2QJDA

Crystal structure of novel immune-type receptor 10 extracellular fragment mutant n30d
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
IKELHVKTVKRGENVTMECSMSKVKDKNKLAWYRQSFGKVPQYFVRYYSSNSGYKFAEGFKDSRFSMTVNDQKFDLNIIGTREDDGGEYFCGEVEGNTIKFTSGTRLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Novel immune-type receptor 10
publication title A bony fish immunological receptor of the NITR multigene family mediates allogeneic recognition.
pubmed doi rcsb
source organism Ictalurus punctatus
molecule tags Immune system
total genus 22
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qjdA00
3ROLA 1J12A 4Y5VC 5GJTL 1VCAA 2X4NB 3RX5A 1I1FB 1EEZB 3DGGB 2WW8A 2P8LA 4K3EH 4Q9RH 3X13A 2CLVB 1G6RL 1OF2A 5ILTH 4OD2B 3KNBB 5HXMA 1JRHL 5I17A 2LABA 5B3NA 3U46B 4W4OC 4EN3B 2FNBA 3VU2A 1SEBA 2AQ1A 4OGAD 4ZPTB 5T1KA 3RI5K 5IV2A 4S1SL 1U2CA 3O3AB 5FYLH 5AYUL 1A7QL 4Y19B 3NZ8B 3ULUH 3IF1B 2PNDA 3UMTA 1QACA 3C9NA 3EYFA 4UT9H 3MLZL 3QUMH 25C8L 1A6ZA 5AZ2H 3AS2A 2VMFA 4NQDB 1RUQH 4M93B 4QYOB 5FYJD 1R6VA 1X5AA 5DD1L 3EO1A 4WO4A 5B4MC 4PS4H 2OTWB 2VE6B 4QRUB 2DOCA 4BQ9A 1H3TA 3EHBD 2KL6A 15C8L 4ZNEA 5HHVL 1NBQA 1CF8H 4WTWA 2BZDA 1AO7E 1IAIH 5H2BB 1KJ2L 1AGEA 3EUUA 3K3QA 4U1JA 5C08E 4YO0A 4NNXA 4WI5A 3CCHB 4L4TD 1T66D 2X41A 3UJIL 3ZYOA 5IESL 5DMKA 3BPOC 4RIRB 4DFHA 3SQOL 3C60C 4MA1C 4ZUTA 4CGTA 1YYMH 3HFMH 4PGCA 5ITBH 5MEPB 3HAEH 2F53E 2CIKB 4BZ2L 5DHVH 2Y36L 3ZKMC 4WI8A 3BRGC 1RURH 4RFEA 1KTKE 4TNWF 4JN2A 2J5LB 5ITFB 4S1DD 1S9WA 2CDFB 5EU5A 4QXWA 1WWAX 2G2RB 5DLML 2FGZA 5EBMA 4KMLB 5DWUL 2AP2A 5B22A 5C6PB 2Z8WC 4TUKH 4BM7A 1BJMA 2EDEA 4IIQA 4N1CA 1FV1B 1FNFA 1CICB 3OPZL 3K46A 5F9DC 