2QJ8A

Crystal structure of an aspartoacylase family protein (mlr6093) from mesorhizobium loti maff303099 at 2.00 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
330
structure length
314
Chain Sequence
SEAPHLTFDLDTPGVSTGHLVVPKGADCEALSLPVFSCNRGEGPSLLITGGNHGNELQGPILARRLVKWLPEAQRCGRIIIVPEINPLAVQAWTRNTPIDGKNLNRVFPGRSDGSVSERIADAISRLLLPVVDTVLDLHSFGPTWDCAPSIISHPIADIDQMTKTVSISKAFKLPVTLLWEHNETDGMFDTLVHRQGKTFICTEFGGGLTIYEAGVRNGLIALGLVKGKAGQTLETTSSDQLKSPSPGIFEPRCSVMDEVEQGDVVGVLHPMGSLSAASIDIRAQSKSTVFAIRSAMYVQGNEEVAILARPLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlr6093 protein
publication title Crystal structure of uncharacterized protein mlr6093 (NP_106651.1) from Mesorhizobium loti at 2.00 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
total genus 88
structure length 314
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2qj8A00
2GLFA 2OR4A 1R3NA 2V8VA 4Q7AA 2PVVA 3PFOA 2NSMA 1CPSA 3D67A 1CX8A 2PJ7A 3LWUA 1UWYA 1F57A 3H8EA 4G1PA 1YMEA 1CP6A 3I1UA 4ZY2A 4CPAA 2XEJA 3B35A 3D7FA 4OC2A 3VATA 8CPAA 1EE3P 2ZEOA 1VIXA 1TF8A 1VHOA 2PRQA 3D4UA 1YW4A 3PBBA 3DGVA 3KASA 4NJQA 1CP7A 1AYEA 1H8LA 1AMPA 2Q4ZA 3RAMA 3PB8X 3CPAA 3HLPA 4NGPA 2PJCA 2DEAA 2V8GA 3IJ3A 2RFHA 3QNVA 2OOTA 3FF3A 2PCUA 5JGFA 1QMUA 2AFSA 2PJ9A 1IGBA 4ZYQA 3KGQA 1HDQA 2CIJA 2IJZA 5K8NA 1BLLE 3D68A 4ZX8A 3SJEA 3H8FA 5IB9A 4FBEA 2QVPA 2BOAA 4WJBA 3CPXA 1YLOA 3MN8A 3NH8A 2PJ3A 4ZI6A 4R76A 2ZENA 2V77A 3V38A 1YW6A 1ZLHA 4NJRA 3KL9A 3S9MA 4RUHA 4YU9A 4F8ZA 4DUKA 2AFOA 3H8GA 2ZEFA 2QJ8A 5F09A 1Z2LA 3KR4A 1LANA 4MMOA 2AFUA 2C6GA 1Z5RA 4P4JA 2O53A 1DE4C 3VH9A 3B3CA 5D29A 2GREA 5K8OA 3S9LA 2ZELA 1NSAA 1XRYA 2VL1A 5LRJA 3SI1A 2CF4A 4A38A 1PCAA 3B2YA 4Z65A 4ZY1A 2V8HA 4F9VA 4EMEA 4OKOA 2RB7A 2F8HA 3PEIA 4DJLA 4UEEA 3PFEA 4OC5A 3B3WA 1BPNA 1Y0RA 1R43A 4P45A 3PB9X 3B7IA 1TXRA 3NH4A 3BHXA 3PB6X 3T8WA 3VARA 1ZG7A 2ZOFA 5DS0A 1CG2A 4FUUA 4P4BA 2IMOA 2PJAA 2WZNA 3KZWA 5LRGA 2PIZA 3IFEA 4FAIA 3WABA 3ISZA 3MRUA 1OBRA 2QYVA 4EFDA 4O23A 3KQZA 2EK8A 4MHPA 4OMEA 3HUVA 1ARMA 3ISXA 1PYTB 5CPAA 5CBMA 4UIAA 2CTBA 3FJUA 3WC5A 3WC6A 4MRIA 3B3TA 4GM5A 4OIWA 2Q51A 2FVGA 3K9TA 1HDUA 1TKJA 4MXUA 2PJ8A 1ZLIA 5ELYA 2POKA 3L2NA 4AXVA 1BPMA 2PIYA 4PQAA 5HVFA 4A39A 1XBUA 1XJOA 4A94A 4X8IA 1F2PA 2IQ6A 3FECA 2BO9A 3KQXA 3N5FA 1Z8LA 4NGSA 4NGMA 4ONWA 3NA6A 3IEHA 3K2KA 4A37A 1GYTA 4PXDA 1DTDA 4NGTA 2V8DA 2NYQA 1F2OA 3FMCA 1LAPA 4JZ0A 4X3RA 4OC1A 2ZEMA 2ZEDA 5I4MA 4MHZA 1CPXA 4OC0A 1Y0YA 1QQ9A 1TF9A 3TX8A 4UEFA 4UEZA 3FEEA 3RBUA 1ZG8A 3D7HA 2JEWA 2EK9A 4YWYA 3IO1A 2PJ6A 3SJGA 1BAVA 2AFZA 4B6ZA 2F7VA 3WC7A 4MHYA 1XMBA 3FVLA 2PJ0A 4TWEA 2JBJA 2XEGA 2JBKA 4PXCA 5LYFA 4R6TA 3D66A 3PB7X 2ZEHA 4MHNA 4PPZA 4WWVA 1YSJA 2PVWA 4X2TA 3BI0A 3SI0A 4TNUA 4OIDA 2XEIA 1M4LA 2WYRA 2C6CA 4P44A 1Q7LA 5HVHA 2GU2A 3CT9A 2ABZA 4OC3A 4UIBA 5K8PA 1FT7A 2PJ4A 4IHMA 3FEDA 5LYLA 2I3CA 5HXDA 3FX6A 3V7ZA 1XFOA 3NFZA 3SI2A 2PJBA 3JRUA 4P6YA 5J1QA 1JQGA 3KR5A 1LFWA 3B3VA 3GUXA 5THWA 4P10A 2ANPA 4LQGA 3WT4A 4EWTA 2AFXA 5LYDA 3SJFA 4NFRA 5JM6A 4W9YA 4ZX9A 3CDXA 1LAMA 5LRKA 7CPAA 4PXBA 4PXEA 4JYWA 1ARLA 1CBXA 3IIBA 2ZEEA 2CTCA 5JH9A 1ELLP 3KHZA 3S9NA 3KHXA 1KWMA 3SJXA 3KI9A 2PE3A 1TKHA 2Q43A 2C1CA 5D8NA 4MCPA 4F9UA 1RTQA 1HEEA 2C6PA 3IC1A 4R8FA 2G9DA 2AFMA 4ZY0A 2ZEPA 2XEFA 1VHEA 4OC4A 1IY7A 2O4HA 5K8MA 3GB0A 3IWWA 2HC9A 4FWUA 4R7MA 2PJ1A 3GLJA 2ZEGA 3BXMA 3D7DA 4KSIA 3DLJA 3PB4X 4P4DA 2HB6A 3D7GA 3NH5A 1TKFA 1LOKA 1Y7EA 4IAVA 2BCOA 3PBEA 5HVGA 3PRTA 3TC8A 4UF4A 4IK2A 4P4IA 4H2KA 5LYIA 2PJ2A 4MCQA 2AFWA 4P4EA 4NGRA 4NGQA 3FH4A 2GLJA 1ELMP 4OP4A 3BI1A 4BD9A 2J9AA 4MCRA 4P4FA 2ZOGA 1LCPA 3LMSA 4DYOA 1FNOA 4MCSA 1VGYA 4NGNA 6CPAA 4K3NA 2EWBA 3B3SA 1ZG9A 2PJ5A 3RZAA
chains in the Genus database with same CATH superfamily
