2QJDA

Crystal structure of novel immune-type receptor 10 extracellular fragment mutant n30d
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
IKELHVKTVKRGENVTMECSMSKVKDKNKLAWYRQSFGKVPQYFVRYYSSNSGYKFAEGFKDSRFSMTVNDQKFDLNIIGTREDDGGEYFCGEVEGNTIKFTSGTRLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Novel immune-type receptor 10
publication title A bony fish immunological receptor of the NITR multigene family mediates allogeneic recognition.
pubmed doi rcsb
source organism Ictalurus punctatus
molecule tags Immune system
total genus 22
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qjdA00
2YUVA 3F58H 1A1MA 5MEQA 4GRWB 2V2XA 2LE9A 1KB5L 4NRXA 1RI8A 3UTPE 5A16B 3C87A 3LRHA 1EAPB 3UTTB 3BGMB 3U7YH 3HMWH 2BOBB 4FNLH 1NCWH 3BI9X 3MV7E 1IKNA 4DN4L 1OLLA 4HAFA 1YPZF 3VH8B 3WEXA 3IGAB 1YPZB 3DXAA 5CJXA 3P4MA 1KTRL 1TQCB 2Q8AH 3ULUD 3CH1B 1NGYA 1A7QL 4KJWD 1UT9A 3BYYA 3O3EB 2J5LC 2RGSA 2NY3D 3MJ8A 3TIDA 4YJZL 3FT4B 3IFNL 3PWUA 1NFKA 2OSLB 3OGCA 4MDJA 3K8LA 3ZO0A 2PNDA 1G7HA 4LEOB 1L0YA 5EOCJ 4KVNL 1BJMA 3ZHLA 1OAKL 2DS4A 1CDJA 2FEDC 3VRJA 5ACZB 3RQ3A 9CGTA 1R3JB 1XCTB 4GQ9L 4RWYH 4Z0BH 3WFZA 3BGFB 3UAJD 3QRFM 1A1NB 3RPIB 3SGDI 4A6YB 1N4XL 1MJ7H 1KG0A 1QEWA 3KYKH 4PRDB 1EGJH 5C0EB 3OKEB 4C83B 3QUZA 4AH2A 5I16A 4ZG1A 1IGTA 3V4UL 3UTTA 3EUUA 2FEEI 1AKJA 2RJMA 1C8PA 1UG9A 1NH6A 1F58H 4OI9A 2R2CA 4WY7L 3W39B 1Q38A 2E3VA 2ZG3A 2D0GA 3ZDZE 5IVXB 4JQVC 3VH8A 1AC0A 5I15L 3VXPB 1Z2KA 4LNVA 5DGQA 4HIEB 1YPZA 2H45A 4OKVB 5AZ2H 2GUOB 3MV8D 2YK1H 3CH1A 1QSED 2FL5B 3HNTL 1RMFL 3O3EA 5F7YC 4FFZL 1LO2L 5J6GB 1K2DB 4Y4FB 5FCSH 1V7NH 5E8DH 1P6AB 1G7LA 1MCNA 1T5XB 4LEOA 2VDNH 2LAAA 1V7ML 1C1EL 2X1PA 2IG2H 1HEZB 4LHUB 3AUVA 2MKLC 3DUSB 2BNUB 4KDTA 5FYKU 5ACZA 4XWGL 1XCTA 3ALPA 3HUJB 1IC5L 2DQGL 4HLZH 2GK0A 1JN6B 2AV1A 3SDDD 1A1NA 3RPIA 4RGNC 4PJDF 3FT2A 5ALCH 4F7EB 4GT7A 4PJDB 2WLYA 2VXTL 3QUMB 1G1YA 2X9YA 4NIKB 5C0EA 3OKEA 4C83A 1JPTH 5JQ6L 2EICA 4HMCA 4MX7B 4KRPC 4E5XB 1TTFA 4K2UL 1T1XB 3S3JA 1BM3L 2WW8A 4S1QH 3RZWA 1T80A 3K0WA 4IBLT 3RBGA 4C57C 3VXPA 1ES0B 1R5WB 4RRPA 4HIEA 4QRPB 5IESL 4OAWB 4OKVA 2P45B 4PJBF 3WD5H 2V5TA 3QI9C 1LK3L 1IM9A 2FL5A 3IU3B 4L4TA 1UZ8B 1MF2H 3SO3B 3NACL 4U1GC 5J6GA 4Y4FA 4OCRH 1T7ZA 4RAVB 2DM2A 1UVQA 1DQLH 4FQQB 1NC4A 1KPVA 4LHUA 2VLRB 4F7MB 1J05B 1IC7L 2BNUA 2D31B 1WK0A 4YHZH 2P46B 5DJAB 2VWEC 2R0KH 1D5XA 1F90H 3DIFB 3I02B 2CMRH 3SE8H 3VGAB 4QGTA 4D9QE 4JRYB 2Q3AA 2PW1A 1LDSA 2YN3A 4LBEB 4N0UE 3X14B 4F7EA 4PJDA 3TWCL 3QUMA 2XPGB 1CK0L 4YXKH 3ARBD 3DSFL 2PTUA 1YMHA 4P2QA 5TQ0L 1LILA 4WEMB 4J4PC 2XKNB 4Z7VF 3MNZB 2XN9E 1T1XA 4EI6A 4YXLL 1X4XA 3X11A 2HT4C 4UNTA 2QL1A 1E6OH 4Z7VB 3EYSL 4HUMB 3PHQA 5JW3H 4NQCD 1YQVL 4OUUA 4M3JA 1ES0A 2DQIH 4H1LB 3QXAA 4ZUWB 2OCFD 1T22B 3HNVL 1WFUA 4KKBD 1J1PH 2VZVA 3BWUC 3G6AB 1UZ8A 4K3JH 4XNZB 2AEPH 5DR5L 2P7TA 4PJBA 1QVOA 5EZOH 3KPSE 1WUNT 2ZOKB 5ETUB 4RAVA 4YK4B 5I8KL 1I1AD 4NHCH 3OSKA 2Y07L 3GMOA 4F7MA 1J05A 2D31A 1QPPA 5E56A 5KSAA 4JN2B 2DYPD 3DIFA 1BFTA 1FYTA 4HZLB 4P4KC 4D0DA 2H3NB 4PREA 4BQ6A 3GMMB 1MUJB 5IROA 4Q97A 3EDEA 2ESVD 5AUMB 1S8DB 4RFOH 4LBEA 3GI9L 3B2VL 3X14A 1CGXA 3MMEA 1WLHA 1FVCB 2XPGA 5HPOA 5E8NB 5TDOB 3BP7A 1PKOA 3DX9B 1S3KH 1B4JH 2FGWH 4YHPB 5D1ZB 3HAEB 5IVZA 4D94A 3BPNC 4ZXBD 2XKNA 5FB8A 1IQDB 3FCTB 3FO2A 4X4YA 1JI1A 2WWKT 2CUMA 4BJLA 4Z7VA 4JHWL 3SOBH 4JZJC 5EOQH 4JG0L 5DDHA 1TETH 4G8EB 3SQOH 1T7YA 2AW2A 1U6AH 4V2BA 2X05A 4ZUWA 1IAKA 1T22A 5DJXB 3O41B 3MJ7B 5A43C 3G6AA 2L4OA 4NQVA 1OP3K 4FTVE 4RGNE 1A9EA 4AEIH 5CILL 3QCTH 1R3KB 1YEJH 1NBQA 5L8KB 5ETUA 2ZOKA 2D0HA 4DOHB 3MRLB 4ONFH 4CJ1A 3C5SB 3QQNA 1FE8H 5HYSA 4M8VA 4M7LT 3TLRA 5CGYC 3ZKXC 2F5AL 5L6YH 3MLWH 4QLRA 5CEYB 1YEDA 5BZWB 4HZLA 4MNGB 4KMQA 4GAFB 4HUXB 4X9HA 3GMMA 3TZVD 5GRXG 1H5BC 2GSIB 1EBPA 2E7BA 4XX1E 3O45B 4DGIL 1GGBL 4HIJA 1I75A 3QWQB 1FVCA 4RX4A 1XGRB 5E8NA 2VIRB 5TDOA 1ZLUK 3DX9A 2VZ3A 4WTXA 4YHPA 5D1ZA 3HAEA 1A8JH 3EOAA 1GXEA 3SE3A 4H88L 4JFZH 3B8YA 1CXKA 2E5EA 2FHFA 3DHMA 5D7JB 4DK3A 1AGEB 1IQDA 2B5IB 2WAHA 1BX2B 1QLFB 5D9SB 3OKOB 2Y6SC 2OK0H 5DQDL 2VWEE 4G8EA 5D1QD 1AY1H 4NUJB 2BNRD 1UB6B 1SBBA 1NAKH 4GRLC 3VFSA 3QNZA 3O41A 4AQ1B 3MJ7A 5HHVL 5F7EH 5CD5C 1AGFB 3OF6D 1JPGA 1QHOA 4TSCH 5E4IA 4L4JA 5F1SA 1BJ1H 3C5SA 4YBHA 4RMRA 3VU2A 3OZ9L 1DVFB 4H8WC 4HLJA 3PHOB 2GW5A 1LE5B 4NT6A 2XY2A 1DQML 4ISVB 4KHXH 4PFEA 3VXQB 2XXCB 5BZWA 3VXUB 4MNGA 4NQED 3D3VB 5E6ID 4HUXA 4D9RD 1U8PB 1QSFA 4JFFB 3L5WA 4MXWL 1UQSB 3H7BB 5A3ID 3O45A 2BSRB 5I18H 2VLKB 3V5HB 4UQ2A 1XGRA 3K80A 5E2TL 2VIRA 3B9KC 3I75B 1FQ9C 3CXDL 3D0LA 2WBJB 2EE9A 2CIKA 1DLFL 3ULUC 4HQQL 3DROB 1A02N 3OKDB 4KJWC 2B1AH 3OKOA 4HIXL 2NY3C 3BH8B 5HVHB 3BP5A 3BIKB 1MVFA 4LQFL 4NUJA 2WUCL 4JKKA 1W72H 2YUWA 4YX2L 3AXLB 3W0WD 5I8OH 1KBGH 1AGFA 4QRSB 1N64L 5C2BH 3PE9A 1Q9LB 4JGUA 5IW1B 5T1KB 2R2EB 3TV3L 4K94H 4QO1A 3UAJC 3DBXB 2DM7A 3FB7B 5E99H 1LE5A 2EDEA 4PGBB 1ZWIB 2IAMD 4ISVA 4EDXA 3VXQA 3MRIA 3HG1B 1NGXB 2D9QB 4J3OC 3VXUA 3WIHH 5D1XD 2YBRB 3D3VA 5KN5B 4YGVA 1U8PA 4YHOH 4OLVL 2N4IA 2GFBB 3BUYB 3K74B 4JFFA 4O2EB 1UQSA 3H7BA 1DBMH 5FXCH 2PTVA 4K3EH 2BSRA 4PJHA 