2QJ4A

A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
b'TLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone
total genus 32
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2qj4A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2qj4A01
2PF1A 5HPGA 4NZQA 3HMSA 1PK4A 1CEBA 4Z0DA 1PK2A 3SP8A 2QJ4A 1CEAA 3U73A 1NL2A 2DOHX 4BVDA 3KIVA 4R1BA 1HKYA 1PKRA 2FD6A 2Q8BA 3BT2A 4APMA 4O03A 4R1AA 1I71A 1KIVA 1JFNA 5EODA 2QJ2A 2YIOA 4A5TS 5EOKA 4UV6A 2YILA 5CSQA 5I25A 1NL1A 3K65A 5CT1A 2K13X 2J8LA 2I9BA 4KIVA 2J8JA 1A0HA 1GMNA 2PF2A 4HZHA 1I5KA 1NK1A 4BVCA 1HPKA 2KNFA 3MKPA 1HPJA 2PK4A 4CIKA 2L0SA 3E6PL 2HPQP 5COEA 2K4RA 1TPKA 4UAOA 4DURA 2K51A 4APLA 1BHTA 3HN4A 5CP9A 1I8NA 1W81A 4BVWA 2FEBA 3HMRA 2SPTA 1KDUA 4BV5A 1PMKA 4Z09A 2F83A 1GP9A 2LL3A 5CS3A 2YIPA 2X2ZA 2HGFA 3SRJA 1GMOA 1Z40A 2HPPP 1KRNA 3NXPA 4IUAA 2LL4M 1URKA 1YXEA 3HMTA 1PMLA 4D3CA 1KI0A 3LAQA 5CS1A 2Y8RA 5CS5A 2Z8WA 2Z8VA 3ZLEA 5CT3A 3BT1A 3SRIA 2KJ4A 2DOIA 1W8KA 4R19A 4R1CA 3ZWZA 4Z0EA 4Z0FA 5CS9A 4BV7A 5CT2A 2I9AA 2Q8AA 4BVVA 1B2IA
chains in the Genus database with same CATH superfamily
2PF1A 5HPGA 4NZQA 3HMSA 1PK4A 1CEBA 4Z0DA 1PK2A 3SP8A 2QJ4A 1CEAA 3U73A 1NL2A 2DOHX 4BVDA 3KIVA 4R1BA 1HKYA 1PKRA 2FD6A 2Q8BA 3BT2A 4APMA 4O03A 4R1AA 1I71A 1KIVA 1JFNA 5EODA 2QJ2A 2YIOA 4A5TS 5EOKA 4UV6A 2YILA 5CSQA 5I25A 1NL1A 3K65A 5CT1A 2K13X 2J8LA 2I9BA 4KIVA 2J8JA 4YIZA 1A0HA 1GMNA 2PF2A 4HZHA 1I5KA 1NK1A 4BVCA 1HPKA 2KNFA 3MKPA 1HPJA 2PK4A 4CIKA 2L0SA 3E6PL 2HPQP 5COEA 2K4RA 1TPKA 4UAOA 4DURA 2K51A 4APLA 1BHTA 3HN4A 5CP9A 1I8NA 1W81A 4BVWA 2FEBA 3HMRA 2KL5A 2SPTA 1KDUA 4BV5A 1PMKA 4Z09A 2F83A 1GP9A 2LL3A 5CS3A 2YIPA 2X2ZA 2HGFA 3SRJA 1GMOA 1Z40A 2HPPP 1KRNA 3NXPA 4IUAA 2LL4M 1URKA 1YXEA 3HMTA 1PMLA 4D3CA 1KI0A 3LAQA 5CS1A 2Y8RA 5CS5A 2Z8WA 2Z8VA 3ZLEA 5CT3A 3BT1A 3SRIA 2KJ4A 2DOIA 4YIVA 1W8KA 4R19A 4R1CA 3ZWZA 4Z0EA 4Z0FA 5CS9A 4BV7A 5CT2A 2I9AA 2Q8AA 4BVVA 1B2IA
chains in the Genus database with same CATH topology
