2QJ7A

Pyp ultra-high resolution of a bacterial photoreceptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
HVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Picometer-scale conformational heterogeneity separates functional from nonfunctional States of a photoreceptor protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qj7A00
1DP9A 1S1ZA 4HP4A 5TBMA 5DKKA 4B9OA 1T1AA 1ODVA 1UWNX 1T18A 1OTDA 3NHQA 3H9WA 2PHYA 2ZOHA 4GS9A 4HJ6A 4R70A 2I9VA 1P97A 5G4ZA 1BYWA 3H7WB 1DP6A 2OWHA 3LIEA 4GHIB 2QKPA 4HJ4A 4BBUA 5HWVA 3SW1A 2W27A 3H82B 4HH3A 4F3LB 3B33A 2W0NA 4MN6A 3F1NA 5F68A 4YWZA 5I5LA 1VB6A 2A24B 3LI8A 5AVEA 4PKYG 3CLOA 2YKHA 4M4XA 1S67L 2CMNA 5DJUA 1KOUA 2EA9A 3LIAA 1Y28A 2BASA 5EFWA 4HQAA 2V9AA 4HI4A 1LL8A 1V9ZA 5DJTA 3KX0X 1N9OA 4BBVA 1D7EA 3VE4A 2OOLA 3GDIA 4HP9A 4R38A 3NOTC 1S66L 4I5SA 4JGOA 1X0OA 3A0RA 1F98A 4EEUA 5J4EA 1DP8A 1OTAA 2PD8A 2V0UA 5AVFA 5F5YA 4L9GA 3UB8A 3LUQA 1OT6A 3HJIA 3K3CA 3FC7A 2QHKA 1T19A 5HDDA 3P7NA 5HD3A 1XJ3A 2M1CA 4L9EA 5HSQA 3MQQA 5IS1A 2R78A 2B02A 1TS0A 2Z6DA 5KIZA 1XJ6A 3F1OB 4NXGA 4HH2A 4LRYC 4NXEA 4F3LA 4GCZA 4H6JA 3IBRA 3PHYA 5HZHA 3MFXA 4RQ9A 3LI9A 5J7EA 3D72A 2VEAA 3GECA 2V1AA 1XJ2A 3K3DA 1D06A 2PDRA 3EWKA 3ULFA 3LICA 1MZUA 4PKYA 3LIFA 2VLGA 4KUKA 3OLOA 5TBMB 3E4PA 1LSWA 2QWSA 2VV8A 3F1PB 4XT2A 2K7SA 3CAXA 1T1CA 4JGPA 4DJ3A 4I3AA 1XFQA 1LSVA 4BBTA 5F69A 3C2WA 2L4RA 2PD7A 1OJGA 1OJ5A 1GSWA 1N9LA 4KQDA 3BY9A 5HWWA 3NOPC 3PYPA 5HDCA 2YKFA 1S4RA 2Z6CA 3UMEA 2D02A 3F1NB 2JHEA 2V1BA 3FG8A 4WF0A 3ICYA 4EQ1A 2L0WA 1TS6A 3IS2B 1N9NA 2V0WA 4EXOA 3UB9A 4EERA 3LYXA 3NOUC 4NXFA 2PR5A 1S1YA 5J3WA 3UB6A 5A8BA 3A0VA 1GSXA 1WA9A 3UE6A 2WKRA 2WKPA 2GJ3A 4HHDA 3MXQA 3H7WA 4E04A 1UGUA 4EW7A 4GHIA 4I39A 4KUOA 1LSXA 4L9FA 4I38A 4HJ3A 4HY8A 3H82A 5HWTA 2JN7A 4I3JA 5HDSA 1EW0A 4I3IA 3A0SA 5G4YA 4EESA 3F1PA 4NXBA 2A24A 4LLOB 3C8CA 3T50A 3HJKA 4JGRA 3RH8B 3LIBA 3CWFA 1OT9A 4EEPA 5IU1A 4GW9A 2H28A 1V9YA 3RTYA 4LRZE 2VV7A 2HV1A 2WKQA 2PR6A 2QJ5A 1P0ZA 3BY8A 1NWZA 4R3AA 4GS9B 4LPZA 1OTIA 2P7JA 4H6JB 4HNBA 1JNUA 2ZBBA 2KX6A 4HIAA 1G28A 1S4SA 1TS8A 3UMDA 4LRXC 3EEHA 3IS2A 1UWPX 3MR0A 3MQOA 3MJQA 4WUJA 5DKLA 2PYPA 1T1BA 3LIDA 4WN5A 3BWLA 2QJ7A 1TS7A 4XT2B 4JGQA 2INWA 1OTEA 3VOLA 4K08A 1XJ4A 3E4QA 5F6AA 3NJAA 2KDKA 1OTBA 4WL9A 3E4OA 4R6LA 4HOIA 2OWJA 2PYRA 4MN5A 2ZOIA 3F1OA 2L1MA 1DRMA 1F9IA 4EETB 5HD5A 3ZQ5A 2J80A 2VV6A 1LT0A 4WLAA 3UB7A 3VE3A 3G6OA 1GSVA 1XFNA 2D01A 4DJ2A
chains in the Genus database with same CATH superfamily
5HAQA 2OLVA 4OOYA 3OPPA 3MZEA 4HP4A 5TBMA 2G7UA 5DKKA 3DWKA 3DBAA 1ZHHB 4B9OA 1IKIA 1T1AA 3PBOA 1SCWA 3NHQA 4NK3A 1FILA 4E3KA 3H9WA 4M3KA 4HJ6A 4A5RA 1W79A 4KZ8A 1H3QA 5BOHA 4N1XA 3SH7A 3MZDA 3QNBA 1KDSA 5KMWA 5G18A 4GHIB 4BBUA 1L0FA 3MKEA 5IHVA 4F3LB 1BZAA 4DF6A 3KSGA 4YOFA 3SH8A 4R3BA 3P98A 4FOFA 3IX3A 2HDUA 5I5LA 1VB6A 2A24B 3IH8A 2XK1A 1N9BA 1KE0A 4QPRA 5AVEA 2Z2MB 4UA7A 1K4EA 4IHQA 5DJUA 1KOUA 2WGWA 4IEDA 2C5WB 1ALQA 2H0TA 5EFWA 1GCEA 2V9AA 3VOZA 4X53A 4HI4A 1LL8A 2J9PA 4WBGA 4MBHA 1CJFA 1V9ZA 3T12B 5CTMA 4NKPA 5F82A 4GKUA 3BFGA 1PZOA 5DJTA 1M6KA 1N9OA 4BBVA 2OAQ1 3CJMA 5E2GA 3B3XA 1TD5A 4H8RA 1PWCA 4LV0A 2J3WA 5J4EA 1DP8A 2Y59A 1ACFA 1OTAA 4PAUA 3HLDA 4WZ5A 1FOFA 3VP1A 5AVFA 1K57C 3W4QA 4L9GA 1H8ZA 4Q0HA 5E2FA 1D1JA 1BTLA 2WGIA 4EU0A 2QHKA 4HBUA 2UV0E 2M1CA 4L9EA 4P85A 4YFMA 4UEYA 1CQAA 1YT4A 2Z6DA 3Q81A 1GA0A 2XFTA 5D3OA 5HPIA 4JPMA 3M2KA 5HAPA 4GCZA 3WRTA 3G34A 5GLDA 3MFXA 2WGVA 3CPTA 3D72A 2JKTI 1IYSA 4KG5A 4RVAA 3S22A 2V1AA 2HZ5A 3SS4A 2Q9NA 5AQAA 3OZHA 3ULFA 1ZG6A 4QJGA 4KQQA 2VLGA 4KUKA 3DTIA 4NEED 3EQVA 3E4PA 1KGEA 2J7VA 5M19A 4IBXA 4WM9A 2VV8A 3Q7VA 3WS1A 4KENB 2XF3A 1W63Q 3NIAA 5HX9A 2HF6A 3UDXA 1TDGA 4JGPA 3W4PA 4BWIA 2A2LA 5CX7A 1XFQA 3KO6A 4BBTA 4GNUA 4DDYA 1MC0A 4JXVA 3FKWA 4KQOA 3NY4A 2P9VA 4E3JA 1L3LA 2JKRI 1OJ5A 3MZFA 1RGYA 1YLPA 3ITBA 1FSWA 2W1RA 4PPRA 2YKFA 1S4RA 1ESUA 5EVLA 2EX9A 3QP5A 2D02A 5CEBA 4N1HA 5EVID 4WF0A 3O87A 2L0WA 4DXBA 5TJJA 2EFUA 1N9NA 3VP4A 3BQ8A 3MXRA 4K0XA 3HL9A 1YLWA 2XH9A 1E25A 2XDMA 1S1YA 2FFFB 3U4LP 5I94A 1H5XA 5A8BA 1WYBA 3G35A 4ZJ1A 1GSXA 2P74A 1P9RA 3UE6A 4OPQA 4C75A 3OPLA 3OPRA 1NLYA 2GJ3A 2Y2NA 2ZL1A 1VM1A 3H7WA 4E04A 3PAEA 1U60A 1FSYA 4X1MA 1LSXA 3D4FA 3H82A 5HWTA 3RXWA 5CGXA 4X1LA 4I3JA 1MXOA 2PRFA 1EW0A 2EX6A 2H5SA 2WAEA 3FKVA 3HLBA 1KVLA 3VSLA 5AQBA 2O9CA 1IKGA 4EESA 3F1PA 4BQMA 3HREA 1G6AA 4JXWA 3NC8A 3HJKA 3RH8B 3LIBA 5FI7A 2EX8A 1EI5A 5IU1A 1JTGA 3CMZA 4GW9A 4GZBA 3DAVA 4EV4A 4S2KA 1NXYA 3RTYA 3VMAA 4WMCD 1IYPA 3LR5A 3BFEA 1GHIA 3CHWP 3FYZA 4GS9B 2V8FA 1OTIA 1NYMA 2Y4AA 1E3UA 2GX5A 4HIAA 3FV7A 3UPPA 2WKEA 1S4SA 5FDHA 5C5KA 4B4XA 1QMEA 3Q1FA 2ZQ9A 3IS2A 4Y13A 5FQ9A 1Q2PA 3W8KA 1H8YA 3MR0A 4FH4A 2EFXA 1YLJA 3BQAA 4XXRA 3QP6A 4WN5A 2V2FF 2QJ7A 3IF6C 4YNRA 4D60A 5M18A 1MY8A 3VOLA 1OTEA 4JLFA 3VP2A 1XJ4A 5EVIB 2HGVA 4RX2A 5F6AA 3MXSA 2B95A 4KZ6A 1OTBA 4R4SA 3E4OA 1VHMA 3ZYTA 4X69A 3PBRA 4O01A 3NECA 1Z6FA 3DTEA 3KSIA 4KZ3A 1MWTA 4S2JA 3BM6A 1TEMA 1PW1A 3Q07A 3HCYA 3TE8A 3ZQ5A 2JCHA 1TF1A 4WLAA 3VE3A 4UQIM 