4EDWH 3GSNL 3V5HA 3LV3B 5K59F 4YXHL 3MCLL 3I75A 1BD2A 3TCLB 4CBPA 5B22A 4NBZB 2WBJA 4PRPB 2IMMA 2WQRA 3PQYD 3VMNA 3DROA 3TN0A 3OKDA 5MEOB 5JHDA 3P11H 4FZEL 1KIQB 3DECA 4WFFD 3ZE2E 3JWDC 3ARFB 3MLYH 4F8QA 3AXLA 5IBLD 2JE8A 2NZIA 4QRSA 2O61A 2W0FA 4UTBL 2R2EA 1G84A 2IPTL 4LSUH 1RPQA 3ZE0F 1MJUH 4HJGB 4EI5A 3WNOA 4TN9A 3DBXA 1KOAA 3SDDC 3FB7A 5D2NB 1SJVA 4YZFF 1ZWIA 4JFEA 5SWZE 4PLNC 4JRXD 5L9DL 2ENYA 2YBRA 5KN5A 1QO3B 4FZ8L 3BUYA 4O2EA 4PJ9B 5E8OB 3RWGB 2F5BL 4PIRF 5KVEL 5DT1H 2EH7H 5K9OB 2AERT 4JFQB 1JZ7A 3QJHB 4NNPL 3LH2H 3TCLA 3QYCA 4KTDH 3BKJL 1D9KB 1VB9A 3T8XB 1GHFL 4MLIA 4ENEC 4NOBA 1NL0L 3T77B 1CVSC 1KB5H 1AIFB 1F4AA 5MEOA 3HKFA 1VEPA 1DP0A 3T1WA 1BVLB 1KIQA 1WIUA 3ARGB 3O4LD 3ARFA 2BMKB 1GH7A 4HS8H 5EU4B 5KSBB 2A6KB 2YKLL 5C0IB 3RGVD 3O6KH 3SO5A 4OCLC 4RNRA 4UI2A 4KUZL 4G8GB 1CL7L 5HHMB 5IP4A 4M00A 1A7QH 1VCAA 3BD4A 4QEGA 2XYCA 4X7EC 1OWRM 1QRND 1XF5B 3P4LA 2DLFL 5D2NA 5D6CA 5IB4A 3WV0A 2WWKO 2CQVA 3ZKNC 1F97A 2D7NA 4KVNH 5TQ2L 3V2AR 3ULUE 2HRLA 1QO3A 3ARBC 1ACYH 2DOCA 4PJ9A 4GQ9H 1FGNL 1RUQL 4MCYB 1H8OA 3RWGA 1I85A 1BBDH 2W9EH 2XA8L 3MXVL 1FH5L 3QDJB 4NKOB 5A2LH 4JG1H 4C54A 1QSVA 4JFQA 3QJHA 1N4XH 1MHCB 2VDOH 5E2WH 4K7PY 3KYOB 1D9KA 1U0QA 3T8XA 4ZAKB 1CLYL 2QEJA 4HWEL 2P5WE 2FO1A 5JOPD 5E4EB 3TESA 1RU9L 3BIBX 1UCBL 3CK0L 3O9WA 4KKBC 3Q2CA 1SBSH 3NZ8B 3CVHL 4DZ8B 3LPWA 4P46D 3P77B 5GISL 4QT5B 4XZUB 4Y16A 2BMKA 4WY7H 5EU4A 1MOEA 1I1AC 1J0HA 4CVWA 5K9KB 4JFPA 2OYPA 5I76B 3NA9L 3GJEB 4JFYB 4K7PX 4G8GA 1CGUA 1CGYA 4P3WA 1NMAL 4FFZH 3I9GL 1LO2H 1SJEB 4HC1A 3O3DA 5I1CL 1CFNA 2BY1A 1XF5A 1DUYB 4PGEB 2FLBT 3SCMA 1ED3A 3U36B 1CICD 3KJ4B 1V7MH 4P5MA 1F2XK 3MV8E 1QSEE 1P84K 3C6LC 3QT2A 1MAKA 4Q9BA 3UCRA 2IQ9L 4MCYA 2VL4A 4ZXBC 3U9UA 3GUTA 4NKOA 2DQCH 4P99A 3WXVH 1J0JA 5D4QA 5I1JL 1L6ZA 2OXGA 3KYOA 4P5TB 1CYGA 4H8WL 4U6TA 1NGZB 1ZLUH 1UKSA 1XGQB 5I9QB 4HCRA 2DTML 5JQ6H 3WO4B 3NZ8A 2AJ3A 4M93B 3P77A 5GZOD 3MCKB 4TVPD 3HE6B 1ZS8A 4QT5A 4XZUA 1BM3H 5LQBH 1GIGL 3OG6B 3K2MC 5K9KA 2VXSL 1N6QH 5I76A 2R69H 3TA3D 2A0LD 1UXWB 5L2KD 8CGTA 2DLIA 5IESH 3MUGB 4LKCB 4Y2DA 5JUEH 1LK3H 3LN5B 4JGJA 5CFHA 1JPFB 4F7PA 1ZLSL 2UWEE 1SJEA 3ULUL 1L0XA 3UTTD 4OUOA 4RGOL 3U36A 3E0GA 1IILE 3NIFF 5ID0B 1IZKA 4ODWA 4NBYB 4Q74A 1IC7H 1UWEH 4P3CL 4H20H 5E5MB 4M62L 5FA4B 3VJ6B 2NY7L 3EFDL 2DLHA 4J6RH 5EOCL 1QFWI 4ZNEA 3KHOA 3UTSB 4P5TA 3S5LA 1NEUA 5JXED 1EJOL 4UINL 5D1QC 3OR6A 3WFDL 3WO3B 4Z8FH 1XGQA 3V0VB 4F80A 3OXSB 1AO7B 1HE7A 3DSFH 2OQJB 4FP8L 3BISA 5TQ0H 3KPMB 4GS7C 3DJ9A 4JO1L 1MFBH 3O6FC 3FOMA 3HE6A 4YXLH 5HHPB 4I3SL 2AEQL 4XP6L 5D93B 5FHAH 4EKXA 4M8QB 3LKRA 2EXYD 4NOFA 5ADOL 4TOYL 15C8L 4RCAA 3HNVH 4PJ7F 3BH9B 3LN5A 4V1DB 1JPFA 3OAYK 5T5FH 4PJ7B 5E6IC 2C9AA 1S9WB 3HA0A 3AREA 3GSQA 5EZLA 3SGKA 4BYHA 2YWZA 4L8SB 5A3IC 5DGRA 4Y4HC 1NFDB 4U3XA 5BRZD 2Y07H 3JWDL 3WHE0 2VLLA 4JHBA 1KYOJ 1DFBL 5FA4A 1I7RB 1SY6A 4KMTL 4WTWA 4GH7B 5JW4M 1CBVL 2D7TL 5DRWB 5JDJA 1Y6NR 3H42L 4LRIA 2IFFH 1B2WL 3GIZL 3B2VH 4OIIL 4NNYB 4XPGL 4O5LL 2D2OA 3IKCA 1CFSB 5LAXB 2ZPKL 1AO7A 2JIXB 4PY8J 2IPUG 3QXDB 2ESVE 2XTJB 5C0GB 1U3YA 4UUJA 3HI1B 3RKDD 1H3WM 4WI3A 5HHOA 2E7MA 3MRKB 4JHWH 3LDBB 4JG0H 5TDNB 4G8FB 2P8PA 2ZJSH 4PJCF 1J1XL 2IAMC 5IBUB 3BH9A 5J12C 4V1DA 1BOYA 2FR4B 1MCFA 3TPUA 5D1XC 4PJCB 1KN2L 4PJ7A 3IAGC 3I85A 4ELKB 1S9WA 4DFHA 1UM6L 3JV4B 4KI1A 5EULV 4O51B 1U8HB 1MCOL 2A77L 3BW9B 5CCKL 3TBTB 4L4VB 4XNMA 1I7RA 2CK2A 4QRPD 4OLUL 5GGTL 1FZKB 2P42B 4XXCC 1M1SA 1OAXH 3O3BB 4FABL 3ZYJA 4TPRL 1LQSR 5LAXA 3HS0B 4G6JL 2VLRD 5IBLC 5CWSB 1E4KA 4WIQA 3HTLX 4OZGE 1AD0B 1R24B 4NO2B 1OARH 3C6SA 3CAFA 5DQDH 4JRYD 5CINL 5TDNA 2YD8A 2Y23A 4FQLL 5DJCB 3EOYG 2EXWD 5C0AB 5HHVH 4F2MB 5C09E 4J3XA 4PJCA 1NLBL 4ELKA 3V52L 1CD8A 2BCKB 4MXVF 3UMTA 3L3JB 2HMIC 3OZ9H 4KTYA 2R9HD 4GXVL 1JNJA 1N0LA 3VFVA 1MLCA 1T6WA 2VN7A 4LLWB 4OQTA 3HE7B 4ZUVB 3NCMA 5FM5O 3D9AL 4L4VA 2NZ9D 3LIZL 1DN0B 4E42A 3H8NA 4XCFH 1FZKA 3BKCL 2VL5A 4Z7WE 3O3BA 4WW2F 5FYLD 4PP2B 1LDPH 3VE0B 4BFBD 3NIGE 4WW2B 2E7CA 4NQEE 3PP3H 1TQBB 4D9RE 3CXDH 3RGVC 4X6EA 1FFPA 5CWSA 1DBAH 1U3ZA 1A3RL 1FAIL 4PG9B 3ZE1E 1NBVH 4KUCF 1N26A 4HQQH 3RWFB 1AD0A 1R24A 1K3IA 4HIXH 3IDUA 2Y36H 3KS0H 1FC2D 4HT1L 2VYRE 1JGEB 4DUXA 1P4IL 4NO0D 4JM2F 4F2MA 2GHWB 2ICES 5SX4H 3GFUA 4H0HB 4X8JB 1N64H 1CLCA 5DVKA 4G3YH 2NCMA 4JM2B 2ITDB 1ZT4B 2BCKA 3TV3H 4I0CC 3O2VL 1D6VL 3W5MA 2BY2A 1KENL 4OCMC 3W0WE 3WUZA 5E24E 3MOAH 5GRJL 2OZ4L 4BH7A 4LLWA 1TLKA 5JDSB 3HE7A 4ZUVA 2YR3A 3F65A 4NQDB 4N5ED 2R39A 4BM7A 1DN0A 5DTFA 5ICYB 2ZZUT 4OM1L 2NW2B 2X44D 2H6PA 4P46C 3ZTJG 4NSKB 4CRPA 3VE0A 3GSNH 3T3MF 3RWCB 3PDOB 1KJ2L 4WW2A 4LSVL 4PJAA 3MCLH 4I3RL 3ZSTA 8FABB 3PV6B 4M5YL 1MRFL 5L8JB 4I0PB 5JPMB 4NN7C 4P9ML 2AJSL 3KLAB 3QG7H 4PG9A 5F3HB 4DVBA 2N7BA 2BVTA 2FX8H 3RWFA 3TJEL 1DQTA 1EHAA 1ZA6A 3VFUB 4WJ5B 4J8RA 3DV6B 3LQZB 1CQYA 4QNPF 5HVWA 4YHYB 4R9HA 3NABH 3PQYE 1A7PH 4HKBB 5IFHL 2VSDA 2FJGB 4X8JA 1HQRB 4JM2A 4L8BA 2ITDA 4WFFE 2B7DT 1ZT4A 2IPTH 5SX5K 5D7JD 5FGSA 3G9VA 2HRPL 3IU4H 4KXZH 3HB3D 5F9OL 1EJ6A 4OZ4B 1WQVT 3RFZC 5L9DH 1SYVB 3GKWH 1CXIA 5HGGS 1Q9OB 3WJLA 2H9GB 4FZ8H 2W60B 2NW2A 3G6JF 