4CAFA 5J8FA 2GLFA 2OR4A 1R3NA 2V8VA 3DR8A 2ATRA 2PVVA 3PFOA 4MFPA 4Q7AA 2NSMA 2Z10A 4UCPA 4GXHA 1CPSA 3D67A 1CX8A 4YFJA 2PJ7A 4PV6A 3LWUA 4AVAA 1IOFA 1UWYA 1F57A 4JWPA 1MJAA 3H8EA 4G1PA 1Z4RA 2JDDA 2OZUA 4A30A 1YMEA 1CP6A 1Q2DA 3I1UA 4UCMA 2D4OA 4UWIA 4ZY2A 2PC1A 4CPAA 1Z8TA 3GY9A 4KOSA 3DSBA 1CJWA 2Z0ZA 4HNYB 2Q7BA 2XEJA 3B35A 3D7FA 4OC2A 4Q38A 2PR1A 4A2ZA 4R3KA 3VATA 2EO8A 4AVCA 4CGNA 3E0KA 4E8OA 2P6EA 1EE3P 2P6GA 2ZEOA 1VIXA 3C26A 1TF8A 1FY7A 1VHOA 2PRQA 1YW4A 3D4UA 3DGVA 3PBBA 3KASA 1YVKA 3LACA 4NJQA 2CXAA 4M6GA 1CP7A 1AYEA 4A33A 4DNCA 1H8LA 4BMHA 4UFXA 4B5OA 4B11A 3SHPA 1AMPA 2Q4ZA 5ISVA 3RAMA 5AG6A 4CYQA 4FD5A 2Z3PA 3PB8X 2H5MA 3CPAA 4KUBA 2ODFA 1IU8A 3HLPA 3TCVA 4NGPA 4CS0B 2PJCA 1RO5A 5A28A 1Y9KA 3ZZIA 2B5GA 2YNCC 1IICA 2DEAA 2V8GA 3IJ3A 4CYNA 2RFHA 1I1DA 3QNVA 4Q36A 4QVTA 3FF3A 2OOTA 2PCUA 1X10A 5JGFA 1QMUA 2AFSA 4KOXA 4FD7A 2PJ9A 1IGBA 4ZYQA 3KGQA 2WPXA 1HDQA 2CIJA 1QSOA 2IJZA 3R96A 5K8NA 1BLLE 2CNTA 3D68A 4ZX8A 3SJEA 4L8AA 2FE7A 3H8FA 4HNWB 4MHDA 5IB9A 1ON0A 1MJ9A 2QVPA 4FBEA 4MFKA 2BOAA 4U9YA 2CY2A 4WJBA 3FRMA 1XF8A 5FVJA 2DPSA 3CPXA 1YLOA 3MN8A 4BBHA 3NH8A 5C82A 5KTAA 3GYAA 2PJ3A 4ZI6A 4R76A 2REFA 1IYKA 4UBRA 2ZENA 2V77A 4AB7A 2QECA 3V38A 1XOVA 4B10A 5G20A 4J3GA 2R1IA 3CXSA 3RO0A 1WWZA 2BEIA 2EUIA 1YW6A 1ZLHA 2Q7SA 3H5ZA 3BLNA 2Z11A 4NJRA 3KL9A 1YQEA 3S9MA 4RUHA 3S6FA 4CGOA 4YU9A 1M4DA 2Z3OA 4M6HA 4DUKA 3B8GA 2AFOA 3H8GA 4NCZA 4F8ZA 2ZEFA 2QJ8A 5F09A 4CAEA 1Z2LA 2JLMA 3KR4A 1S5KA 1LANA 4U9ZA 4MMOA 1S7KA 4MY0A 5G22A 4B5PB 2AFUA 4M6IA 2C6GA 2OZHA 1YX0A 4QUSA 3R9EA 4QC6A 1Z5RA 4KZTA 2O53A 4P4JA 4PSWA 5G21A 1Y7RA 1DE4C 3VH9A 3B3CA 5D29A 1RXTA 3RNZA 2G3TA 2GREA 5K8OA 4KUAA 1AUGA 5EBVA 3S9LA 2ZELA 2PDOA 1L0CA 2AJ6A 1NSAA 1KUXA 1XRYA 1Z4EA 2JEVA 2Q04A 2VL1A 4KLWA 5LRJA 3SI1A 2CF4A 1S7LA 5AG4A 4A38A 1PCAA 1YLEA 3B2YA 4Y49B 4Z65A 4ZY1A 1IB1E 2OH1A 2Q4YA 2V8HA 2BUEA 4F9VA 4KS9A 4EMEA 2VQYA 4OKOA 1YVOA 2RB7A 4FD4A 2CNMA 2O28A 2F8HA 4KSFA 4QBJA 3G3SA 3PEIA 2OB0A 2J8RA 2ZPAA 4UEEA 3PFEA 4OAEA 4CYOA 4DJLA 3P2HA 4Y49C 4M85A 4OC5A 4CGPA 3B3WA 3IWEA 4KVOE 2G3AA 4KOYA 4MY3A 4ZGYB 1B6BA 4UWJA 4MJ8A 1BPNA 3JTKA 3R9GA 3CZXA 2J8NA 1Y0RA 1R43A 4C2YA 4P45A 2PQ8A 3CXQA 1UFHA 4UCNA 3PB9X 3TO6A 2J8MA 3B7IA 2B3VA 2KCWA 2Z3MA 2P0WA 4QB9A 1TXRA 3NH4A 4KVME 3BHXA 2FXFA 4LX9A 3VWDA 2JDCA 3PB6X 1YK3A 3FXTA 4HPSA 4KSAA 1TIQA 3T8WA 3VARA 3SXNA 3WR7A 1ZG7A 2ZOFA 2FCKA 2YGWA 2ZW7A 1KZFA 5DS0A 1CG2A 2B58A 3DNSA 4FUUA 2I00A 4P4BA 5AGEA 4GS4A 2IMOA 4LUAA 2PJAA 2PR8A 2WZNA 1NMTA 3KZWA 4KOWA 5LRGA 2WPWA 1S60A 2PIZA 3IFEA 4F6AA 4FAIA 5JQ4A 3TO7A 3WABA 1R57A 3ISZA 3MRUA 4MFZA 4ONUA 1OBRA 2VI7A 2QYVA 4KVXA 4L89A 5EC4A 4B13A 4EFDA 4O23A 3DDDA 3KQZA 3H4QA 2EK8A 3V8IA 5A27A 4MHPA 4OMEA 1Q2YA 1M4IA 3HUVA 3I3GA 4HNXB 1ARMA 3D2PA 3ISXA 4K30A 1PYTB 2VEZA 5CPAA 5CBMA 1K4JA 2B5GB 4KORA 4NXYA 4UIAA 2CTBA 1MJBA 3CXPA 3FJUA 4UFVA 3WC5A 3WC6A 4MRIA 4A95A 3T90A 3B3TA 3F0AA 2OZGA 4GM5A 4XPDC 4OIWA 2Q51A 1Y9WA 2FVGA 3K9TA 1HDUA 1TKJA 3IU2A 2PJ8A 4MXUA 2IL4A 3R9FA 1ZLIA 3TOAA 5ELYA 2POKA 3L2NA 4CRYB 2WUUA 5IX3A 4AXVA 1BPMA 2PIYA 5H86A 4PQAA 4MI4A 5HVFA 4ORFA 4A39A 1XBUA 2VBQA 2B4BA 1A2ZA 1XJOA 4A94A 4X8IA 2FSRA 5DWNA 1F2PA 4MFLA 2K5TA 3EO4A 2IQ6A 4H6ZA 3FECA 1XMTA 2EBJA 2X7BA 2BO9A 3KQXA 3N5FA 1Z8LA 4NGSA 4NGMA 4ONWA 3NA6A 4NSQA 3IEHA 2NMTA 5AG7A 1WK4A 3K2KA 4A37A 1GYTA 4RN7A 3TO9A 4PXDA 4CGLA 5IB0A 1DTDA 4LQ6A 4NGTA 4KOVA 2GANA 5F48A 2V8DA 3KKWA 3ZJ0A 2NYQA 3NE7A 1PUAA 1F2OA 3FMCA 1LAPA 1YGHA 4IF5A 4JZ0A 4X3RA 1OZPA 4CAXA 4OC1A 4AG7A 2ZEMA 2ZEDA 5I4MA 4MHZA 1CPXA 4OC0A 4E2AA 3R95A 4RS2A 2R98A 1Y0YA 3PGPA 4OADA 1QQ9A 5F49A 1TF9A 3TX8A 2G0BA 1Q2CA 4UEZA 3FEEA 4UEFA 3IWGA 1ZG8A 4YRHA 3RBUA 2FIWA 5F46A 3G8WA 1VKCA 5HMNA 2F5IA 3JVNA 4E0AA 3D7HA 4F0XA 2JEWA 2Q4VA 2EK9A 4UFWA 3F5BA 3TE4A 4R9MA 4YWYA 4B12A 1I12A 2P6FA 5I0CA 2Z3NA 4AG9A 4A32A 4A31A 3IO1A 1QSTA 2FT0A 4CRZB 2PJ6A 3SJGA 1BAVA 4CAVA 3T9YA 2AFZA 4B6ZA 5DWMA 2F7VA 2R7HA 2I79A 3I9SA 4C2XA 3WC7A 4MHYA 1N71A 1XMBA 3FVLA 2PJ0A 4TWEA 4JXRA 2JBJA 3S6GA 1V0CA 2ZW5A 1SQHA 3QB8A 