4GLQA 2V20A 1W63M 4DJ2A 2K2NA 2OLUA 4S2IA 1LL5A 5MC7A 4D2OA 4UQIS 1PZPA 4Q8IA 3HUMA 1UWNX 4E6XA 1QMFA 3VP3A 3G32A 2ZM8A 4OLGA 2ZOHA 4BL3A 4LV3A 2W1TB 1P97A 1XA1A 3AGEA 2HDQA 1BYWA 4HBTA 4ETZA 1ONGA 3LIEA 5F83A 2W27A 5F1GA 3CZDA 3E0YA 1XX2A 3B33A 3LY4A 1NRFA 1GA9A 2W0NA 3W4OA 3F1NA 3NCKA 4WEKA 5KSHA 4ARZB 3W2ZA 1ZG4A 3A3IA 4Y0UA 2EX2A 4B93A 1W7FA 5CXWA 4XUXA 2ZMVA 4PKYG 2VGLM 3CLOA 4CLCE 3WWXA 1EROA 2X71A 4M4XA 1S67L 2CMNA 2EA9A 4JBFA 2XD1A 3LIAA 5TR7A 1XGIA 1YSQA 1NZUA 3CITA 3EOIA 2VGLS 4B4ZA 4QY6A 1CF0A 1IOUA 1I2WA 5CHMA 2ZC5B 3C5AA 4MCWA 5CERA 4Y17A 2QZ6A 1PWDA 3N7WA 1O7EA 2X02A 1W8YA 4QB8A 5EM1A 3FZCA 3KX0X 4ZBEA 2G2WA 5AJGA 2WKHA 2Y2KA 4JXGA 2VGKA 2OOLA 2Y2LA 1VEUA 2ZQCA 3BFFA 2XFSA 4E3OA 1X0OA 3TG9A 1LLBA 4X56A 1F98A 4EEUA 3UPOA 1SDEA 4QWOA 3CUEC 3QP8A 3PTEA 4CPKA 2Y79A 2Y2PA 5DF8A 2VK3A 4MBFA 3LUQA 4LCMA 1NYYA 5FAOA 3SH9A 2PT7A 3K3CA 3FC7A 3E2LA 1ES4A 1T19A 3VFHA 2VGJA 1K0KA 3R7WB 2W3DA 1LHYA 1ERQA 2VZWA 2R78A 4EUZA 5KIZA 3KYZA 3PBNA 1FR1A 3F1OB 4HH2A 3IWQA 2A49A 3N8RA 1XP4A 4F3LA 3N8SA 5HZHA 2XQZA 5EOEA 1BUEA 4RQ9A 4ETXA 4DKIA 1K4FA 1XJ2A 1D06A 2ZC6B 4GB7A 5JYOA 3PXPA 1ERMA 4PKYA 2PU4A 2KLIA 4P6ZM 5AQ7A 5TBMB 1F5MA 3SOIA 5L2FA 2CC1A 1LSWA 2P08A 2QWSA 3CG5A 3N8LA 4BLMA 2K7SA 1T1CA 4DJ3A 2V1ZA 1PRQA 1BLHA 2R9XA 4OP5A 1E4DA 3IX4A 3C2WA 2PD7A 1TDLA 2MJ6A 1N9LA 4KQDA 3ZNTA 2DRWA 2W3EA 4JF5A 2WKIA 2Z6CA 4IVKA 2R9WA 3LR3A 5GHYA 3UMEA 2ZMAA 4PM6A 3OBFA 1FQGA 3BLMA 4WELA 2O99A 3IT9A 4E3MA 3RXXA 3O86A 3AGFA 2BG1A 2EWWA 2V0WA 3BFCA 1LL9A 4EXOA 4EERA 4U0XA 3NOUC 3B42A 2WGWB 4NXFA 3UE0A 1KVMA 3T4LA 4E6WA 3L7HA 2LB9A 3TJZC 4Y15A 1K55A 3LCEA 1ZC2A 3BECA 1WA9A 4E3IA 3PAGA 3A3JA 3JVUA 1BLCA 5FDSA 2PAVP 2ZC3B 4DDSA 4X25A 1MKMA 5EPHA 2B18A 5HAIA 5F1FA 5CRFA 1CI9A 1RP5A 2ZJ9A 3GMWA 4FCFA 5FQIA 5GL9A 3E98A 4CJNA 4Y0OA 4HY8A 1STZA 4K0WA 5E2EA 2O0YA 4I3IA 4C3QA 1P9WA 4B88A 4S2NA 3O5YA 3FPWA 3C8CA 3EQUA 3CWFA 2X01A 1PIOA 2KOIA 1LI9A 4EWFA 4ESPA 2H28A 2ZQDA 4Y5FA 4LRZE 3VV4A 2PR6A 1P0ZA 2JE5A 4R3AA 4LPZA 5FQQA 2PBYA 4JF6A 2ACGA 4DE1A 1JNUA 3HLFA 2EXBA 4WYYA 2KX6A 5K5BA 3CPTB 2XEPA 3GVBA 1G28A 1IYOA 1ES2A 1MWUA 3MS6A 2JKGA 3UMDA 4LRXC 2QPNA 1ONHA 1SKOA 2OV5A 1AWIA 1VQQA 4ME4A 3MQOA 4P6BA 4IVIA 3MJQA 4FH2A 3HLCA 3Q7VB 3ZCZA 1E3UD 1JWPA 1CI8A 1TS7A 1AXBA 4Z9QA 1PW8A 3RJUA 2ZC7A 3HLEA 2M7UA 2Y2IA 4CQHA 1WYCA 3QP2A 1YSPA 4OQHA 3ZG7B 4HOIA 5DF9A 2J9OA 3HBRA 3IF6B 4K91A 2IWDA 1PNEA 2L1MA 4F94A 3VFFA 2WADA 4EBPA 3A3EA 1BLPA 2J3TC 3NI9A 2JKFA 4WZ5C 4EETB 1DJCA 4P0MA 1KE4A 1CEFA 4WZ4A 1PYYA 1LT0A 1NY0A 3G6OA 1GSVA 3KYEA 4JF4A 4ID4A 1XFNA 1DP9A 1S1ZA 3PBSA 4NG2A 3M6HA 3IHAA 4U0TA 3LEQA 3LGOA 4GJ4A 5GLCA 4S2LA 4GDBA 3BYDA 3UE3A 1XGJA 1K38A 4GS9A 4R70A 3QP1A 4OQGA 2XA7M 5FAPA 3H7WB 3T4QA 2ZM0A 1DP6A 4S2NC 2B5RA 2OWHA 3WS0A 1I5QA 1LI0A 2ZC4B 4OPRA 5KSCA 2QKPA 4HJ4A 4AFIA 5DTSA 2XA7S 2V8CA 4EBNA 5L10A 1W8QA 3H82B 1OMEA 5FQJA 4UHUA 4YWZA 1JTDA 4R4RA 1IYQA 5A93A 1BT5A 2QMIA 3EGDC 3SS3A 3ZFZA 3BW6A 2YKHA 2HDSA 4LGWA 5EVIA 4N9KA 1Q2QA 4MDZA 5A90A 4IJGA 3TSGA 1XXMA 1K6SA 5GLAA 3TW8A 3T4JA 3VOYA 1PI4A 1NRJA 2BTFP 4YINA 3IX8A 1FIKA 4KG6A 5TGFA 3BLSA 1KE3A 3C4OA 1ZTUA 1FCNA 3G30A 4LCLA 4ZJ2A 3PBTA 1D7EA 1PFLA 3IWOA 5TFQA 3VE4A 3GDIA 2FH5A 4HP9A 4R38A 1MPLA 3NOTC 1S66L 3KYQA 3WS4A 1FCOA 3A0RA 1VETA 1EWZA 3C7VA 4BJPA 1HLUP 4RA7A 4KZ9A 4ZAMA 1HVBA 3BFDA 3UB8A 1OT6A 3HJIA 2WYXA 5FATA 1BLSA 5CHJA 2QYBA 3DTKA 4OPZA 4MNRA 1XJ3A 2W1TA 1MWSA 4EQIA 3S7OA 5LBRA 5HSQA 5DVAA 5IS1A 3OCNA 1FCMA 2B02A 3T1RA 1GHPA 5FASA 4CLCA 4EBLA 1XJ6A 1CK3A 3IH9A 4NXGA 2O9BA 3ZG0A 3MFDA 2NUTC 3FWLA 3ZG9B 4H6JA 4BD1A 3KSHA 4S2PA 4Y3IA 3U2AA 4DE3A 4JKTA 3PR6A 4WMCA 3B47A 5AQ9A 3V3SA 3K3DA 1A0KA 1S0WA 3G2YA 3EWKA 3TRCA 1SKFA 2ZM2A 1RGZA 2OSUA 3LY3A 3MQ0A 4O7DA 4XT2A 3C4PA 4E3NA 2GZAA 2XGNA 4GDNA 2L4RA 3TOIA 2Y2JA 3BJNA 4FTXA 1SHVA 3VP0A 1GSWA 1NJ4A 3BY9A 2ZLYA 5FAQA 3MBZA 1DY6A 5L8MA 3IF5A 2XSSA 3PYPA 3DTMA 3T4KA 5HDCA 4FUWA 1ES5A 4X68A 3GR2A 3LR4A 2ZMFA 3PBQA 5L07A 2VKSA 3F1NB 2JHEA 2V1BA 2VA0A 3FG8A 3QP4A 4Q0IA 4EQ1A 2Y2HA 2M7VA 1TS6A 3OCLA 1HD8A 3K2NA 1TVFA 3S1YA 3M6BA 4R1GA 5EUAA 2Y2MA 3MSHA 5FQKA 1DJBA 5J3WA 3UB6A 3A0VA 5FQMA 4P87A 4GD6A 1I2SA 5EOOA 3NDGA 1L0EA 2VX8A 3HVFA 3V67A 3MXQA 4L0LA 3AGDA 2GDNA 2W3GA 1UGUA 1IELA 4Y7PA 3ZG5A 4GHIA 3ZNYA 4I39A 4KUOA 1VEUB 5CEDA 5FA7A 4L9FA 4I38A 2W3HA 4BD0A 3T4TA 5EE8A 4HESA 4OVDA 5HDSA 1BULA 5L09A 3LFVA 2DNSA 5G4YA 3V3RA 4UAAA 3UPNA 4U3TA 4CLCC 3JPUA 3UO9A 2A24A 4ZRRA 4LLOB 3T50A 4JGRA 3UE1A 3ZVWA 4EEPA 2Q0OA 4X55A 3MKFA 4R23A 1V9YA 4OOLA 4PM7A 3DW0A 3GRJA 2VV7A 1Y54A 2HV1A 3UDFA 2IA2A 4G3KA 4UA6A 2QJ5A 3BY8A 3GV9A 2DMWA 4P6ZS 1NWZA 3IHBA 2Y2GA 2P7JA 1YMSA 4HNBA 1YKDA 5A91A 1MBLA 3IBJA 3LO7A 4KZBA 2E8IA 1YLYA 4OOMA 3V39A 3V5MA 1C3BA 3VSKA 1NLZA 4IUHA 4LENA 1ESIA 4WUJA 1K56A 2XRNA 4MMNA 3N6IA 3DWZA 3C30A 2E8JA 3IQAA 4RX3A 2PBDP 3LIDA 5FSRA 3SZTA 2P04A 4JGQA 2INWA 2BLSA 5GHXA 3UNWA 5HW3A 4K08A 4N92A 1H0MA 3MF0A 5GLBA 3NJAA 2XLNA 1WE4A 1OPXA 3OPHA 3ZG8B 4WL9A 4R6LA 5CGWA 1F2KA 3ZVTA 2JKTM 1YLTA 4MN5A 2ZOIA 4MLLA 4Y0TA 4OP8A 4BENA 