4XAWL 1K6QL 2LFGA 2F5BH 3CMGA 3FFDB 4F58L 5GZOC 5KVEH 3G6JB 4IRJB 3NPSB 4NSKA 4PJEE 5GSRB 3RWCA 1X5HA 4AEHH 4JRXE 1BFVL 1DVFD 5ENWB 4C59B 4WEUD 8FABA 3PV6A 3MRGB 5FYKD 3EJZD 3BKJH 4I0PA 5ACLA 2FX7L 4HUVB 3UBXB 3HI6L 2A0LC 1IL1A 3TA3C 1A7NL 2XQBL 1NL0H 3X13A 2UZXB 5K9QI 1XEDA 3QIBA 5HYFA 3BHBB 3VXUD 4X6CE 2GAZB 4LSRL 2H32A 5T1LD 4WJ5A 4XMLL 3IDNB 3NTCH 4OCNC 4C58B 1RUML 3DURA 1FP5A 3HC4H 4X4XB 3MOQA 4AL8H 4TRPL 1U95B 3L5IA 5SWSD 4ACPA 4LLYB 3BGAA 2VLKD 1EEZA 1EO7A 2C26A 3EYFB 3FJTA 3V6OA 5EO0A 3CSPA 2F19L 2B0SH 3OX8B 1QPXA 4KUZH 1NANH 3KPLB 3O4LE 3N1MC 2NY2D 4E0RB 2XWTB 1OGAB 1TQCC 1TJIL 3BKMH 3QIUB 4XP5L 4JREB 4LF3B 1V05A 2DLFH 4TNVF 3ARRA 3CZJA 5TQ2H 1KCSH 1SYVA 5JXEC 1RIVL 5E6YA 5CAYB 2HH0L 5LXGH 1Q9OA 1C5BH 4R7DA 4Y5XA 4UIKH 2L7UA 1QRNE 1RUQH 2CDGA 2ED9A 3FFDA 3VH8G 3MXVH 5T1KD 1FH5H 4IRJA 5GSRA 5CP7B 4M1GH 4LFHD 1FFNB 3K1DA 3BGFC 3MRGA 2EXYC 5EBLB 4YDVA 4HUVA 5B4MC 1CLYH 3E1F1 4HWEH 3UYPA 3GMPB 4YNYB 3HG1D 1AGBB 3BHBA 5FO8B 2GAZA 3CVHH 3RUGE 3IDNA 5GISH 3PXJA 5DK3A 4EUPA 5F88B 3W81A 1MAJA 2NXYB 1U95A 2LAGB 1I8KA 3KPOB 3RY6C 5JOPE 3EYFA 4Z7NE 1M05B 4JJ5B 4DW2H 3S88L 1WWBX 1EFQA 5KVMC 1U8IB 3OX8A 2YPLD 1JWUB 2PO6A 4PRPD 4K55A 2XWTA 1OGAA 3QIWD 3THML 4E0RA 3I9GH 1GOGA 4KZDL 2NTSP 2CK0L 3QIUA 4U3HA 5I1CH 4ZYKA 3QG6B 3MGOB 3MRHB 4Y4FC 1U8KA 1SYSB 3RZCB 2X4RB 1MFDL 3OKKB 5DF0A 3O2DL 3BE1L 2AEIT 3QXUA 1FG2B 5GGQL 1ODAA 5HDQL 5EIQA 5CP7A 1IGCL 2K9UA 4RRPG 5IJVA 3RKDC 1V3JA 1FFNA 5I1JH 1V8HA 5DUBA 1D5BB 3WKNA 4ZMAT 5BCAA 5FV2A 3C2SA 3VGBA 3U0WL 1JV5B 2G5BB 3MZTA 4S10A 1AGBA 4NZUH 2DTMH 1MCPL 4PS4H 5FO8A 4JLRA 3MJ6A 4UT9H 1MIML 5EFIB 4LHUG 3JXAA 3EKCA 3C9NB 3KPOA 1TZGH 3GNML 1M05A 1B4RA 1D5ZB 1WBZA 1KCVL 4PBWD 1D9KD 1TJGL 4TVPE 3CFKA 3NVQA 32C2B 1ZLSH 2KL6A 1PDKA 4YFDB 5ICXA 3F7RA 1YDPA 3RNKB 3QG6A 3MGOA 3SO3C 3ARGD 3MRHA 1YJDC 3QPQD 4OF5A 1UXSB 1SYSA 3BN9D 3BOVA 4HJJL 4TSAL 1P4LA 2PCPB 3OKKA 4NJ9H 4GRWE 1K8DB 2MTPA 4P3CH 1P1ZB 3HPJB 3QDMB 3I3DA 2H2SD 2DDQL 4YE4L 4PR5B 1S9VB 2JF1A 3ROOB 1FG2A 2JJWA 2NY7H 4EBQL 5KZCB 2YD7A 3UTTE 4IM8A 5HHMD 4FQCL 1BQHB 4QHNB 3DRQB 4U2ZA 1F11A 3P3YA 4UINH 2V2TB 3QP3A 2LV4A 3WFDH 2FBJH 3VXRB 3QZWB 1YPZE 1JV5A 2G5BA 2EXWC 4FP8H 2IPUK 2APBA 3U9PL 4G7VL 4WI6A 5EFIA 4JO1H 1PEZA 4GAGL 4ELMB 4I3SH 5DHYB 4KHTL 1NMCB 1NKRA 5FKPB 3QDJD 4M02A 1RY7B 2R9HC 5E8PB 1KT2A 2D4FA 2FX9L 1ZLWH 5ADOH 3IDGA 4TOYH 3DHJA 3OB8A 4HXAL 4ZAKD 2FGZA 1IEHA 2FECI 2NZ9C 3W5NA 1OGTB 3C5ZB 2E6JA 1MEXH 4PY7A 2YD5A 4OCWL 1AI1L 4BSVB 4EXKA 1HNGA 2FB4L 3CLFL 2VE6A 4YK4C 4MWFA 1UENA 2PCPA 5FM4A 1PY4A 4MD0B 1P1ZA 3QDMA 1FJ1B 5J3HD 1DFBH 1U3JA 1S9VA 5FGRA 5JZ7D 4KMTH 4AENB 1MFEL 1MIEL 3PWJB 1CBVH 5IB2B 5BMFH 1FL6A 1D6EA 4H1LG 1BQHA 1FGVL 3EDKA 1F42A 4QHNA 4CADB 5IVXE 2X42A 4OIIH 2BSSA 1YEIL 2BNQA 2PN5A 3KR3L 4XPGH 4XPFL 2DF3A 3L5HA 2ZPKH 3LKSB 5E9DB 4EOWL 2H26A 3ZL4H 3RWDA 2WM0A 4R8WL 4ALAH 1OB1A 1JWSB 1M7DB 3NCEB 5KTEL 5L88H 1HI6B 2VZUA 2VR5A 4TVPL 1U8LB 4P5TD 1EDQA 3PWLA 1J1XH 1X5LA 1SEBB 2HFTA 4YWGL 2AJXL 2Z4QB 3HUJE 4N5EC 5EIIB 4CGTA 5TH2B 1BVKB 4BSVA 1UM6H 3HAEG 1N0XL 4PJDE 5H35A 4NM8L 1MCOH 1PFCA 1NC2D 2IH3B 1LE9B 2A77H 1HSAA 5DQ9A 4RDQF 5CCKH 2GITB 4P49A 5HGHB 3IS1X 3WS6C 5E00B 4AENA 3KGRA 1A2YA 5IB2A 2XT1B 2QSCL 1A21A 1P5VA 4DN3H 4FABH 1TFHA 1IAIL 2OXHA 1RHFA 3L3HB 4EIGB 4QRPE 4BQ8A 1UZ6E 1Y0LA 4G6JH 3M07A 4R96B 1G0YR 1ZGLB 5CJOL 2DQFB 3JVGC 1CGSL 5D7JC 1HK6A 4OM0H 2B5IC 2O26U 3DVFA 2XNAB 2PYEB 1I3VA 1HI6A 1Z3GL 2NYYD 2J6EL 4JY4B 4NKQB 5CINH 2ICCA 3EO0B 2VLRE 3UTSD 3HB3C 1KJMB 1U8LA 2G5RA 3STLA 3D85A 4ZFOB 5GS1B 3X17A 4ERSL 4HWBH 1T7VA 5F7NC 2Z4QA 4K23L 4X0KB 4DWHA 1HCFX 3B9DA 3K4AA 4A6YL 4KDWA 1BVKA 5E94B 1G1CA 2DRUA 4JRYE 3V52H 4HXBH 3JV6B 1KEML 2ZUWA 1Y6KR 1A6TB 1B6UA 4OGXH 2V5RA 4GXVH 4UT7H 1DVFC 1LE9A 3EJZC 3MFGB 2GITA 3D9AH 3AY4C 5FUZL 5HGHA 3WYRA 5E08L 2R0WL 3LIZH 3GJFK 5J1AB 5E00A 2EEAA 3TO4B 1XCQB 3BKCH 2VDPL 5EIVA 4X6DF 5FOBB 3B83A 2Z8SA 1D5MB 5CS7A 1UACH 4X6DB 5LGJB 3L3HA 4NC2B 1KN4L 3QB7C 2X4NB 1O7SA 3REVB 3SKMB 3L7FB 4R96A 5ISZB 2G60H 4S1DD 3B3IB 1ZGLA 4OBSA 1FAIH 5FYLE 2YUXA 1NUNB 2IBBA 2NY2C 4IRSB 4HEPG 1Z9LA 3DVNB 4J2XA 5J9PA 3QHFH 2XNAA 2FYYA 4JY4A 4FOMA 4MD4B 4Y19B 4HT1H 2EZ0D 3EO0A 5T3ZD 1KJMA 4JPVL 3FTGA 5GS1A 5HVHC 1P4IH 1S7TB 4S2SA 5CJ8A 4X0KA 1I7UB 3MTRA 3PL6B 4MB5A 3PF2A 3VG0L 2JIXD 2ADJB 4UAOB 3F7VB 5DO2D 2XTJD 3O2VH 5IHUH 1D6VH 2VXQL 4G7YH 3L7EA 4P23D 1A6TA 1UWXK 1KENH 4KY1L 5LBSL 5INDB 2X1XR 5C71A 4YDLB 1MCSA 4OI8A 3EYOB 1NDMA 3OB0H 2CXKA 1JPSL 2BX5A 2RCSL 4OM1H 4Q6IA 1FLRL 5FOBA 3RWHB 1D5MA 4F7CA 3SKJL 1OT1A 4LASL 5DVNA 4X6DA 5LGJA 4QWWD 5INCB 1O7VA 4HK0A 4AZ8A 2ICEB 4IDJH 4LSVH 2X4NA 4I3RH 4ONGL 1YJDL 4M5YH 1MRFH 2A9NH 3L7FA 2VUOA 5F1KC 2X89D 4LFHG 2AJSH 3PJSB 3FMGL 5ISZA 1F4YH 5FCUL 4YHLL 3MBEB 4DOHE 1HZHH 3VXTB 3TJEH 4AMKL 4WUUA 1IAIM 4IRSA 3DVNA 3RDTB 1A6PA 4DGYH 4MD4A 1MI5A 4Y19A 5HBBA 1A4KA 1JWMB 3I6GB 4HFWB 3T0XA 2OL3A 1S7TA 3Q3GB 3ARFC 2X4UB 4P4RB 4Q9RL 5IFHH 1CE6A 3RIFF 2ADJA 4ZSOB 2VITB 2C5DC 3S36L 3F7VA 4JEGB 2HRPH 4QTIL 4FQXD 1PAMA 1IT9L 4Y5VB 1TCRB 4LHQB 3D0VB 2DI8A 3EYOA 3F7QA 3KWWB 5D2NC 1G9NC 2K1MA 