2QJAC

Crystal structure analysis of bmp-2 in complex with bmpr-ia variant b12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCLGLEGSDFQCRDTPIPHQRRSIECCRTNLCNQYLQPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title Structure analysis of bone morphogenetic protein-2 type I receptor complexes reveals a mechanism of receptor inactivation in juvenile polyposis syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 13
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qjaC00
2JVEA 2PJYC 1ABTA 1LX5B 1HAAA 2QC1A 3VTSA 1DRSA 1CCQA 4QTIU 1BXPA 2BTXA 3LAQU 2H62D 2MFAA 2X8BB 5DU1A 1KBSA 1IDHA 5IMYC 1ERAA 1REWC 2LA1A 2LCRA 4RUDA 1JBDA 1TXAA 1IKCA 1HAJA 1KTZB 1KXIA 4HQPF 1CDTA 1F8UB 2CDXA 2GOOB 3NEQA 3BT2U 1NYUA 1H0JA 2I9BE 3KFDE 1CRFA 1TFSA 2ABXA 2CRSA 2MHYA 3NH7A 4ZQYA 1LXGA 1CB9A 2OFSA 1CODA 2H7ZB 3KFDI 2FD6U 2GOOC 1JE9A 2QJAC 1MR6A 1FSSB 1KFHA 4OM5A 2CCXA 2BHIA 4IYEA 2CTXA 2CRTA 1KU6B 1TXBA 2UX2A 1CREA 4AEAA 1KBTA 2L5SA 1CDQA 1FSCA 1M9ZA 1YWHA 2JQPA 1CDRA 1HOYA 2H64C 1G6MA 1IDIA 1FRAA 1HC9B 1RGJA 2H5FA 1ZADA 1B41B 2MUPA 1BTEA 2H7ZA 4EY8B 1UG4A 3EVSC 1V6PA 2L03A 1CTXA 1NEAA 1TGXA 1COEA 1FFJA 1NXBA 1IDGA 1KL8A 1W6BA 2J8BA 4FAOC 1ERGA 3EBXA 1NTNA 2H64B 1JGKA 5DO6A 1RL5A 1VB0A 3U73U 1NORA 2QJBC 2MJ0A 3PLCA 4XJJA 1CXOA 2ERAA 6EBXA 1ES7B 1IDLA 1ONJA 1CDSA 3FEVA 1LXHA 1NTXA 1PLOA 1XT3A 3U74U 5IMTD 1HC9A 2QJ9C 2MJ4A 1IK8A 1LJZA 1KS6A 1QM7A 1LSIA 5EBXA 4FAOE 1CVOA 1MAHF 2H62C 2NBTA 2UWRA 4OM4A 1FF4A 2MUOA 3QB4B 2HLQA 2MJYA 2K3GA 2VLWA 3ERAA 1QKDA 4P7UA 1CXNA 1I02A 1IJCA 4UY2C 1KC4A 1S4YA 2PJYB 3NDSA 2H8UA 2N99A 1FASA 1CHVS 4BIKB 2HLRA 4DO8A 3BT1U 1L4WA 5DZ5A 1NYSA 4BDTB 1KBAA 1QKEA 4LFTA 1F94A 3HH7A 1IQ9A
chains in the Genus database with same CATH superfamily