4KZ4A 4DE2A 1Y4OA 2RL3A 1F9IA 1IFQA 4GN2A 1J9MA 4N9LA 3JYIA 5CECA 3GTCA 1BSGA 2VV6A 3UB7A 5E2HA 3GQZA 3ISGA 1CEGA 1S6RA 1JWZA 4R3JA 4XUZA 2HJ9C 1W5DA 2JKRM 2HP6A 1ODVA 4PM8A 3BRMA 1T18A 4GOGA 1OTDA 2J8YA 2PHYA 2Z2LB 3ZGAB 4LV2A 2JC7A 2HP9A 2I9VA 4KQRA 3T1SA 5G4ZA 3HUOA 2C6WB 1YQSA 5HWVA 4G3VA 4PMAA 5GHZA 3SW1A 4HH3A 1ES3A 2W3FA 4MN6A 5F68A 3N4IA 3LI8A 4O0PA 2OAP1 1Y28A 2BASA 2ZQ7A 3G31A 1K54A 4HQAA 4KG2A 3S7PA 3T4SA 4ZTKA 4LFUA 4QD4A 3IF6A 5HFOA 2WAFA 3D3OA 2XR0A 5EM0A 2NUPC 2P9VB 1KGFA 4FSFA 2JBFA 3IWIA 2FZ0A 3LEZA 3HLGA 3C7UA 1SKOB 1Z09A 5M1AA 2XD5A 3LR0A 4I5SA 4JGOA 2PU2A 2RCXA 4RYEA 2IWBA 2Y8HA 4OPYA 2PD8A 4IUKA 1K55C 2V0UA 1G6OA 4S2OA 1YMXA 5DTTA 4QHCA 5F5YA 3A3DA 2LB5A 1H8MA 1XKZA 2FFYA 3UB5P 5HDDA 3P7NA 3UY6A 4NETA 5HD3A 1XA7A 5IT5A 3WRZA 3MQQA 4OH0A 4OONA 1TS0A 2EXAA 4DMZA 4KZ7A 3WS5A 2HJEA 4LRYC 4NXEA 1XPBA 2ZL1B 3ZHHA 3IBRA 1SZVA 3PHYA 4O8GA 2DCFA 3LI9A 3UDIA 3C38A 4MBKA 5HARA 5J7EA 2VEAA 3GECA 4CLCD 2HDRA 2PDRA 1PI5A 3P09A 3IXGA 4DE0A 3LICA 3ITAA 1MZUA 3LIFA 4DN0A 3OLOA 3KSFA 1HTZA 1K25A 1JWVA 5EV0A 4E3LA 3F1PB 5CTNA 3CAXA 4DXCA 3O88A 4I3AA 1LSVA 1IEMA 4ZDXA 1RCJA 4DRTA 5J8XA 5F69A 2HPBA 1OJGA 3IXBA 4WEJA 5HWWA 1JVJA 3NOPC 3T1XA 5EECA 1YPRA 3OC2A 2WK0A 4PM5A 1GHMA 4KZ5A 4KZAA 3I7JA 3GSGA 4UA9A 1K54C 3ICYA 5A92A 5FI2A 4OKPA 3ZDJA 3IS2B 1MKIA 2G2UA 3UB9A 3LYXA 3O3VA 1L0DA 3HUNA 4MEZA 3V50A 3BEBA 2PR5A 4QY5A 1MWRA 5DFYA 3CUEA 2K31A 1YLZA 3MMHA 3OOVA 1HZOA 2Y2OA 4OQ0A 4C6YA 1L0GA 2WKRA 2WKPA 1KDWA 4Z1WA 4MN7A 3HLWA 4HHDA 1M40A 4JXSA 5E43A 3S4XA 3IXDA 5KZHA 3EGXC 3NBLA 2EWVA 2HP5A 1G5UA 1K6RA 3D9YA 4EW7A 3R4KA 2GNXA 3T4OA 5DTKA 4FD8A 4HJ3A 3JVVA 1VETB 2IWCA 2JN7A 3L9KA 2H10A 2I72A 3A0SA 2ZQ8A 4OLDA 3S7QA 1L2SA 2Y55A 4PM9A 5EVEA 4ARZA 3P01A 3NULA 3S7NA 4NXBA 3IXHA 4IBRA 2UWXA 4Y2FA 5JYPA 1OT9A 3E2KA 3QHYA 3EEAA 1J3WA 3RFBA 2Y2QA 4CLCB 2WKQA 3M2JA 2ZD8A 3T1QB 5FL3A 3CI6A 4S2MA 5HPFA 5CGSA 2WUQA 5DFXA 4H6JB 2Y91A 2AVXA 3WS2A 1YAXA 2ZBBA 4II7A 5HL1A 1FR6A 4BMWA 1TS8A 3EEHA 2Q9MA 1UWPX 3A3FA 2XROA 4G3WA 5EVIC 4Q0JA 3Q82A 2A3UA 1DJAA 3G2ZA 5DF7A 5DKLA 2PYPA 1T1BA 3G4PA 3BWLA 4HEFA 4BL2A 3UN7A 1KGGA 4XT2B 5CHUA 4OQIA 4X6TA 3E4QA 4LV1A 2H0YA 5FEGA 1O07A 3R7WA 2KDKA 1K56D 4QU3A 3QNCA 2ZQAA 1SDNA 5HL6A 5FEFA 3FPVA 2O9AA 2OWJA 1PWGA 2PYRA 4PHTA 1G68A 1K57A 1ZKJA 3SS5A 3F1OA 3NDEA 2WZXA 2VJWA 1N4OA 4EUVA 1DRMA 4GD8A 5FI6A 2J3TD 5HD5A 2J80A 1YM1A 4ZJ3A 3Q7ZA 5U47A 2D01A 4R0QA 2WZZA 1NZOA
chains in the Genus database with same CATH topology
1DP9A 1S1ZA 2HJ9C 3PBSA 2JKRM 4HP4A 5TBMA 2G7UA 5DKKA 5MC7A 4UQIS 3DBAA 1ZHHB 4B9OA 1T1AA 1ODVA 4GJ4A 1UWNX 1T18A 3PBOA 1OTDA 3NHQA 3UE3A 3H9WA 2PHYA 2ZOHA 4GS9A 4HJ6A 4R70A 2I9VA 2W1TB 2XA7M 1H3QA 1P97A 5G4ZA 1BYWA 4ETZA 3H7WB 3T4QA 1DP6A 2OWHA 3LIEA 4GHIB 2QKPA 4HJ4A 4BBUA 5HWVA 4G3VA 4AFIA 2XA7S 3SW1A 2W27A 3H82B 4HH3A 3E0YA 4F3LB 3B33A 2W0NA 3KSGA 2W3FA 4YOFA 4MN6A 3F1NA 4WEKA 4FOFA 5KSHA 4ARZB 5F68A 4YWZA 3W2ZA 5I5LA 4B93A 1VB6A 2A24B 3LI8A 3EGDC 5AVEA 2ZMVA 4PKYG 4QPRA 2VGLM 3CLOA 4CLCE 3BW6A 2YKHA 4IHQA 4M4XA 1S67L 2CMNA 5DJUA 1KOUA 4O0PA 2EA9A 2OAP1 3LIAA 1Y28A 4MDZA 1YSQA 4IJGA 2BASA 5EFWA 3EOIA 3CITA 2VGLS 1IOUA 4HQAA 3T4SA 2V9AA 3S7PA 3T4JA 3TW8A 1NRJA 4HI4A 1LL8A 1V9ZA 3D3OA 4MCWA 4NKPA 2NUPC 4FSFA 5DJTA 1ZTUA 3KX0X 5AJGA 1N9OA 4BBVA 3PBTA 1D7EA 2FZ0A 2OAQ1 3VE4A 2OOLA 3GDIA 2FH5A 4HP9A 4R38A 1TD5A 3NOTC 1S66L 3KYQA 3LR0A 4I5SA 4JGOA 1X0OA 3A0RA 1F98A 4EEUA 2J3WA 5J4EA 3CUEC 4BJPA 1DP8A 2Y8HA 1OTAA 4PAUA 2PD8A 4IUKA 2V0UA 2Y79A 5AVFA 1G6OA 5F5YA 4L9GA 4Q0HA 2LB5A 3UB8A 3LUQA 1OT6A 1H8MA 3HJIA 2PT7A 3K3CA 3FC7A 4EU0A 2QHKA 2QYBA 1T19A 5HDDA 3P7NA 3R7WB 5HD3A 1XJ3A 2M1CA 2W1TA 4L9EA 2W3DA 3S7OA 5IT5A 5LBRA 2VZWA 5HSQA 3MQQA 5IS1A 2R78A 3OCNA 4UEYA 2B02A 1TS0A 2Z6DA 4CLCA 5KIZA 4DMZA 3KYZA 1XJ6A 3PBNA 3F1OB 2HJEA 4NXGA 4HH2A 4LRYC 2O9BA 5HPIA 4NXEA 2NUTC 4F3LA 4GCZA 4H6JA 3IBRA 3PHYA 5HZHA 4O8GA 3KSHA 3MFXA 4RQ9A 4Y3IA 3U2AA 3LI9A 4ETXA 3C38A 5J7EA 3PR6A 3D72A 3B47A 2JKTI 2VEAA 3GECA 4CLCD 2V1AA 1XJ2A 3K3DA 1D06A 2PDRA 3EWKA 3TRCA 3PXPA 3ULFA 3LICA 1MZUA 4PKYA 3LIFA 2VLGA 4KUKA 4DN0A 2KLIA 3OLOA 3KSFA 4P6ZM 5TBMB 4NEED 3EQVA 3E4PA 1F5MA 1LSWA 2P08A 2QWSA 2VV8A 3F1PB 1W63Q 3MQ0A 2HF6A 4XT2A 2K7SA 3CAXA 1T1CA 4JGPA 4DJ3A 4BWIA 2A2LA 4I3AA 5CX7A 1XFQA 3KO6A 1LSVA 4BBTA 2GZAA 1MC0A 5F69A 3C2WA 2L4RA 2PD7A 3BJNA 4KQOA 1OJGA 2JKRI 1OJ5A 2MJ6A 1GSWA 1N9LA 4KQDA 3BY9A 4WEJA 5HWWA 5L8MA 2XSSA 3NOPC 2W3EA 3PYPA 3T4KA 5HDCA 2W1RA 3OC2A 2YKFA 1S4RA 2Z6CA 3LR3A 3UMEA 3LR4A 2D02A 2ZMFA 3OBFA 3PBQA 2VKSA 4WELA 2O99A 3F1NB 2JHEA 2V1BA 2VA0A 3FG8A 4WF0A 4Q0IA 3ICYA 4EQ1A 2L0WA 2EWWA 2M7VA 1TS6A 5TJJA 3OCLA 3IS2B 1N9NA 3K2NA 2V0WA 3BQ8A 4EXOA 3UB9A 4EERA 3LYXA 3NOUC 3B42A 4NXFA 2PR5A 1S1YA 3T4LA 5DFYA 3CUEA 2K31A 5J3WA 3UB6A 2LB9A 5A8BA 3TJZC 3MMHA 3OOVA 3A0VA 1GSXA 1P9RA 1WA9A 3JVUA 3UE6A 2WKRA 2WKPA 2VX8A 4Z1WA 4MN7A 1MKMA 1NLYA 2GJ3A 4HHDA 3V67A 2B18A 3MXQA 4L0LA 3EGXC 2W3GA 2EWVA 3H7WA 4E04A 1UGUA 4EW7A 3R4KA 2GNXA 4GHIA 4I39A 4KUOA 3T4OA 1LSXA 3E98A 4L9FA 4I38A 2W3HA 4HJ3A 