4HZAA 3DPBA 3KXFD 4OIBA 4PBXA 4U0RB 4ZUSB 5C0AD 1JFQH 4CVZA 5F7HA 2VKWA 5JW4N 4MQSB 3SBWA 1RZGA 1J10A 4U3CA 4F58H 5CD3B 2BSTB 5INCA 2GJZA 2XWJA 4PJ9C 2ICEA 4MS8C 1HWGB 2FJHA 4YPGB 1CQKA 2FX7H 5FYLL 4NRZA 1GL4B 4IMLB 3PJSA 4U05A 3V6FB 2XQBH 5DQJA 1D9KC 4MNQD 2VNCA 1F13A 3MBEA 4U1JB 1DQDH 5SWQB 1P69B 4XNXH 3VXTA 2EE3A 3RDTA 2GI7A 4LSRH 4LGRB 4WO4B 4XMLH 5FYKE 3MO1B 1X7QA 2FATL 1JWMA 1RUMH 5LGKA 4TRPH 1BLNA 3ARGC 4OKDA 3QPQC 3BN9C 4ZOBA 3Q3GA 2V9TA 3U0TB 2HKFH 4D0CB 1D7FA 5KANI 4U33A 3VXUE 2X4UA 5C07D 4LOUD 4K3GA 2H2SC 1H3VA 1CFQA 3A6BL 5F7DB 5SWSE 1TJIH 3NAAH 3NFNB 3LPGA 2VLKE 1A14H 5C2UB 4Y5VA 3WIFB 1TCRA 2I9TA 3D0VA 1NCDL 1FV1B 3TPKA 3KWWA 2CKBB 2HH0H 4ZUSA 4U7KA 2NXZB 1JF1B 5JW5B 1ZT1B 1QFOA 1JNNL 4ZS7H 2AJYL 4R2GB 2BSTA 1R0AL 1KYOK 3LMJH 4GAYB 4FQ1H 4CJ0A 4UQ3B 1L7TL 3AMKA 3I50H 2J8UF 4CMHB 4YPGA 4IMLA 2CLZB 3LPFA 5L8LB 4JB9L 4NQDD 3D5OF 4U1JA 4ZAKC 4JKPH 5E4EC 3EJYD 4WO4A 3RVUD 3FN0L 3MO1A 4MQTB 4OFPA 1UJTA 4ZTPL 5I6XB 3HG1E 4D0CA 3D2UA 1DQJB 1N5AB 3S88H 5F9JB 4DKEL 1QFPA 5TF1L 1XGPA 4JDTL 5BV7B 4LCWD 4MA1B 3QEGL 3JUZA 2YC1A 5I8EB 5E7BA 3ECBB 3ZKQD 1K5NB 3THMH 5JZ7C 5F7DA 2FLRT 3NFNA 4NP4H 2NW3B 2V9QA 4OT1L 2OJZL 2NY0D 3ARDA 3BKYH 3OMZA 5I19L 3MLUL 1FIGL 1J7VR 2Q8BL 3PP4L 4NPYB 1FV1A 1N2RB 1MFDH 2CKBA 3O2DH 5GRZA 3BE1H 4PRPE 5CLWA 1IM3B 3UPRA 1JF1A 3MBXL 1ZT1A 3WFHA 5CIPB 2ZP0T 5HDQH 2A73B 4GAYA 4UQ3A 4L3EA 2DJSA 3QFDA 2E8YA 4PRAB 1NDGB 2CLZA 2E9BA 5GJSL 2J8UA 2ZCKH 3SY0A 4DTGH 5JHLL 3U0WH 1CD0A 4P5TC 3UZQA 2CRMA 5FYKL 3FQNB 4ZTOL 3VWKD 1YEGL 4PP1C 1KPUA 4LU5L 3EZ8A 3WO4C 1MVUB 2PW2B 4LSSL 4QXGL 5D2NE 4M93C 2XZCH 3GHBH 2IH1B 6FABH 3GNMH 1QRKA 4I2XA 1ADQL 4MZ2A 4XRCA 1KCVH 2R23A 1TPXB 5CGTA 1XH3B 1TJGH 3ECBA 1K5NA 5D72L 3SE9H 3U30B 2YHGA 4N0RA 4XPAL 1M6OB 3DTXB 4FS0A 2BRRH 5F6IC 2AK4D 4AK1A 2WNGA 4NPYA 1IARB 4HJJH 4TSAH 3SGKC 3GIVB 2DDQH 4WFGD 4YE4H 4EBQH 3GJFH 1QTYT 1VGEH 5CIPA 5IF0B 1MRDL 3TT3L 5E7FA 1D5IL 3I3EA 2A73A 3L5JA 5DJ8B 4EJ1C 5KSBE 1MY7A 3QIUD 1IAMA 3CGTA 2NYYC 1NDGA 4PRAA 2BXYA 1PGRB 5FO9A 4OGYL 2H32H 2X1WL 5HHME 4HUWB 5ERWB 1I8IA 1A7RL 1BF8A 3MLTB 3OBAA 5CP3H 1B90A 3VXSD 2GTZB 3N85L 4JZOA 2PW2A 4GAGH 2HT2D 4LARL 4UOW1 1U58B 1ONQB 4D8PA 2IH1A 2FX9H 4JO3L 2Q7NA 3L3GB 1X5AA 5D93C 3ILPB 1KCLA 3ARTA 1OM3H 3QA3B 3DUUA 3RKPA 4NDMB 1HXYA 1ZSDB 2A6JB 3VMOA 2G75B 2F53D 3QDJE 1GAFL 4OCWH 5JA9A 1AI1H 3VWJB 5KVFL 2FB4H 4MSWA 3CLFH 1DZBA 5D2LE 3SGDH 1QBAA 2NXYD 5HGAA 2WP3T 2YN5A 4L8SC 4Q58C 4X7FC 1GGUA 3GIVA 3QUYA 4LLUB 2GQHA 2DBJA 3U7WH 5IF0A 3QCVL 4S1DC 4GFTB 2ZCLL 1MIEH 3GM8A 3UROR 2ZCHH 5DJ8A 2Z92B 2D4DA 1PW3A 1FGVH 3LQAH 1K9TA 3GHEH 5EC2B 1QBBA 4J12A 3KR3H 4JKLA 3MRNB 4XPFH 3U1SL 3RZCD 2MPAL 3Q6GL 4HUWA 5ERWA 4EUPH 4LRNL 1ZVHA 4WI7A 1G9NL 3MLZL 2GTZA 3VD7A 4U1LA 4R3SB 4R8WH 4GBXB 5CEXB 3NCYP 3OWEA 1U8QB 2HTLD 2FH8A 2JJTA 5DO2C 2XTJC 1ONQA 3CC5B 3MCG1 1E4KC 1NGQH 3TFKD 2WBWB 3DETD 1FIEA 1N59B 3FAWA 3IDXL 4P23C 1WTLA 3ILPA 3LDBC 2YRZA 1T1ZB 3L6FB 3CFIC 3QA3A 4M5ZL 5FECB 5D7IF 4OCSH 2AJXH 4NDMA 4E41D 1JGDB 1ZSDA 2A6JA 2G75A 3BPCB 1I1YB 4QRRD 5D7IB 5EO9B 1PLGL 1MHHA 5CMAB 4NZRL 3VWJA 3B5HA 4ZNEE 5LWYL 4GRWH 4MDIB 3WNLA 1DSFH 1N0XH 4QWWC 1QBLL 2X10A 2KQMA 5LCVL 4GMSL 2WSKA 4OZHF 1ZOXA 2XWBB 4UDTB 1OAUL 1JK8B 2BY0A 4OZHB 1G6RA 1OW0A 1J88A 1FZJB 3QEQA 2QSCH 2ITCB 4WWKA 3L3DA 5IBUG 3FQXA 4OCXH 5EC2A 4IRZL 5H37H 3IDYC 3RP1A 3MRNA 3K2UH 5J57B 4U2YA 1CE1L 4FFWD 1I9JH 1F3DJ 3OKMB 2D3VA 2M1KA 4WHTB 3NIDF 4JY5H 4PJIF 5CJOH 4R3SA 5AZEH 1DUZB 4GBXA 5C6TH 5CEXA 1CGSH 5KZCD 2NNAA 1BZ9A 4FQJL 2ERJB 3BJLA 4C55A 1HILA 2XICA 5JIHA 4FQXC 2VRAA 2J6EH 5KG9B 3HN3A 1EO8L 3H9SB 3LS5L 2R2BB 2GCYB 4J3WA 4XHJD 3QDHA 5FECA 5IFJB 4H26B 4K23H 3VXRD 4GG6F 4IJ3B 1QQDB 4HIIB 1ROWA 3UC0L 3RVWD 1WVZA 3BPCA 1QA9A 1I1YA 4GG6B 4KKLD 5CMAA 4QOKB 3UTSE 2R0ZL 3TNMB 2DQDL 4YR6B 4GKNB 3WUWA 2XWBA 4H5SB 5FUZH 4UDTA 1U8MB 5E08H 1JK8A 4BZ2H 1CT8B 4OZHA 3HE7C 2VR4A 1FZJA 5DA4A 4X8XA 2VDPH 4LVEA 1JYWA 3C5ZD 2ITCA 5C08B 5EDXA 1PG7H 3QFJB 4LLMA 4ZPTA 1KN4H 1HQ4A 3CDCA 1YEKL 4PV8B 3S35L 4WW2C 3OKMA 4R7NA 4PJ7E 4LOUC 4OSUL 3P0VH 1TQBC 2VB5A 1G9ML 4QHUA 5GSVB 3CPLA 4PJIA 2VDML 5IKCB 5KG9A 1NFDE 3ISWA 5DFVD 4KC3B 5IV2B 4QF1B 1I8MB 3MROA 4APQA 2GCYA 2R8SL 4WHYG 5IFJA 5EORL 4X98B 3NH7L 4HIIA 5E9DD 1PQZA 3EYQD 1X4ZA 4GG6A 4QOKA 3W11D 4XC3L 3CSBA 3TNMA 1RZ8B 3P2TA 1WAAA 4O9HL 2EYRB 2VXQH 3GZKA 5C0RL 4KY1H 4GKNA 5LBSH 3T0DA 3DYMA 2ID5A 1U8MA 1G7IB 2XTJE 3WFBL 2O5ZH 4I77L 3LN4B 1JZ3A 1A47A 2P5EB 5DJ0B 3EJYC 2UVEA 5JR1H 3KHQA 3RVUC 3QFJA 5GS0H 1BEYL 4LAQH 3CFDB 4TUKL 1YJDH 1EXUB 4PV8A 4BQ9A 5TGBA 3DO7B 4PJCE 4I0PC 5EC1B 4L8CB 5GSVA 5DK2B 1BBJA 4X4MA 4X9BA 3N9GL 4HMEA 3VXMA 1AXSB 4KXZI 4MJIB 4OTXL 3IFLL 4NO5B 2NY0C 4MB4A 5IV2A 1NCCH 2DIJA 1PX4A 1I8MA 5JPNB 3T4YB 3TJHD 5JQHC 4L4VE 2JCCE 1KXQE 4X98A 4YIQA 4Q9RH 4CVXA 5J7CC 1CZ8H 2IEPA 2R4RL 4YHML 3S36H 3TBVB 1X5XA 1RZ8A 3DMMB 4QTIH 5GHWL 2EYRA 5TDPB 4XVJL 3HZMA 1OP5K 2PYED 3K8MA 3GSWA 3QWRD 1QD0A 1G7IA 1LP9F 1L4IA 4GO6B 4WHDA 1MCHA 4O2CB 5EU3B 1NSNL 4R4BB 1FFOB 4HGKC 3EGSA 5J89A 1Y18B 3QH3B 4KJPD 4JY6B 1KTDB 3DYPA 1JYNA 1BFOB 1T2QL 4P59L 2BY3A 