2QJ2A

A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
RNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 46
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2qj2A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2qj2A01
1KIVA 5CS9A 3HMTA 1YXEA 3U73A 4R1CA 4O03A 1Z40A 4BVVA 3MKPA 1NL2A 2LL4M 3HMRA 3SRIA 1PK2A 4BVDA 3KIVA 2X2ZA 2DOHX 1KRNA 2LL3A 2FD6A 3HN4A 4KIVA 5CS5A 4Z0DA 3BT1A 2J8LA 3ZWZA 4APMA 3BT2A 2HGFA 1I8NA 1URKA 4R19A 4A5TS 2KNFA 5CT3A 3K65A 3NXPA 2QJ4A 2PF1A 2FEBA 1W8KA 4IUAA 4BV7A 2F83A 2I9AA 1GMNA 4UV6A 4D3CA 1BHTA 4APLA 2DOIA 1JFNA 5EODA 5I25A 2L0SA 2J8JA 2HPQP 4Z0EA 1HPJA 3LAQA 1CEAA 2YILA 4R1AA 1TPKA 2QJ2A 2Q8BA 1B2IA 3HMSA 5CS3A 5COEA 1NK1A 2I9BA 1KI0A 4HZHA 1A0HA 4Z0FA 1CEBA 1PK4A 4R1BA 1GMOA 2PK4A 2YIPA 5CP9A 4DURA 1PKRA 5CT2A 5HPGA 5EOKA 2K13X 4BVWA 1NL1A 2K4RA 2Y8RA 5CS1A 1PMKA 2Z8WA 4Z09A 2Q8AA 4NZQA 2HPPP 2KJ4A 1HKYA 2YIOA 1HPKA 2SPTA 1W81A 2PF2A 3ZLEA 5CT1A 2K51A 3SP8A 4BV5A 5CSQA 1PMLA 4BVCA 2Z8VA 1I71A 4UAOA 3E6PL 1I5KA 3SRJA 4CIKA 1GP9A 1KDUA
chains in the Genus database with same CATH superfamily
1KIVA 5CS9A 3HMTA 1YXEA 3U73A 4R1CA 4O03A 1Z40A 4BVVA 3MKPA 1NL2A 2LL4M 3HMRA 3SRIA 1PK2A 4BVDA 3KIVA 2X2ZA 2DOHX 1KRNA 2LL3A 2FD6A 3HN4A 4KIVA 5CS5A 4Z0DA 3BT1A 2J8LA 3ZWZA 4APMA 3BT2A 2HGFA 1I8NA 1URKA 4R19A 4A5TS 4YIVA 2KNFA 5CT3A 3K65A 3NXPA 2QJ4A 2PF1A 2FEBA 1W8KA 4IUAA 4BV7A 2F83A 2I9AA 1GMNA 4UV6A 4YIZA 4D3CA 1BHTA 4APLA 2DOIA 1JFNA 5EODA 5I25A 2L0SA 2J8JA 2HPQP 4Z0EA 1HPJA 3LAQA 1CEAA 2YILA 4R1AA 1TPKA 2QJ2A 2Q8BA 1B2IA 3HMSA 5CS3A 5COEA 1NK1A 2I9BA 1KI0A 4HZHA 1A0HA 4Z0FA 1CEBA 1PK4A 4R1BA 1GMOA 2PK4A 2YIPA 5CP9A 4DURA 1PKRA 5CT2A 5HPGA 5EOKA 2K13X 4BVWA 1NL1A 2K4RA 2Y8RA 5CS1A 1PMKA 2Z8WA 4Z09A 2Q8AA 4NZQA 2HPPP 2KJ4A 1HKYA 2YIOA 1HPKA 2SPTA 1W81A 2PF2A 3ZLEA 5CT1A 2K51A 3SP8A 4BV5A 2KL5A 5CSQA 1PMLA 4BVCA 2Z8VA 1I71A 4UAOA 3E6PL 1I5KA 3SRJA 4CIKA 1GP9A 1KDUA
chains in the Genus database with same CATH topology