4HY8A 1STZA 3H82A 3JVVA 5HWTA 3T4TA 2JN7A 4I3JA 5HDSA 1EW0A 3LFVA 2O0YA 4I3IA 3A0SA 5G4YA 3S7QA 2O9CA 4CLCC 4ARZA 1P9WA 4EESA 3F1PA 3P01A 3O5YA 3S7NA 4NXBA 2A24A 4ZRRA 4LLOB 3FPWA 3C8CA 3T50A 3EQUA 3HJKA 4Y2FA 4JGRA 3RH8B 3LIBA 3CWFA 1OT9A 2KOIA 4EEPA 5IU1A 3EEAA 2H28A 4GW9A 3RFBA 1V9YA 4OOLA 4Y5FA 3RTYA 4LRZE 2VV7A 3VV4A 2HV1A 4CLCB 2WKQA 2IA2A 2PR6A 4G3KA 2QJ5A 1P0ZA 3BY8A 2DMWA 3LR5A 5FL3A 3CI6A 4P6ZS 1NWZA 4R3AA 5HPFA 4GS9B 4LPZA 5DFXA 1OTIA 2P7JA 4H6JB 4HNBA 1YKDA 1JNUA 3IBJA 1YAXA 2ZBBA 2KX6A 4II7A 2GX5A 5K5BA 4HIAA 1G28A 4BMWA 4OOMA 1S4SA 1TS8A 5C5KA 3UMDA 4LRXC 3EEHA 3IS2A 1UWPX 2XROA 4G3WA 3MR0A 4ME4A 1NLZA 4IUHA 3MQOA 4Q0JA 3MJQA 4WUJA 5DKLA 2XRNA 4MMNA 3BQAA 2PYPA 1T1BA 3C30A 3LIDA 4WN5A 3BWLA 2QJ7A 4YNRA 2P04A 1TS7A 4XT2B 4JGQA 2INWA 1OTEA 3VOLA 4K08A 1XJ4A 3MF0A 3E4QA 2HGVA 5F6AA 3NJAA 2M7UA 1OPXA 3R7WA 4CQHA 2KDKA 1OTBA 1YSPA 4WL9A 5HL6A 3E4OA 4R6LA 3FPVA 1VHMA 4HOIA 2JKTM 3ZYTA 2O9AA 2OWJA 5DF9A 2PYRA 4MN5A 4PHTA 2ZOIA 3PBRA 4O01A 3F1OA 2L1MA 2VJWA 3KSIA 4EUVA 2J3TC 1DRMA 1F9IA 1IFQA 2J3TD 4EETB 3HCYA 5HD5A 3TE8A 3ZQ5A 2J80A 1TF1A 2VV6A 1LT0A 4WLAA 3UB7A 3VE3A 4UQIM 3G6OA 1GSVA 4GLQA 1XFNA 2D01A 1W63M 4DJ2A 2K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP9 A;  1S1Z A;  4HP4 A;  5TBM A;  5DKK A;  4B9O A;  1T1A A;  1ODV A;  1UWN X;  1T18 A;  1OTD A;  3NHQ A;  3H9W A;  2PHY A;  2ZOH A;  4GS9 A;  4HJ6 A;  4R70 A;  2I9V A;  1P97 A;  5G4Z A;  1BYW A;  3H7W B;  1DP6 A;  2OWH A;  3LIE A;  4GHI B;  2QKP A;  4HJ4 A;  4BBU A;  5HWV A;  3SW1 A;  2W27 A;  3H82 B;  4HH3 A;  4F3L B;  3B33 A;  2W0N A;  4MN6 A;  3F1N A;  5F68 A;  4YWZ A;  5I5L A;  1VB6 A;  2A24 B;  3LI8 A;  5AVE A;  4PKY G;  3CLO A;  2YKH A;  4M4X A;  1S67 L;  2CMN A;  5DJU A;  1KOU A;  2EA9 A;  3LIA A;  1Y28 A;  2BAS A;  5EFW A;  4HQA A;  2V9A A;  4HI4 A;  1LL8 A;  1V9Z A;  5DJT A;  3KX0 X;  1N9O A;  4BBV A;  1D7E A;  3VE4 A;  2OOL A;  3GDI A;  4HP9 A;  4R38 A;  3NOT C;  1S66 L;  4I5S A;  4JGO A;  1X0O A;  3A0R A;  1F98 A;  4EEU A;  5J4E A;  1DP8 A;  1OTA A;  2PD8 A;  2V0U A;  5AVF A;  5F5Y A;  4L9G A;  3UB8 A;  3LUQ A;  1OT6 A;  3HJI A;  3K3C A;  3FC7 A;  2QHK A;  1T19 A;  5HDD A;  3P7N A;  5HD3 A;  1XJ3 A;  2M1C A;  4L9E A;  5HSQ A;  3MQQ A;  5IS1 A;  2R78 A;  2B02 A;  1TS0 A;  2Z6D A;  5KIZ A;  1XJ6 A;  3F1O B;  4NXG A;  4HH2 A;  4LRY C;  4NXE A;  4F3L A;  4GCZ A;  4H6J A;  3IBR A;  3PHY A;  5HZH A;  3MFX A;  4RQ9 A;  3LI9 A;  5J7E A;  3D72 A;  2VEA A;  3GEC A;  2V1A A;  1XJ2 A;  3K3D A;  1D06 A;  2PDR A;  3EWK A;  3ULF A;  3LIC A;  1MZU A;  4PKY A;  3LIF A;  2VLG A;  4KUK A;  3OLO A;  5TBM B;  3E4P A;  1LSW A;  2QWS A;  2VV8 A;  3F1P B;  4XT2 A;  2K7S A;  3CAX A;  1T1C A;  4JGP A;  4DJ3 A;  4I3A A;  1XFQ A;  1LSV A;  4BBT A;  5F69 A;  3C2W A;  2L4R A;  2PD7 A;  1OJG A;  1OJ5 A;  1GSW A;  1N9L A;  4KQD A;  3BY9 A;  5HWW A;  3NOP C;  3PYP A;  5HDC A;  2YKF A;  1S4R A;  2Z6C A;  3UME A;  2D02 A;  3F1N B;  2JHE A;  2V1B A;  3FG8 A;  4WF0 A;  3ICY A;  4EQ1 A;  2L0W A;  1TS6 A;  3IS2 B;  1N9N A;  2V0W A;  4EXO A;  3UB9 A;  4EER A;  3LYX A;  3NOU C;  4NXF A;  2PR5 A;  1S1Y A;  5J3W A;  3UB6 A;  5A8B A;  3A0V A;  1GSX A;  1WA9 A;  3UE6 A;  2WKR A;  2WKP A;  2GJ3 A;  4HHD A;  3MXQ A;  3H7W A;  4E04 A;  1UGU A;  4EW7 A;  4GHI A;  4I39 A;  4KUO A;  1LSX A;  4L9F A;  4I38 A;  4HJ3 A;  4HY8 A;  3H82 A;  5HWT A;  2JN7 A;  4I3J A;  5HDS A;  1EW0 A;  4I3I A;  3A0S A;  5G4Y A;  4EES A;  3F1P A;  4NXB A;  2A24 A;  4LLO B;  3C8C A;  3T50 A;  3HJK A;  4JGR A;  3RH8 B;  3LIB A;  3CWF A;  1OT9 A;  4EEP A;  5IU1 A;  4GW9 A;  2H28 A;  1V9Y A;  3RTY A;  4LRZ E;  2VV7 A;  2HV1 A;  2WKQ A;  2PR6 A;  2QJ5 A;  1P0Z A;  3BY8 A;  1NWZ A;  4R3A A;  4GS9 B;  4LPZ A;  1OTI A;  2P7J A;  4H6J B;  4HNB A;  1JNU A;  2ZBB A;  2KX6 A;  4HIA A;  1G28 A;  1S4S A;  1TS8 A;  3UMD A;  4LRX C;  3EEH A;  3IS2 A;  1UWP X;  3MR0 A;  3MQO A;  3MJQ A;  4WUJ A;  5DKL A;  2PYP A;  1T1B A;  3LID A;  4WN5 A;  3BWL A;  2QJ7 A;  1TS7 A;  4XT2 B;  4JGQ A;  2INW A;  1OTE A;  3VOL A;  4K08 A;  1XJ4 A;  3E4Q A;  5F6A A;  3NJA A;  2KDK A;  1OTB A;  4WL9 A;  3E4O A;  4R6L A;  4HOI A;  2OWJ A;  2PYR A;  4MN5 A;  2ZOI A;  3F1O A;  2L1M A;  1DRM A;  1F9I A;  4EET B;  5HD5 A;  3ZQ5 A;  2J80 A;  2VV6 A;  1LT0 A;  4WLA A;  3UB7 A;  3VE3 A;  3G6O A;  1GSV A;  1XFN A;  2D01 A;  4DJ2 A; 
#chains in the Genus database with same CATH topology