4NNXA 4K8RH 3T4AA 1OD7A 4IRJC 5C0AE 3NPSC 5KSVA 1EXUA 3U6RB 5FYLH 3DO7A 3LKPB 1NCAL 1BJ8A 4L8CA 1CL7I 1NANI 5DK2A 1KC5L 3LEVL 3TO4D 3D18A 1XGUA 1T0MA 1AXSA 1CGWA 4MJIA 4MXVE 2FATH 1FNEB 1FL3B 2BVYA 5I2IB 1BPVA 4Z77B 4FQIH 4HHAB 4F9PA 5T3ZL 1GVIA 1FBIL 1W8NA 2HKHL 5ISZD 5HPMA 3TBVA 3A6BH 3KPRD 3PG2A 3DMMA 4UV4H 3UBXG 2DKUA 3RVVD 2HFGL 3A67H 3MRRB 2HLAB 5CKGA 1EGJA 1EX0A 1IFHH 2NTFB 5C07E 3D1MC 2CLRB 3MV01 3QIUC 1LD9B 4Y19D 1NCDH 4O2CA 5EU3A 1OP9A 3WSQL 4RMQA 2VXUL 3MPCA 1LP9A 4R4BA 3PL6D 5IB3B 2EC9U 3N1GC 1Y18A 1JNNH 3QH3A 5E6ZA 1U91B 4JY6A 1KTDA 1R0AH 3G5XB 2EDRA 3OAUH 2DQJH 1RUKL 1MHPL 1L7TH 2J3SA 4KK5D 5HTSA 4NZTL 1KELL 3C08L 1MWAH 5BW7C 2W59A 3STZA 2X7LB 3EDJA 4Y8DC 2GJJA 3FN0H 3MGTA 1FNEA 3T2NL 4KK9D 5B8CB 2R1YB 2EIEA 1C16B 4NQDE 4Z77A 5BOZG 2NXYC 4HHAA 3WS3A 5JNYA 5TF1H 2Y4SA 3QEGH 5JOFA 4TUJA 2QHLA 3ILQD 4XT1C 1DR9A 2OJZH 2HLAA 2FHBA 1FO0B 2NTFA 5I19H 4L9LB 2CLRA 2WWMD 3MLUH 4JO4H 4N9GB 2MFNA 3WIIH 3IAQA 3RL1B 5F89B 3HMXL 4JN1H 4W4OA 3RZCC 1JL8A 2HT3D 2EEBA 1J8KA 3T0AA 4KK8D 1EIBA 3G5XA 2RFXA 3K81A 3UO1L 1Q1JL 4XCEA 2IANB 3MSPA 4WHCA 5F6HJ 2HTLC 2Y7QA 3TFKC 5DWUL 1KULA 1OAYL 4LVOB 3DETC 4QNPE 1J8HB 5DVOA 3DX7A 5JHLH 2APWA 5FYKH 2DQUL 2EE2A 4P2CG 3PV7A 2OL3H 1YEGH 2IJ0C 4LU5H 4KDVA 5HHQB 4LSSH 5A2FA 5B8CA 2R1YA 3GK8L 2CUIA 2EECA 1T20B 4X80H 4WEBH 2Q3ZA 1ADQH 3BT2L 5E2VL 4JJHA 1XF4B 4LL9A 4Q9QL 3NGBC 4DAGH 2BZDA 3MV7D 4PRHD 4U6VL 4LSTH 5DJ6B 5D72H 1WZLA 3G6JE 4WI5A 3MV9B 4XPAH 4HGWB 1FZOB 1C12B 3BPLC 1XR9A 5FA3A 4EN3B 3N06B 3QO1A 3RL1A 5F89A 5GGVL 1CXHA 2JJSA 1YEEH 2EDDA 4X7CC 4RMTA 4N8VB 1MRDH 1QSZA 2AK4E 2BVOB 3BIAX 3TT3H 1JNHB 1N5YL 1D5IH 2IANA 1LO5B 4FMKA 2BFVL 3ZLQC 1J8HA 3DVIA 3VFWA 4WFGE 1ORSA 5EU6A 4CDHA 4OGYH 3CXHK 3MJ9L 4XHJC 4WDIB 1O0VA 1A7RH 2VDRL 3CD4A 3INUL 2NXZD 3RVWC 4AIOA 5BOPA 1A6ZB 2DJ4A 4KKLC 4LARH 2X4PA 4PB9H 5KVDL 4KJYB 1T20A 3LB6D 1XF4A 5D96B 3WFCL 5FGBA 3WN5A 3VXSE 1BQHG 1ZT7B 4MA8L 4N8PA 5HGBB 5DJ6A 4F9LA 3TVMA 1OCWL 4OCYL 5FV1L 1GAFH 1RZ7H 1JGLH 3W9EB 3QZWG 4HGWA 1C12A 3C5ZC 1KGCD 5D7LB 2UUDH 4EN3A 5DJDB 3V9FA 3PNWA 3PGFH 2FRGP 1RZIA 3M8OL 4N8VA 1RJLB 2BVOA 3VGFA 3B2UD 1QUNA 2IGFL 1KTKE 1MREH 1DEEA 3RWIB 1YEHL 1J0YA 4WV1B 5DFVC 1F6FB 4N0CD 4GJTB 2MPAH 4MHHG 3Q6GH 3UDWA 4WDIA 3MODH 3DUHA 2E27L 1G9NH 1AP2B 3MLZH 5EUOF 2FBOJ 4UB0H 2V5MA 1IGIL 3W11C 1M4KA 1R3HB 3FHAA 5EUOB 4KJYA 4BH8B 3IDXH 1GGIH 1A6WL 4OZFH 3KG5A 2XRAL 5D6DA 1MNUL 1ZEAL 3U4EB 2YRPA 4CKVX 1ZT7A 5HGBA 5IMOA 3GBML 2F58L 1PLGH 4R0LB 4JFOB 5BS0A 4NZRH 4I0KA 2FNBA 1YN6B 5D7LA 5DJDA 1S9YA 2COQA 4XCYB 1U3HA 1QBLH 5I1AB 4E41E 5LCVH 4GMSH 2XACC 4QRRE 2I27N 4U1KB 1RJLA 5HYIA 2KPNA 1FDLH 1W72B 2C3VB 2CRIA 4Y8AA 1A6UL 3N1FC 3T0BA 4IRZH 4Y4KD 2C3GA 2CIIA 4G9FB 1CE1H 4YDKL 3TJHC 1ZVSB 1TZHB 1XMWA 1J1OL 5JIPA 5J4MA 4F3FA 1T4KB 3WL9B 1NMBH 4G8IA 4RBPK 4LIQE 1R3HA 4U4BA 2ED8A 3MRQA 5F9DC 4FQJH 5EUOA 4CVUA 4BH8A 1XF2B 4ZFFB 4RDQG 3X3GL 1T1WB 3U4EA 3LS5H 2OMNA 3KPNB 4F57H 3K3QA 1WZMA 5J8OA 2MSPA 3CLEH 3T0ED 3TCXA 4XBGB 4NHUB 4JFOA 3VDAA 1M7XA 4I1NB 2P8MB 2R0ZH 1YN6A 4GRMB 3TF7C 4KJPC 1IBGL 2DQDH 2VOTA 3IDMB 3AS2A 1T04B 3VXRE 5I1AA 4GXUN 3G5ZB 3L95B 2Z93A 3LVEA 5AG8A 4R4FH 1I3RB 1HDMB 4ZS6D 1W72A 4ELME 3TH2T 2ZUVA 3TO4C 5J0BA 1S7UB 2CLVB 5IVNA 3MYJB 3VW3H 2F54B 3OL2A 1OTTD 3B6SA 1ZVSA 1MCKA 4PJXF 3S35H 4RGMC 1T4KA 5MERB 3WL9A 2BC4B 5B3NA 2FECL 4YHKL 4PJXB 1G9MH 3QNXB 3SDAA 5EZIL 1KIPA 3WFEL 1HKLL 4KVCL 3EOTL 1YYLH 1XF2A 2VDMH 1CIDA 3RVVC 5DRNA 2E7LA 4RISL 1FPTL 1QYGH 5I1KL 2EO1A 1RVFL 1IKFL 5EORH 1LNUA 2H41A 1OSPL 1D3CA 2IALB 3R0NA 3U0PB 4B7IA 4JFHD 3V4PH 4XBGA 3D39B 5D5MF 3PL6C 3VD5A 3DI2B 4GRMA 4QHMB 5AG9A 3RA7H 1MELA 5B38B 4FTVD 4GBXD 4O9HH 4UAOC 5KOVC 4A2MA 5D5MB 4C56A 3ES6B 2C1PB 5C0RH 3GSOA 5B3JF 5I66A 3KPQA 3RVXD 4U1IB 4KK5C 5E9DE 2VSCA 5D8JH 1F2QA 3G5ZA 4YUEH 3L95A 4FRWA 4RMVA 2J12B 5F3BB 1YEFH 2AV7A 3BO8B 4XVSH 2Z35B 4YDLC 4Y88A 1I3RA 5F71A 4ETQB 3IDIB 3WFBH 4KRPD 3LS4H 5HGDB 5DHXB 2ZG1A 5F7LB 5I1EL 2A9ML 2CLVA 3G5VB 2W38A 1AFVH 2F54A 1KCRL 5JIIA 3SBWC 4KK9C 4YBLB 2BERA 3OJVC 1XIWB 2NX5B 5ID1B 3UX9B 4LIQL 4PJXA 5F8RC 2K7QA 1U93B 5IEKB 3N9GH 2Q7YB 2Z91A 3MBEC 5HDLA 4GKZB 1XZ0B 3IFLH 4NCDA 3M17A 3RDTC 4K9EC 2V2WA 2FD6L 2P48B 3EJJX 4U1MB 3S97C 5ITBH 1LGVA 4TSBH 1M7IB 4GW5B 3PWVB 4KRNA 3QUKB 4OLXL 4D3CL 5DZLA 2E7HA 2PTTB 3BQUD 2HFEA 3MXWH 3GI8L 4LSQL 3D39A 3RHWK 2HT3C 1BZQK 4MD5B 4QHMA 5B38A 2W92A 4KK8C 3ZDYF 3ZKMD 5D5MA 3ES6A 3IF1B 3NCBB 4XVJH 4JDZB 1UFUA 4U1IA 5F70A 4ODTL 1DTUA 4PJ8B 1KB5A 3F7YB 5M94B 5F3BA 1AD9A 3H9SD 4Y5VC 1MJ8L 4O4YL 4ETQA 1ZTXL 4NQTA 5AD0A 5L7XH 1VFBA 2H1PL 4B0MM 4U0RC 3G5VA 2HT4D 3ARZA 2PYEE 4XGZA 2J4WL 5ESAB 2AABL 3D25B 1X5GA 2LTQB 5ID1A 2O5XL 4K7FA 4QHLB 1NCAH 1U93A 1HINH 2GJ6D 3SDXF 5IEKA 1KC5H 3LEVH 2Q7YA 4TNVK 2QSQA 4RA0C 1TNNA 3IVKB 1XZ0A 3SDXB 3U4BL 2YUZA 5C08D 2YD1A 4WO4C 4U1MA 2LVCA 3BSZL 2WINB 1M7IA 4N1HB 3PWVA 5CJQL 5T3ZH 3PGCB 1VEOA 2PTTA 5MEND 4ZUUB 2ZWLT 2ZSWB 2HKHH 4OD3L 4XNQA 5IG7B 4MD5A 5DUML 4X6DE 4MAYB 3V7AG 1T89A 2H2PD 3IF1A 5KOMC 4JDZA 1QLRA 4PJ8A 4P3DB 2G9HB 3S3PA 3S37L 3CX5J 3ME0A 5ISZE 2MQ3A 3FQRB 3KPRE 3WSQH 