2JVEA 2PJYC 1ABTA 1LX5B 1HAAA 2QC1A 3VTSA 1DRSA 1CCQA 4QTIU 1BXPA 2BTXA 3LAQU 2H62D 2MFAA 2X8BB 5DU1A 1KBSA 1IDHA 5IMYC 1ERAA 1REWC 2LA1A 2LCRA 4RUDA 1JBDA 1TXAA 1IKCA 1HAJA 1KTZB 1KXIA 4HQPF 1CDTA 1F8UB 2CDXA 2GOOB 3NEQA 3BT2U 1NYUA 1H0JA 2I9BE 3KFDE 1CRFA 1TFSA 2ABXA 2CRSA 2MHYA 3NH7A 4ZQYA 1LXGA 1CB9A 2OFSA 1CODA 2H7ZB 3KFDI 2FD6U 2GOOC 1JE9A 2QJAC 1MR6A 1FSSB 1KFHA 4OM5A 2CCXA 2BHIA 4IYEA 2CTXA 2CRTA 1KU6B 1TXBA 2UX2A 1CREA 4AEAA 1KBTA 2L5SA 1CDQA 1FSCA 1M9ZA 1YWHA 2JQPA 1CDRA 1HOYA 2H64C 1G6MA 1IDIA 1FRAA 1HC9B 1RGJA 2H5FA 1ZADA 1B41B 2MUPA 1BTEA 2H7ZA 4EY8B 1UG4A 3EVSC 1V6PA 2L03A 1CTXA 1NEAA 1TGXA 1COEA 1FFJA 1NXBA 1IDGA 1KL8A 1W6BA 2J8BA 4FAOC 1ERGA 3EBXA 1NTNA 2H64B 1JGKA 5DO6A 1RL5A 1VB0A 3U73U 1NORA 2QJBC 2MJ0A 3PLCA 4XJJA 1CXOA 2ERAA 6EBXA 1ES7B 1IDLA 1ONJA 1CDSA 3FEVA 1LXHA 1NTXA 1PLOA 1XT3A 3U74U 5IMTD 1HC9A 2QJ9C 2MJ4A 1IK8A 1LJZA 1KS6A 1QM7A 1LSIA 5EBXA 4FAOE 1CVOA 1MAHF 2H62C 2NBTA 2UWRA 4OM4A 1FF4A 2MUOA 3QB4B 2HLQA 2MJYA 2K3GA 2VLWA 3ERAA 1QKDA 4P7UA 1CXNA 1I02A 1IJCA 4UY2C 1KC4A 1S4YA 2PJYB 3NDSA 2H8UA 2N99A 1FASA 1CHVS 4BIKB 2HLRA 4DO8A 3BT1U 1L4WA 5DZ5A 1NYSA 4BDTB 1KBAA 1QKEA 4LFTA 1F94A 3HH7A 4KSNA 1IQ9A
chains in the Genus database with same CATH topology
2JVEA 2PJYC 1ABTA 1LX5B 1HAAA 2QC1A 3VTSA 1DRSA 1CCQA 4QTIU 1BXPA 2BTXA 3LAQU 2H62D 2MFAA 2X8BB 5DU1A 1KBSA 1IDHA 5IMYC 1ERAA 1REWC 2LA1A 2LCRA 4RUDA 1JBDA 1TXAA 1IKCA 1HAJA 1KTZB 1KXIA 4HQPF 1CDTA 1F8UB 2CDXA 2GOOB 3NEQA 3BT2U 1NYUA 1H0JA 2I9BE 3KFDE 1CRFA 1TFSA 2ABXA 2CRSA 2MHYA 3NH7A 4ZQYA 1LXGA 1CB9A 2OFSA 1CODA 2H7ZB 3KFDI 2FD6U 2GOOC 1JE9A 2QJAC 1MR6A 1FSSB 1KFHA 4OM5A 2CCXA 2BHIA 4IYEA 2CTXA 2CRTA 1KU6B 1TXBA 2UX2A 1CREA 4AEAA 1KBTA 2L5SA 1CDQA 1FSCA 1M9ZA 1YWHA 2JQPA 1CDRA 1HOYA 2H64C 1G6MA 1IDIA 1FRAA 1HC9B 1RGJA 2H5FA 1ZADA 1B41B 2MUPA 1BTEA 2H7ZA 4EY8B 1UG4A 3EVSC 1V6PA 2L03A 1CTXA 1NEAA 1TGXA 1COEA 1FFJA 1NXBA 1IDGA 1KL8A 1W6BA 2J8BA 4FAOC 1ERGA 3EBXA 1NTNA 2H64B 1JGKA 5DO6A 1RL5A 1VB0A 3U73U 1NORA 2QJBC 2MJ0A 3PLCA 4XJJA 1CXOA 2ERAA 6EBXA 1ES7B 1IDLA 1ONJA 1CDSA 3FEVA 1LXHA 1NTXA 1PLOA 1XT3A 3U74U 5IMTD 1HC9A 2QJ9C 2MJ4A 1IK8A 1LJZA 1KS6A 1QM7A 