4XP9H 4ORZC 3WXVL 1WAAF 2XACC 4E41B 4L8BB 4OBSA 3RL1A 3LRSB 4HPYH 4S1RH 3EGSA 2R0WL 4OLUH 5ADPH 4ZODA 1GC1L 2NY3B 2YZ8A 4QHLA 4YDLB 4LGPB 1EGJL 2R1YA 3DV6A 3VH8G 4ACPA 4D9LH 1KCRH 1CGUA 5IG7B 5I1AA 1JGVH 3B4NA 4RAVB 3DXAE 2X89A 2X1WL 2P5ED 2LQRA 4AIOA 1X5XA 5IHUL 4U1GC 4P2QD 3MV8A 1OT2A 4DKEL 2IFGA 3PWPD 5E70A 1QSEB 2OK0H 4KK6D 1S5HA 3FO0H 4WY7H 4HK3N 3N1GC 1P84J 5E8EA 3INUH 4O2CA 1U93B 5BS0E 2VIRB 1MVFA 4P2RD 5FGCE 1T5WA 2A6KA 4LU5L 3BKMH 1UJ3B 2Q7YB 5GSRB 3RY6A 4RDQF 1HH6A 1CFTA 1S7QB 5EPMB 1U42A 5IFAL 3WNNA 5CBAA 5H37H 5HDBE 2APVA 4P46C 3S35H 1U3HB 1T0MB 2BNRD 4GKSA 3HPJB 4W4NA 3P2TA 4JCMA 4G6FD 3MBXH 4KRPC 5B39B 2G5RA 3GHBH 3CMGA 1T1XA 3BUYB 6FABL 3JWOC 4MLSA 1CDIA 4OQTH 4P99A 1CD9B 1EX0A 3IU3A 1S9VA 4PRDB 3SPVB 1V7ML 4JY5L 1AHWA 2P7TB 4PJ7A 4XNYL 4P5MB 3DGCR 3CPLA 3HC3H 3OAYH 1NMCC 4X9FA 2XZQH 3LQZB 2V5YA 1NCDL 3L3HB 5H35A 4Z7WF 2W0LA 1U6AL 2LFGA 2V2WB 3QUYC 1CXKA 1JI2A 2AJ3A 1F6AB 3O9WC 5HJ3B 3DV4B 1TJIH 4HIJB 4LHUG 4X6CA 5K9JL 5KN5B 4P57A 5JPNA 4G80B 1YN7B 4O4YH 2AXGB 3MNWA 1HH9B 5ICYB 4QXTA 3OJMB 2R1XA 1F3DJ 4JO4L 4KROC 3RIFK 2UWEA 2R2EB 1MY5A 1A6PA 3MV9A 1RULH 1LO0H 4PUBL 1IVLA 3SY0B 1QP1A 4K71C 5DGQA 5I1KH 5LBSH 1CU4H 1LMKA 3EOAB 4A6YH 1EFXA 2NXZD 1U2HA 1RIUL 2CUHA 4U1NB 4WEUD 3REWA 5J1AB 1GL4B 1AH1A 5I1JL 2YN3A 1CT8B 1OT1A 1BAFL 1OWWA 4WW2B 4RX4D 5IF0A 3HHRB 5E9DB 5DJ8B 4OJFL 4MCYB 3BQUB 2OLDA 3EJYD 5C6WH 1A22B 1JZ5A 4PJDA 3RTQA 1J1XL 5DD3L 5ALCH 2DKMA 5DHYA 1QRND 2Y23A 1DQQA 3H3PH 1JN6B 2ZJSH 2ICEA 5ELIA 3VI4E 3MLWH 4RZCB 4MA8H 4XZUB 1NAML 1FDLH 5HHME 1IEHA 4Q7DA 1P5UA 1X4ZA 4OZGA 4G7VL 3GMNA 5E8NA 4XCCH 4ODXA 3H9YA 1E4XL 2J1KA 4J23A 1T22A 2C5DC 2EDKA 2NXYC 