3HZKB 5IBTL 3ULVD 3FRPA 2CJUH 4PJ5D 1I7ZB 5CLTA 2NXZC 1HHKA 4Y19E 3F8UB 2HLFD 1LO4L 3S98A 1RUKH 1MHPH 1NEZB 4JM4H 2NY4B 4NZTH 1IGML 3LB6C 3VD9A 1KELH 2D03L 3C08H 1VKXA 2HA1A 2VO5A 3IXTB 4QHLA 4CMHC 3LHPL 4TVSa 2P47B 3QULB 4HUNB 1CXFA 5BO1L 2VDLL 3MZGB 4S11A 5J11B 4LLVB 2X4QB 3SDXA 2P5ED 4X9GA 4ZD3L 1CLZL 3T2NH 3O8XB 2PKDA 4G6ML 3L5XL 3SPVA 4PJGB 5L2JA 1R3LB 2AJZB 5LJYH 3BX7C 3PGCA 5I6XC 4I4WB 2IADA 5D7SH 1FZMB 4ZUUA 2ZSWA 5MEQB 1A1MB 1YNKL 2V2XB 5IG7A 2JB5L 5BV7C 3B2UC 3UTZB 3PWPB 4X7SL 1H0DA 3PDGA 5J13B 3ZDZF 4HUKB 3BRDA 3T04D 2R29L 2OI9B 3HMXH 4KRMB 3VXNA 4N0CC 1G0DA 3W2DL 3WEXB 3HZKA 4W81A 1IGYA 3DXAB 1I7ZA 4GOSA 4HKXB 3P4MB 4K71B 4RIRA 3T2QA 4BFGA 5HYJB 1Z6JT 1RUPL 4ZFOL 3UO1H 1NGPL 1VHPA 3U46A 5T33L 1FSKB 1NEZA 3V79C 1CDIA 1F6AA 1OAYH 4MDJB 4W6XB 2GT9A 1G7HB 1OTSD 3OHXA 1OL0A 1RD6A 3IXTA 4GMTL 4GQPH 1CDBA 4LMQI 5CD5D 4ZSOE 3QULA 3VRJB 2DQUH 2P44B 5C7XL 4RBPH 1N6VA 5KVGH 3UYRH 1I3GH 2X4QA 1VFAA 3O8XA 2I9LA 2PUQT 3RTQB 1NUGA 4NUGH 1R3LA 2AJZA 3BT2H 4PB0H 1RZFH 4MA7L 5IOPA 4OF3A 1KG0B 1QEWB 1B0GB 3OV6A 3KDMA 4I4WA 1FZMA 5IQ7H 4LEXH 4ONHA 4OIAA 3O2WL 2FSEA 1WFNA 1TPXC 3QUZB 4AH2B 2PXYD 3W82A 5I16B 1IGTB 3UTZA 3PWPA 2X2YA 1AKJB 3U30C 1CFTA 4PD4K 1U2CA 3SDYH 2X4SB 3B9KD 4PRHE 4Y4KC 4QTHA 3FFCD 3V7AE 5GGVH 2N1KA 3V7MA 4Z6AT 1IRAY 4R26L 4HKXA 4IS6B 4ETYA 5HYJA 4M7JL 2QV2A 1U8OB 1N5YH 1ITCA 3IXAB 1CU4H 2OLDA 4XC1L 4KPHH 1G7LB 1NCBH 2R0LL 5I1HL 4PRBA 1GOHA 4PYHA 2AJUL 3AAZB 1C5DB 5CHNA 1I7TB 5TPWH 2M8XA 2P5WD 3T0EC 2LU4A 4RMUA 4MGXA 5FFLA 2GK0B 2DL9A 3C2AL 3RTQA 5KVDH 1AHWC 2AV1B 2VQUA 1B0WA 2JJTC 4KZEH 1E4WL 2BXZA 3FT2B 2Z0BA 5BVPL 2X9WA 1B0GA 5ADPH 3BWAB 3HC0B 1A22B 1OCWH 3PXHA 1I8LC 2AXHA 4OCYH 5DHVH 4ZS6C 2RHEA 2RAMA 3RL2B 4I5BB 2XN9B 3TO2A 2X4SA 3HFML 3SE4A 2F8XC 5AAMA 2EIZB 1OTTC 4K9EL 5DVMA 3WHE1 1E4XL 1SVZA 4IS6A 2C3HA 1KGCE 1U8OA 1IM9B 5BZDB 4L4TB 3GBLA 2IGFH 2W07A 3IXAA 3MLXL 1ZGLM 1MFCL 2LABA 3KPSB 3K7UA 35C8L 3G08B 1UVQB 1MFAL 1NC4B 2A83B 1H15A 1KPVB 3AAZA 1C5DA 1I7TA 1EK3A 3RU8L 1D5XB 2E27H 2XZAH 1IGIH 1AXTL 3QCUH 3GMQA 2ARJB 3VI3F 3UJJH 3BDXA 4GBXC 2PW1B 2E9WA 1A6WH 3QBTB 4HFUL 2XRAH 4N0UA 4YGAB 3RVXC 1MNUH 3WXWH 3BWAA 3HC0A 2EKSA 4BQBA 1RFDL 4JVPA 2XZZA 1YMHB 4P2QB 3O11B 3UJIL 3I6KA 3GBMH 2F58H 3FKUS 4LPUA 3QUXB 4IEFB 2DLEA 5LGHL 4EI6B 2W91A 1N3NA 3N0PB 2XN9A 4I5BA 1IAII 3RL2A 3X11B 4KJQD 3CU7A 2HJKA 2VAAA 3PHQB 1LO3L 4I48B 5F8QC 4M9OA 2EIZA 4D9LL 4OUUB 4ENED 3MLPA 1PKQB 3QXAB 4LQ1A 3L1OL 5BZDA 2DL2A 1SEQL 3ULSB 1E0OB 2P7TB 4DEPB 1A3LH 1QVOB 4IDLA 4K7PL 4PJBB 5I1IH 4LKXA 5JTWA 3MV9D 3KPSA 3CMOL 3C09B 1A6UH 1MHEA 1NFIB 1W8OA 1WF5A 3G08A 2ATPA 4G80B 3ZYZA 2A83A 4FQPA 4OFDA 3GMOB 1J1OH 4KQ4H 1EAJA 4RZCA 5KSAB 3TYGL 1FYTB 3BQUC 3AM8C 1P2CA 1KCKA 4D0DB 2ARJA 1MH5A 4PREB 1T2XA 5CSZB 2EYTA 3ZKMC 1UWGL 2C7UA 3NFPA 2VERN 3ZKND 1CFVH 2ERJC 1A7BA 2RR3A 2GIYA 3MMEB 3TBYA 3QI9B 3NZHH 3T09A 3D48R 3BP7B 3FRUB 1OQOA 4MQXD 3IFPA 2I60H 1CFBA 3FOLB 3GSNB 5IVZB 3O11A 1RSFA 1QP1A 1PG7X 1ZHBB 3QUXA 5FB8B 2MNUA 1II4E 3FO2B 4X4YB 4XBEL 1J0KA 1IBGH 4FA8A 4I48A 1F02I 3GMNB 5DDHB 3T0EE 2IMNA 1PKQA 1IAKB 3HR5A 5EOTB 4NQVB 4BZ1H 3ULSA 1A9EB 1NBYA 1V3MA 4JCMA 4CL7A 1NAML 5BV7L 1NFIA 4NWTH 4PY8I 4CNIB 2Q86A 1BMGA 4G80A 5HYSB 3FB6B 3OXRA 1ZAGA 2GY7B 1OSZA 1Q9KB 4I13B 3DNKA 5DD5L 1YYML 2N7AA 4I18C 4YHKH 1YEDB 4UILH 5EZIH 4Z7QE 4JVWA 1HKLH 3EOTH 3ET9F 5CSZA 5EWIL 4E9LA 4PG2A 2H2PC 1K3ZA 2ATKA 3H3BC 4HIJB 4JPWL 4U1HA 2C4FT 5I1KH 3QI9A 5MHSD 1RVFH 1IKFH 1BQLL 5CSGA 1DLHA 3C6LD 1BJ1J 1EERB 3FRUA 1OSPH 4FFYL 3FOLA 3GSNA 3EOAB 2QQKL 3MR9B 1ZHBA 2OR8A 1UA6H 5DC9B 3SDCD 3ULVC 5L0QC 4OFYA 1CCZA 4P9HC 2HLFC 1S9KC 3GMNA 5JORB 4JFHE 3IT8D 3VFSB 3QNZB 5BVJB 3OR7B 5EOTA 1FORH 2IPKA 4JR9H 1JPGB 5I1EH 4PRIB 3I84A 4EIZC 4CNIA 3MLRL 3S34H 3VFOB 4JZNA 5IUSA 3PIQB 3FB6A 5CJBA 1JZ4A 1U2HA 2WIIB 1PG7W 1Q9KA 2P4AB 3BPNB 4J4PA 4NT6B 5C92A 3FB8B 3S36X 2QHRL 4M1CC 5E70A 5D7IE 3U79A 1HH6A 2QADB 1KB9K 3BZEB 1QSFB 4HDIB 1OD9A 3L5WB 2DQTL 4LAJH 3VA2C 1CR9L 4UQ2B 3CFEB 4G9FD 4OZHE 5C0BB 1B6DA 3MR9A 2DM4A 3ETBF 4J1UB 3GI8H 3D0LB 4LSQH 1R6VA 3V4VL 2CIKB 3RWEA 2DMKA 2PF6A 5C09D 5HSFA 2APFA 4J3UA 5JORA 3BP5B 4ODTH 1CF8L 3QDGB 2I25N 1RAMA 4BK5A 3CVHB 1MJ8H 1OTSC 4JPKL 3WKML 5BVJA 3OR7A 4O4YH 1MQKH 5DD0L 3BUTA 5DK0A 5HJ3B 5DURD 4PLJD 3O6FD 2X1QA 3NIDE 2W0KA 4PRIA 4AYFA 3RAJH 1BECA 3ZT5A 3H9SE 3VFOA 3KLSA 2J4WH 1A4JA 3PIQA 4Y5YC 5E5RB 2WIIA 5DRXB 2O5XH 1HIML 1FVDB 3L3KB 4EDXB 5C9JA 3FB8A 4OQ1A 3MRIB 4FG6D 5KJRH 1S5HB 2XV6B 4BFIA 4XHQA 5FIEA 4YGVB 2I07B 4JZJA 4EEEA 3BZEA 2B1HH 4HDIA 2WBKA 4PJHF 5IFAH 2PXYC 3R0MA 3U4BH 3KJ6L 2Y5TB 4Y4HD 4PJHB 3BSZH 3CFEA 2Q6WA 1BD2B 5ECJE 1TIUA 2NMSA 2NY5C 2GJ6E 3IYLW 4HS6B 5CJQH 5C0BA 2GSGB 5DS8A 5T3XD 4J1UA 1F00I 4OD3H 5C08E 4M43L 1QFWM 3TN0B 5JHDB 3BDYH 5IEHA 2EDXA 3AGVA 2NPLX 3QDGA 1HOCB 5MENE 3S37H 2ORBL 3CVHA 2CPCA 1WZKA 1AGCB 2CGRH 5HJ3A 2ZKHH 4Z78A 1H5BA 3CDYA 5IBTH 5I1GH 4X4ME 2O61B 2W0FB 2OP4L 1OHQA 4FQHA 3MRPB 2X5PA 1LHZA 4M6NL 5AYUL 1EZVY 4EI5B 5DMGD 3ZSSA 5I74C 3KPTA 4U31A 4UTAL 3ABZA 3HC3L 4X4ZA 1IGMH 4PUBL 5DRXA 4HG4K 1FVDA 3L3KA 3ULVE 4JFEB 4PJ5E 