2QJ4A

A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
TLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title A mechanistic basis for converting a receptor tyrosine kinase agonist to an antagonist
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone
total genus 32
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 2qj4A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2qj4A01
1CEAA 2X2ZA 2Q8BA 2PF1A 4DURA 1KDUA 4R1AA 3ZWZA 1HPKA 4KIVA 3SRJA 2PF2A 4BVVA 3HMSA 3SRIA 2FD6A 2HPQP 1Z40A 3K65A 1PKRA 5CS1A 1NK1A 5CS5A 3LAQA 2SPTA 1HPJA 1YXEA 5CS3A 2I9AA 4Z0FA 1I5KA 4BVDA 2PK4A 2Z8WA 4BVCA 1PK2A 5CP9A 3ZLEA 4HZHA 2YIPA 1JFNA 2KJ4A 2K13X 5CT3A 1TPKA 4CIKA 2DOHX 1W81A 1GMOA 1A0HA 3HN4A 4R1BA 1CEBA 1BHTA 1I71A 2FEBA 1KRNA 3U73A 4R1CA 1HKYA 5CSQA 1PMLA 4R19A 4D3CA 2K51A 4BV7A 1I8NA 4Z09A 2YILA 2HPPP 1NL2A 4IUAA 2I9BA 3BT1A 2L0SA 3E6PL 2LL4M 1PMKA 4BVWA 4O03A 4APMA 3SP8A 2J8JA 4NZQA 2LL3A 1B2IA 2YIOA 2QJ2A 2F83A 5EOKA 4Z0DA 3BT2A 3HMRA 5CT1A 4APLA 2Q8AA 4A5TS 1NL1A 2KNFA 1KIVA 4UAOA 4Z0EA 1GMNA 5COEA 2QJ4A 4BV5A 3MKPA 1PK4A 1URKA 2K4RA 2J8LA 1KI0A 5HPGA 3KIVA 3HMTA 2HGFA 1GP9A 1W8KA 5CT2A 2Z8VA 5I25A 2Y8RA 5CS9A 2DOIA 4UV6A 3NXPA 5EODA
chains in the Genus database with same CATH superfamily
1CEAA 2X2ZA 2Q8BA 2PF1A 4DURA 1KDUA 4R1AA 3ZWZA 1HPKA 4KIVA 3SRJA 2PF2A 4BVVA 3HMSA 3SRIA 2FD6A 2HPQP 1Z40A 3K65A 1PKRA 5CS1A 1NK1A 4YIZA 5CS5A 3LAQA 2SPTA 1HPJA 1YXEA 5CS3A 2I9AA 4Z0FA 1I5KA 4BVDA 2PK4A 2Z8WA 4BVCA 1PK2A 5CP9A 3ZLEA 4HZHA 2YIPA 1JFNA 2KJ4A 2K13X 5CT3A 1TPKA 4CIKA 2DOHX 1W81A 1GMOA 1A0HA 3HN4A 4R1BA 1CEBA 1BHTA 4YIVA 1I71A 2FEBA 1KRNA 3U73A 4R1CA 1HKYA 5CSQA 1PMLA 4R19A 4D3CA 2K51A 4BV7A 1I8NA 2KL5A 4Z09A 2YILA 2HPPP 1NL2A 4IUAA 2I9BA 3BT1A 2L0SA 3E6PL 2LL4M 1PMKA 4BVWA 4O03A 4APMA 3SP8A 2J8JA 4NZQA 2LL3A 1B2IA 2YIOA 2QJ2A 2F83A 5EOKA 4Z0DA 3BT2A 3HMRA 5CT1A 4APLA 2Q8AA 4A5TS 1NL1A 2KNFA 1KIVA 4UAOA 4Z0EA 1GMNA 5COEA 2QJ4A 4BV5A 3MKPA 1PK4A 1URKA 2K4RA 2J8LA 1KI0A 5HPGA 3KIVA 3HMTA 2HGFA 1GP9A 1W8KA 5CT2A 2Z8VA 5I25A 2Y8RA 5CS9A 2DOIA 4UV6A 3NXPA 5EODA
chains in the Genus database with same CATH topology