4G7YL 3H9SE 1CLYH 4UAOB 2IGFH 4Y4HA 1JP5A 2WM0A 3I9GH 1L7TH 3TJEH 1FFOB 4N0YH 3ARDA 1JV5B 3V5HA 3QDGD 1OTUD 4K3HA 1ZHNA 1MCSA 5CEYB 2EECA 3HPLA 1YEIH 3HKFA 2PKDA 4QY8B 3MREA 1T0NA 2NLJB 4WWKA 1NMAH 3CVHB 4UUJA 3O2DH 3RZCD 3S4SA 4XI5C 3ZHDA 3ARGC 2JIXB 2WK2A 1QBLH 1TTFA 1RZJC 3IETA 4PRBA 4HSQA 3O3EB 1ZT1A 4PJFA 3NFSH 1XGQA 5EO0A 1BLNA 3SDCC 1QZ1A 1H15B 3G6JB 4K3DL 2PR4H 3IDYB 3C6SB 3NN8B 2EDTA 4FNLH 3I75A 3TN0A 4FG6D 4L3ED 3C09B 2VDMH 1N0XL 1N3NB 3CFDB 2ICWJ 1N6QH 5F8RC 4AMKL 4IMLA 3RVWC 3ARBC 2OR9H 2OJZL 5JW4Q 4G6KH 3BZ4B 1R24B 4MAYA 1QFPA 4JY6A 3UXFA 3O6ML 1S9YA 5C0NC 4NT6A 1YUHB 4JJ5B 1KOAA 4BSVB 3TA3B 5FYLD 3ULUD 4HT1L 1T3FA 1Q9OB 3BPLC 3IU4H 3E6FB 4K7PY 5IVZA 3OJVC 1N2RA 4K8RD 3UAJD 4OZFA 3UO1H 1SMAA 1L0QA 4KJYA 1CL7L 3N0PB 3WIHL 3VDAA 4K2UL 1VSCA 1FN4B 1FO0L 2J3SA 4UINH 2XPGA 3UJTH 2P8LB 3CDFA 4P9HH 5E6ZA 1W72H 3ULSA 3LMJL 1OF2B 1KFAL 3RGVD 2VN7A 5I17B 4RBPH 4EUPH 2NCMA 2BSRA 3O6FA 2EYRA 1TZGH 4R97C 1NGPL 5T33H 3DMMC 5FB8A 1QSFD 3HI5H 2CDEA 1PSKL 4HDIA 3D3VE 2ZSWA 3OAZH 3C9NB 3EYFB 3ZTNL 4NO0D 4WUUE 2W91A 5DMIH 1WZMA 3F6LA 1UEYA 3EO1B 4WO4B 3B8YA 1DEDA 5IR1A 4R4BA 1INDH 4LCWE 5H8DA 5MENE 5E2VL 3GJFH 1BJ8A 1A7PH 4ZDHA 4MJ6A 1TQBB 4UOW1 1JHKL 3G5XB 4ZSOA 5I6XC 5J13B 5EU4A 2J4WH 4Z9KB 4LRIC 2W0KA 5HGAA 2DD8H 1KIPA 4PGJA 4P3DA 4KKAD 5C6TH 4E9LA 3EYQC 4ELMF 2NYYC 1V3LA 3UTZB 4XP5L 1FAKT 1KN2H 3FN3A 4KDWA 4JO2L 1M71A 4Q97A 3PE9A 3NCYS 3HNSL 2NY1D 3F58L 1YDPA 2X5PA 5E2TH 1QD0A 4D2NA 3GBMH 3OXSA 3MFFA 5KW9L 4JN2B 1JGUH 4NO3A 4M6OL 5EBMB 5EZJA 5F1SA 3P11L 4D0CB 2VLMD 1YPZE 1K4CB 1OM3L 3IJHA 2YKLH 5F9AC 4QRRA 5F88A 3MV11 2QQNH 4M5ZL 1MVUA 3MLVH 4WGVB 1F5WA 2D7TH 1F13A 4PR5A 