 5HAQ A;  2OLV A;  4OOY A;  3OPP A;  3MZE A;  4HP4 A;  5TBM A;  2G7U A;  5DKK A;  3DWK A;  3DBA A;  1ZHH B;  4B9O A;  1IKI A;  1T1A A;  3PBO A;  1SCW A;  3NHQ A;  4NK3 A;  1FIL A;  4E3K A;  3H9W A;  4M3K A;  4HJ6 A;  4A5R A;  1W79 A;  4KZ8 A;  1H3Q A;  5BOH A;  4N1X A;  3SH7 A;  3MZD A;  3QNB A;  1KDS A;  5KMW A;  5G18 A;  4GHI B;  4BBU A;  1L0F A;  3MKE A;  5IHV A;  4F3L B;  1BZA A;  4DF6 A;  3KSG A;  4YOF A;  3SH8 A;  4R3B A;  3P98 A;  4FOF A;  3IX3 A;  2HDU A;  5I5L A;  1VB6 A;  2A24 B;  3IH8 A;  2XK1 A;  1N9B A;  1KE0 A;  4QPR A;  5AVE A;  2Z2M B;  4UA7 A;  1K4E A;  4IHQ A;  5DJU A;  1KOU A;  2WGW A;  4IED A;  2C5W B;  1ALQ A;  2H0T A;  5EFW A;  1GCE A;  2V9A A;  3VOZ A;  4X53 A;  4HI4 A;  1LL8 A;  2J9P A;  4WBG A;  4MBH A;  1CJF A;  1V9Z A;  3T12 B;  5CTM A;  4NKP A;  5F82 A;  4GKU A;  3BFG A;  1PZO A;  5DJT A;  1M6K A;  1N9O A;  4BBV A;  2OAQ 1;  3CJM A;  5E2G A;  3B3X A;  1TD5 A;  4H8R A;  1PWC A;  4LV0 A;  2J3W A;  5J4E A;  1DP8 A;  2Y59 A;  1ACF A;  1OTA A;  4PAU A;  3HLD A;  4WZ5 A;  1FOF A;  3VP1 A;  5AVF A;  1K57 C;  3W4Q A;  4L9G A;  1H8Z A;  4Q0H A;  5E2F A;  1D1J A;  1BTL A;  2WGI A;  4EU0 A;  2QHK A;  4HBU A;  2UV0 E;  2M1C A;  4L9E A;  4P85 A;  4YFM A;  4UEY A;  1CQA A;  1YT4 A;  2Z6D A;  3Q81 A;  1GA0 A;  2XFT A;  5D3O A;  5HPI A;  4JPM A;  3M2K A;  5HAP A;  4GCZ A;  3WRT A;  3G34 A;  5GLD A;  3MFX A;  2WGV A;  3CPT A;  3D72 A;  2JKT I;  1IYS A;  4KG5 A;  4RVA A;  3S22 A;  2V1A A;  2HZ5 A;  3SS4 A;  2Q9N A;  5AQA A;  3OZH A;  3ULF A;  1ZG6 A;  4QJG A;  4KQQ A;  2VLG A;  4KUK A;  3DTI A;  4NEE D;  3EQV A;  3E4P A;  1KGE A;  2J7V A;  5M19 A;  4IBX A;  4WM9 A;  2VV8 A;  3Q7V A;  3WS1 A;  4KEN B;  2XF3 A;  1W63 Q;  3NIA A;  5HX9 A;  2HF6 A;  3UDX A;  1TDG A;  4JGP A;  3W4P A;  4BWI A;  2A2L A;  5CX7 A;  1XFQ A;  3KO6 A;  4BBT A;  4GNU A;  4DDY A;  1MC0 A;  4JXV A;  3FKW A;  4KQO A;  3NY4 A;  2P9V A;  4E3J A;  1L3L A;  2JKR I;  1OJ5 A;  3MZF A;  1RGY A;  1YLP A;  3ITB A;  1FSW A;  2W1R A;  4PPR A;  2YKF A;  1S4R A;  1ESU A;  5EVL A;  2EX9 A;  3QP5 A;  2D02 A;  5CEB A;  4N1H A;  5EVI D;  4WF0 A;  3O87 A;  2L0W A;  4DXB A;  5TJJ A;  2EFU A;  1N9N A;  3VP4 A;  3BQ8 A;  3MXR A;  4K0X A;  3HL9 A;  1YLW A;  2XH9 A;  1E25 A;  2XDM A;  1S1Y A;  2FFF B;  3U4L P;  5I94 A;  1H5X A;  5A8B A;  1WYB A;  3G35 A;  4ZJ1 A;  1GSX A;  2P74 A;  1P9R A;  3UE6 A;  4OPQ A;  4C75 A;  3OPL A;  3OPR A;  1NLY A;  2GJ3 A;  2Y2N A;  2ZL1 A;  1VM1 A;  3H7W A;  4E04 A;  3PAE A;  1U60 A;  1FSY A;  4X1M A;  1LSX A;  3D4F A;  3H82 A;  5HWT A;  3RXW A;  5CGX A;  4X1L A;  4I3J A;  1MXO A;  2PRF A;  1EW0 A;  2EX6 A;  2H5S A;  2WAE A;  3FKV A;  3HLB A;  1KVL A;  3VSL A;  5AQB A;  2O9C A;  1IKG A;  4EES A;  3F1P A;  4BQM A;  3HRE A;  1G6A A;  4JXW A;  3NC8 A;  3HJK A;  3RH8 B;  3LIB A;  5FI7 A;  2EX8 A;  1EI5 A;  5IU1 A;  1JTG A;  3CMZ A;  4GW9 A;  4GZB A;  3DAV A;  4EV4 A;  4S2K A;  1NXY A;  3RTY A;  3VMA A;  4WMC D;  1IYP A;  3LR5 A;  3BFE A;  1GHI A;  3CHW P;  3FYZ A;  4GS9 B;  2V8F A;  1OTI A;  1NYM A;  2Y4A A;  1E3U A;  2GX5 A;  4HIA A;  3FV7 A;  3UPP A;  2WKE A;  1S4S A;  5FDH A;  5C5K A;  4B4X A;  1QME A;  3Q1F A;  2ZQ9 A;  3IS2 A;  4Y13 A;  5FQ9 A;  1Q2P A;  3W8K A;  1H8Y A;  3MR0 A;  4FH4 A;  2EFX A;  1YLJ A;  3BQA A;  4XXR A;  3QP6 A;  4WN5 A;  2V2F F;  2QJ7 A;  3IF6 C;  4YNR A;  4D60 A;  5M18 A;  1MY8 A;  3VOL A;  1OTE A;  4JLF A;  3VP2 A;  1XJ4 A;  5EVI B;  2HGV A;  4RX2 A;  5F6A A;  3MXS A;  2B95 A;  4KZ6 A;  1OTB A;  4R4S A;  3E4O A;  1VHM A;  3ZYT A;  4X69 A;  3PBR A;  4O01 A;  3NEC A;  1Z6F A;  3DTE A;  3KSI A;  4KZ3 A;  1MWT A;  4S2J A;  3BM6 A;  1TEM A;  1PW1 A;  3Q07 A;  3HCY A;  3TE8 A;  3ZQ5 A;  2JCH A;  1TF1 A;  4WLA A;  3VE3 A;  4UQI M;  4GLQ A;  2V20 A;  1W63 M;  4DJ2 A;  2K2N A;  2OLU A;  4S2I A;  1LL5 A;  5MC7 A;  4D2O A;  4UQI S;  1PZP A;  4Q8I A;  3HUM A;  1UWN X;  4E6X A;  1QMF A;  3VP3 A;  3G32 A;  2ZM8 A;  4OLG A;  2ZOH A;  4BL3 A;  4LV3 A;  2W1T B;  1P97 A;  1XA1 A;  3AGE A;  2HDQ A;  1BYW A;  4HBT A;  4ETZ A;  1ONG A;  3LIE A;  5F83 A;  2W27 A;  5F1G A;  3CZD A;  3E0Y A;  1XX2 A;  3B33 A;  3LY4 A;  1NRF A;  1GA9 A;  2W0N A;  3W4O A;  3F1N A;  3NCK A;  4WEK A;  5KSH A;  4ARZ B;  3W2Z A;  1ZG4 A;  3A3I A;  4Y0U A;  2EX2 A;  4B93 A;  1W7F A;  5CXW A;  4XUX A;  2ZMV A;  4PKY G;  2VGL M;  3CLO A;  4CLC E;  3WWX A;  1ERO A;  2X71 A;  4M4X A;  1S67 L;  2CMN A;  2EA9 A;  4JBF A;  2XD1 A;  3LIA A;  5TR7 A;  1XGI A;  1YSQ A;  1NZU A;  3CIT A;  3EOI A;  2VGL S;  4B4Z A;  4QY6 A;  1CF0 A;  1IOU A;  1I2W A;  5CHM A;  2ZC5 B;  3C5A A;  4MCW A;  5CER A;  4Y17 A;  2QZ6 A;  1PWD A;  3N7W A;  1O7E A;  2X02 A;  1W8Y A;  4QB8 A;  5EM1 A;  3FZC A;  3KX0 X;  4ZBE A;  2G2W A;  5AJG A;  2WKH A;  2Y2K A;  4JXG A;  2VGK A;  2OOL A;  2Y2L A;  1VEU A;  2ZQC A;  3BFF A;  2XFS A;  4E3O A;  1X0O A;  3TG9 A;  1LLB A;  4X56 A;  1F98 A;  4EEU A;  3UPO A;  1SDE A;  4QWO A;  3CUE C;  3QP8 A;  3PTE A;  4CPK A;  2Y79 A;  2Y2P A;  5DF8 A;  2VK3 A;  4MBF A;  3LUQ A;  4LCM A;  1NYY A;  5FAO A;  3SH9 A;  2PT7 A;  3K3C A;  3FC7 A;  3E2L A;  1ES4 A;  1T19 A;  3VFH A;  2VGJ A;  1K0K A;  3R7W B;  2W3D A;  1LHY A;  1ERQ A;  2VZW A;  2R78 A;  4EUZ A;  5KIZ A;  3KYZ A;  3PBN A;  1FR1 A;  3F1O B;  4HH2 A;  3IWQ A;  2A49 A;  3N8R A;  1XP4 A;  4F3L A;  3N8S A;  5HZH A;  2XQZ A;  5EOE A;  1BUE A;  4RQ9 A;  4ETX A;  4DKI A;  1K4F A;  1XJ2 A;  1D06 A;  2ZC6 B;  4GB7 A;  5JYO A;  3PXP A;  1ERM A;  4PKY A;  2PU4 A;  2KLI A;  4P6Z M;  5AQ7 A;  5TBM B;  1F5M A;  3SOI A;  5L2F A;  2CC1 A;  1LSW A;  