1LSIA 5EBXA 4FAOE 1CVOA 1MAHF 2H62C 2NBTA 2UWRA 4OM4A 1FF4A 2MUOA 3QB4B 2HLQA 2MJYA 2K3GA 2VLWA 3ERAA 1QKDA 4P7UA 1CXNA 1I02A 1IJCA 4UY2C 1KC4A 1S4YA 2PJYB 3NDSA 2H8UA 2N99A 1FASA 1CHVS 4BIKB 2HLRA 4DO8A 3BT1U 1L4WA 5DZ5A 1NYSA 4BDTB 1KBAA 1QKEA 4LFTA 1F94A 3HH7A 4KSNA 1IQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVE A;  2PJY C;  1ABT A;  1LX5 B;  1HAA A;  2QC1 A;  3VTS A;  1DRS A;  1CCQ A;  4QTI U;  1BXP A;  2BTX A;  3LAQ U;  2H62 D;  2MFA A;  2X8B B;  5DU1 A;  1KBS A;  1IDH A;  5IMY C;  1ERA A;  1REW C;  2LA1 A;  2LCR A;  4RUD A;  1JBD A;  1TXA A;  1IKC A;  1HAJ A;  1KTZ B;  1KXI A;  4HQP F;  1CDT A;  1F8U B;  2CDX A;  2GOO B;  3NEQ A;  3BT2 U;  1NYU A;  1H0J A;  2I9B E;  3KFD E;  1CRF A;  1TFS A;  2ABX A;  2CRS A;  2MHY A;  3NH7 A;  4ZQY A;  1LXG A;  1CB9 A;  2OFS A;  1COD A;  2H7Z B;  3KFD I;  2FD6 U;  2GOO C;  1JE9 A;  2QJA C;  1MR6 A;  1FSS B;  1KFH A;  4OM5 A;  2CCX A;  2BHI A;  4IYE A;  2CTX A;  2CRT A;  1KU6 B;  1TXB A;  2UX2 A;  1CRE A;  4AEA A;  1KBT A;  2L5S A;  1CDQ A;  1FSC A;  1M9Z A;  1YWH A;  2JQP A;  1CDR A;  1HOY A;  2H64 C;  1G6M A;  1IDI A;  1FRA A;  1HC9 B;  1RGJ A;  2H5F A;  1ZAD A;  1B41 B;  2MUP A;  1BTE A;  2H7Z A;  4EY8 B;  1UG4 A;  3EVS C;  1V6P A;  2L03 A;  1CTX A;  1NEA A;  1TGX A;  1COE A;  1FFJ A;  1NXB A;  1IDG A;  1KL8 A;  1W6B A;  2J8B A;  4FAO C;  1ERG A;  3EBX A;  1NTN A;  2H64 B;  1JGK A;  5DO6 A;  1RL5 A;  1VB0 A;  3U73 U;  1NOR A;  2QJB C;  2MJ0 A;  3PLC A;  4XJJ A;  1CXO A;  2ERA A;  6EBX A;  1ES7 B;  1IDL A;  1ONJ A;  1CDS A;  3FEV A;  1LXH A;  1NTX A;  1PLO A;  1XT3 A;  3U74 U;  5IMT D;  1HC9 A;  2QJ9 C;  2MJ4 A;  1IK8 A;  1LJZ A;  1KS6 A;  1QM7 A;  1LSI A;  5EBX A;  4FAO E;  1CVO A;  1MAH F;  2H62 C;  2NBT A;  2UWR A;  4OM4 A;  1FF4 A;  2MUO A;  3QB4 B;  2HLQ A;  2MJY A;  2K3G A;  2VLW A;  3ERA A;  1QKD A;  4P7U A;  1CXN A;  1I02 A;  1IJC A;  4UY2 C;  1KC4 A;  1S4Y A;  2PJY B;  3NDS A;  2H8U A;  2N99 A;  1FAS A;  1CHV S;  4BIK B;  2HLR A;  4DO8 A;  3BT1 U;  1L4W A;  5DZ5 A;  1NYS A;  4BDT B;  1KBA A;  1QKE A;  4LFT A;  1F94 A;  3HH7 A;  1IQ9 A; 
