2QJCA

Crystal structure of a putative diadenosine tetraphosphatase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
242
structure length
222
Chain Sequence
YANVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAYSVLGNHDAKLLKLVKKLSLAPLAQSIPTDVETYLSQLPHIIRIPAHNVMVAHAGLHPQRPVDRQYEDEVTTMRNLIEKVTLTATEETNDGGKPWASMWRGPETVVFGHDARRGLQEQYKPLAIGLDSRCVYGGRLSAAVFPGGCIISVPGWNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
molecule keywords Diadenosine tetraphosphatase, putative
total genus 63
structure length 222
sequence length 242
ec nomenclature ec 3.6.1.41: Bis(5'-nucleosyl)-tetraphosphatase (symmetrical).
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2qjcA00
1KBPA 3DW8C 3H64A 2WDCA 4ORBA 3RL4A 2HYPA 4O5GA 4F0ZA 4LACC 4O43A 4Q7FA 1UF3A 4ORAA 1WAO1 3DSDA 4I5LC 4JA9A 3AUZA 3H69A 2USHA 3H60A 4M0VA 5JJTA 1S3LA 1V73A 2IE4C 3LL8A 4G9JA 4O4KA 5IOHA 1TCOA 2Z06A 3IB8A 1HO5A 4FBQA 2HYOA 4UT2A 4J6OA 4B2OA 4H2FA 4DT2A 3PSOA 3RL5A 5JPFA 2NXFA 1S8EA 1M63A 5EQVA 3QFMA 1G5BA 4UT3A 1S95A 3ICFA 4IYPC 2NPPC 3N5UA 2R17A 2GJUA 4LTYA 2P6BA 1OIDA 2Z1AA 3TGHA 3DSCA 3E7BA 2NYLC 3FGAC 3HVQA 5C1VA 2IE3C 4H2GA 2Z72A 3K7WC 3P71C 4H2BA 4UT3B 3H66A 5GTUA 2ZBMA 4H2IA 3JYFA 1HPUA 1OI8A 2BCDA 3KBPA 4MOYA 4OR9A 1OIEA 1QFCA 2KKNA 1UTEA 1USHA 2BDXA 3QFNA 4MOVA 4WWLA 1FJMA 4NZVA 4O24A 1Z2WA 3IVEA 3H63A 3QFKA 4V0VA 1XM7A 4V0XA 4KKZA 3PSNA 1Z2XA 1AUIA 3H67A 4TUGA 2WDFA 2WDEA 4H1SA 3GVEA 3H68A 3C9FA 4IL1A 5HPEA 3C5WC 2IAEC 3IB7A 1SU1A 3QFOA 2HY1A 5J28A 2DFJA 1NNWA 3EGGA 1S3NA 4MP0A 4YKEA 5JPEA 4HD0A 1JK7A 2Q8UA 1T71A 4TUIA 2O8GA 3QG5C 1S70A 1II7A 3E7AA 2NYMC 2YVTA 3AV0A 4JA7A 4V0WA 3K7VC 4KBPA 2A22A 1WARA 3CK2A 4H1YP 5DNYA 4FBKA 4ORCA 3THNA 1IT6A 2CV9A 2XMOA 3THOB 3ZTVA 5INBA 1QHWA 4UWQA 2O8AA 2QFPA 4ZX2A 2BQ8X 3V4YA 1HP1A 2QJCA 3RQZA 1U32A 3ZU0A 1W24A 2QFRA 3T1IA 3IVDA 2AHDA 5F3WA 2JOGA 4LU9A 1T70A 1MF8A 4FCXA 4I5NC 3H61A 3H62B 1S3MA 4ZVZA 4FBWA 4XPNA 2WDDA 3RL3A 5B8IA 3EGHA 1XZWA 4DSYA 4DHLA
chains in the Genus database with same CATH superfamily