2P08 A;  2QWS A;  3CG5 A;  3N8L A;  4BLM A;  2K7S A;  1T1C A;  4DJ3 A;  2V1Z A;  1PRQ A;  1BLH A;  2R9X A;  4OP5 A;  1E4D A;  3IX4 A;  3C2W A;  2PD7 A;  1TDL A;  2MJ6 A;  1N9L A;  4KQD A;  3ZNT A;  2DRW A;  2W3E A;  4JF5 A;  2WKI A;  2Z6C A;  4IVK A;  2R9W A;  3LR3 A;  5GHY A;  3UME A;  2ZMA A;  4PM6 A;  3OBF A;  1FQG A;  3BLM A;  4WEL A;  2O99 A;  3IT9 A;  4E3M A;  3RXX A;  3O86 A;  3AGF A;  2BG1 A;  2EWW A;  2V0W A;  3BFC A;  1LL9 A;  4EXO A;  4EER A;  4U0X A;  3NOU C;  3B42 A;  2WGW B;  4NXF A;  3UE0 A;  1KVM A;  3T4L A;  4E6W A;  3L7H A;  2LB9 A;  3TJZ C;  4Y15 A;  1K55 A;  3LCE A;  1ZC2 A;  3BEC A;  1WA9 A;  4E3I A;  3PAG A;  3A3J A;  3JVU A;  1BLC A;  5FDS A;  2PAV P;  2ZC3 B;  4DDS A;  4X25 A;  1MKM A;  5EPH A;  2B18 A;  5HAI A;  5F1F A;  5CRF A;  1CI9 A;  1RP5 A;  2ZJ9 A;  3GMW A;  4FCF A;  5FQI A;  5GL9 A;  3E98 A;  4CJN A;  4Y0O A;  4HY8 A;  1STZ A;  4K0W A;  5E2E A;  2O0Y A;  4I3I A;  4C3Q A;  1P9W A;  4B88 A;  4S2N A;  3O5Y A;  3FPW A;  3C8C A;  3EQU A;  3CWF A;  2X01 A;  1PIO A;  2KOI A;  1LI9 A;  4EWF A;  4ESP A;  2H28 A;  2ZQD A;  4Y5F A;  4LRZ E;  3VV4 A;  2PR6 A;  1P0Z A;  2JE5 A;  4R3A A;  4LPZ A;  5FQQ A;  2PBY A;  4JF6 A;  2ACG A;  4DE1 A;  1JNU A;  3HLF A;  2EXB A;  4WYY A;  2KX6 A;  5K5B A;  3CPT B;  2XEP A;  3GVB A;  1G28 A;  1IYO A;  1ES2 A;  1MWU A;  3MS6 A;  2JKG A;  3UMD A;  4LRX C;  2QPN A;  1ONH A;  1SKO A;  2OV5 A;  1AWI A;  1VQQ A;  4ME4 A;  3MQO A;  4P6B A;  4IVI A;  3MJQ A;  4FH2 A;  3HLC A;  3Q7V B;  3ZCZ A;  1E3U D;  1JWP A;  1CI8 A;  1TS7 A;  1AXB A;  4Z9Q A;  1PW8 A;  3RJU A;  2ZC7 A;  3HLE A;  2M7U A;  2Y2I A;  4CQH A;  1WYC A;  3QP2 A;  1YSP A;  4OQH A;  3ZG7 B;  4HOI A;  5DF9 A;  2J9O A;  3HBR A;  3IF6 B;  4K91 A;  2IWD A;  1PNE A;  2L1M A;  4F94 A;  3VFF A;  2WAD A;  4EBP A;  3A3E A;  1BLP A;  2J3T C;  3NI9 A;  2JKF A;  4WZ5 C;  4EET B;  1DJC A;  4P0M A;  1KE4 A;  1CEF A;  4WZ4 A;  1PYY A;  1LT0 A;  1NY0 A;  3G6O A;  1GSV A;  3KYE A;  4JF4 A;  4ID4 A;  1XFN A;  1DP9 A;  1S1Z A;  3PBS A;  4NG2 A;  3M6H A;  3IHA A;  4U0T A;  3LEQ A;  3LGO A;  4GJ4 A;  5GLC A;  4S2L A;  4GDB A;  3BYD A;  3UE3 A;  1XGJ A;  1K38 A;  4GS9 A;  4R70 A;  3QP1 A;  4OQG A;  2XA7 M;  5FAP A;  3H7W B;  3T4Q A;  2ZM0 A;  1DP6 A;  4S2N C;  2B5R A;  2OWH A;  3WS0 A;  1I5Q A;  1LI0 A;  2ZC4 B;  4OPR A;  5KSC A;  2QKP A;  4HJ4 A;  4AFI A;  5DTS A;  2XA7 S;  2V8C A;  4EBN A;  5L10 A;  1W8Q A;  3H82 B;  1OME A;  5FQJ A;  4UHU A;  4YWZ A;  1JTD A;  4R4R A;  1IYQ A;  5A93 A;  1BT5 A;  2QMI A;  3EGD C;  3SS3 A;  3ZFZ A;  3BW6 A;  2YKH A;  2HDS A;  4LGW A;  5EVI A;  4N9K A;  1Q2Q A;  4MDZ A;  5A90 A;  4IJG A;  3TSG A;  1XXM A;  1K6S A;  5GLA A;  3TW8 A;  3T4J A;  3VOY A;  1PI4 A;  1NRJ A;  2BTF P;  4YIN A;  3IX8 A;  1FIK A;  4KG6 A;  5TGF A;  3BLS A;  1KE3 A;  3C4O A;  1ZTU A;  1FCN A;  3G30 A;  4LCL A;  4ZJ2 A;  3PBT A;  1D7E A;  1PFL A;  3IWO A;  5TFQ A;  3VE4 A;  3GDI A;  2FH5 A;  4HP9 A;  4R38 A;  1MPL A;  3NOT C;  1S66 L;  3KYQ A;  3WS4 A;  1FCO A;  3A0R A;  1VET A;  1EWZ A;  3C7V A;  4BJP A;  1HLU P;  4RA7 A;  4KZ9 A;  4ZAM A;  1HVB A;  3BFD A;  3UB8 A;  1OT6 A;  3HJI A;  2WYX A;  5FAT A;  1BLS A;  5CHJ A;  2QYB A;  3DTK A;  4OPZ A;  4MNR A;  1XJ3 A;  2W1T A;  1MWS A;  4EQI A;  3S7O A;  5LBR A;  5HSQ A;  5DVA A;  5IS1 A;  3OCN A;  1FCM A;  2B02 A;  3T1R A;  1GHP A;  5FAS A;  4CLC A;  4EBL A;  1XJ6 A;  1CK3 A;  3IH9 A;  4NXG A;  2O9B A;  3ZG0 A;  3MFD A;  2NUT C;  3FWL A;  3ZG9 B;  4H6J A;  4BD1 A;  3KSH A;  4S2P A;  4Y3I A;  3U2A A;  4DE3 A;  4JKT A;  3PR6 A;  4WMC A;  3B47 A;  5AQ9 A;  3V3S A;  3K3D A;  1A0K A;  1S0W A;  3G2Y A;  3EWK A;  3TRC A;  1SKF A;  2ZM2 A;  1RGZ A;  2OSU A;  3LY3 A;  3MQ0 A;  4O7D A;  4XT2 A;  3C4P A;  4E3N A;  2GZA A;  2XGN A;  4GDN A;  2L4R A;  3TOI A;  2Y2J A;  3BJN A;  4FTX A;  1SHV A;  3VP0 A;  1GSW A;  1NJ4 A;  3BY9 A;  2ZLY A;  5FAQ A;  3MBZ A;  1DY6 A;  5L8M A;  3IF5 A;  2XSS A;  3PYP A;  3DTM A;  3T4K A;  5HDC A;  4FUW A;  1ES5 A;  4X68 A;  3GR2 A;  3LR4 A;  2ZMF A;  3PBQ A;  5L07 A;  2VKS A;  3F1N B;  2JHE A;  2V1B A;  2VA0 A;  3FG8 A;  3QP4 A;  4Q0I A;  4EQ1 A;  2Y2H A;  2M7V A;  1TS6 A;  3OCL A;  1HD8 A;  3K2N A;  1TVF A;  3S1Y A;  3M6B A;  4R1G A;  5EUA A;  2Y2M A;  3MSH A;  5FQK A;  1DJB A;  5J3W A;  3UB6 A;  3A0V A;  5FQM A;  4P87 A;  4GD6 A;  1I2S A;  5EOO A;  3NDG A;  1L0E A;  2VX8 A;  3HVF A;  3V67 A;  3MXQ A;  4L0L A;  3AGD A;  2GDN A;  2W3G A;  1UGU A;  1IEL A;  4Y7P A;  3ZG5 A;  4GHI A;  3ZNY A;  4I39 A;  4KUO A;  1VEU B;  5CED A;  5FA7 A;  4L9F A;  4I38 A;  2W3H A;  4BD0 A;  3T4T A;  5EE8 A;  4HES A;  4OVD A;  5HDS A;  1BUL A;  5L09 A;  3LFV A;  2DNS A;  5G4Y A;  3V3R A;  4UAA A;  3UPN A;  4U3T A;  4CLC C;  3JPU A;  3UO9 A;  2A24 A;  4ZRR A;  4LLO B;  3T50 A;  4JGR A;  3UE1 A;  3ZVW A;  4EEP A;  2Q0O A;  4X55 A;  3MKF A;  4R23 A;  1V9Y A;  4OOL A;  4PM7 A;  3DW0 A;  3GRJ A;  2VV7 A;  1Y54 A;  2HV1 A;  3UDF A;  2IA2 A;  4G3K A;  4UA6 A;  2QJ5 A;  