1J4JA 2XEGA 3S6HA 2JBKA 4PXCA 2QMLA 3QAYA 2B4DB 4XNHB 5LYFA 4R6TA 3D66A 3PB7X 4PK2A 3W91A 1GHEA 2VXKA 2ZEHA 4MHNA 4PPZA 4WWVA 1YSJA 2PVWA 2B4DA 3BI0A 4X2TA 4MBUA 4NEXA 4TNUA 3SI0A 4JLYA 4R87A 4OIDA 2Z3KA 2ARHA 1JWQA 3D8PA 2BSWA 5EMIA 5F47A 2XEIA 2C27A 3N7ZA 4XNHC 1M4LA 4H89A 2WYRA 2C6CA 4P44A 4CGMA 1Q7LA 5HVHA 2GU2A 3CT9A 4II9A 2ABZA 4OC3A 4UIBA 2OU2A 5K8PA 4U5YA 3UY5A 1KUVA 1NE9A 4AVBA 1FT7A 2PJ4A 3LD2A 4IHMA 5H84A 3FEDA 5LYLA 3TFYA 1YR0A 2I3CA 2YNDA 5HXDA 3FX6A 3V7ZA 1XFOA 3NFZA 4MFQA 2PJBA 3SI2A 3JRUA 2GFQA 1M44A 4P6YA 5J1QA 2BL1A 2RC4A 3NE8A 4C7HA 2VZZA 3D3SA 1M4GA 1JQGA 4R57A 3TT2A 3KR5A 1BOBA 1LFWA 3B3VA 3GUXA 4BINA 4KLVA 1S7NA 3BJ7A 3K9UA 1P0HA 5THWA 4P10A 2Z3LA 2ANPA 3FNCA 4YGOA 3FB3A 1S3ZA 4LQGA 3WT4A 4EWTA 2FL4A 2AFXA 2Q44A 1Z8WA 1KUYA 3LODA 2HV2A 4XPLA 5LYDA 3VWEA 2PRBA 3SJFA 3GKRA 3FYNA 5HH1A 2ZXVA 4NFRA 4W9YA 5JM6A 4ZX9A 3CDXA 1LAMA 2R8VA 4I49A 7CPAA 5LRKA 4PXBA 4JJXA 4PXEA 1BO4A 3P2FA 3OWCA 2B3UA 4JYWA 2D4PA 3EY5A 4H6UA 1ARLA 1CBXA 5JPHA 3IIBA 1B87A 2ZEEA 2CTCA 5JH9A 1ELLP 2Y0MA 3KHZA 3EC4A 4KOTA 3S9NA 3KHXA 3MGDA 5AG5A 1QSMA 2DXQA 1KWMA 1XIXA 3SJXA 3EFAA 4OLLA 2GIVA 4B14A 3KI9A 2PE3A 4M3SA 1TKHA 2YNCA 3FBUA 4UA3A 2Q43A 2FS5A 2C1CA 1U6MA 5IV0A 5D8NA 4MCPA 1P4NA 4F9UA 1RTQA 2GE3A 3JUWA 5BWAB 3PP9A 5KTDA 1HEEA 2C6PA 3IC1A 2CNSA 2G9DA 2AFMA 4R8FA 4HKFA 4ZY0A 5GCNA 2ZEPA 2XEFA 2EVNA 1M1DA 8CPAA 4JXQA 4KOUA 1VHEA 4CAWA 4OC4A 2HQYA 1IY7A 2A4NA 2O4HA 5K8MA 3GB0A 3IWWA 2HC9A 4FWUA 4R7MA 3RYOA 5J8CA 2PJ1A 1X12A 3GLJA 2ZEGA 5E96A 3BXMA 3D7DA 1ZO0A 2FIAA 3DLJA 3PZJA 4FD6A 1CM0A 4KSIA 1XEBA 3PB4X 2HB6A 3D7GA 4PK3A 4P4DA 1XE4A 3NH5A 1TKFA 5KTCA 3SXOA 1LOKA 3GIUA 3IU1A 2ZW6A 3D2MA 1NSLA 4C7IA 4PSXA 3W6XA 1Y7EA 2DF5A 1S7FA 4IAVA 4XPKA 2BCOA 4EVYA 1PU9A 3PBEA 3EXNA 4ZBGA 5HVGA 3PRTA 3TC8A 4UF4A 4C2ZA 4IK2A 4P4IA 5C88A 4H2KA 5LYIA 1VHSA 1QSNA 2HUZA 2QIRA 2AE6A 2PJ2A 4MCQA 1IOIA 3A9LA 4CYPA 2AFWA 4P4EA 4NGRA 4R3LA 4NGQA 3FH4A 2GLJA 2REEA 4B5PA 1Z9UA 1ELMP 3FIXA 4OP4A 4MFJA 3BI1A 4BD9A 2VZYA 2YNEA 5G1ZA 2J9AA 3F8KA 1YREA 4MCRA 3S6KA 3IGRA 2ZW4A 4P4FA 1IIDA 3QAHA 4JD6A 1QSRA 2ZOGA 2PSWA 1LCPA 4X5KA 3TTHA 3LMSA 4DYOA 1I21A 1FNOA 2Q0YA 4IUSA 5CNPA 4MCSA 4RI1A 1VGYA 4NGNA 4XPDB 2WSAA 6CPAA 1IYLA 3DR6A 3R1KA 4K3NA 2EWBA 2DPTA 3B3SA 1ZG9A 2PJ5A 4C68A 4F0YA 1Z8XA 4NF1A 1LRZA 1MK4A 3TOBA 3RZAA 3BJ8A 3W6SA
chains in the Genus database with same CATH topology
2GLFA 2OR4A 1R3NA 2V8VA 4Q7AA 2PVVA 3PFOA 2NSMA 1CPSA 3D67A 1CX8A 2PJ7A 3LWUA 1UWYA 1F57A 3H8EA 4G1PA 1YMEA 1CP6A 3I1UA 4ZY2A 4CPAA 2XEJA 3B35A 3D7FA 4OC2A 3VATA 8CPAA 1EE3P 2ZEOA 1VIXA 1TF8A 1VHOA 2PRQA 3D4UA 1YW4A 3PBBA 3DGVA 3KASA 4NJQA 1CP7A 1AYEA 1H8LA 1AMPA 2Q4ZA 3RAMA 3PB8X 3CPAA 3HLPA 4NGPA 2PJCA 2DEAA 2V8GA 3IJ3A 2RFHA 3QNVA 2OOTA 3FF3A 2PCUA 5JGFA 1QMUA 2AFSA 2PJ9A 1IGBA 4ZYQA 3KGQA 1HDQA 2CIJA 2IJZA 5K8NA 1BLLE 3D68A 4ZX8A 3SJEA 3H8FA 5IB9A 4FBEA 2QVPA 2BOAA 4WJBA 3CPXA 1YLOA 3MN8A 3NH8A 2PJ3A 4ZI6A 4R76A 2ZENA 2V77A 3V38A 1YW6A 1ZLHA 4NJRA 3KL9A 3S9MA 4RUHA 4YU9A 4F8ZA 4DUKA 2AFOA 3H8GA 2ZEFA 2QJ8A 5F09A 1Z2LA 3KR4A 1LANA 4MMOA 2AFUA 2C6GA 1Z5RA 4P4JA 2O53A 1DE4C 3VH9A 3B3CA 5D29A 2GREA 5K8OA 3S9LA 2ZELA 1NSAA 1XRYA 2VL1A 5LRJA 3SI1A 2CF4A 4A38A 1PCAA 3B2YA 4Z65A 4ZY1A 2V8HA 4F9VA 4EMEA 4OKOA 2RB7A 2F8HA 3PEIA 4DJLA 4UEEA 3PFEA 4OC5A 3B3WA 1BPNA 1Y0RA 1R43A 4P45A 3PB9X 3B7IA 1TXRA 3NH4A 3BHXA 3PB6X 3T8WA 3VARA 1ZG7A 2ZOFA 5DS0A 1CG2A 4FUUA 4P4BA 2IMOA 2PJAA 2WZNA 3KZWA 5LRGA 2PIZA 3IFEA 4FAIA 3WABA 3ISZA 3MRUA 1OBRA 2QYVA 4EFDA 4O23A 3KQZA 2EK8A 4MHPA 4OMEA 3HUVA 1ARMA 3ISXA 1PYTB 5CPAA 5CBMA 4UIAA 2CTBA 3FJUA 3WC5A 3WC6A 4MRIA 3B3TA 4GM5A 4OIWA 2Q51A 2FVGA 3K9TA 1HDUA 1TKJA 4MXUA 2PJ8A 1ZLIA 5ELYA 2POKA 3L2NA 4AXVA 1BPMA 2PIYA 4PQAA 5HVFA 4A39A 1XBUA 1XJOA 4A94A 4X8IA 1F2PA 2IQ6A 3FECA 2BO9A 3KQXA 3N5FA 1Z8LA 4NGSA 4NGMA 4ONWA 3NA6A 3IEHA 3K2KA 4A37A 1GYTA 4PXDA 1DTDA 4NGTA 2V8DA 2NYQA 1F2OA 