#chains in the Genus database with same CATH topology
 2JVE A;  2PJY C;  1ABT A;  1LX5 B;  1HAA A;  2QC1 A;  3VTS A;  1DRS A;  1CCQ A;  4QTI U;  1BXP A;  2BTX A;  3LAQ U;  2H62 D;  2MFA A;  2X8B B;  5DU1 A;  1KBS A;  1IDH A;  5IMY C;  1ERA A;  1REW C;  2LA1 A;  2LCR A;  4RUD A;  1JBD A;  1TXA A;  1IKC A;  1HAJ A;  1KTZ B;  1KXI A;  4HQP F;  1CDT A;  1F8U B;  2CDX A;  2GOO B;  3NEQ A;  3BT2 U;  1NYU A;  1H0J A;  2I9B E;  3KFD E;  1CRF A;  1TFS A;  2ABX A;  2CRS A;  2MHY A;  3NH7 A;  4ZQY A;  1LXG A;  1CB9 A;  2OFS A;  1COD A;  2H7Z B;  3KFD I;  2FD6 U;  2GOO C;  1JE9 A;  2QJA C;  1MR6 A;  1FSS B;  1KFH A;  4OM5 A;  2CCX A;  2BHI A;  4IYE A;  2CTX A;  2CRT A;  1KU6 B;  1TXB A;  2UX2 A;  1CRE A;  4AEA A;  1KBT A;  2L5S A;  1CDQ A;  1FSC A;  1M9Z A;  1YWH A;  2JQP A;  1CDR A;  1HOY A;  2H64 C;  1G6M A;  1IDI A;  1FRA A;  1HC9 B;  1RGJ A;  2H5F A;  1ZAD A;  1B41 B;  2MUP A;  1BTE A;  2H7Z A;  4EY8 B;  1UG4 A;  3EVS C;  1V6P A;  2L03 A;  1CTX A;  1NEA A;  1TGX A;  1COE A;  1FFJ A;  1NXB A;  1IDG A;  1KL8 A;  1W6B A;  2J8B A;  4FAO C;  1ERG A;  3EBX A;  1NTN A;  2H64 B;  1JGK A;  5DO6 A;  1RL5 A;  1VB0 A;  3U73 U;  1NOR A;  2QJB C;  2MJ0 A;  3PLC A;  4XJJ A;  1CXO A;  2ERA A;  6EBX A;  1ES7 B;  1IDL A;  1ONJ A;  1CDS A;  3FEV A;  1LXH A;  1NTX A;  1PLO A;  1XT3 A;  3U74 U;  5IMT D;  1HC9 A;  2QJ9 C;  2MJ4 A;  1IK8 A;  1LJZ A;  1KS6 A;  1QM7 A;  1LSI A;  5EBX A;  4FAO E;  1CVO A;  1MAH F;  2H62 C;  2NBT A;  2UWR A;  4OM4 A;  1FF4 A;  2MUO A;  3QB4 B;  2HLQ A;  2MJY A;  2K3G A;  2VLW A;  3ERA A;  1QKD A;  4P7U A;  1CXN A;  1I02 A;  1IJC A;  4UY2 C;  1KC4 A;  1S4Y A;  2PJY B;  3NDS A;  2H8U A;  2N99 A;  1FAS A;  1CHV S;  4BIK B;  2HLR A;  4DO8 A;  3BT1 U;  1L4W A;  5DZ5 A;  1NYS A;  4BDT B;  1KBA A;  1QKE A;  4LFT A;  1F94 A;  3HH7 A;  4KSN A;  1IQ9 A; 