3BY8 A;  3GV9 A;  2DMW A;  4P6Z S;  1NWZ A;  3IHB A;  2Y2G A;  2P7J A;  1YMS A;  4HNB A;  1YKD A;  5A91 A;  1MBL A;  3IBJ A;  3LO7 A;  4KZB A;  2E8I A;  1YLY A;  4OOM A;  3V39 A;  3V5M A;  1C3B A;  3VSK A;  1NLZ A;  4IUH A;  4LEN A;  1ESI A;  4WUJ A;  1K56 A;  2XRN A;  4MMN A;  3N6I A;  3DWZ A;  3C30 A;  2E8J A;  3IQA A;  4RX3 A;  2PBD P;  3LID A;  5FSR A;  3SZT A;  2P04 A;  4JGQ A;  2INW A;  2BLS A;  5GHX A;  3UNW A;  5HW3 A;  4K08 A;  4N92 A;  1H0M A;  3MF0 A;  5GLB A;  3NJA A;  2XLN A;  1WE4 A;  1OPX A;  3OPH A;  3ZG8 B;  4WL9 A;  4R6L A;  5CGW A;  1F2K A;  3ZVT A;  2JKT M;  1YLT A;  4MN5 A;  2ZOI A;  4MLL A;  4Y0T A;  4OP8 A;  4BEN A;  4KZ4 A;  4DE2 A;  1Y4O A;  2RL3 A;  1F9I A;  1IFQ A;  4GN2 A;  1J9M A;  4N9L A;  3JYI A;  5CEC A;  3GTC A;  1BSG A;  2VV6 A;  3UB7 A;  5E2H A;  3GQZ A;  3ISG A;  1CEG A;  1S6R A;  1JWZ A;  4R3J A;  4XUZ A;  2HJ9 C;  1W5D A;  2JKR M;  2HP6 A;  1ODV A;  4PM8 A;  3BRM A;  1T18 A;  4GOG A;  1OTD A;  2J8Y A;  2PHY A;  2Z2L B;  3ZGA B;  4LV2 A;  2JC7 A;  2HP9 A;  2I9V A;  4KQR A;  3T1S A;  5G4Z A;  3HUO A;  2C6W B;  1YQS A;  5HWV A;  4G3V A;  4PMA A;  5GHZ A;  3SW1 A;  4HH3 A;  1ES3 A;  2W3F A;  4MN6 A;  5F68 A;  3N4I A;  3LI8 A;  4O0P A;  2OAP 1;  1Y28 A;  2BAS A;  2ZQ7 A;  3G31 A;  1K54 A;  4HQA A;  4KG2 A;  3S7P A;  3T4S A;  4ZTK A;  4LFU A;  4QD4 A;  3IF6 A;  5HFO A;  2WAF A;  3D3O A;  2XR0 A;  5EM0 A;  2NUP C;  2P9V B;  1KGF A;  4FSF A;  2JBF A;  3IWI A;  2FZ0 A;  3LEZ A;  3HLG A;  3C7U A;  1SKO B;  1Z09 A;  5M1A A;  2XD5 A;  3LR0 A;  4I5S A;  4JGO A;  2PU2 A;  2RCX A;  4RYE A;  2IWB A;  2Y8H A;  4OPY A;  2PD8 A;  4IUK A;  1K55 C;  2V0U A;  1G6O A;  4S2O A;  1YMX A;  5DTT A;  4QHC A;  5F5Y A;  3A3D A;  2LB5 A;  1H8M A;  1XKZ A;  2FFY A;  3UB5 P;  5HDD A;  3P7N A;  3UY6 A;  4NET A;  5HD3 A;  1XA7 A;  5IT5 A;  3WRZ A;  3MQQ A;  4OH0 A;  4OON A;  1TS0 A;  2EXA A;  4DMZ A;  4KZ7 A;  3WS5 A;  2HJE A;  4LRY C;  4NXE A;  1XPB A;  2ZL1 B;  3ZHH A;  3IBR A;  1SZV A;  3PHY A;  4O8G A;  2DCF A;  3LI9 A;  3UDI A;  3C38 A;  4MBK A;  5HAR A;  5J7E A;  2VEA A;  3GEC A;  4CLC D;  2HDR A;  2PDR A;  1PI5 A;  3P09 A;  3IXG A;  4DE0 A;  3LIC A;  3ITA A;  1MZU A;  3LIF A;  4DN0 A;  3OLO A;  3KSF A;  1HTZ A;  1K25 A;  1JWV A;  5EV0 A;  4E3L A;  3F1P B;  5CTN A;  3CAX A;  4DXC A;  3O88 A;  4I3A A;  1LSV A;  1IEM A;  4ZDX A;  1RCJ A;  4DRT A;  5J8X A;  5F69 A;  2HPB A;  1OJG A;  3IXB A;  4WEJ A;  5HWW A;  1JVJ A;  3NOP C;  3T1X A;  5EEC A;  1YPR A;  3OC2 A;  2WK0 A;  4PM5 A;  1GHM A;  4KZ5 A;  4KZA A;  3I7J A;  3GSG A;  4UA9 A;  1K54 C;  3ICY A;  5A92 A;  5FI2 A;  4OKP A;  3ZDJ A;  3IS2 B;  1MKI A;  2G2U A;  3UB9 A;  3LYX A;  3O3V A;  1L0D A;  3HUN A;  4MEZ A;  3V50 A;  3BEB A;  2PR5 A;  4QY5 A;  1MWR A;  5DFY A;  3CUE A;  2K31 A;  1YLZ A;  3MMH A;  3OOV A;  1HZO A;  2Y2O A;  4OQ0 A;  4C6Y A;  1L0G A;  2WKR A;  2WKP A;  1KDW A;  4Z1W A;  4MN7 A;  3HLW A;  4HHD A;  1M40 A;  4JXS A;  5E43 A;  3S4X A;  3IXD A;  5KZH A;  3EGX C;  3NBL A;  2EWV A;  2HP5 A;  1G5U A;  1K6R A;  3D9Y A;  4EW7 A;  3R4K A;  2GNX A;  3T4O A;  5DTK A;  4FD8 A;  4HJ3 A;  3JVV A;  1VET B;  2IWC A;  2JN7 A;  3L9K A;  2H10 A;  2I72 A;  3A0S A;  2ZQ8 A;  4OLD A;  3S7Q A;  1L2S A;  2Y55 A;  4PM9 A;  5EVE A;  4ARZ A;  3P01 A;  3NUL A;  3S7N A;  4NXB A;  3IXH A;  4IBR A;  2UWX A;  4Y2F A;  5JYP A;  1OT9 A;  3E2K A;  3QHY A;  3EEA A;  1J3W A;  3RFB A;  2Y2Q A;  4CLC B;  2WKQ A;  3M2J A;  2ZD8 A;  3T1Q B;  5FL3 A;  3CI6 A;  4S2M A;  5HPF A;  5CGS A;  2WUQ A;  5DFX A;  4H6J B;  2Y91 A;  2AVX A;  3WS2 A;  1YAX A;  2ZBB A;  4II7 A;  5HL1 A;  1FR6 A;  4BMW A;  1TS8 A;  3EEH A;  2Q9M A;  1UWP X;  3A3F A;  2XRO A;  4G3W A;  5EVI C;  4Q0J A;  3Q82 A;  2A3U A;  1DJA A;  3G2Z A;  5DF7 A;  5DKL A;  2PYP A;  1T1B A;  3G4P A;  3BWL A;  4HEF A;  4BL2 A;  3UN7 A;  1KGG A;  4XT2 B;  5CHU A;  4OQI A;  4X6T A;  3E4Q A;  4LV1 A;  2H0Y A;  5FEG A;  1O07 A;  3R7W A;  2KDK A;  1K56 D;  4QU3 A;  3QNC A;  2ZQA A;  1SDN A;  5HL6 A;  5FEF A;  3FPV A;  2O9A A;  2OWJ A;  1PWG A;  2PYR A;  4PHT A;  1G68 A;  1K57 A;  1ZKJ A;  3SS5 A;  3F1O A;  3NDE A;  2WZX A;  2VJW A;  1N4O A;  4EUV A;  1DRM A;  4GD8 A;  5FI6 A;  2J3T D;  5HD5 A;  2J80 A;  1YM1 A;  4ZJ3 A;  3Q7Z A;  5U47 A;  2D01 A;  4R0Q A;  2WZZ A;  1NZO A; 
#chains in the Genus database with same CATH homology