1KIVA 5CS9A 3HMTA 1YXEA 3U73A 4R1CA 4O03A 1Z40A 4BVVA 3MKPA 1NL2A 2LL4M 3HMRA 3SRIA 1PK2A 4BVDA 3KIVA 2X2ZA 2DOHX 1KRNA 2LL3A 2FD6A 3HN4A 4KIVA 5CS5A 4Z0DA 3BT1A 2J8LA 3ZWZA 4APMA 3BT2A 2HGFA 1I8NA 1URKA 4R19A 4A5TS 4YIVA 2KNFA 5CT3A 3K65A 3NXPA 2QJ4A 2PF1A 2FEBA 1W8KA 4IUAA 4BV7A 2F83A 2I9AA 1GMNA 4UV6A 4YIZA 4D3CA 1BHTA 4APLA 2DOIA 1JFNA 5EODA 5I25A 2L0SA 2J8JA 2HPQP 4Z0EA 1HPJA 3LAQA 1CEAA 2YILA 4R1AA 1TPKA 2QJ2A 2Q8BA 1B2IA 3HMSA 5CS3A 5COEA 1NK1A 2I9BA 1KI0A 4HZHA 1A0HA 4Z0FA 1CEBA 1PK4A 4R1BA 1GMOA 2PK4A 2YIPA 5CP9A 4DURA 1PKRA 5CT2A 5HPGA 5EOKA 2K13X 4BVWA 1NL1A 2K4RA 2Y8RA 5CS1A 1PMKA 2Z8WA 4Z09A 2Q8AA 4NZQA 2HPPP 2KJ4A 1HKYA 2YIOA 1HPKA 2SPTA 1W81A 2PF2A 3ZLEA 5CT1A 2K51A 3SP8A 4BV5A 2KL5A 5CSQA 1PMLA 4BVCA 2Z8VA 1I71A 4UAOA 3E6PL 1I5KA 3SRJA 4CIKA 1GP9A 1KDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIV A;  5CS9 A;  3HMT A;  1YXE A;  3U73 A;  4R1C A;  4O03 A;  1Z40 A;  4BVV A;  3MKP A;  1NL2 A;  2LL4 M;  3HMR A;  3SRI A;  1PK2 A;  4BVD A;  3KIV A;  2X2Z A;  2DOH X;  1KRN A;  2LL3 A;  2FD6 A;  3HN4 A;  4KIV A;  5CS5 A;  4Z0D A;  3BT1 A;  2J8L A;  3ZWZ A;  4APM A;  3BT2 A;  2HGF A;  1I8N A;  1URK A;  4R19 A;  4A5T S;  2KNF A;  5CT3 A;  3K65 A;  3NXP A;  2QJ4 A;  2PF1 A;  2FEB A;  1W8K A;  4IUA A;  4BV7 A;  2F83 A;  2I9A A;  1GMN A;  4UV6 A;  4D3C A;  1BHT A;  4APL A;  2DOI A;  1JFN A;  5EOD A;  5I25 A;  2L0S A;  2J8J A;  2HPQ P;  4Z0E A;  1HPJ A;  3LAQ A;  1CEA A;  2YIL A;  4R1A A;  1TPK A;  2QJ2 A;  2Q8B A;  1B2I A;  3HMS A;  5CS3 A;  5COE A;  1NK1 A;  2I9B A;  1KI0 A;  4HZH A;  1A0H A;  4Z0F A;  1CEB A;  1PK4 A;  4R1B A;  1GMO A;  2PK4 A;  2YIP A;  5CP9 A;  4DUR A;  1PKR A;  5CT2 A;  5HPG A;  5EOK A;  2K13 X;  4BVW A;  1NL1 A;  2K4R A;  2Y8R A;  5CS1 A;  1PMK A;  2Z8W A;  4Z09 A;  2Q8A A;  4NZQ A;  2HPP P;  2KJ4 A;  1HKY A;  2YIO A;  1HPK A;  2SPT A;  1W81 A;  2PF2 A;  3ZLE A;  5CT1 A;  2K51 A;  3SP8 A;  4BV5 A;  5CSQ A;  1PML A;  4BVC A;  2Z8V A;  1I71 A;  4UAO A;  3E6P L;  1I5K A;  3SRJ A;  4CIK A;  1GP9 A;  1KDU A; 
#chains in the Genus database with same CATH topology
 1KIV A;  5CS9 A;  3HMT A;  1YXE A;  3U73 A;  4R1C A;  4O03 A;  1Z40 A;  4BVV A;  3MKP A;  1NL2 A;  2LL4 M;  3HMR A;  3SRI A;  1PK2 A;  4BVD A;  3KIV A;  2X2Z A;  2DOH X;  1KRN A;  2LL3 A;  2FD6 A;  3HN4 A;  4KIV A;  5CS5 A;  4Z0D A;  3BT1 A;  2J8L A;  3ZWZ A;  4APM A;  3BT2 A;  2HGF A;  1I8N A;  1URK A;  4R19 A;  4A5T S;  