1KBPA 3DW8C 3H64A 2WDCA 4ORBA 3RL4A 2HYPA 4O5GA 4F0ZA 4LACC 4O43A 4Q7FA 1UF3A 4ORAA 1WAO1 3DSDA 4I5LC 4JA9A 3AUZA 3H69A 2USHA 3H60A 2DXLA 4M0VA 5JJTA 1S3LA 1V73A 2IE4C 3LL8A 4G9JA 4O4KA 5IOHA 1TCOA 2Z06A 3IB8A 1HO5A 4FBQA 2HYOA 4UT2A 4J6OA 4B2OA 4H2FA 4DT2A 3PSOA 3RL5A 5JPFA 2NXFA 1S8EA 1M63A 5EQVA 3QFMA 1G5BA 4UT3A 1S95A 3ICFA 4IYPC 2NPPC 3N5UA 2R17A 2GJUA 4LTYA 2P6BA 1OIDA 2Z1AA 3TGHA 3DSCA 3E7BA 2DXNA 2NYLC 2ZOAA 3FGAC 3HVQA 5C1VA 2IE3C 4H2GA 2Z72A 3K7WC 3P71C 4H2BA 4UT3B 2YEQA 3H66A 5GTUA 2ZBMA 4H2IA 3JYFA 1HPUA 4DHLA 1OI8A 2BCDA 3KBPA 4MOYA 4OR9A 1OIEA 1QFCA 2KKNA 1UTEA 1USHA 2BDXA 3QFNA 4MOVA 4WWLA 1FJMA 4NZVA 2ZO9B 4O24A 1Z2WA 3D03A 3IVEA 3H63A 3QFKA 4V0VA 1XM7A 4V0XA 4KKZA 3PSNA 1Z2XA 1AUIA 3H67A 4TUGA 2WDFA 2WDEA 3FLOA 4H1SA 3GVEA 3H68A 3C9FA 4IL1A 5HPEA 3C5WC 2IAEC 3IB7A 1SU1A 3QFOA 2HY1A 5J28A 2DFJA 1NNWA 3EGGA 1S3NA 4MP0A 4YKEA 5JPEA 4HD0A 1JK7A 2Q8UA 1T71A 4TUIA 2O8GA 3QG5C 1S70A 1II7A 3E7AA 2NYMC 2YVTA 3AV0A 4JA7A 4V0WA 3K7VC 4KBPA 2A22A 1WARA 3CK2A 4H1YP 5DNYA 4FBKA 4ORCA 3THNA 1IT6A 2CV9A 2XMOA 3THOB 3ZTVA 5INBA 1QHWA 4UWQA 2O8AA 2QFPA 4ZX2A 2BQ8X 3V4YA 1HP1A 2QJCA 3RQZA 1U32A 3ZU0A 1W24A 2QFRA 3T1IA 3IVDA 2AHDA 5F3WA 2JOGA 4LU9A 1T70A 1MF8A 4FCXA 4I5NC 3H61A 3H62B 1S3MA 4ZVZA 4FBWA 4XPNA 2WDDA 3RL3A 5B8IA 3EGHA 1XZWA 4DSYA 3E0JA
chains in the Genus database with same CATH topology
1KBPA 3DW8C 3H64A 2WDCA 4ORBA 3RL4A 2HYPA 4O5GA 4F0ZA 4LACC 4O43A 4Q7FA 1UF3A 4ORAA 1WAO1 3DSDA 4I5LC 4JA9A 3AUZA 3H69A 2USHA 3H60A 2DXLA 4M0VA 5JJTA 1S3LA 1V73A 2IE4C 3LL8A 4G9JA 4O4KA 5IOHA 1TCOA 2Z06A 3IB8A 1HO5A 4FBQA 2HYOA 4UT2A 4J6OA 4B2OA 4H2FA 4DT2A 3PSOA 3RL5A 5JPFA 2NXFA 1S8EA 1M63A 5EQVA 3QFMA 1G5BA 4UT3A 1S95A 3ICFA 4IYPC 2NPPC 3N5UA 2R17A 2GJUA 4LTYA 2P6BA 1OIDA 2Z1AA 3TGHA 3DSCA 3E7BA 2DXNA 2NYLC 2ZOAA 3FGAC 3HVQA 5C1VA 2IE3C 4H2GA 2Z72A 3K7WC 3P71C 4H2BA 4UT3B 2YEQA 3H66A 5GTUA 2ZBMA 4H2IA 3JYFA 1HPUA 4DHLA 1OI8A 2BCDA 3KBPA 4MOYA 4OR9A 1OIEA 1QFCA 2KKNA 1UTEA 1USHA 2BDXA 3QFNA 4MOVA 4WWLA 1FJMA 4NZVA 2ZO9B 4O24A 1Z2WA 3D03A 3IVEA 3H63A 3QFKA 4V0VA 1XM7A 4V0XA 4KKZA 3PSNA 1Z2XA 1AUIA 3H67A 4TUGA 2WDFA 2WDEA 3FLOA 4H1SA 3GVEA 3H68A 3C9FA 4IL1A 5HPEA 3C5WC 2IAEC 3IB7A 1SU1A 3QFOA 2HY1A 5J28A 2DFJA 1NNWA 3EGGA 1S3NA 4MP0A 4YKEA 5JPEA 4HD0A 1JK7A 2Q8UA 