 1DP9 A;  1S1Z A;  2HJ9 C;  3PBS A;  2JKR M;  4HP4 A;  5TBM A;  2G7U A;  5DKK A;  5MC7 A;  4UQI S;  3DBA A;  1ZHH B;  4B9O A;  1T1A A;  1ODV A;  4GJ4 A;  1UWN X;  1T18 A;  3PBO A;  1OTD A;  3NHQ A;  3UE3 A;  3H9W A;  2PHY A;  2ZOH A;  4GS9 A;  4HJ6 A;  4R70 A;  2I9V A;  2W1T B;  2XA7 M;  1H3Q A;  1P97 A;  5G4Z A;  1BYW A;  4ETZ A;  3H7W B;  3T4Q A;  1DP6 A;  2OWH A;  3LIE A;  4GHI B;  2QKP A;  4HJ4 A;  4BBU A;  5HWV A;  4G3V A;  4AFI A;  2XA7 S;  3SW1 A;  2W27 A;  3H82 B;  4HH3 A;  3E0Y A;  4F3L B;  3B33 A;  2W0N A;  3KSG A;  2W3F A;  4YOF A;  4MN6 A;  3F1N A;  4WEK A;  4FOF A;  5KSH A;  4ARZ B;  5F68 A;  4YWZ A;  3W2Z A;  5I5L A;  4B93 A;  1VB6 A;  2A24 B;  3LI8 A;  3EGD C;  5AVE A;  2ZMV A;  4PKY G;  4QPR A;  2VGL M;  3CLO A;  4CLC E;  3BW6 A;  2YKH A;  4IHQ A;  4M4X A;  1S67 L;  2CMN A;  5DJU A;  1KOU A;  4O0P A;  2EA9 A;  2OAP 1;  3LIA A;  1Y28 A;  4MDZ A;  1YSQ A;  4IJG A;  2BAS A;  5EFW A;  3EOI A;  3CIT A;  2VGL S;  1IOU A;  4HQA A;  3T4S A;  2V9A A;  3S7P A;  3T4J A;  3TW8 A;  1NRJ A;  4HI4 A;  1LL8 A;  1V9Z A;  3D3O A;  4MCW A;  4NKP A;  2NUP C;  4FSF A;  5DJT A;  1ZTU A;  3KX0 X;  5AJG A;  1N9O A;  4BBV A;  3PBT A;  1D7E A;  2FZ0 A;  2OAQ 1;  3VE4 A;  2OOL A;  3GDI A;  2FH5 A;  4HP9 A;  4R38 A;  1TD5 A;  3NOT C;  1S66 L;  3KYQ A;  3LR0 A;  4I5S A;  4JGO A;  1X0O A;  3A0R A;  1F98 A;  4EEU A;  2J3W A;  5J4E A;  3CUE C;  4BJP A;  1DP8 A;  2Y8H A;  1OTA A;  4PAU A;  2PD8 A;  4IUK A;  2V0U A;  2Y79 A;  5AVF A;  1G6O A;  5F5Y A;  4L9G A;  4Q0H A;  2LB5 A;  3UB8 A;  3LUQ A;  1OT6 A;  1H8M A;  3HJI A;  2PT7 A;  3K3C A;  3FC7 A;  4EU0 A;  2QHK A;  2QYB A;  1T19 A;  5HDD A;  3P7N A;  3R7W B;  5HD3 A;  1XJ3 A;  2M1C A;  2W1T A;  4L9E A;  2W3D A;  3S7O A;  5IT5 A;  5LBR A;  2VZW A;  5HSQ A;  3MQQ A;  5IS1 A;  2R78 A;  3OCN A;  4UEY A;  2B02 A;  1TS0 A;  2Z6D A;  4CLC A;  5KIZ A;  4DMZ A;  3KYZ A;  1XJ6 A;  3PBN A;  3F1O B;  2HJE A;  4NXG A;  4HH2 A;  4LRY C;  2O9B A;  5HPI A;  4NXE A;  2NUT C;  4F3L A;  4GCZ A;  4H6J A;  3IBR A;  3PHY A;  5HZH A;  4O8G A;  3KSH A;  3MFX A;  4RQ9 A;  4Y3I A;  3U2A A;  3LI9 A;  4ETX A;  3C38 A;  5J7E A;  3PR6 A;  3D72 A;  3B47 A;  2JKT I;  2VEA A;  3GEC A;  4CLC D;  2V1A A;  1XJ2 A;  3K3D A;  1D06 A;  2PDR A;  3EWK A;  3TRC A;  3PXP A;  3ULF A;  3LIC A;  1MZU A;  4PKY A;  3LIF A;  2VLG A;  4KUK A;  4DN0 A;  2KLI A;  3OLO A;  3KSF A;  4P6Z M;  5TBM B;  4NEE D;  3EQV A;  3E4P A;  1F5M A;  1LSW A;  2P08 A;  2QWS A;  2VV8 A;  3F1P B;  1W63 Q;  3MQ0 A;  2HF6 A;  4XT2 A;  2K7S A;  3CAX A;  1T1C A;  4JGP A;  4DJ3 A;  4BWI A;  2A2L A;  4I3A A;  5CX7 A;  1XFQ A;  3KO6 A;  1LSV A;  4BBT A;  2GZA A;  1MC0 A;  5F69 A;  3C2W A;  2L4R A;  2PD7 A;  3BJN A;  4KQO A;  1OJG A;  2JKR I;  1OJ5 A;  2MJ6 A;  1GSW A;  1N9L A;  4KQD A;  3BY9 A;  4WEJ A;  5HWW A;  5L8M A;  2XSS A;  3NOP C;  2W3E A;  3PYP A;  3T4K A;  5HDC A;  2W1R A;  3OC2 A;  2YKF A;  1S4R A;  2Z6C A;  3LR3 A;  3UME A;  3LR4 A;  2D02 A;  2ZMF A;  3OBF A;  3PBQ A;  2VKS A;  4WEL A;  2O99 A;  3F1N B;  2JHE A;  2V1B A;  2VA0 A;  3FG8 A;  4WF0 A;  4Q0I A;  3ICY A;  4EQ1 A;  2L0W A;  2EWW A;  2M7V A;  1TS6 A;  5TJJ A;  3OCL A;  3IS2 B;  1N9N A;  3K2N A;  2V0W A;  3BQ8 A;  4EXO A;  3UB9 A;  4EER A;  3LYX A;  3NOU C;  3B42 A;  4NXF A;  2PR5 A;  1S1Y A;  3T4L A;  5DFY A;  3CUE A;  2K31 A;  5J3W A;  3UB6 A;  2LB9 A;  5A8B A;  3TJZ C;  3MMH A;  3OOV A;  3A0V A;  1GSX A;  1P9R A;  1WA9 A;  3JVU A;  3UE6 A;  2WKR A;  2WKP A;  2VX8 A;  4Z1W A;  4MN7 A;  1MKM A;  1NLY A;  2GJ3 A;  4HHD A;  3V67 A;  2B18 A;  3MXQ A;  4L0L A;  3EGX C;  2W3G A;  2EWV A;  3H7W A;  4E04 A;  1UGU A;  4EW7 A;  3R4K A;  2GNX A;  4GHI A;  4I39 A;  4KUO A;  3T4O A;  1LSX A;  3E98 A;  4L9F A;  4I38 A;  2W3H A;  4HJ3 A;  4HY8 A;  1STZ A;  3H82 A;  3JVV A;  5HWT A;  3T4T A;  2JN7 A;  4I3J A;  5HDS A;  1EW0 A;  3LFV A;  2O0Y A;  4I3I A;  3A0S A;  5G4Y A;  3S7Q A;  2O9C A;  4CLC C;  4ARZ A;  1P9W A;  4EES A;  3F1P A;  3P01 A;  3O5Y A;  3S7N A;  4NXB A;  2A24 A;  4ZRR A;  4LLO B;  3FPW A;  3C8C A;  3T50 A;  3EQU A;  3HJK A;  4Y2F A;  4JGR A;  3RH8 B;  3LIB A;  3CWF A;  1OT9 A;  2KOI A;  4EEP A;  5IU1 A;  3EEA A;  2H28 A;  4GW9 A;  3RFB A;  1V9Y A;  4OOL A;  4Y5F A;  3RTY A;  4LRZ E;  2VV7 A;  3VV4 A;  2HV1 A;  4CLC B;  2WKQ A;  2IA2 A;  2PR6 A;  4G3K A;  2QJ5 A;  1P0Z A;  3BY8 A;  2DMW A;  3LR5 A;  5FL3 A;  3CI6 A;  4P6Z S;  1NWZ A;  4R3A A;  5HPF A;  4GS9 B;  4LPZ A;  5DFX A;  1OTI A;  2P7J A;  4H6J B;  4HNB A;  1YKD A;  1JNU A;  3IBJ A;  1YAX A;  2ZBB A;  2KX6 A;  4II7 A;  2GX5 A;  5K5B A;  4HIA A;  1G28 A;  4BMW A;  4OOM A;  1S4S A;  1TS8 A;  5C5K A;  3UMD A;  4LRX C;  3EEH A;  3IS2 A;  1UWP X;  2XRO A;  4G3W A;  3MR0 A;  4ME4 A;  1NLZ A;  4IUH A;  3MQO A;  4Q0J A;  3MJQ A;  4WUJ A;  5DKL A;  2XRN A;  4MMN A;  3BQA A;  2PYP A;  1T1B A;  3C30 A;  3LID A;  4WN5 A;  3BWL A;  2QJ7 A;  4YNR A;  2P04 A;  1TS7 A;  4XT2 B;  4JGQ A;  2INW A;  1OTE A;  3VOL A;  4K08 A;  1XJ4 A;  3MF0 A;  3E4Q A;  2HGV A;  5F6A A;  3NJA A;  2M7U A;  1OPX A;  3R7W A;  4CQH A;  2KDK A;  1OTB A;  1YSP A;  4WL9 A;  5HL6 A;  3E4O A;  4R6L A;  3FPV A;  1VHM A;  4HOI A;  2JKT M;  3ZYT A;  2O9A A;  2OWJ A;  5DF9 A;  2PYR A;  4MN5 A;  4PHT A;  2ZOI A;  3PBR A;  4O01 A;  3F1O A;  2L1M A;  2VJW A;  3KSI A;  4EUV A;  2J3T C;  1DRM A;  1F9I A;  1IFQ A;  2J3T D;  4EET B;  3HCY A;  5HD5 A;  3TE8 A;  3ZQ5 A;  2J80 A;  1TF1 A;  2VV6 A;  1LT0 A;  4WLA A;  3UB7 A;  3VE3 A;  4UQI M;  3G6O A;  1GSV A;  4GLQ A;  1XFN A;  2D01 A;  1W63 M;  4DJ2 A;  2K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...