3FMCA 1LAPA 4JZ0A 4X3RA 4OC1A 2ZEMA 2ZEDA 5I4MA 4MHZA 1CPXA 4OC0A 1Y0YA 1QQ9A 1TF9A 3TX8A 4UEFA 4UEZA 3FEEA 3RBUA 1ZG8A 3D7HA 2JEWA 2EK9A 4YWYA 3IO1A 2PJ6A 3SJGA 1BAVA 2AFZA 4B6ZA 2F7VA 3WC7A 4MHYA 1XMBA 3FVLA 2PJ0A 4TWEA 2JBJA 2XEGA 2JBKA 4PXCA 5LYFA 4R6TA 3D66A 3PB7X 2ZEHA 4MHNA 4PPZA 4WWVA 1YSJA 2PVWA 4X2TA 3BI0A 3SI0A 4TNUA 4OIDA 2XEIA 1M4LA 2WYRA 2C6CA 4P44A 1Q7LA 5HVHA 2GU2A 3CT9A 2ABZA 4OC3A 4UIBA 5K8PA 1FT7A 2PJ4A 4IHMA 3FEDA 5LYLA 2I3CA 5HXDA 3FX6A 3V7ZA 1XFOA 3NFZA 3SI2A 2PJBA 3JRUA 4P6YA 5J1QA 1JQGA 3KR5A 1LFWA 3B3VA 3GUXA 5THWA 4P10A 2ANPA 4LQGA 3WT4A 4EWTA 2AFXA 5LYDA 3SJFA 4NFRA 5JM6A 4W9YA 4ZX9A 3CDXA 1LAMA 5LRKA 7CPAA 4PXBA 4PXEA 4JYWA 1ARLA 1CBXA 3IIBA 2ZEEA 2CTCA 5JH9A 1ELLP 3KHZA 3S9NA 3KHXA 1KWMA 3SJXA 3KI9A 2PE3A 1TKHA 2Q43A 2C1CA 5D8NA 4MCPA 4F9UA 1RTQA 1HEEA 2C6PA 3IC1A 4R8FA 2G9DA 2AFMA 4ZY0A 2ZEPA 2XEFA 1VHEA 4OC4A 1IY7A 2O4HA 5K8MA 3GB0A 3IWWA 2HC9A 4FWUA 4R7MA 2PJ1A 3GLJA 2ZEGA 3BXMA 3D7DA 4KSIA 3DLJA 3PB4X 4P4DA 2HB6A 3D7GA 3NH5A 1TKFA 1LOKA 1Y7EA 4IAVA 2BCOA 3PBEA 5HVGA 3PRTA 3TC8A 4UF4A 4IK2A 4P4IA 4H2KA 5LYIA 2PJ2A 4MCQA 2AFWA 4P4EA 4NGRA 4NGQA 3FH4A 2GLJA 1ELMP 4OP4A 3BI1A 4BD9A 2J9AA 4MCRA 4P4FA 2ZOGA 1LCPA 3LMSA 4DYOA 1FNOA 4MCSA 1VGYA 4NGNA 6CPAA 4K3NA 2EWBA 3B3SA 1ZG9A 2PJ5A 3RZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLF A;  2OR4 A;  1R3N A;  2V8V A;  4Q7A A;  2PVV A;  3PFO A;  2NSM A;  1CPS A;  3D67 A;  1CX8 A;  2PJ7 A;  3LWU A;  1UWY A;  1F57 A;  3H8E A;  4G1P A;  1YME A;  1CP6 A;  3I1U A;  4ZY2 A;  4CPA A;  2XEJ A;  3B35 A;  3D7F A;  4OC2 A;  3VAT A;  8CPA A;  1EE3 P;  2ZEO A;  1VIX A;  1TF8 A;  1VHO A;  2PRQ A;  3D4U A;  1YW4 A;  3PBB A;  3DGV A;  3KAS A;  4NJQ A;  1CP7 A;  1AYE A;  1H8L A;  1AMP A;  2Q4Z A;  3RAM A;  3PB8 X;  3CPA A;  3HLP A;  4NGP A;  2PJC A;  2DEA A;  2V8G A;  3IJ3 A;  2RFH A;  3QNV A;  2OOT A;  3FF3 A;  2PCU A;  5JGF A;  1QMU A;  2AFS A;  2PJ9 A;  1IGB A;  4ZYQ A;  3KGQ A;  1HDQ A;  2CIJ A;  2IJZ A;  5K8N A;  1BLL E;  3D68 A;  4ZX8 A;  3SJE A;  3H8F A;  5IB9 A;  4FBE A;  2QVP A;  2BOA A;  4WJB A;  3CPX A;  1YLO A;  3MN8 A;  3NH8 A;  2PJ3 A;  4ZI6 A;  4R76 A;  2ZEN A;  2V77 A;  3V38 A;  1YW6 A;  1ZLH A;  4NJR A;  3KL9 A;  3S9M A;  4RUH A;  4YU9 A;  4F8Z A;  4DUK A;  2AFO A;  3H8G A;  2ZEF A;  2QJ8 A;  5F09 A;  1Z2L A;  3KR4 A;  1LAN A;  4MMO A;  2AFU A;  2C6G A;  1Z5R A;  4P4J A;  2O53 A;  1DE4 C;  3VH9 A;  3B3C A;  5D29 A;  2GRE A;  5K8O A;  3S9L A;  2ZEL A;  1NSA A;  1XRY A;  2VL1 A;  5LRJ A;  3SI1 A;  2CF4 A;  4A38 A;  1PCA A;  3B2Y A;  4Z65 A;  4ZY1 A;  2V8H A;  4F9V A;  4EME A;  4OKO A;  2RB7 A;  2F8H A;  3PEI A;  4DJL A;  4UEE A;  3PFE A;  4OC5 A;  3B3W A;  1BPN A;  1Y0R A;  1R43 A;  4P45 A;  3PB9 X;  3B7I A;  1TXR A;  3NH4 A;  3BHX A;  3PB6 X;  3T8W A;  3VAR A;  1ZG7 A;  2ZOF A;  5DS0 A;  1CG2 A;  4FUU A;  4P4B A;  2IMO A;  2PJA A;  2WZN A;  3KZW A;  5LRG A;  2PIZ A;  3IFE A;  4FAI A;  3WAB A;  3ISZ A;  3MRU A;  1OBR A;  2QYV A;  4EFD A;  4O23 A;  3KQZ A;  2EK8 A;  4MHP A;  4OME A;  3HUV A;  1ARM A;  3ISX A;  1PYT B;  5CPA A;  5CBM A;  4UIA A;  2CTB A;  3FJU A;  3WC5 A;  3WC6 A;  4MRI A;  3B3T A;  4GM5 A;  4OIW A;  2Q51 A;  2FVG A;  3K9T A;  1HDU A;  1TKJ A;  4MXU A;  2PJ8 A;  1ZLI A;  5ELY A;  2POK A;  3L2N A;  4AXV A;  1BPM A;  2PIY A;  4PQA A;  5HVF A;  4A39 A;  1XBU A;  1XJO A;  4A94 A;  4X8I A;  1F2P A;  2IQ6 A;  3FEC A;  2BO9 A;  3KQX A;  3N5F A;  1Z8L A;  4NGS A;  4NGM A;  4ONW A;  3NA6 A;  3IEH A;  3K2K A;  4A37 A;  1GYT A;  4PXD A;  1DTD A;  4NGT A;  2V8D A;  2NYQ A;  1F2O A;  3FMC A;  1LAP A;  4JZ0 A;  4X3R A;  4OC1 A;  2ZEM A;  2ZED A;  5I4M A;  4MHZ A;  1CPX A;  4OC0 A;  1Y0Y A;  1QQ9 A;  1TF9 A;  3TX8 A;  4UEF A;  4UEZ A;  3FEE A;  3RBU A;  1ZG8 A;  3D7H A;  2JEW A;  2EK9 A;  4YWY A;  3IO1 A;  2PJ6 A;  3SJG A;  1BAV A;  2AFZ A;  4B6Z A;  2F7V A;  3WC7 