1T71A 4TUIA 2O8GA 3QG5C 1S70A 1II7A 3E7AA 2NYMC 2YVTA 3AV0A 4JA7A 4V0WA 3K7VC 4KBPA 2A22A 1WARA 3CK2A 4H1YP 5DNYA 4FBKA 4ORCA 3THNA 1IT6A 2CV9A 2XMOA 3THOB 3ZTVA 5INBA 1QHWA 4UWQA 2O8AA 2QFPA 4ZX2A 2BQ8X 3V4YA 1HP1A 2QJCA 3RQZA 1U32A 3ZU0A 1W24A 2QFRA 3T1IA 3IVDA 2AHDA 5F3WA 2JOGA 4LU9A 1T70A 1MF8A 4FCXA 4I5NC 3H61A 3H62B 1S3MA 4ZVZA 4FBWA 4XPNA 2WDDA 3RL3A 5B8IA 3EGHA 1XZWA 4DSYA 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBP A;  3DW8 C;  3H64 A;  2WDC A;  4ORB A;  3RL4 A;  2HYP A;  4O5G A;  4F0Z A;  4LAC C;  4O43 A;  4Q7F A;  1UF3 A;  4ORA A;  1WAO 1;  3DSD A;  4I5L C;  4JA9 A;  3AUZ A;  3H69 A;  2USH A;  3H60 A;  4M0V A;  5JJT A;  1S3L A;  1V73 A;  2IE4 C;  3LL8 A;  4G9J A;  4O4K A;  5IOH A;  1TCO A;  2Z06 A;  3IB8 A;  1HO5 A;  4FBQ A;  2HYO A;  4UT2 A;  4J6O A;  4B2O A;  4H2F A;  4DT2 A;  3PSO A;  3RL5 A;  5JPF A;  2NXF A;  1S8E A;  1M63 A;  5EQV A;  3QFM A;  1G5B A;  4UT3 A;  1S95 A;  3ICF A;  4IYP C;  2NPP C;  3N5U A;  2R17 A;  2GJU A;  4LTY A;  2P6B A;  1OID A;  2Z1A A;  3TGH A;  3DSC A;  3E7B A;  2NYL C;  3FGA C;  3HVQ A;  5C1V A;  2IE3 C;  4H2G A;  2Z72 A;  3K7W C;  3P71 C;  4H2B A;  4UT3 B;  3H66 A;  5GTU A;  2ZBM A;  4H2I A;  3JYF A;  1HPU A;  1OI8 A;  2BCD A;  3KBP A;  4MOY A;  4OR9 A;  1OIE A;  1QFC A;  2KKN A;  1UTE A;  1USH A;  2BDX A;  3QFN A;  4MOV A;  4WWL A;  1FJM A;  4NZV A;  4O24 A;  1Z2W A;  3IVE A;  3H63 A;  3QFK A;  4V0V A;  1XM7 A;  4V0X A;  4KKZ A;  3PSN A;  1Z2X A;  1AUI A;  3H67 A;  4TUG A;  2WDF A;  2WDE A;  4H1S A;  3GVE A;  3H68 A;  3C9F A;  4IL1 A;  5HPE A;  3C5W C;  2IAE C;  3IB7 A;  1SU1 A;  3QFO A;  2HY1 A;  5J28 A;  2DFJ A;  1NNW A;  3EGG A;  1S3N A;  4MP0 A;  4YKE A;  5JPE A;  4HD0 A;  1JK7 A;  2Q8U A;  1T71 A;  4TUI A;  2O8G A;  3QG5 C;  1S70 A;  1II7 A;  3E7A A;  2NYM C;  2YVT A;  3AV0 A;  4JA7 A;  4V0W A;  3K7V C;  4KBP A;  2A22 A;  1WAR A;  3CK2 A;  4H1Y P;  5DNY A;  4FBK A;  4ORC A;  3THN A;  1IT6 A;  2CV9 A;  2XMO A;  3THO B;  3ZTV A;  5INB A;  1QHW A;  4UWQ A;  2O8A A;  2QFP A;  4ZX2 A;  2BQ8 X;  3V4Y A;  1HP1 A;  2QJC A;  3RQZ A;  1U32 A;  3ZU0 A;  1W24 A;  2QFR A;  3T1I A;  3IVD A;  2AHD A;  5F3W A;  2JOG A;  4LU9 A;  1T70 A;  1MF8 A;  4FCX A;  4I5N C;  3H61 A;  3H62 B;  1S3M A;  4ZVZ A;  4FBW A;  4XPN A;  2WDD A;  3RL3 A;  5B8I A;  3EGH A;  1XZW A;  4DSY A;  4DHL A; 