1UH3A 5SWZA 7CGTA 1S5HA 3LHPH 3BRFA 5BO1H 2I07A 5DC0A 1P9MC 4LVNB 3BFOA 4ZD3H 1CLZH 5ILTH 2Y5TA 1VFUA 3MYZA 2UYLB 2OTUB 4G6MH 4GRLA 4X5XA 4KROB 1NUFA 1EZVX 4TULL 4HS6A 2GSGA 3O6LL 1XIWD 2HWZH 3GSUB 4DQOH 2NX5D 1FNLA 4UZGA 2P5EE 1YNKH 2JB5H 5TFSL 4HWNA 4LVHC 4XPBH 5FKAA 1I3UA 4X7SH 43CAA 3VGDA 4XAKE 4I8DA 1HOCA 1HYRC 4XH2A 3ZDXE 4HBQA 7FABL 2QKIB 4L9LC 2GY5A 1PSKL 1AGCA 4HK3J 3W2DH 1BWMA 1JJUA 1EPFA 1JZ2A 4LSPH 2EDNA 4RNRB 4DKFH 2JJSC 1FNAA 4BK4A 3MRPA 3QEUA 3ARPA 4KQ3L 2EDKA 2AGJL 2VQTA 5T33H 4X6FB 5D6CB 2ZUTA 5IB4B 1RHHB 1WWCA 4PJ8D 2AXGB 4LVOC 4G42A 1WCBB 2E8ZA 5C7XH 3QRGL 5CZVH 2X70B 5F96H 3U82B 2HMID 4NQSB 1KLGA 2IC2A 3K4DA 5ALBL 1F4XL 4LHJB 2UYLA 4ONOA 2OTUA 3EO9L 4LLDA 2YSSA 1EEUA 4KJQC 1UJ3B 4NCC2 2WUBL 3LQMA 2YD9A 4MA7H 1DBJH 5I0ZA 4DK6A 3GSUA 3AS3A 5C0DA 4YC2B 3O9WB 1R5IA 4N1EA 5AWNL 2EDHA 1YY9D 3SDDB 2YPVL 4F9LC 1L9NA 2YOCA 1TCMA 4Y16B 2P43B 1YUHA 3C60B 4DN4H 2QKIA 4YEEA 1JTOA 4JFPB 3RX5A 1Q9WA 4R26H 1VADA 4M7JH 1L9MA 2UWEF 3CDGB 2J7LA 3LKQB 4ORGB 3FFCE 3ULVL 3IFNH 3O3DB 1CFNB 4MAYD 4X6FA 3SCMB 1ED3B 1RHHA 3MA9L 1GPOL 1IEBB 4P9HL 5F21B 3ESUF 4P5MB 2AXGA 3L3OA 1ZHLA 3F5WA 1OAKH 3MV8A 1QSEA 4Z5RA 1WCBA 1HHHB 3F58L 1W0VA 4L5FL 4YBQD 2X70A 4MQXC 4XP9L 4XI5D 4BUHA 4NQSA 5IMMA 3UDWC 3U9UB 3GUTB 1NCNA 5EH1A 4PLOB 3UTQA 1UJ3A 3U7YL 3HMWL 4N8VG 4FNLL 1E4WH 2NY4D 4R97B 4NKMB 1GGCL 3CH8A 3KNBB 2ICWB 4PTTA 3R8QA 3QNYA 4L3CA 3UJTL 1H8SA 1JTPA 3WJJC 3V4UH 2AJ3B 1P7QD 3SDDA 1ZS8B 5ELIA 3C60A 3GB7A 4KI5F 4OGAD 5J6HB 5I15H 2MHAA 2DMCA 1F3JB 3O6ML 4PV9A 4Y2DB 1LEIB 1OP3H 3QR2A 3F12B 3HNTH 4NO3B 3CDGA 1RMFH 4F7PB 4ESKA 4CDGC 3LKQA 4QXUL 4ORGA 4Z0BL 3VDCA 4RWYL 2UWEA 1MFCH 4NQCB 1U92A 4TYUA 1IEBA 1CVRA 1MJ7L 1C1EH 5C0ND 2CDEA 4ODWB 4WV1C 5F1IA 1FNSL 1HHHA 4NJAL 4XWGH 1I9IL 1IC5H 2DQGH 3DXAD 1J86A 5HYJD 1AXTH 4M48L 5DJ2B 3SDCC 4JVUA 4Z7OF 3LKNB 3N50A 1P6FA 1DANT 1F58L 5GGTA 3S5LB 3RGHA 3OR6B 1Z9OA 2VXTH 2DYPB 3QQ9D 3DOSA 4NKMA 1RFDH 5MEPA 3KNBA 2ICWA 2YK1L 5IGXL 1S7RA 3MLVL 4K2UH 1U42A 5LGHH 2EC8A 3FOMB 3NBNA 3TBWB 4UDUA 4R0LC 1J8HE 4HKJA 3LKRB 2CR3A 3EYUL 2B8OT 5J6HA 2VDNL 3ARBA 2IG2L 2D7MA 3BP4A 3Q1SL 1WFOA 4OLWL 1F3JA 4UIMA 4ZXBB 1LEIA 2NY5L 3F12A 4NO3A 4UOJA 4OF6A 3NACH 4DGVL 3GRWL 3QUZD 4HWBA 4NQCA 1TVBA 3AREB 4BSWB 3GSQB 2HTKC 5EZLB 1AKJD 1BZ7B 1J0ZA 4OB5L 4WU5A 3VD4A 5ALCL 2ADFL 2D7QA 2FWOB 2CD0A 2VLLB 1JYVA 2ZSVA 3V8OA 3TYGH 1JPTL 3MV9E 2VLJB 1WC7A 4PGZA 5DJ2A 2MQ0A 4K94C 2MJWA 1I1AA 4ZDHA 3LKNA 3VFMB 4U1NA 1TDQA 1ZXQA 1UWGH 4S1QL 3MA7A 5IMKA 1PZUB 1RJCA 3V95A 3TWCH 2DYPA 1CK0H 3IKCB 3H0TB 1T6VN 3BD3A 1RJYB 3TZVB 1DCLA 4O58L 4OZGF 4PLJC 1YNTB 4UUJB 3VG9C 4OCRL 4XBEH 3TBWA 5HHOB 2Q76A 3EYSH 1XAUA 1ITBB 4ZO6A 3P9MA 1J87A 1DQLL 1YQVH 2EKJA 3S35X 5B4MD 3NFSL 3Q48A 1UM5L 5SV3A 2P8PB 2ZNWA 3MFFB 4ODHL 5JLZB 1S9XB 3P30L 4YHZL 4ZXBA 4OD2B 1F8TL 5ITFB 1F90L 4FG6C 2EDYA 5DR5H 5DYOA 3TPUB 3SE8L 1NAMH 4BSWA 1WBYA 5DZNA 5I8KH 4HBCL 1BZ7A 1X4YA 4Z7UF 5D1QB 2BNRB 5H2BA 2APVA 4GW1A 4Z7UB 2FWOA 5GS2D 5DD5H 4YXKL 1FO0L 1YYMH 4XNMB 2VLJA 4WGWB 2EDWA 4UOW0 2OZ4A 4Z7WF 1CDCA 1IM9D 3VFMA 4L4TD 5EWIH 4Z7WB 1E6OL 4MCZA 1INQB 4Y4FD 3JWOC 3GI9H 4JPWH 4QXWA 1A6AA 4QY8A 2DQIL 1U8JB 1NC4D 2FZ3A 5IIEB 4LHUD 3H0TA 1J1PL 1RJYA 3C8DA 1KJ2A 2FDBP 3TZVA 1FVEA 5C6PB 4K3JL 4WVRA 2AEPL 4OF7A 1MLBB 3FAXA 4ODVL 3GEWB 5EZOL 1YNTA 3ZT7A 5FAAA 3GBNL 5IWLA 1V3KA 4OZGA 4MMZC 5MHSE 3AFLA 5DMGC 3C6SB 4YO0B 5C0JB 3MFFA 5JLZA 1S9XA 5TJWK 1A9BB 4OD2A 3VGEA 5ITFA 5CILH 2D9CA 5EUOE 4KGLA 4P2QD 5D1QA 2BNRA 3MLRH 1TZIB 5DJYA 2YA2A 4PGJA 3L3IB 3LD8C 4Z7UA 1ORQB 4PJFF 1T21B 1Q94A 3VFVB 1FNFA 1MLCB 4YBLC 5B38G 2F5AH 3OF6A 2QHRH 4PJFB 3KS0J 1XIWC 3CUPA 4E42B 1T5WA 1C08B 2VL5B 4Z7WA 5C9KA 5J56B 1INQA 3SOBL 4DGIH 1GGBH 2IAMB 1CR9H 3SQOL 2IBZY 4JGMA 5DRZA 1U6AL 3EDFA 1U8JA 1T83C 5IIEA 5D1XB 4NGHL 4H88H 1FFPB 4X6EB 1MLBA 5KSAD 4AEIL 5F7UA 1YEJL 1FYTD 1P84J 5K93A 5J1SC 1EVUA 5ICZB 4G9FE 4U6XA 2YMXL 4YO0A 1FE8L 5C0JA 5EU5B 5IHZA 4POUB 1T89C 1A9BA 4PJ8C 4L1HA 3PQYB 2IBZX 5EU7C 3PWNB 3HRZB 3RJQB 1TZIA 2EDTA 3L3IA 4NN6B 3T1FB 1LEKB 1ORQA 3W0WA 1CTOA 4BH7B 1T21A 3ZMRA 1HIMH 5C86A 1DQMH 3T08A 3SEPA 4PJFA 3DARA 2OM5A 1KNOB 5DTFB 5HD8D 1C08A 4PRNA 2H6PB 4MXWH 2CDFB 4PJEF 1YY9C 4PJAF 3KJ6H 5GQBA 5IW3A 3U2SB 5IQ9B 2IAMA 1FL5A 1RURL 2NR6D 3FRPG 4JRXB 4PJAB 2C4XA 5E2TH 1GGTA 1NAKL 1X5FA 5D1XA 1QLEL 2L0DA 2MKWA 1A1OA 1UEMA 4JFDB 1CXEA 5F7EL 1INDL 4DVBB 3C8KA 4M43H 1DLFH 4OZIF 4TSCL 1JGVL 2F54E 2HN7A 1FNGB 1ZA6B 5ICZA 4OZIB 4J8RB 4LQFH 2MWCA 5EU5A 4MAYC 2WUCH 3CSYB 5T3XE 1VGKB 3ARUA 4YX2H 2ORBH 5FK9B 3OGOE 4KHXL 4RX4D 3RPKA 2OR9L 4PJXE 1RJZB 3PQYA 4XXCA 5D1ZD 4L8BB 4YBQC 2OP4H 3PWNA 3HRZA 4XI5C 3BPOB 1EHXA 2QSVA 3O4LB 1L0QA 1H3UA 3T1FA 1LEKA 3HC3H 4RAUB 4H0IA 3SGJA 2W1NA 2NY4C 3WLBB 3BXNA 1KEGL 1KNOA 4Y1AB 2XA3A 4OLVH 3M45A 1H3PL 5D5ME 2CDFA 3O2DA 3U2SA 5J11C 5IQ9A 3LY6A 4PJEA 3H9HB 3UP1A 4YXHH 4JRXA 5B3JE 5EO1B 1W72L 5HYQB 4OGAC 1H3XA 4JFDA 3OKNA 3O6LH 5I8OL 1IL1B 3X13B 4NBXB 1NEZG 5C2BL 1U41A 5TFSH 3QIBB 5MP6L 1XF3B 1FNGA 1UCTA 2QADD 1P4BL 4FZEH 4KKNA 2H32B 1QSFD 4OZIA 1MCBA 4K94L 3DURB 3CSYA 4MVBD 3QXTA 4Z7NF 