3UTTD 3ECBA 4JDTL 4LQFH 4GW5B 4AIXA 4URTB 2XY2A 3FQRB 5C0BE 4TSAL 1MCBA 4KU1A 2J6EH 2APWA 2H32H 4QHLB 4KY1H 1LK3H 1NLBH 4Y16D 5D1QA 2R1YB 4G6AD 3DV6B 1A6WH 4OTXL 4PD4J 1R5IB 3A6BL 1OARH 2Q3AA 3HC0B 4PRHE 3ARWA 4MD4A 4W81A 3QCVH 4R26L 2EDDA 5ID1A 3QDAA 3VFOB 1F00I 4W4OA 5CGYD 2DQCH 1LO2H 4EJ1C 4CW1B 2Z0BA 3KYKH 4GLRH 4OCRH 3TCLB 4F37F 5K9OA 2GSGA 2GYSA 1V8HA 4O2CB 2CR6A 1FFQA 5E99L 4W68A 3G6DH 1T5WB 2A6KB 5IK3B 3WFEH 3MUJA 5DZOA 5FK9B 2FATL 1MEXH 3O2VH 2FH8A 2WUBH 2R4SL 4KDTA 1CFTB 1RI8A 4YE4H 5C08A 4OGZA 1Q38A 4P2OD 3DETD 5FKAA 4LP4A 1MRCH 1BECA 1NKOA 5CBAB 1YEGL 2D4FA 3QDMB 3CU7A 2OMNA 4JREB 3LD8C 1UCBH 4GKSB 3QZWB 4JANA 3HMXL 1WIUA 5C8JA 1GIGL 1KPVB 1HQ4A 3BH8B 5TDOA 3CZFB 5GGTL 1A7RH 1U58A 3BGMA 3RL2A 2F53A 1T2JA 3O4LB 1T1XB 1HHKA 1PG7H 4M7LL 2V2XA 3EJZD 3C60A 3MBEB 5IM7B 4TNWK 3QQNA 1AHWB 1C5DB 1HHIA 3D87B 3L5WB 4GW4A 4J3VA 4WU7A 1JGLH 2AJYH 4KJQC 5C2BL 3CPLB 1QSVA 2FX8H 2WLZA 1GGIL 3U1SH 3BGFC 1KLGA 3AREC 2G75B 2EC9U 4G9FD 1SEQH 1CGWA 2EEDA 3D85D 1C8PA 2AJ3B 3PGFL 4M48L 4OGXL 4X6CB 3G5ZA 2JJVA 4P57B 4J4PC 3QIUC 4I0PA 1HXMA 2PYEE 4PJGE 3TBSA 3RWJA 4O51A 4LCIL 5JDSA 2UWEB 4ZNCD 4G8GD 4PYGA 1CWVA 1EEUA 2XKUA 3JTTA 4Y1AE 1NCBH 3MV9B 3A67L 3JXAA 4KKCD 5I15L 4LEOB 3M45A 5I30L 2P5EE 3WDHA 4HWZA 4X5WB 1EFXB 4H0HB 4XVUC 3HE7C 3PWPE 3REWB 5BS0A 1KPRB 4F7MA 5EO1B 1KG0A 3ILPB 5EU3B 4KV5F 5IF0B 5HDLA 5L8LB 1MPAL 1UC6A 1QTYT 2CJUL 1K6QL 2RHEA 3ARYA 1P4BH 5EBLB 5C0RL 4PJDB 3HRPA 4ODUA 3GI8H 2ICEB 4MQ7B 1W0YT 3QUKA 1YECH 3JV5A 1UWXH 2BNRE 4LIQE 4ERSH 4YFLI 4C54A 5HHPB 2QTEA 1R3HB 4KVCL 3UTPE 2JKXA 4OZHE 4OZGB 3GMNB 5E8NB 4ONFH 1FLRL 4MNHA 4EQ3A 1OP9A 4MGXA 1I85C 2HH0L 3OKNB 1UKTA 