A;  4MHY A;  1XMB A;  3FVL A;  2PJ0 A;  4TWE A;  2JBJ A;  2XEG A;  2JBK A;  4PXC A;  5LYF A;  4R6T A;  3D66 A;  3PB7 X;  2ZEH A;  4MHN A;  4PPZ A;  4WWV A;  1YSJ A;  2PVW A;  4X2T A;  3BI0 A;  3SI0 A;  4TNU A;  4OID A;  2XEI A;  1M4L A;  2WYR A;  2C6C A;  4P44 A;  1Q7L A;  5HVH A;  2GU2 A;  3CT9 A;  2ABZ A;  4OC3 A;  4UIB A;  5K8P A;  1FT7 A;  2PJ4 A;  4IHM A;  3FED A;  5LYL A;  2I3C A;  5HXD A;  3FX6 A;  3V7Z A;  1XFO A;  3NFZ A;  3SI2 A;  2PJB A;  3JRU A;  4P6Y A;  5J1Q A;  1JQG A;  3KR5 A;  1LFW A;  3B3V A;  3GUX A;  5THW A;  4P10 A;  2ANP A;  4LQG A;  3WT4 A;  4EWT A;  2AFX A;  5LYD A;  3SJF A;  4NFR A;  5JM6 A;  4W9Y A;  4ZX9 A;  3CDX A;  1LAM A;  5LRK A;  7CPA A;  4PXB A;  4PXE A;  4JYW A;  1ARL A;  1CBX A;  3IIB A;  2ZEE A;  2CTC A;  5JH9 A;  1ELL P;  3KHZ A;  3S9N A;  3KHX A;  1KWM A;  3SJX A;  3KI9 A;  2PE3 A;  1TKH A;  2Q43 A;  2C1C A;  5D8N A;  4MCP A;  4F9U A;  1RTQ A;  1HEE A;  2C6P A;  3IC1 A;  4R8F A;  2G9D A;  2AFM A;  4ZY0 A;  2ZEP A;  2XEF A;  1VHE A;  4OC4 A;  1IY7 A;  2O4H A;  5K8M A;  3GB0 A;  3IWW A;  2HC9 A;  4FWU A;  4R7M A;  2PJ1 A;  3GLJ A;  2ZEG A;  3BXM A;  3D7D A;  4KSI A;  3DLJ A;  3PB4 X;  4P4D A;  2HB6 A;  3D7G A;  3NH5 A;  1TKF A;  1LOK A;  1Y7E A;  4IAV A;  2BCO A;  3PBE A;  5HVG A;  3PRT A;  3TC8 A;  4UF4 A;  4IK2 A;  4P4I A;  4H2K A;  5LYI A;  2PJ2 A;  4MCQ A;  2AFW A;  4P4E A;  4NGR A;  4NGQ A;  3FH4 A;  2GLJ A;  1ELM P;  4OP4 A;  3BI1 A;  4BD9 A;  2J9A A;  4MCR A;  4P4F A;  2ZOG A;  1LCP A;  3LMS A;  4DYO A;  1FNO A;  4MCS A;  1VGY A;  4NGN A;  6CPA A;  4K3N A;  2EWB A;  3B3S A;  1ZG9 A;  2PJ5 A;  3RZA A; 
#chains in the Genus database with same CATH topology
 4CAF A;  5J8F A;  2GLF A;  2OR4 A;  1R3N A;  2V8V A;  3DR8 A;  2ATR A;  2PVV A;  3PFO A;  4MFP A;  4Q7A A;  2NSM A;  2Z10 A;  4UCP A;  4GXH A;  1CPS A;  3D67 A;  1CX8 A;  4YFJ A;  2PJ7 A;  4PV6 A;  3LWU A;  4AVA A;  1IOF A;  1UWY A;  1F57 A;  4JWP A;  1MJA A;  3H8E A;  4G1P A;  1Z4R A;  2JDD A;  2OZU A;  4A30 A;  1YME A;  1CP6 A;  1Q2D A;  3I1U A;  4UCM A;  2D4O A;  4UWI A;  4ZY2 A;  2PC1 A;  4CPA A;  1Z8T A;  3GY9 A;  4KOS A;  3DSB A;  1CJW A;  2Z0Z A;  4HNY B;  2Q7B A;  2XEJ A;  3B35 A;  3D7F A;  4OC2 A;  4Q38 A;  2PR1 A;  4A2Z A;  4R3K A;  3VAT A;  2EO8 A;  4AVC A;  4CGN A;  3E0K A;  4E8O A;  2P6E A;  1EE3 P;  2P6G A;  2ZEO A;  1VIX A;  3C26 A;  1TF8 A;  1FY7 A;  1VHO A;  2PRQ A;  1YW4 A;  3D4U A;  3DGV A;  3PBB A;  3KAS A;  1YVK A;  3LAC A;  4NJQ A;  2CXA A;  4M6G A;  1CP7 A;  1AYE A;  4A33 A;  4DNC A;  1H8L A;  4BMH A;  4UFX A;  4B5O A;  4B11 A;  3SHP A;  1AMP A;  2Q4Z A;  5ISV A;  3RAM A;  5AG6 A;  4CYQ A;  4FD5 A;  2Z3P A;  3PB8 X;  2H5M A;  3CPA A;  4KUB A;  2ODF A;  1IU8 A;  3HLP A;  3TCV A;  4NGP A;  4CS0 B;  2PJC A;  1RO5 A;  5A28 A;  1Y9K A;  3ZZI A;  2B5G A;  2YNC C;  1IIC A;  2DEA A;  2V8G A;  3IJ3 A;  4CYN A;  2RFH A;  1I1D A;  3QNV A;  4Q36 A;  4QVT A;  3FF3 A;  2OOT A;  2PCU A;  1X10 A;  5JGF A;  1QMU A;  2AFS A;  4KOX A;  4FD7 A;  2PJ9 A;  1IGB A;  4ZYQ A;  3KGQ A;  2WPX A;  1HDQ A;  2CIJ A;  1QSO A;  2IJZ A;  3R96 A;  5K8N A;  1BLL E;  2CNT A;  3D68 A;  4ZX8 A;  3SJE A;  4L8A A;  2FE7 A;  3H8F A;  4HNW B;  4MHD A;  5IB9 A;  1ON0 A;  1MJ9 A;  2QVP A;  4FBE A;  4MFK A;  2BOA A;  4U9Y A;  2CY2 A;  4WJB A;  3FRM A;  1XF8 A;  5FVJ A;  2DPS A;  3CPX A;  1YLO A;  3MN8 A;  4BBH A;  3NH8 A;  5C82 A;  5KTA A;  3GYA A;  2PJ3 A;  4ZI6 A;  4R76 A;  2REF A;  1IYK A;  4UBR A;  2ZEN A;  2V77 A;  4AB7 A;  2QEC A;  3V38 A;  1XOV A;  4B10 A;  5G20 A;  4J3G A;  2R1I A;  3CXS A;  3RO0 A;  1WWZ A;  2BEI A;  2EUI A;  1YW6 A;  1ZLH A;  2Q7S A;  3H5Z A;  3BLN A;  2Z11 A;  4NJR A;  3KL9 A;  1YQE A;  3S9M A;  4RUH A;  3S6F A;  4CGO A;  4YU9 A;  1M4D A;  2Z3O A;  4M6H A;  4DUK A;  3B8G A;  2AFO A;  3H8G A;  4NCZ A;  4F8Z A;  2ZEF A;  2QJ8 A;  5F09 A;  4CAE