1VGKA 3H3KA 2NX5E 3EAKA 5E99L 5FK9A 1BOGA 1VDGA 1EEZB 5J13C 5C0NC 3OKLB 3T3PE 5EO0B 1RJZA 1IKNC 3WIHL 2OI9C 5C0BD 3CFBB 3S4SB 4L1DA 4UTBH 4M6ML 5GGVY 3N1PC 3O4LA 4QXTB 4K71C 5CJXC 3JTTB 2FHCA 4LPTA 3TH3T 1WBXA 3SKOA 4RAUA 3RGVA 4B41A 4HIHA 1CD1B 2ARWA 1MCJA 3WLBA 4Y1AA 3QQ9C 4R7DB 3QRGH 5IM7B 4Y5XB 1GZPA 1RK1B 1AJ7L 4PBVC 1QRNA 2CDGB 3GSXA 4N5UA 5FEBA 4XMPL 3ZDYE 3EO9H 1CICB 5F7MC 3GJFA 3H9HA 3QWOA 2WUBH 3EBAA 4NNPH 5EO1A 1DE4B 4QCIA 5HYQA 4YDVB 5EU7E 1GHFH 4N1CA 4YFEA 4WUKL 5FYJU 3P4NA 1X3DA 1TVHA 1XF3A 3MNVB 3TM6A 5CBEB 3D3VD 5T3XL 4Z18A 2YPVH 3QUZC 4JFFD 3RUGA 4EUPB 5CP3A 1I8KB 2YKLH 1F4HA 3STBA 2XG4A 3JWOL 3BEWB 3OKLA 2ZUQB 4QYOA 1BD2D 3JSSA 3SE4C 3CFBA 3S4SA 3OAYH 1CL7H 4P46A 2PO6B 2WBJD 3SDXE 1P7KB 2W9DL 4QXTA 4LMQE 3JTTA 1PYWB 3TN0D 3ULVH 2EH7L 4ZYKB 5IB1B 5JHDD 2P49B 1NKOA 1CD1A 1U8KB 4LPYA 2IFGA 3LH2L 5L2KB 4KV5E 4KTDL 4GRWF 4HUUB 2AAVA 4ODUB 3T0WA 4X5LA 1XT5A 4L5FH 4Y7MA 4DCQB 5IM7A 1IZJA 2MOVA 2OJEB 1RK1A 4PGCB 4XP9H 1FGNH 5FGCB 4KDTC 2XA8H 2AKRB 1FCGA 1CICA 5CGMA 5IJVB 4FMFA 5C70A 4EI5D 4HMDA 2CUHA 2P24B 1DE4A 5DUBB 4HS8L 2JB6B 1QKZL 3ARVA 1LWRA 3O6KL 1C7SA 1RU9H 3KPPB 4JFED 1GGCH 4YHIB 4ZFZA 1A64A 1UCBH 3CK0H 3UJTH 3MNVA 5CBEA 4DZBB 2ED7A 4JLRB 1FLTX 4ODSL 1QBML 3V0AC 5HHXL 3H3PL 2DICA 1IMHC 3BEWA 1PX3A 4KROD 3VFGL 1ZANL 1WBZB 3NA9H 5FF6A 3O6MH 3DWTA 1Z0NA 4LK4A 3MUJA 4LDLB 1ACYL 3CFKB 1P7KA 1NMAH 4QXUH 1PYWA 2JTDA 3BESR 1BBDL 2W9EL 1Q72L 5ICXB 5JMRA 4PJGE 1YDPB 5IB1A 2DB8A 4JG1L 3TA3A 1TITA 3WBDA 2A6IA 3SKUD 5L2KA 5E2WL 2VDOL 4MQ7B 4HUUA 1P4LB 1RIHL 3ARFD 1FNSH 2XXMB 4ODUA 4QHKJ 1JZ8A 4NJAH 4DCQA 1P5UA 2OJEA 1I9IH 4PGCA 5CZXC 2IQ9H 3D87B 1YMMB 5DJZB 5A16A 3PWPE 3UBXI 1EAPA 1SBSL 4M48H 2AKRA 5IVXF 3BGMA 2BOBA 2P24A 5BRZB 4LNRB 1U36A 3FHQA 2JB6A 2WK2A 4H8WH 3NCJL 1F11B 3PUCA 4YDIL 3KPPA 3DXAE 5HYJE 3IGAA 4YHIA 4DZBA 5IGXH 4GKSB 3MLVH 3DO3A 4QRUB 4PJ9D 3FT4A 1SMOA 4MS8D 2OSLA 2X1OA 3FN3A 1GIGH 3QUXC 5JXEA 3EYUH 2VXSH 1KT2B 4D0BB 3Q1SH 3IDGB 4OLWH 3HUJF 43C9B 2NY5H 2J6EA 4POYA 2VQ1B 1R3JA 1MCRA 3HZYB 5LG1A 4Q9CA 4DGVH 3O9WD 3GRWH 4PY7B 2DQCL 5E95B 3ULUH 3WXVL 4DEPC 4RGOH 3T2PA 4OB5H 4A6YA 1JPST 4LP5A 4MQ7A 2VE6B 3C09C 4Y16D 2ADFH 4MWFB 3C60D 4PGDB 1QNZL 4PRDA 2LU3A 4M62H 3EFDH 1YMMA 5DJZA 4G8GD 5EOCH 5KSAC 3RY6A 2YD2A 4LCIL 1F45A 1FL6B 1D6EB 5LQBL 5BRZA 4LNRA 5FDYA 3VGAC 3W39A 5IVXA 2BSSB 1N6QL 1UZ6F 2BNQB 5IROC 1EJOH 1XF1A 2R69L 3QQ3B 2WANA 3SCMD 4PG2C 5EUKB 3RJDA 2GUOA 5JUEL 5D70L 2H26B 1DQQB 4GKSA 4O58H 3RWDB 4QRUA 1K2DA 2VAJA 3KYAA 1OB1B 2AEQH 4XP6H 1T5XA 2MCPL 4D0BA 3NFSH 1UM5H 4V2CB 1HEZA 4ODHH 1OOAA 15C8H 3DUSA 1RUAL 1UWEL 3P30H 3PWLB 4H20L 1F8TH 43C9A 3EYVB 4J3VA 2VQ1A 2ICWJ 3K46A 3HUJA 4XX1G 4J6RL 3HZYA 3EDDA 1JN6A 5HD8C 4XNZC 4M6OL 4HBCH 5FUOL 5EBWB 3JWDH 5H35B 2NR6C 4PGDA 5A2IH 4Z8FL 1HSAB 5DQ9B 1FO0H 3X12B 4KI5D 5ANMB 1E4JA 3IJSB 4MX7A 4Y2DD 4E5XA 2XFXB 4F15B 1MFBL 1A2YB 1VA9A 2D7TH 3H42H 4LCCB 1FHGA 5FHAL 3LSOB 1DBBL 5HVFB 1B2WH 3GIZH 2YD6A 3IKKA 2XOTA 3QQ3A 4O5LH 3ARXA 1R5WA 5EUKA 4QGYA 1JUFB 3P0GB 4QRPA 4X9FA 1I1FB 4OAWA 1Y0LB 2V5YA 3FN9A 4HH9B 4L4TE 3IU3A 3O4OB 1DQQA 5HYSG 4OGZA 1TNMA 2Y25A 4ODVH 5T5FL 2M26A 5D1ZC 3RIAK 1FC1A 2G2RB 3SE3C 3GBNH 2HVJB 1SMAA 1KF9B 3AROA 1O5DT 4FQQA 1BQUA 5I75B 2VLRA 3STLB 3D85B 5DJAA 4IMKA 3E2HB 3EYVA 2XIDA 5T1DL 3I02A 1KN2H 4PP1D 5SX5H 4BSJA 4HF5L 4JRYA 1JNLL 1MCIA 3Q6FB 4HGMA 2IFFL 3HE6D 3VI3E 5A2JH 5EBWA 2KUTA 4NO0B 4PLKD 1OY3B 2R4SL 1GGYA 3RY5A 3X12A 4P2QE 4X5WB 5ANMA 3RI5K 4OLUH 5GGTH 3IJSA 4RA3A 2XFXA 3MNZA 1CD9B 4ZUTB 4L3AA 1WFTA 4LCCA 3WCYA 3LSOA 2QADC 4TPRH 5FHBL 3ARED 4MVBC 5F44A 5I30L 2OTPA 1PKQE 1JUFA 2ZJSL 1I1FA 4H1LA 4HH9A 4NGHH 2BJML 4PJBE 2E6PA 1ZA3B 1S5IL 2G2RA 2VLJD 1MWAB 2HYMA 2HVJA 1VENA 5J9PB 2YMXH 2FYYB 1IAOB 1X44A 4M4PA 1Z5LB 1IVLA 3FTGB 4FQLH 4MHHI 5IK3B 4B5EA 4S2SB 2DM3A 4JN2A 1FYTE 2EDQA 4HJ0D 1AO7D 1NLBH 2VJXA 2H3NA 4KWUA 1OAXL 1MUJA 4JQXA 5AUMA 1S8DA 3Q6FA 1C7TA 4ZO9A 3L7EB 5HHOD 5HYEA 4NO0A 2P1YA 4M7ZB 5AEAA 4N0FB 5IMLB 2WLZA 4D2NA 4X5WA 1NDMB 4PYGA 3FCTA 4V1DD 4ZUTA 4Q6IB 4Z7VE 3RBSA 4KKAC 4F7CB 2HG5B 3H2WA 3VFNB 3S37X 1OARL 4HK0B 2BHZA 1RURH 5GS3A 4UMGA 5DJXA 1QLEH 2JKXA 3FO0L 3REWB 1A3RH 4ZODA 1ZA3A 1R3KA 1INDH 4XBPB 4HX1B 1MWAA 1JGVH 4WUUB 3MRLA 2WBJC 1E28B 5M7QA 1MI5B 5IT2L 1IAOA 3TN0C 3RWJB 1A4KB 2DQHL 1Z5LA 3OG4B 4WNQB 3NN8B 5IK3A 4UNVA 2OL3B 1W0YT 1ND0B 3WS6A 4JKWA 2OR9H 4NC1C 5C8JB 5CEYA 3O3AB 4MJ5B 3NPZB 1CE6B 3CSGA 1WWWX 4XCFL 1KSRA 1EBAA 5T1LB 2GSIA 4ZOCA 2BRQA 3QUML 5SWSB 1LDPL 5GRJH 2OZ4H 2HP4A 2VABB 4EI5C 4N0FA 5IMLA 5I1LB 3OQ3B 4OLZL 3BP6B 3JVGA 1KEGH 1DBAL 5D7JA 5T5NF 1AGEA 5DMYA 2NY2B 4CVZB 1NBVL 4WGVB 1BX2A 1H3PH 1SM3L 1QLFA 5D9SA 1RZGB 2HG5A 3VFNA 2X4TB 3DVGB 2Y36L 4LVNC 2GJZB 2XWJB 2QTEA 3WNMA 1KJ2H 2VZTA 5C3LD 1UB6A 1EFXB 2AI0L 2FJHB 2DD8L 3IRPX 4HS3B 4KROC 2YRLA 2DBLL 4NRZB 4P9MH 3I6LD 3REWA 4JANB 3BMWA 4P57B 5DQJB 4L4VD 4PRIE 4XBPA 4G3YL 4HX1A 5MP6H 4K07A 1FAKT 1P4BH 1DVFA 1E28A 1X7QB 3RWJA 2CH8A 3PHOA 1GZQB 3AY4A 2Q20A 3MOAL 1BLNB 4WNQA 3NN8A 1ND0A 5C8JA 3LRSB 3CVIL 3O3AA 4MJ5A 3RNQB 4MNGE 2ZUUA 1QSFE 1ADQA 4I9WD 4M6MH 5T1LA