3MRDA 3FJTA 4MD5B 1DSFL 4DEPC 1KXVC 2EXYD 4BJLA 1HZHL 2IEPA 4EOWH 4E0RB 3LPWA 4Z7UF 4Q6IB 1KIQA 1NBYB 4OSUH 4NBZB 5FUOH 3P4NB 3QBTB 3CAFA 4Y4HB 4R4ND 4M7KH 1J5OL 4GFTB 5FDWB 1UXWA 4UQ3A 4AQOA 4TSCH 1CR9H 1VA9A 5L9DH 3V5HB 4NQEA 4OCWL 4JGMA 1ZTXH 1ZHNB 4Z7NF 4HWEH 2FD6H 5D93B 4WWKB 5DMGD 2GT9B 3MREB 1M05B 4HZLB 2A9NL 3RP1A 2ZOLA 4UUJB 4TTDC 3TFKC 4UT9L 5JHLH 3QUML 3MPCA 1ZA3A 1UZ8A 1NCCH 2QJDA 3IETB 3K81A 4PRBB 5DD6B 4PS4L 2IMMA 4LMQE 4PJFB 5C0FA 4F9PC 1U8MA 3QHTC 1ACYH 2DYPD 3ZT5A 1OHQA 2IPKB 3RBGA 4EZMA 1BP3B 4J1UB 3WXWH 1TJGH 1BIHA 1HNGA 1TIUA 5FO7A 1JHTA 1MCOL 3DPBA 5CKAA 4Z77A 1JFQL 4LCUA 3DX9A 3TEUA 5T5NF 4H1LB 2Z91A 1RU9H 3RJDA 4KVNL 1FHGA 5I9QC 2KZ1B 5DXWA 3WS6A 4HW6A 3NA9H 3G6AA 3C08H 1CDJA 4MAYB 4JY6B 1YYML 3HFML 4NC1E 4GRLC 4LFHD 1OTSD 3MODH 5J7CC 1B2WH 1I9RL 2CIIB 3GSUB 5T1DL 2C9AA 1RURL 1JPST 3T1FA 2R1WA 3MJ9L 1Q9WA 1QRNE 4ZUWA 4ZFOA 2CD0A 4NJ9H 2YPLD 1T3FB 1L0YA 4H20L 5IVZB 1DQMH 4IMKA 5GISH 4FQ1H 1N2RB 3N06B 5C0AD 3OV6A 1CDCA 2VAJA 4MQSB 4KFZC 3RJQB 3FQWA 3GSWA 5D71L 3K2MC 4Q0XL 2N7BA 3H9SA 4ZS7H 4S2SA 2PCPA 2XPGB 4HPYL 1VFUA 4OLUL 4JFZH 4OFYD 3R8QA 5F9OH 4LSQH 2JK5B 2BSRB 4D9RD 3FFDA 1IKFL 3O6FB 5EB9A 4D9LL 2J8UF 5JZ7D 5B8CC 2QHLA 5L6YH 1JGVL 1LDSA 1MCPL 2HLFC 5D2NA 2VH5H 5GGVH 4LAJH 1AQKH 3QG6A 4UILL 1HK6A 2NY5C 4QWWD 1UACL 1T20A 3V8CA 1MRDL 2JCCF 3S9DB 3D25A 5IR1B 4R4BB 3GSVA 4WY7L 2Y1VA 2DQUH 3AC0A 2BOCA 1J18A 3ARGA 4ZDHB 3BKML 4R0LC 1BFOA 5T3ZH 3EOBA 5HYSG 5J6GA 2GEEA 4ZSOB 4R96A 5ADOH 3SDCA 3EZ8A 4N90E 3MGAA 4GRWB 3BWAA 3VCLA 1KIPB 1KXTB 4P3DB 4L3EE 4XH2A 5DQJB 1G0YR 2R4RL 3R0MA 3ILQD 2DF3A 2ZG2A 5F3BB 3THMH 4NM8H 1MNUL 2GTWA 1M71B 5FXCH 4Y5XC 1TPXC 3NH7L 