A;  1Z2L A;  2JLM A;  3KR4 A;  1S5K A;  1LAN A;  4U9Z A;  4MMO A;  1S7K A;  4MY0 A;  5G22 A;  4B5P B;  2AFU A;  4M6I A;  2C6G A;  2OZH A;  1YX0 A;  4QUS A;  3R9E A;  4QC6 A;  1Z5R A;  4KZT A;  2O53 A;  4P4J A;  4PSW A;  5G21 A;  1Y7R A;  1DE4 C;  3VH9 A;  3B3C A;  5D29 A;  1RXT A;  3RNZ A;  2G3T A;  2GRE A;  5K8O A;  4KUA A;  1AUG A;  5EBV A;  3S9L A;  2ZEL A;  2PDO A;  1L0C A;  2AJ6 A;  1NSA A;  1KUX A;  1XRY A;  1Z4E A;  2JEV A;  2Q04 A;  2VL1 A;  4KLW A;  5LRJ A;  3SI1 A;  2CF4 A;  1S7L A;  5AG4 A;  4A38 A;  1PCA A;  1YLE A;  3B2Y A;  4Y49 B;  4Z65 A;  4ZY1 A;  1IB1 E;  2OH1 A;  2Q4Y A;  2V8H A;  2BUE A;  4F9V A;  4KS9 A;  4EME A;  2VQY A;  4OKO A;  1YVO A;  2RB7 A;  4FD4 A;  2CNM A;  2O28 A;  2F8H A;  4KSF A;  4QBJ A;  3G3S A;  3PEI A;  2OB0 A;  2J8R A;  2ZPA A;  4UEE A;  3PFE A;  4OAE A;  4CYO A;  4DJL A;  3P2H A;  4Y49 C;  4M85 A;  4OC5 A;  4CGP A;  3B3W A;  3IWE A;  4KVO E;  2G3A A;  4KOY A;  4MY3 A;  4ZGY B;  1B6B A;  4UWJ A;  4MJ8 A;  1BPN A;  3JTK A;  3R9G A;  3CZX A;  2J8N A;  1Y0R A;  1R43 A;  4C2Y A;  4P45 A;  2PQ8 A;  3CXQ A;  1UFH A;  4UCN A;  3PB9 X;  3TO6 A;  2J8M A;  3B7I A;  2B3V A;  2KCW A;  2Z3M A;  2P0W A;  4QB9 A;  1TXR A;  3NH4 A;  4KVM E;  3BHX A;  2FXF A;  4LX9 A;  3VWD A;  2JDC A;  3PB6 X;  1YK3 A;  3FXT A;  4HPS A;  4KSA A;  1TIQ A;  3T8W A;  3VAR A;  3SXN A;  3WR7 A;  1ZG7 A;  2ZOF A;  2FCK A;  2YGW A;  2ZW7 A;  1KZF A;  5DS0 A;  1CG2 A;  2B58 A;  3DNS A;  4FUU A;  2I00 A;  4P4B A;  5AGE A;  4GS4 A;  2IMO A;  4LUA A;  2PJA A;  2PR8 A;  2WZN A;  1NMT A;  3KZW A;  4KOW A;  5LRG A;  2WPW A;  1S60 A;  2PIZ A;  3IFE A;  4F6A A;  4FAI A;  5JQ4 A;  3TO7 A;  3WAB A;  1R57 A;  3ISZ A;  3MRU A;  4MFZ A;  4ONU A;  1OBR A;  2VI7 A;  2QYV A;  4KVX A;  4L89 A;  5EC4 A;  4B13 A;  4EFD A;  4O23 A;  3DDD A;  3KQZ A;  3H4Q A;  2EK8 A;  3V8I A;  5A27 A;  4MHP A;  4OME A;  1Q2Y A;  1M4I A;  3HUV A;  3I3G A;  4HNX B;  1ARM A;  3D2P A;  3ISX A;  4K30 A;  1PYT B;  2VEZ A;  5CPA A;  5CBM A;  1K4J A;  2B5G B;  4KOR A;  4NXY A;  4UIA A;  2CTB A;  1MJB A;  3CXP A;  3FJU A;  4UFV A;  3WC5 A;  3WC6 A;  4MRI A;  4A95 A;  3T90 A;  3B3T A;  3F0A A;  2OZG A;  4GM5 A;  4XPD C;  4OIW A;  2Q51 A;  1Y9W A;  2FVG A;  3K9T A;  1HDU A;  1TKJ A;  3IU2 A;  2PJ8 A;  4MXU A;  2IL4 A;  3R9F A;  1ZLI A;  3TOA A;  5ELY A;  2POK A;  3L2N A;  4CRY B;  2WUU A;  5IX3 A;  4AXV A;  1BPM A;  2PIY A;  5H86 A;  4PQA A;  4MI4 A;  5HVF A;  4ORF A;  4A39 A;  1XBU A;  2VBQ A;  2B4B A;  1A2Z A;  1XJO A;  4A94 A;  4X8I A;  2FSR A;  5DWN A;  1F2P A;  4MFL A;  2K5T A;  3EO4 A;  2IQ6 A;  4H6Z A;  3FEC A;  1XMT A;  2EBJ A;  2X7B A;  2BO9 A;  3KQX A;  3N5F A;  1Z8L A;  4NGS A;  4NGM A;  4ONW A;  3NA6 A;  4NSQ A;  3IEH A;  2NMT A;  5AG7 A;  1WK4 A;  3K2K A;  4A37 A;  1GYT A;  4RN7 A;  3TO9 A;  4PXD A;  4CGL A;  5IB0 A;  1DTD A;  4LQ6 A;  4NGT A;  4KOV A;  2GAN A;  5F48 A;  2V8D A;  3KKW A;  3ZJ0 A;  2NYQ A;  3NE7 A;  1PUA A;  1F2O A;  3FMC A;  1LAP A;  1YGH A;  4IF5 A;  4JZ0 A;  4X3R A;  1OZP A;  4CAX A;  4OC1 A;  4AG7 A;  2ZEM A;  2ZED A;  5I4M A;  4MHZ A;  1CPX A;  4OC0 A;  4E2A A;  3R95 A;  4RS2 A;  2R98 A;  1Y0Y A;  3PGP A;  4OAD A;  1QQ9 A;  5F49 A;  1TF9 A;  3TX8 A;  2G0B A;  1Q2C A;  4UEZ A;  3FEE A;  4UEF A;  3IWG A;  1ZG8 A;  4YRH A;  3RBU A;  2FIW A;  5F46 A;  3G8W A;  1VKC A;  5HMN A;  2F5I A;  3JVN A;  4E0A A;  3D7H A;  4F0X A;  2JEW A;  2Q4V A;  2EK9 A;  4UFW A;  3F5B A;  3TE4 A;  4R9M A;  4YWY A;  4B12 A;  1I12 A;  2P6F A;  5I0C A;  2Z3N A;  4AG9 A;  4A32 A;  4A31 A;  3IO1 A;  1QST A;  2FT0 A;  4CRZ B;  2PJ6 A;  3SJG A;  1BAV A;  4CAV A;  3T9Y A;  2AFZ A;  4B6Z A;  5DWM A;  2F7V A;  2R7H A;  2I79 A;  3I9S A;  4C2X A;  3WC7 A;  4MHY A;  1N71 A;  1XMB A;  3FVL A;  2PJ0 A;  4TWE A;  4JXR A;  2JBJ A;  3S6G A;  1V0C A;  2ZW5 A;  1SQH A;  3QB8 A;  1J4J A;  2XEG A;  3S6H A;  