1CEAA 2X2ZA 2Q8BA 2PF1A 4DURA 1KDUA 4R1AA 3ZWZA 1HPKA 4KIVA 3SRJA 2PF2A 4BVVA 3HMSA 3SRIA 2FD6A 2HPQP 1Z40A 3K65A 1PKRA 5CS1A 1NK1A 4YIZA 5CS5A 3LAQA 2SPTA 1HPJA 1YXEA 5CS3A 2I9AA 4Z0FA 1I5KA 4BVDA 2PK4A 2Z8WA 4BVCA 1PK2A 5CP9A 3ZLEA 4HZHA 2YIPA 1JFNA 2KJ4A 2K13X 5CT3A 1TPKA 4CIKA 2DOHX 1W81A 1GMOA 1A0HA 3HN4A 4R1BA 1CEBA 1BHTA 4YIVA 1I71A 2FEBA 1KRNA 3U73A 4R1CA 1HKYA 5CSQA 1PMLA 4R19A 4D3CA 2K51A 4BV7A 1I8NA 2KL5A 4Z09A 2YILA 2HPPP 1NL2A 4IUAA 2I9BA 3BT1A 2L0SA 3E6PL 2LL4M 1PMKA 4BVWA 4O03A 4APMA 3SP8A 2J8JA 4NZQA 2LL3A 1B2IA 2YIOA 2QJ2A 2F83A 5EOKA 4Z0DA 3BT2A 3HMRA 5CT1A 4APLA 2Q8AA 4A5TS 1NL1A 2KNFA 1KIVA 4UAOA 4Z0EA 1GMNA 5COEA 2QJ4A 4BV5A 3MKPA 1PK4A 1URKA 2K4RA 2J8LA 1KI0A 5HPGA 3KIVA 3HMTA 2HGFA 1GP9A 1W8KA 5CT2A 2Z8VA 5I25A 2Y8RA 5CS9A 2DOIA 4UV6A 3NXPA 5EODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEA A;  2X2Z A;  2Q8B A;  2PF1 A;  4DUR A;  1KDU A;  4R1A A;  3ZWZ A;  1HPK A;  4KIV A;  3SRJ A;  2PF2 A;  4BVV A;  3HMS A;  3SRI A;  2FD6 A;  2HPQ P;  1Z40 A;  3K65 A;  1PKR A;  5CS1 A;  1NK1 A;  5CS5 A;  3LAQ A;  2SPT A;  1HPJ A;  1YXE A;  5CS3 A;  2I9A A;  4Z0F A;  1I5K A;  4BVD A;  2PK4 A;  2Z8W A;  4BVC A;  1PK2 A;  5CP9 A;  3ZLE A;  4HZH A;  2YIP A;  1JFN A;  2KJ4 A;  2K13 X;  5CT3 A;  1TPK A;  4CIK A;  2DOH X;  1W81 A;  1GMO A;  1A0H A;  3HN4 A;  4R1B A;  1CEB A;  1BHT A;  1I71 A;  2FEB A;  1KRN A;  3U73 A;  4R1C A;  1HKY A;  5CSQ A;  1PML A;  4R19 A;  4D3C A;  2K51 A;  4BV7 A;  1I8N A;  4Z09 A;  2YIL A;  2HPP P;  1NL2 A;  4IUA A;  2I9B A;  3BT1 A;  2L0S A;  3E6P L;  2LL4 M;  1PMK A;  4BVW A;  4O03 A;  4APM A;  3SP8 A;  2J8J A;  4NZQ A;  2LL3 A;  1B2I A;  2YIO A;  2QJ2 A;  2F83 A;  5EOK A;  4Z0D A;  3BT2 A;  3HMR A;  5CT1 A;  4APL A;  2Q8A A;  4A5T S;  1NL1 A;  2KNF A;  1KIV A;  4UAO A;  4Z0E A;  1GMN A;  5COE A;  2QJ4 A;  4BV5 A;  3MKP A;  1PK4 A;  1URK A;  2K4R A;  2J8L A;  1KI0 A;  5HPG A;  3KIV A;  3HMT A;  2HGF A;  1GP9 A;  1W8K A;  5CT2 A;  2Z8V A;  5I25 A;  2Y8R A;  5CS9 A;  2DOI A;  4UV6 A;  3NXP A;  5EOD A; 
#chains in the Genus database with same CATH topology