3RWIA 2DN7A 4Y89A 5DK2A 3ARBA 3GHBL 1ZVHA 1T04A 3QB7C 4OQTL 1AD0A 3HS0A 5D2LE 2HFEB 3EOYG 3SO5A 1X6NA 2VTFA 1H5BC 4NO3B 3VXQA 5CINH 3KLHD 3RWGB 1OGTA 4PLNC 1IC5H 1QKZH 4QRRB 1ZGLP 3HC3L 1KELL 1X4XA 4NKDB 5F88B 4V2CB 3RPKA 3K7UA 2P48B 4Q2ZA 3RQ3A 5D5ME 4YPJA 1MVUB 3HUJF 2NY2C 4HLJA 1Z3GH 3EO0A 3IS1X 3TV3L 1AI1L 4XVJH 5F7DA 1LQSR 3MRFA 4V2BA 1V5JA 2X1PA 3ETBF 4Y5VB 1A3LH 5J6HA 1YEJL 3PL6C 2HVJA 3MXWH 3TVMD 1N4XL 2VDKL 3CFEB 3O45A 3OKOA 4ALAL 4X0KB 4WUUA 4TVPE 1LO0L 1AXSB 3AY4A 5J8OA 3QJFA 5I1KL 5LBSL 2P47B 3TZVD 1YNLH 2Z9TA 3DMMA 3L7EA 4JFDA 3UROR 3MCG1 4LCWA 1J8HA 5MENA 1BVZA 5DK0B 5AAWA 4QHUA 3QCUH 3MACH 3VH8A 1IT9L 1AKJB 1QQDA 1UGNA 1AO7B 1HILA 3ULVC 3OR7B 1EJOH 2CK2A 3HCVB 3NCFB 5DO2C 3TH3T 3VGDA 3FONA 5FF6A 1B0RB 3C5JB 4JFEA 2APTA 5E56A 5K93A 2D03H 4TNVK 4LFHG 4XCFH 4KUZH 3F7VA 4LKCA 2R9HC 5IMLB 2H2SC 4HS3B 1O5DT 5HYJD 4I0CC 5ALCL 5DJDA 4JANB 3WS3A 3H3PL 5IMKB 4MNQB 3UPRA 2X1XR 2O93L 5TDOB 4PJIE 4MNGB 4MA8L 1HINL 3BZFA 1O7VA 3SKOB 1F2XK 1X5IA 3TYFA 2DLFL 4CU6A 4YZFE 3BPOB 3BP4A 3SEPA 2B4CL 1YY8A 1G1CA 2V2XB 3C60B 4J3WA 4KJPC 3VXMB 1J05A 1HYSD 3LEYH 3QFDA 1XZ0A 3QH3B 2XQYG 4MA1B 4PB0H 1HHIB 1QFWM 1YPZA 4M7JH 2FDBP 1E28A 3QEHB 4X6BA 3MGOA 2FJGA 3VXPB 4KI5F 1OB1A 4KQ4H 4GKZB 2VLME 32C2B 3X3GH 2JJTC 3CDCA 5C07D 3O3DB 2IGFL 3RNKB 3GSOB 5HHQA 3I9GL 2XIDA 1DBKH 1L7TL 3TJEL 5C0BA 4N0YL 1K2DB 4EI6B 3MLRL 4PJAF 4B53A 3KR3H 3VWKD 5KVEH 4EBQL 3UTTE 4XAWH 3TBSB 3DSFL 3OTTA 2AJXH 4A2MA 4F2MB 3O2DL 4O51B 4Y4KD 1IEBA 2H3NA 3DXAB 4CVXA 5EUOE 2R69H 2BRRL 4MXVF 4O9HL 5JDSB 4S1QL 1OVZA 2YUXA 1B0GB 1QBLL 1HHHA 5HPOA 1EMTL 4AM0B 3QNYA 3Q5YA 3SCMD 1JZ7A 2AABH 3NFSL 4JR9L 3RX8A 2ZUSA 2B20A 