC 2OEDA 3SE0A 3TUOA 3TP8A 3Q69A 4RHSA 2PIAA 1KNEA 2E2JB 1OO9B 3B2FA 4YTNB 2KOLA 5F2DA 3DWGC 3RUZA 1A2TA 3NPPA 4G57A 1TU2B 2J52A 4NAMA 3OMGA 3P1HA 1B9NA 4KGSA 5IIFA 1L0XB 1D1KA 3BDCA 4OL7A 5M9OA 3T4AC 3CQZB 4Z9CB 5EE1A 1EZ6A 2JYOA 2BCOA 2RMMA 5MPOA 1TKWB 1PDXA 3Q8AA 3C8YA 2A74C 2A6ED 1Q8IA 4RFBA 1UWMA 3SK4A 2E3TA 2F0QA 4DAPA 4US9A 2VZKD 2N88A 5T8IA 3AE3B 2O5IC 5TSSA 1HHVA 1RD9D 4KY5A 2E75C 4AYBB 4CHTB 1XCTL 2KACA 1XX8A 3DXJC 5IGCA 4LMQD 2WINB 4HN7A 4C3JB 1VRAB 2J7ZA 1MI0A 1WD0A 2OHFA 5BMIA 5JXVA 4CKEA 1VF7A 3SFDB 3QB3A 1WRIA 5I6YA 1LT4D 5ELFA 2X69A 1RDPD 5G5HA 3URYA 3DHQA 2B2VA 4A3KB 1WCMB 3I90A 5E3FA 1Y1WB 1CHQD 1CHPD 3A55A 4RAUC 4ZHPA 1XXGA 4ZUJA 2VNUD 1CK1A 4L2YA 3VR4A 1DM0B 3W3AA 3C3LA 4HCEA 1FFUA 1KNAA 1VZ6A 4KJOA 2I46A 2YU9B 1WSPA 1OXTA 1RJTA 1LT3D 4JWUC 3AE5B 3PUXA 2IX3A 2C9OA 2PNRC 1AFPA 2ICIA 3AEDB 2WQYB 3J81E 1TQOA 1SSNA 2DLBA 5D3IB 2LUMA 3ZJVA 3FMCA 2LHDA 3FPPA 2ICEC 1I4PA 1YN5A 4ABNA 1XYIA 4IOIE 1TZOA 5CV7A 1SIJA 3Q8FA 2K03A 3DWAA 1DOIA 4XDCA 4YIJA 1V1PA 1BDOA 1H9SB 2H89B 2ZW0A 3Q8BA 1SE4A 5AUIA 5G3LD 3EVQA 3U9OA 4NP5A 4A6QA 3K5OA 4Q5VA 3W2DA 3FILA 3U4EG 4ARIA 3NTKA 1ENCA 1XO3A 5HG2A 3RZDB 1LTAD 1IUEA 5ELDA 5C0XJ 1F9PA 4RCOA 1GXDC 4MN3A 1S5BD 1EL0A 4L63B 5A2QL 4KMUC 2GI9A 1A70A 5C2TB 5BYRA 2A6HC 2KA7A 4DNRB 3MAQA 1VR9A 2JXMB 4WIPA 1X32A 1Q10A 3M3YB 3MA2B 3P7JA 1S5DD 1VJKA 3GV3A 2JA7B 4N9TA 2A73B 3JAME 2D5DA 1GB4A 1SE2A 5LL6S 4A3FB 2NVXB 4RNAA 4M8AA 2RDGA 3A8JE 3IFTA 3SEBA 2KJXA 1GPXA 2F0HA 1KDAA 1V97A 1LABA 2RBMA 5T1IA 5KNDA 1NVID 3CHBD 1R7SA 4XWWA 2F0IA 2AQ1B 2IDYA 2J42A 1TVXA 4XDXA 3I9V1 4RGMA 2JWUA 2EELA 3WCQA 4FNFA 4YXDB 2RPVA 2PZUA 4XYQA 2L12A 4RF1A 5IGFA 1HXYD 1VZ7A 1D1IA 3K5LA 2J0TD 2FHTA 3QOLA 4HAEA 5K36G 1PGAA 2JX5A 4ZLTF 4GLSC 5J22A 2K05A 2NVTB 3MEHA 3S1NB 3GV6A 2WKDA 2BDOA 2WXJA 3GTMB 2LY7A 1YJJA 4RF0A 1H9MA 4F7XA 1NI3A 2MJDA 2B8FA 1C4AA 1MD2D 1BCPF 1BOSA 1FR3A 1TY0A 5CGKA 4V190 5DAUA 1QJOA 1SYCA 2RQXA 5BN5A 1PTOB 3P4RB 3GP7A 1CA6A 4R8IA 4EGVA 2SEBD 1C9FA 3GTOB 5EKKA 2SDFA 2V4DA 5D65A 5JEAG 3O13A 3FVQA 2F1MA 2CHBD 3N52A 2ZT9C 1JW9D 3HP3A 3HZXA 1WYGA 4QCLA 3P4SB 1HEZE 5FR3A 3S2HB 1RKNA 3S1MB 4YSYB 4HMIA 1QKZA 4WFN3 4NMZA 1SEBD 4EE2A 4R9WA 1I7HA 3LB8C 1PFBA 1WTRA 4BA1I 1F9RA 5FLXL 2E2IB 5IT9E 1ZXIA 1EM7A 3AB9A 1YNJC 1FEHA 2DN8A 1KTKA 2A6EC 1BXTA 2B2VC 2EOTA 5EBCA 1DXMA 1AZPA 2HDMA 1F9QA 2WXIA 3BZDB 3HVZA 3ETRA 3HEJA 1ZPSA 3BG3A 3HG9A 3IKJA 4TQ1A 1GB1A 4X3KA 5A35A 3H91A 3H3VC 4OZAA 4F87A 2JA8B 2K9XA 5JOBA 3OWEB 4FVMA 1MPEA 2IGDA 4JPSA 5ELBA 1TWAB 4CGYB 4B9XA 3P4PB 1EY6A 2JA5B 1DZ1A 1IW7D 3U2SC 2NN6G 2V0GA 3KUPA 5KYLA 3ND8A 1E7PB 2FMMA 2B2TC 4QB4A 2CJNA 2BE5D 1TR5A 2Z4HA 4A3DB 1I4RA 1F2RC 1B53A 1YMHE 2KVMA 2ZXPA 3GTLB 3J80L 3NK9A 2Z8LA 1IHZA 2WP8J 1AEXA 4ILWA 3GB1A 5M3FB 4DA2A 2B2UC 1X3QA 2XNAC 3ZQ4A 2HCCA 1SE3A 1I50B 1CZWA 1J9OA 2PZTA 2Y3AA 1STEA 2WU5B 1YNTE 3D4DA 4HSVA 4C7ZA 1K51A 2H88B 1WTXA 1RTOA 2BBCA 1DOLA 3SK8A 1P7FA 2K0PA