#chains in the Genus database with same CATH topology
 1KBP A;  3DW8 C;  3H64 A;  2WDC A;  4ORB A;  3RL4 A;  2HYP A;  4O5G A;  4F0Z A;  4LAC C;  4O43 A;  4Q7F A;  1UF3 A;  4ORA A;  1WAO 1;  3DSD A;  4I5L C;  4JA9 A;  3AUZ A;  3H69 A;  2USH A;  3H60 A;  2DXL A;  4M0V A;  5JJT A;  1S3L A;  1V73 A;  2IE4 C;  3LL8 A;  4G9J A;  4O4K A;  5IOH A;  1TCO A;  2Z06 A;  3IB8 A;  1HO5 A;  4FBQ A;  2HYO A;  4UT2 A;  4J6O A;  4B2O A;  4H2F A;  4DT2 A;  3PSO A;  3RL5 A;  5JPF A;  2NXF A;  1S8E A;  1M63 A;  5EQV A;  3QFM A;  1G5B A;  4UT3 A;  1S95 A;  3ICF A;  4IYP C;  2NPP C;  3N5U A;  2R17 A;  2GJU A;  4LTY A;  2P6B A;  1OID A;  2Z1A A;  3TGH A;  3DSC A;  3E7B A;  2DXN A;  2NYL C;  2ZOA A;  3FGA C;  3HVQ A;  5C1V A;  2IE3 C;  4H2G A;  2Z72 A;  3K7W C;  3P71 C;  4H2B A;  4UT3 B;  2YEQ A;  3H66 A;  5GTU A;  2ZBM A;  4H2I A;  3JYF A;  1HPU A;  4DHL A;  1OI8 A;  2BCD A;  3KBP A;  4MOY A;  4OR9 A;  1OIE A;  1QFC A;  2KKN A;  1UTE A;  1USH A;  2BDX A;  3QFN A;  4MOV A;  4WWL A;  1FJM A;  4NZV A;  2ZO9 B;  4O24 A;  1Z2W A;  3D03 A;  3IVE A;  3H63 A;  3QFK A;  4V0V A;  1XM7 A;  4V0X A;  4KKZ A;  3PSN A;  1Z2X A;  1AUI A;  3H67 A;  4TUG A;  2WDF A;  2WDE A;  3FLO A;  4H1S A;  3GVE A;  3H68 A;  3C9F A;  4IL1 A;  5HPE A;  3C5W C;  2IAE C;  3IB7 A;  1SU1 A;  3QFO A;  2HY1 A;  5J28 A;  2DFJ A;  1NNW A;  3EGG A;  1S3N A;  4MP0 A;  4YKE A;  5JPE A;  4HD0 A;  1JK7 A;  2Q8U A;  1T71 A;  4TUI A;  2O8G A;  3QG5 C;  1S70 A;  1II7 A;  3E7A A;  2NYM C;  2YVT A;  3AV0 A;  4JA7 A;  4V0W A;  3K7V C;  4KBP A;  2A22 A;  1WAR A;  3CK2 A;  4H1Y P;  5DNY A;  4FBK A;  4ORC A;  3THN A;  1IT6 A;  2CV9 A;  2XMO A;  3THO B;  3ZTV A;  5INB A;  1QHW A;  4UWQ A;  2O8A A;  2QFP A;  4ZX2 A;  2BQ8 X;  3V4Y A;  1HP1 A;  2QJC A;  3RQZ A;  1U32 A;  3ZU0 A;  1W24 A;  2QFR A;  3T1I A;  3IVD A;  2AHD A;  5F3W A;  2JOG A;  4LU9 A;  1T70 A;  1MF8 A;  4FCX A;  4I5N C;  3H61 A;  3H62 B;  1S3M A;  4ZVZ A;  4FBW A;  4XPN A;  2WDD A;  3RL3 A;  5B8I A;  3EGH A;  1XZW A;  4DSY A;  3E0J A; 