4YIV A;  2KNF A;  5CT3 A;  3K65 A;  3NXP A;  2QJ4 A;  2PF1 A;  2FEB A;  1W8K A;  4IUA A;  4BV7 A;  2F83 A;  2I9A A;  1GMN A;  4UV6 A;  4YIZ A;  4D3C A;  1BHT A;  4APL A;  2DOI A;  1JFN A;  5EOD A;  5I25 A;  2L0S A;  2J8J A;  2HPQ P;  4Z0E A;  1HPJ A;  3LAQ A;  1CEA A;  2YIL A;  4R1A A;  1TPK A;  2QJ2 A;  2Q8B A;  1B2I A;  3HMS A;  5CS3 A;  5COE A;  1NK1 A;  2I9B A;  1KI0 A;  4HZH A;  1A0H A;  4Z0F A;  1CEB A;  1PK4 A;  4R1B A;  1GMO A;  2PK4 A;  2YIP A;  5CP9 A;  4DUR A;  1PKR A;  5CT2 A;  5HPG A;  5EOK A;  2K13 X;  4BVW A;  1NL1 A;  2K4R A;  2Y8R A;  5CS1 A;  1PMK A;  2Z8W A;  4Z09 A;  2Q8A A;  4NZQ A;  2HPP P;  2KJ4 A;  1HKY A;  2YIO A;  1HPK A;  2SPT A;  1W81 A;  2PF2 A;  3ZLE A;  5CT1 A;  2K51 A;  3SP8 A;  4BV5 A;  2KL5 A;  5CSQ A;  1PML A;  4BVC A;  2Z8V A;  1I71 A;  4UAO A;  3E6P L;  1I5K A;  3SRJ A;  4CIK A;  1GP9 A;  1KDU A; 
#chains in the Genus database with same CATH homology
 1KIV A;  5CS9 A;  3HMT A;  1YXE A;  3U73 A;  4R1C A;  4O03 A;  1Z40 A;  4BVV A;  3MKP A;  1NL2 A;  2LL4 M;  3HMR A;  3SRI A;  1PK2 A;  4BVD A;  3KIV A;  2X2Z A;  2DOH X;  1KRN A;  2LL3 A;  2FD6 A;  3HN4 A;  4KIV A;  5CS5 A;  4Z0D A;  3BT1 A;  2J8L A;  3ZWZ A;  4APM A;  3BT2 A;  2HGF A;  1I8N A;  1URK A;  4R19 A;  4A5T S;  4YIV A;  2KNF A;  5CT3 A;  3K65 A;  3NXP A;  2QJ4 A;  2PF1 A;  2FEB A;  1W8K A;  4IUA A;  4BV7 A;  2F83 A;  2I9A A;  1GMN A;  4UV6 A;  4YIZ A;  4D3C A;  1BHT A;  4APL A;  2DOI A;  1JFN A;  5EOD A;  5I25 A;  2L0S A;  2J8J A;  2HPQ P;  4Z0E A;  1HPJ A;  3LAQ A;  1CEA A;  2YIL A;  4R1A A;  1TPK A;  2QJ2 A;  2Q8B A;  1B2I A;  3HMS A;  5CS3 A;  5COE A;  1NK1 A;  2I9B A;  1KI0 A;  4HZH A;  1A0H A;  4Z0F A;  1CEB A;  1PK4 A;  4R1B A;  1GMO A;  2PK4 A;  2YIP A;  5CP9 A;  4DUR A;  1PKR A;  5CT2 A;  5HPG A;  5EOK A;  2K13 X;  4BVW A;  1NL1 A;  2K4R A;  2Y8R A;  5CS1 A;  1PMK A;  2Z8W A;  4Z09 A;  2Q8A A;  4NZQ A;  2HPP P;  2KJ4 A;  1HKY A;  2YIO A;  1HPK A;  2SPT A;  1W81 A;  2PF2 A;  3ZLE A;  5CT1 A;  2K51 A;  3SP8 A;  4BV5 A;  2KL5 A;  5CSQ A;  1PML A;  4BVC A;  2Z8V A;  1I71 A;  4UAO A;  3E6P L;  1I5K A;  3SRJ A;  4CIK A;  1GP9 A;  1KDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...