#chains in the Genus database with same CATH homology
 2JVE A;  2PJY C;  1ABT A;  1LX5 B;  1HAA A;  2QC1 A;  3VTS A;  1DRS A;  1CCQ A;  4QTI U;  1BXP A;  2BTX A;  3LAQ U;  2H62 D;  2MFA A;  2X8B B;  5DU1 A;  1KBS A;  1IDH A;  5IMY C;  1ERA A;  1REW C;  2LA1 A;  2LCR A;  4RUD A;  1JBD A;  1TXA A;  1IKC A;  1HAJ A;  1KTZ B;  1KXI A;  4HQP F;  1CDT A;  1F8U B;  2CDX A;  2GOO B;  3NEQ A;  3BT2 U;  1NYU A;  1H0J A;  2I9B E;  3KFD E;  1CRF A;  1TFS A;  2ABX A;  2CRS A;  2MHY A;  3NH7 A;  4ZQY A;  1LXG A;  1CB9 A;  2OFS A;  1COD A;  2H7Z B;  3KFD I;  2FD6 U;  2GOO C;  1JE9 A;  2QJA C;  1MR6 A;  1FSS B;  1KFH A;  4OM5 A;  2CCX A;  2BHI A;  4IYE A;  2CTX A;  2CRT A;  1KU6 B;  1TXB A;  2UX2 A;  1CRE A;  4AEA A;  1KBT A;  2L5S A;  1CDQ A;  1FSC A;  1M9Z A;  1YWH A;  2JQP A;  1CDR A;  1HOY A;  2H64 C;  1G6M A;  1IDI A;  1FRA A;  1HC9 B;  1RGJ A;  2H5F A;  1ZAD A;  1B41 B;  2MUP A;  1BTE A;  2H7Z A;  4EY8 B;  1UG4 A;  3EVS C;  1V6P A;  2L03 A;  1CTX A;  1NEA A;  1TGX A;  1COE A;  1FFJ A;  1NXB A;  1IDG A;  1KL8 A;  1W6B A;  2J8B A;  4FAO C;  1ERG A;  3EBX A;  1NTN A;  2H64 B;  1JGK A;  5DO6 A;  1RL5 A;  1VB0 A;  3U73 U;  1NOR A;  2QJB C;  2MJ0 A;  3PLC A;  4XJJ A;  1CXO A;  2ERA A;  6EBX A;  1ES7 B;  1IDL A;  1ONJ A;  1CDS A;  3FEV A;  1LXH A;  1NTX A;  1PLO A;  1XT3 A;  3U74 U;  5IMT D;  1HC9 A;  2QJ9 C;  2MJ4 A;  1IK8 A;  1LJZ A;  1KS6 A;  1QM7 A;  1LSI A;  5EBX A;  4FAO E;  1CVO A;  1MAH F;  2H62 C;  2NBT A;  2UWR A;  4OM4 A;  1FF4 A;  2MUO A;  3QB4 B;  2HLQ A;  2MJY A;  2K3G A;  2VLW A;  3ERA A;  1QKD A;  4P7U A;  1CXN A;  1I02 A;  1IJC A;  4UY2 C;  1KC4 A;  1S4Y A;  2PJY B;  3NDS A;  2H8U A;  2N99 A;  1FAS A;  1CHV S;  4BIK B;  2HLR A;  4DO8 A;  3BT1 U;  1L4W A;  5DZ5 A;  1NYS A;  4BDT B;  1KBA A;  1QKE A;  4LFT A;  1F94 A;  3HH7 A;  4KSN A;  1IQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...