4HWZB 4LHUA 2XRAL 5CGTA 1QBBA 5FGSA 2VDNL 4U1GB 4FNLL 4F37K 5FYKH 3AS1A 5BS0B 5DD0H 3OAYK 5FGCB 3NIDF 4JKKA 2VDML 2E27H 2HTKD 3C2AH 1UM5H 4OLYH 1G84A 3VXTA 5E6IC 2WQ8A 4HBQA 3OKDA 1A6AA 4PJ5D 4D8PA 4YBQD 1S78C 1MLCB 3D0VA 1ZA6B 2EDFA 3MLSL 1DE4B 4ODUB 2K7PA 4ZMAT 1WCBB 4XNQB 1VFBA 3DECA 3MCKB 4U1IA 3CSGA 3WNOA 2EZ0C 5DDHA 3RVXD 4WJ5A 2YPKA 4P46B 3SKUD 3WDIA 4ZTOH 5IFHH 1K4DA 3PDOA 4Z0XB 1Y0LA 5D8JL 1IAIM 2R29H 5CD3A 2BNQE 4NQVA 4JHZA 1KNOA 1F4YL 4KRPB 4AEIH 4JPVL 2VQ1A 3UO1L 3GKZA 4PRNA 2V6HA 3QO1A 1P5VA 4UINL 3M1BB 2HT4D 2HAZA 3B2UC 3MRPA 3DIFB 2DQIL 5HBBA 1FIEA 4PJ9C 2E7LC 3FOLA 4UQ3B 4XPHH 1Q0YH 4KTDH 5SV3A 5FEBA 5HTSA 3WO4C 4G9FE 5CHNB 3AREA 2ITCB 3L7FA 2A74A 1RZ7L 4PGBA 5DURB 4PJGA 1EA9C 4NCC1 2DIJA 3QUYB 3WMSA 2R0ZH 4BZYA 3T2OA 2QQLH 3HI5L 3O9WB 4IRSD 3RWCB 4K94C 4LOUD 3U7WH 1ZMYA 1KTLA 4KKCC 5TE6L 4Y1AA 1EO7A 1GRWA 3FQNA 1OTTC 4RMUA 2FR4A 4X6DE 4QXGH 1S9XA 1VGEH 1U8MB 2P5EA 1INDL 1S7RA 2E9IA 1IGFH 1TETH 4G8GE 4KROB 4K3JH 4QF1A 1J0KA 3MLYL 5IBUG 4OGYH 3PWPA 3IDUA 5CP7B 5GHWL 5JPMA 1CFBA 4LSUH 3T4AB 4K71B 4H26A 2MQ0A 1G7QA 4Z77B 4LCUB 4LLYA 5JA9A 3Q5OA 3IFOA 4HC1H 2DD8L 1U8OA 5D7KE 3E2HC 3VRLF 2EH8H 3BDBA 1ZK9A 3G6AB 4JO1H 5EBWA 3C6LD 3R06A 2HFGH 5KS9E 1MCEA 5C09D 2IQ9H 5K9QI 1FL3B 2NY0D 2Z93B 2AJVL 3WNKA 2BNRA 1EBPA 3T1FB 2FB4L 4HIHB 3T0XA 2R1WB 5TE7L 4CADA 4WHTA 1JGUL 1HHGA 4ZFOB 4OZHA 1ROWA 4XPFH 3RUGF 2CLRA 1RAMA 3MRBA 4NUGL 5CJXC 1XF1A 4P3WA 2A6IA 4APQC 4JPWH 1FNHA 4YHNA 5DFTA 2QQNL 3Q48A 1J10A 3FQWB 3GSWB 1JF1B 3MLVL 1MH5B 2BC4A 3H9SB 4JKPH 2PCPB 2QSVA 1U41A 4HGWA 1G1YA 4PFEA 1I85A 3VD7A 3TBYA 3BO8A 2X1OA 1RK1A 3MMEB 4WCYH 1NLBL 3K1KC 3NIGF 1RZIA 3WFBL 1A6WL 