2JBK A;  4PXC A;  2QML A;  3QAY A;  2B4D B;  4XNH B;  5LYF A;  4R6T A;  3D66 A;  3PB7 X;  4PK2 A;  3W91 A;  1GHE A;  2VXK A;  2ZEH A;  4MHN A;  4PPZ A;  4WWV A;  1YSJ A;  2PVW A;  2B4D A;  3BI0 A;  4X2T A;  4MBU A;  4NEX A;  4TNU A;  3SI0 A;  4JLY A;  4R87 A;  4OID A;  2Z3K A;  2ARH A;  1JWQ A;  3D8P A;  2BSW A;  5EMI A;  5F47 A;  2XEI A;  2C27 A;  3N7Z A;  4XNH C;  1M4L A;  4H89 A;  2WYR A;  2C6C A;  4P44 A;  4CGM A;  1Q7L A;  5HVH A;  2GU2 A;  3CT9 A;  4II9 A;  2ABZ A;  4OC3 A;  4UIB A;  2OU2 A;  5K8P A;  4U5Y A;  3UY5 A;  1KUV A;  1NE9 A;  4AVB A;  1FT7 A;  2PJ4 A;  3LD2 A;  4IHM A;  5H84 A;  3FED A;  5LYL A;  3TFY A;  1YR0 A;  2I3C A;  2YND A;  5HXD A;  3FX6 A;  3V7Z A;  1XFO A;  3NFZ A;  4MFQ A;  2PJB A;  3SI2 A;  3JRU A;  2GFQ A;  1M44 A;  4P6Y A;  5J1Q A;  2BL1 A;  2RC4 A;  3NE8 A;  4C7H A;  2VZZ A;  3D3S A;  1M4G A;  1JQG A;  4R57 A;  3TT2 A;  3KR5 A;  1BOB A;  1LFW A;  3B3V A;  3GUX A;  4BIN A;  4KLV A;  1S7N A;  3BJ7 A;  3K9U A;  1P0H A;  5THW A;  4P10 A;  2Z3L A;  2ANP A;  3FNC A;  4YGO A;  3FB3 A;  1S3Z A;  4LQG A;  3WT4 A;  4EWT A;  2FL4 A;  2AFX A;  2Q44 A;  1Z8W A;  1KUY A;  3LOD A;  2HV2 A;  4XPL A;  5LYD A;  3VWE A;  2PRB A;  3SJF A;  3GKR A;  3FYN A;  5HH1 A;  2ZXV A;  4NFR A;  4W9Y A;  5JM6 A;  4ZX9 A;  3CDX A;  1LAM A;  2R8V A;  4I49 A;  7CPA A;  5LRK A;  4PXB A;  4JJX A;  4PXE A;  1BO4 A;  3P2F A;  3OWC A;  2B3U A;  4JYW A;  2D4P A;  3EY5 A;  4H6U A;  1ARL A;  1CBX A;  5JPH A;  3IIB A;  1B87 A;  2ZEE A;  2CTC A;  5JH9 A;  1ELL P;  2Y0M A;  3KHZ A;  3EC4 A;  4KOT A;  3S9N A;  3KHX A;  3MGD A;  5AG5 A;  1QSM A;  2DXQ A;  1KWM A;  1XIX A;  3SJX A;  3EFA A;  4OLL A;  2GIV A;  4B14 A;  3KI9 A;  2PE3 A;  4M3S A;  1TKH A;  2YNC A;  3FBU A;  4UA3 A;  2Q43 A;  2FS5 A;  2C1C A;  1U6M A;  5IV0 A;  5D8N A;  4MCP A;  1P4N A;  4F9U A;  1RTQ A;  2GE3 A;  3JUW A;  5BWA B;  3PP9 A;  5KTD A;  1HEE A;  2C6P A;  3IC1 A;  2CNS A;  2G9D A;  2AFM A;  4R8F A;  4HKF A;  4ZY0 A;  5GCN A;  2ZEP A;  2XEF A;  2EVN A;  1M1D A;  8CPA A;  4JXQ A;  4KOU A;  1VHE A;  4CAW A;  4OC4 A;  2HQY A;  1IY7 A;  2A4N A;  2O4H A;  5K8M A;  3GB0 A;  3IWW A;  2HC9 A;  4FWU A;  4R7M A;  3RYO A;  5J8C A;  2PJ1 A;  1X12 A;  3GLJ A;  2ZEG A;  5E96 A;  3BXM A;  3D7D A;  1ZO0 A;  2FIA A;  3DLJ A;  3PZJ A;  4FD6 A;  1CM0 A;  4KSI A;  1XEB A;  3PB4 X;  2HB6 A;  3D7G A;  4PK3 A;  4P4D A;  1XE4 A;  3NH5 A;  1TKF A;  5KTC A;  3SXO A;  1LOK A;  3GIU A;  3IU1 A;  2ZW6 A;  3D2M A;  1NSL A;  4C7I A;  4PSX A;  3W6X A;  1Y7E A;  2DF5 A;  1S7F A;  4IAV A;  4XPK A;  2BCO A;  4EVY A;  1PU9 A;  3PBE A;  3EXN A;  4ZBG A;  5HVG A;  3PRT A;  3TC8 A;  4UF4 A;  4C2Z A;  4IK2 A;  4P4I A;  5C88 A;  4H2K A;  5LYI A;  1VHS A;  1QSN A;  2HUZ A;  2QIR A;  2AE6 A;  2PJ2 A;  4MCQ A;  1IOI A;  3A9L A;  4CYP A;  2AFW A;  4P4E A;  4NGR A;  4R3L A;  4NGQ A;  3FH4 A;  2GLJ A;  2REE A;  4B5P A;  1Z9U A;  1ELM P;  3FIX A;  4OP4 A;  4MFJ A;  3BI1 A;  4BD9 A;  2VZY A;  2YNE A;  5G1Z A;  2J9A A;  3F8K A;  1YRE A;  4MCR A;  3S6K A;  3IGR A;  2ZW4 A;  4P4F A;  1IID A;  3QAH A;  4JD6 A;  1QSR A;  2ZOG A;  2PSW A;  1LCP A;  4X5K A;  3TTH A;  3LMS A;  4DYO A;  1I21 A;  1FNO A;  2Q0Y A;  4IUS A;  5CNP A;  4MCS A;  4RI1 A;  1VGY A;  4NGN A;  4XPD B;  2WSA A;  6CPA A;  1IYL A;  3DR6 A;  3R1K A;  4K3N A;  2EWB A;  2DPT A;  3B3S A;  1ZG9 A;  2PJ5 A;  4C68 A;  4F0Y A;  1Z8X A;  4NF1 A;  1LRZ A;  1MK4 A;  3TOB A;  3RZA A;  3BJ8 A;  3W6S A; 
#chains in the Genus database with same CATH homology
 2GLF A;  2OR4 A;  1R3N A;  2V8V A;  4Q7A A;  2PVV A;  3PFO A;  2NSM A;  1CPS A;  3D67 A;  1CX8 A;  2PJ7 A;  3LWU A;  1UWY A;  1F57 A;  3H8E A;  4G1P A;  1YME A;  1CP6 A;  3I1U A;  4ZY2 A;  4CPA A;  2XEJ A;  3B35 A;  3D7F A;  4OC2 A;  3VAT A;  8CPA A;  1EE3 P;  2ZEO A;  1VIX A;  1TF8 A;  1VHO A;  2PRQ A;  3D4U A;  1YW4 A;  3PBB A;  3DGV A;  3KAS A;  4NJQ A;  1CP7 A;  1AYE A;  1H8L A;  1AMP A;  2Q4Z A;  3RAM A;  3PB8 X;  3CPA A;  3HLP A;  4NGP A;  2PJC A;  2DEA A;  2V8G A;  3IJ3 A;  2RFH A;  3QNV A;  2OOT A;  3FF3 A;  2PCU A;  5JGF A;  1QMU A;  2AFS A;  2PJ9 A;  1IGB A;  4ZYQ A;  3KGQ A;  1HDQ A;  2CIJ A;  2IJZ A;  5K8N A;  1BLL E;  3D68 A;  4ZX8 A;  3SJE A;  3H8F A;  5IB9 A;  4FBE A;  2QVP A;  2BOA A;  4WJB A;  3CPX A;  1YLO A;  3MN8 A;  3NH8 A;  2PJ3 A;  4ZI6 A;  4R76 A;  2ZEN A;  2V77 A;  3V38 A;  1YW6 A;  1ZLH A;  4NJR A;  3KL9 A;  3S9M A;  4RUH A;  4YU9 A;  4F8Z A;  4DUK A;  2AFO A;  3H8G A;  2ZEF A;  2QJ8 A;  5F09 A;  1Z2L A;  3KR4 A;  1LAN A;  4MMO A;  2AFU A;  2C6G A;  1Z5R A;  4P4J A;  2O53 A;  1DE4 C;  3VH9 A;  3B3C A;  5D29 A;  2GRE A;  5K8O A;  3S9L A;  2ZEL A;  1NSA A;  1XRY A;  2VL1 A;  5LRJ A;  3SI1 A;  2CF4 A;  4A38 A;  1PCA A;  3B2Y A;  4Z65 A;  4ZY1 A;  2V8H A;  4F9V A;  4EME A;  4OKO A;  2RB7 A;  2F8H A;  3PEI A;  4DJL A;  4UEE A;  3PFE A;  4OC5 A;  3B3W A;  1BPN A;  1Y0R A;  1R43 A;  4P45 A;  3PB9 X;  3B7I A;  1TXR A;  3NH4 A;  3BHX A;  3PB6 X;  3T8W A;  3VAR A;  1ZG7 A;  2ZOF A;  5DS0 A;  1CG2 A;  4FUU A;  4P4B A;  2IMO A;  2PJA A;  2WZN A;  3KZW A;  5LRG A;  2PIZ A;  3IFE A;  4FAI A;  3WAB A;  3ISZ A;  3MRU A;  1OBR A;  2QYV A;  4EFD A;  4O23 A;  3KQZ A;  2EK8 A;  4MHP A;  4OME A;  3HUV A;  1ARM A;  3ISX A;  1PYT B;  5CPA A;  5CBM A;  4UIA A;  2CTB A;  3FJU A;  3WC5 A;  3WC6 A;  4MRI A;  3B3T A;  4GM5 A;  4OIW A;  2Q51 A;  2FVG A;  3K9T A;  1HDU A;  1TKJ A;  4MXU A;  2PJ8 A;  1ZLI A;  5ELY A;  2POK A;  3L2N A;  4AXV A;  1BPM A;  2PIY A;  4PQA A;  5HVF A;  4A39 A;  1XBU A;  1XJO A;  4A94 A;  4X8I A;  1F2P A;  2IQ6 A;  3FEC A;  2BO9 A;  3KQX A;  3N5F A;  1Z8L A;  4NGS A;  4NGM A;  4ONW A;  3NA6 A;  3IEH A;  3K2K A;  4A37 A;  1GYT A;  4PXD A;  1DTD A;  4NGT A;  2V8D A;  2NYQ A;  1F2O A;  3FMC A;  1LAP A;  4JZ0 A;  4X3R A;  4OC1 A;  2ZEM A;  2ZED A;  5I4M A;  4MHZ A;  1CPX A;  4OC0 A;  1Y0Y A;  1QQ9 A;  1TF9 A;  3TX8 A;  4UEF A;  4UEZ A;  3FEE A;  3RBU A;  1ZG8 A;  3D7H A;  2JEW A;  2EK9 A;  4YWY A;  3IO1 A;  2PJ6 A;  3SJG A;  1BAV A;  2AFZ A;  4B6Z A;  2F7V A;  3WC7 A;  4MHY A;  1XMB A;  3FVL A;  2PJ0 A;  4TWE A;  2JBJ A;  2XEG A;  2JBK A;  4PXC A;  5LYF A;  4R6T A;  3D66 A;  3PB7 X;  2ZEH A;  4MHN A;  4PPZ A;  4WWV A;  1YSJ A;  2PVW A;  4X2T A;  3BI0 A;  3SI0 A;  4TNU A;  4OID A;  2XEI A;  1M4L A;  2WYR A;  2C6C A;  4P44 A;  1Q7L A;  5HVH A;  2GU2 A;  3CT9 A;  2ABZ A;  4OC3 A;  4UIB A;  5K8P A;  1FT7 A;  2PJ4 A;  4IHM A;  3FED A;  5LYL A;  2I3C A;  5HXD A;  3FX6 A;  3V7Z A;  1XFO A;  3NFZ A;  3SI2 A;  2PJB A;  3JRU A;  4P6Y A;  5J1Q A;  1JQG A;  3KR5 A;  1LFW A;  3B3V A;  3GUX A;  5THW A;  4P10 A;  2ANP A;  4LQG A;  3WT4 A;  4EWT A;  2AFX A;  5LYD A;  3SJF A;  4NFR A;  5JM6 A;  4W9Y A;  4ZX9 A;  3CDX A;  1LAM A;  5LRK A;  7CPA A;  4PXB A;  4PXE A;  4JYW A;  1ARL A;  1CBX A;  3IIB A;  2ZEE A;  2CTC A;  5JH9 A;  1ELL P;  3KHZ A;  3S9N A;  3KHX A;  1KWM A;  3SJX A;  3KI9 A;  2PE3 A;  1TKH A;  2Q43 A;  2C1C A;  5D8N A;  4MCP A;  4F9U A;  1RTQ A;  1HEE A;  2C6P A;  3IC1 A;  4R8F A;  2G9D A;  2AFM A;  4ZY0 A;  2ZEP A;  2XEF A;  1VHE A;  4OC4 A;  1IY7 A;  2O4H A;  5K8M A;  3GB0 A;  3IWW A;  2HC9 A;  4FWU A;  4R7M A;  2PJ1 A;  3GLJ A;  2ZEG A;  3BXM A;  3D7D A;  4KSI A;  3DLJ A;  3PB4 X;  4P4D A;  2HB6 A;  3D7G A;  3NH5 A;  1TKF A;  1LOK A;  1Y7E A;  4IAV A;  2BCO A;  3PBE A;  5HVG A;  3PRT A;  3TC8 A;  4UF4 A;  4IK2 A;  4P4I A;  4H2K A;  5LYI A;  2PJ2 A;  4MCQ A;  2AFW A;  4P4E A;  4NGR A;  4NGQ A;  3FH4 A;  2GLJ A;  1ELM P;  4OP4 A;  3BI1 A;  4BD9 A;  2J9A A;  4MCR A;  4P4F A;  2ZOG A;  1LCP A;  3LMS A;  4DYO A;  1FNO A;  4MCS A;  1VGY A;  4NGN A;  6CPA A;  4K3N A;  2EWB A;  3B3S A;  1ZG9 A;  2PJ5 A;  3RZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...