#chains in the Genus database with same CATH homology
 1KBP A;  3DW8 C;  3H64 A;  2WDC A;  4ORB A;  3RL4 A;  2HYP A;  4O5G A;  4F0Z A;  4LAC C;  4O43 A;  4Q7F A;  1UF3 A;  4ORA A;  1WAO 1;  3DSD A;  4I5L C;  4JA9 A;  3AUZ A;  3H69 A;  2USH A;  3H60 A;  2DXL A;  4M0V A;  5JJT A;  1S3L A;  1V73 A;  2IE4 C;  3LL8 A;  4G9J A;  4O4K A;  5IOH A;  1TCO A;  2Z06 A;  3IB8 A;  1HO5 A;  4FBQ A;  2HYO A;  4UT2 A;  4J6O A;  4B2O A;  4H2F A;  4DT2 A;  3PSO A;  3RL5 A;  5JPF A;  2NXF A;  1S8E A;  1M63 A;  5EQV A;  3QFM A;  1G5B A;  4UT3 A;  1S95 A;  3ICF A;  4IYP C;  2NPP C;  3N5U A;  2R17 A;  2GJU A;  4LTY A;  2P6B A;  1OID A;  2Z1A A;  3TGH A;  3DSC A;  3E7B A;  2DXN A;  2NYL C;  2ZOA A;  3FGA C;  3HVQ A;  5C1V A;  2IE3 C;  4H2G A;  2Z72 A;  3K7W C;  3P71 C;  4H2B A;  4UT3 B;  2YEQ A;  3H66 A;  5GTU A;  2ZBM A;  4H2I A;  3JYF A;  1HPU A;  4DHL A;  1OI8 A;  2BCD A;  3KBP A;  4MOY A;  4OR9 A;  1OIE A;  1QFC A;  2KKN A;  1UTE A;  1USH A;  2BDX A;  3QFN A;  4MOV A;  4WWL A;  1FJM A;  4NZV A;  2ZO9 B;  4O24 A;  1Z2W A;  3D03 A;  3IVE A;  3H63 A;  3QFK A;  4V0V A;  1XM7 A;  4V0X A;  4KKZ A;  3PSN A;  1Z2X A;  1AUI A;  3H67 A;  4TUG A;  2WDF A;  2WDE A;  3FLO A;  4H1S A;  3GVE A;  3H68 A;  3C9F A;  4IL1 A;  5HPE A;  3C5W C;  2IAE C;  3IB7 A;  1SU1 A;  3QFO A;  2HY1 A;  5J28 A;  2DFJ A;  1NNW A;  3EGG A;  1S3N A;  4MP0 A;  4YKE A;  5JPE A;  4HD0 A;  1JK7 A;  2Q8U A;  1T71 A;  4TUI A;  2O8G A;  3QG5 C;  1S70 A;  1II7 A;  3E7A A;  2NYM C;  2YVT A;  3AV0 A;  4JA7 A;  4V0W A;  3K7V C;  4KBP A;  2A22 A;  1WAR A;  3CK2 A;  4H1Y P;  5DNY A;  4FBK A;  4ORC A;  3THN A;  1IT6 A;  2CV9 A;  2XMO A;  3THO B;  3ZTV A;  5INB A;  1QHW A;  4UWQ A;  2O8A A;  2QFP A;  4ZX2 A;  2BQ8 X;  3V4Y A;  1HP1 A;  2QJC A;  3RQZ A;  1U32 A;  3ZU0 A;  1W24 A;  2QFR A;  3T1I A;  3IVD A;  2AHD A;  5F3W A;  2JOG A;  4LU9 A;  1T70 A;  1MF8 A;  4FCX A;  4I5N C;  3H61 A;  3H62 B;  1S3M A;  4ZVZ A;  4FBW A;  4XPN A;  2WDD A;  3RL3 A;  5B8I A;  3EGH A;  1XZW A;  4DSY A;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...