 1CEA A;  2X2Z A;  2Q8B A;  2PF1 A;  4DUR A;  1KDU A;  4R1A A;  3ZWZ A;  1HPK A;  4KIV A;  3SRJ A;  2PF2 A;  4BVV A;  3HMS A;  3SRI A;  2FD6 A;  2HPQ P;  1Z40 A;  3K65 A;  1PKR A;  5CS1 A;  1NK1 A;  4YIZ A;  5CS5 A;  3LAQ A;  2SPT A;  1HPJ A;  1YXE A;  5CS3 A;  2I9A A;  4Z0F A;  1I5K A;  4BVD A;  2PK4 A;  2Z8W A;  4BVC A;  1PK2 A;  5CP9 A;  3ZLE A;  4HZH A;  2YIP A;  1JFN A;  2KJ4 A;  2K13 X;  5CT3 A;  1TPK A;  4CIK A;  2DOH X;  1W81 A;  1GMO A;  1A0H A;  3HN4 A;  4R1B A;  1CEB A;  1BHT A;  4YIV A;  1I71 A;  2FEB A;  1KRN A;  3U73 A;  4R1C A;  1HKY A;  5CSQ A;  1PML A;  4R19 A;  4D3C A;  2K51 A;  4BV7 A;  1I8N A;  2KL5 A;  4Z09 A;  2YIL A;  2HPP P;  1NL2 A;  4IUA A;  2I9B A;  3BT1 A;  2L0S A;  3E6P L;  2LL4 M;  1PMK A;  4BVW A;  4O03 A;  4APM A;  3SP8 A;  2J8J A;  4NZQ A;  2LL3 A;  1B2I A;  2YIO A;  2QJ2 A;  2F83 A;  5EOK A;  4Z0D A;  3BT2 A;  3HMR A;  5CT1 A;  4APL A;  2Q8A A;  4A5T S;  1NL1 A;  2KNF A;  1KIV A;  4UAO A;  4Z0E A;  1GMN A;  5COE A;  2QJ4 A;  4BV5 A;  3MKP A;  1PK4 A;  1URK A;  2K4R A;  2J8L A;  1KI0 A;  5HPG A;  3KIV A;  3HMT A;  2HGF A;  1GP9 A;  1W8K A;  5CT2 A;  2Z8V A;  5I25 A;  2Y8R A;  5CS9 A;  2DOI A;  4UV6 A;  3NXP A;  5EOD A; 
#chains in the Genus database with same CATH homology
 1CEA A;  2X2Z A;  2Q8B A;  2PF1 A;  4DUR A;  1KDU A;  4R1A A;  3ZWZ A;  1HPK A;  4KIV A;  3SRJ A;  2PF2 A;  4BVV A;  3HMS A;  3SRI A;  2FD6 A;  2HPQ P;  1Z40 A;  3K65 A;  1PKR A;  5CS1 A;  1NK1 A;  4YIZ A;  5CS5 A;  3LAQ A;  2SPT A;  1HPJ A;  1YXE A;  5CS3 A;  2I9A A;  4Z0F A;  1I5K A;  4BVD A;  2PK4 A;  2Z8W A;  4BVC A;  1PK2 A;  5CP9 A;  3ZLE A;  4HZH A;  2YIP A;  1JFN A;  2KJ4 A;  2K13 X;  5CT3 A;  1TPK A;  4CIK A;  2DOH X;  1W81 A;  1GMO A;  1A0H A;  3HN4 A;  4R1B A;  1CEB A;  1BHT A;  4YIV A;  1I71 A;  2FEB A;  1KRN A;  3U73 A;  4R1C A;  1HKY A;  5CSQ A;  1PML A;  4R19 A;  4D3C A;  2K51 A;  4BV7 A;  1I8N A;  2KL5 A;  4Z09 A;  2YIL A;  2HPP P;  1NL2 A;  4IUA A;  2I9B A;  3BT1 A;  2L0S A;  3E6P L;  2LL4 M;  1PMK A;  4BVW A;  4O03 A;  4APM A;  3SP8 A;  2J8J A;  4NZQ A;  2LL3 A;  1B2I A;  2YIO A;  2QJ2 A;  2F83 A;  5EOK A;  4Z0D A;  3BT2 A;  3HMR A;  5CT1 A;  4APL A;  2Q8A A;  4A5T S;  1NL1 A;  2KNF A;  1KIV A;  4UAO A;  4Z0E A;  1GMN A;  5COE A;  2QJ4 A;  4BV5 A;  3MKP A;  1PK4 A;  1URK A;  2K4R A;  2J8L A;  1KI0 A;  5HPG A;  3KIV A;  3HMT A;  2HGF A;  1GP9 A;  1W8K A;  5CT2 A;  2Z8V A;  5I25 A;  2Y8R A;  5CS9 A;  2DOI A;  4UV6 A;  3NXP A;  5EOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...