2PF1A 5HPGA 4NZQA 3HMSA 1PK4A 1CEBA 4Z0DA 1PK2A 3SP8A 2QJ4A 1CEAA 3U73A 1NL2A 2DOHX 4BVDA 3KIVA 4R1BA 1HKYA 1PKRA 2FD6A 2Q8BA 3BT2A 4APMA 4O03A 4R1AA 1I71A 1KIVA 1JFNA 5EODA 2QJ2A 2YIOA 4A5TS 5EOKA 4UV6A 2YILA 5CSQA 5I25A 1NL1A 3K65A 5CT1A 2K13X 2J8LA 2I9BA 4KIVA 2J8JA 4YIZA 1A0HA 1GMNA 2PF2A 4HZHA 1I5KA 1NK1A 4BVCA 1HPKA 2KNFA 3MKPA 1HPJA 2PK4A 4CIKA 2L0SA 3E6PL 2HPQP 5COEA 2K4RA 1TPKA 4UAOA 4DURA 2K51A 4APLA 1BHTA 3HN4A 5CP9A 1I8NA 1W81A 4BVWA 2FEBA 3HMRA 2KL5A 2SPTA 1KDUA 4BV5A 1PMKA 4Z09A 2F83A 1GP9A 2LL3A 5CS3A 2YIPA 2X2ZA 2HGFA 3SRJA 1GMOA 1Z40A 2HPPP 1KRNA 3NXPA 4IUAA 2LL4M 1URKA 1YXEA 3HMTA 1PMLA 4D3CA 1KI0A 3LAQA 5CS1A 2Y8RA 5CS5A 2Z8WA 2Z8VA 3ZLEA 5CT3A 3BT1A 3SRIA 2KJ4A 2DOIA 4YIVA 1W8KA 4R19A 4R1CA 3ZWZA 4Z0EA 4Z0FA 5CS9A 4BV7A 5CT2A 2I9AA 2Q8AA 4BVVA 1B2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PF1 A;  5HPG A;  4NZQ A;  3HMS A;  1PK4 A;  1CEB A;  4Z0D A;  1PK2 A;  3SP8 A;  2QJ4 A;  1CEA A;  3U73 A;  1NL2 A;  2DOH X;  4BVD A;  3KIV A;  4R1B A;  1HKY A;  1PKR A;  2FD6 A;  2Q8B A;  3BT2 A;  4APM A;  4O03 A;  4R1A A;  1I71 A;  1KIV A;  1JFN A;  5EOD A;  2QJ2 A;  2YIO A;  4A5T S;  5EOK A;  4UV6 A;  2YIL A;  5CSQ A;  5I25 A;  1NL1 A;  3K65 A;  5CT1 A;  2K13 X;  2J8L A;  2I9B A;  4KIV A;  2J8J A;  1A0H A;  1GMN A;  2PF2 A;  4HZH A;  1I5K A;  1NK1 A;  4BVC A;  1HPK A;  2KNF A;  3MKP A;  1HPJ A;  2PK4 A;  4CIK A;  2L0S A;  3E6P L;  2HPQ P;  5COE A;  2K4R A;  1TPK A;  4UAO A;  4DUR A;  2K51 A;  4APL A;  1BHT A;  3HN4 A;  5CP9 A;  1I8N A;  1W81 A;  4BVW A;  2FEB A;  3HMR A;  2SPT A;  1KDU A;  4BV5 A;  1PMK A;  4Z09 A;  2F83 A;  1GP9 A;  2LL3 A;  5CS3 A;  2YIP A;  2X2Z A;  2HGF A;  3SRJ A;  1GMO A;  1Z40 A;  2HPP P;  1KRN A;  3NXP A;  4IUA A;  2LL4 M;  1URK A;  1YXE A;  3HMT A;  1PML A;  4D3C A;  1KI0 A;  3LAQ A;  5CS1 A;  2Y8R A;  5CS5 A;  2Z8W A;  2Z8V A;  3ZLE A;  5CT3 A;  3BT1 A;  3SRI A;  2KJ4 A;  2DOI A;  1W8K A;  4R19 A;  4R1C A;  3ZWZ A;  4Z0E A;  4Z0F A;  5CS9 A;  4BV7 A;  5CT2 A;  2I9A A;  2Q8A A;  4BVV A;  1B2I A; 
#chains in the Genus database with same CATH topology
 2PF1 A;  5HPG A;  4NZQ A;  3HMS A;  1PK4 A;  1CEB A;  4Z0D A;  1PK2 A;  3SP8 A;  2QJ4 A;  1CEA A;  3U73 A;  1NL2 A;  2DOH X;  4BVD A;  3KIV A;  4R1B A;  1HKY A;  1PKR A;  2FD6 A;  2Q8B A;  3BT2 A;  4APM A;  4O03 A;  4R1A A;  1I71 A;  1KIV A;  1JFN A;  5EOD A;  2QJ2 A;  2YIO A;  4A5T S;  5EOK A;  4UV6 A;  2YIL A;  5CSQ A;  5I25 A;  1NL1 A;  3K65 A;  5CT1 A;  2K13 X;  2J8L A;  2I9B A;  4KIV A;  2J8J A;  4YIZ A;  1A0H A;  1GMN A;  2PF2 A;  4HZH A;  1I5K A;  1NK1 A;  4BVC A;  1HPK A;  2KNF A;  3MKP A;  1HPJ A;  2PK4 A;  4CIK A;  2L0S A;  3E6P L;  2HPQ P;  5COE A;  2K4R A;  1TPK A;  4UAO A;  4DUR A;  2K51 A;  4APL A;  1BHT A;  3HN4 A;  5CP9 A;  1I8N A;  1W81 A;  4BVW A;  2FEB A;  3HMR A;  2KL5 A;  2SPT A;  1KDU A;  4BV5 A;  1PMK A;  4Z09 A;  2F83 A;  1GP9 A;  2LL3 A;  5CS3 A;  2YIP A;  2X2Z A;  2HGF A;  3SRJ A;  1GMO A;  1Z40 A;  2HPP P;  1KRN A;  3NXP A;  4IUA A;  2LL4 M;  1URK A;  1YXE A;  3HMT A;  1PML A;  4D3C A;  1KI0 A;  3LAQ A;  5CS1 A;  2Y8R A;  5CS5 A;  2Z8W A;  2Z8V A;  3ZLE A;  5CT3 A;  3BT1 A;  3SRI A;  2KJ4 A;  2DOI A;  4YIV A;  1W8K A;  4R19 A;  4R1C A;  3ZWZ A;  4Z0E A;  4Z0F A;  5CS9 A;  4BV7 A;  5CT2 A;  2I9A A;  2Q8A A;  4BVV A;  1B2I A; 
#chains in the Genus database with same CATH homology
 2PF1 A;  5HPG A;  4NZQ A;  3HMS A;  1PK4 A;  1CEB A;  4Z0D A;  1PK2 A;  3SP8 A;  2QJ4 A;  1CEA A;  3U73 A;  1NL2 A;  2DOH X;  4BVD A;  3KIV A;  4R1B A;  1HKY A;  1PKR A;  2FD6 A;  2Q8B A;  3BT2 A;  4APM A;  4O03 A;  4R1A A;  1I71 A;  1KIV A;  1JFN A;  5EOD A;  2QJ2 A;  2YIO A;  4A5T S;  5EOK A;  4UV6 A;  2YIL A;  5CSQ A;  5I25 A;  1NL1 A;  3K65 A;  5CT1 A;  2K13 X;  2J8L A;  2I9B A;  4KIV A;  2J8J A;  4YIZ A;  1A0H A;  1GMN A;  2PF2 A;  4HZH A;  1I5K A;  1NK1 A;  4BVC A;  1HPK A;  2KNF A;  3MKP A;  1HPJ A;  2PK4 A;  4CIK A;  2L0S A;  3E6P L;  2HPQ P;  5COE A;  2K4R A;  1TPK A;  4UAO A;  4DUR A;  2K51 A;  4APL A;  1BHT A;  3HN4 A;  5CP9 A;  1I8N A;  1W81 A;  4BVW A;  2FEB A;  3HMR A;  2KL5 A;  2SPT A;  1KDU A;  4BV5 A;  1PMK A;  4Z09 A;  2F83 A;  1GP9 A;  2LL3 A;  5CS3 A;  2YIP A;  2X2Z A;  2HGF A;  3SRJ A;  1GMO A;  1Z40 A;  2HPP P;  1KRN A;  3NXP A;  4IUA A;  2LL4 M;  1URK A;  1YXE A;  3HMT A;  1PML A;  4D3C A;  1KI0 A;  3LAQ A;  5CS1 A;  2Y8R A;  5CS5 A;  2Z8W A;  2Z8V A;  3ZLE A;  5CT3 A;  3BT1 A;  3SRI A;  2KJ4 A;  2DOI A;  4YIV A;  1W8K A;  4R19 A;  4R1C A;  3ZWZ A;  4Z0E A;  4Z0F A;  5CS9 A;  4BV7 A;  5CT2 A;  2I9A A;  2Q8A A;  4BVV A;  1B2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...