1U36A 2NXYB 1OARL 1D6VH 3P4MA 4YBLC 4FQXD 2WINB 4ODVH 3QCVL 5ENWB 4DUVA 4AL8L 3RNQA 4L5FL 1JE6A 2NPLX 2YD2A 3BIKA 2WWKT 4OCRL 3WE6A 5I71C 1YEFH 3OGOE 3T0ED 3D25B 4YDVB 3KWWB 1MFAH 4NCC2 5KJRL 3K8KA 1OPGH 5KZCD 4L8DB 3ARGB 5HVHC 4FFYL 3WFEL 3VD4A 3K2UH 1YZZA 5C9JA 2DBLH 4KZDL 2MHAA 3O2VL 5J6GB 2UZXB 4O5LL 4R96B 2XZCL 3SDCB 2CPCA 3UC0H 1MRCL 3BWAB 2P44B 2NR6D 4RBPK 4JFFB 1UCBL 1AP2A 4RX4A 4Z95H 5IB2A 2VYRE 1HKLH 4YHMH 3E8UL 4PB9H 1NFDF 3RWIB 4PLKC 3CSYA 3MLTA 1BFVL 3ARBB 3VRIB 1OD9A 3OAZK 1FYHB 4X7DC 1QRNA 1ZAGA 1FZOA 4MS8D 5E0QA 1WBXA 2VWEC 4R90H 3STBA 1I3RA 3W9EA 3LOWA 2XV6B 1JGLL 4PTUB 2LVCA 3QEUA 3V8OA 3LVEA 2P5WD 1T21A 3GJFK 1XFPA 5C0IA 4M00A 3VXUE 2YPLE 2VWEE 4Q2ZB 4AQ1B 1SEQL 2YRZA 3BPLB 4LPXA 1MCWW 4Y4FC 3EO0B 5C0AE 5F1NA 5F7DB 5KANI 5TPWH 4OAWA 1E4JA 1SM3H 5J6HB 4OB5H 4K23H 2HVJB 3K0WA 2ILLA 4PRAB 4M1GH 5HY9B 1SYVB 4NWUH 5MEQA 2F74A 3D3VB 2XWBA 4D9RE 1MCDA 3QDGA 4QWWC 5IFJA 4WUUB 4P4KC 3WSQL 3BT2L 3HI1B 3GSXB 1JWUB 3QIWD 5CZXC 1WGOA 3VA2C 1YMME 4R97B 4AH2A 3RZCA 3DMMB 3RAJL 4XTRC 3T3ME 5MENB 3O2WL 1KBGH 1QFOA 1SJVA 1TVBB 1YNTB 4PJCF 1QQDB 1Z0NA 1H3VA 5FM5M 5J9PB 1A1MA 2X6MA 4U6HA 1U8QA 4DK3A 1A1NA 4R4FL 2Z31C 2BCKB 2UZYB 3FONB 5FF6B 3FFCE 4U33A 5I18H 3QWOA 2DQGL 4L3EA 2Z92A 1G7JA 4R0LA 4EXKA 2ZOKA 1GC1C 5DJDB 3SE3C 3VDBA 1EUUA 5DA0B 1ZWIB 3WS3B 5I6XB 2Y06H 5DFVC 4OLXH 3UPRB 2VDQL 5DR5L 3V6FA 4EN3D 2CKBH 3CFIC 3PGCA 1YECL 4GXVL 2UY7A 3BZFB 4KKBC 4G8EB 1TNNA 3TYFB 4N0CD 4I13B 4Y19D 4L1DA 5D2LA 3SKNA 3QFDB 2AK4D 4Y5XA 2VB5A 1YPZB 3KVQA 3MA7B 5GGQL 3VWJC 2IMNA 3MGOB 2FJGB 3JWDH 4CVZA 4MXQD 1WBYB 5I76A 3SGDI 1OB1B 3DURA 3P40A 1N6UA 2E6JA 5D5MA 4KTEH 1LEKA 2AKRA 3OF6D 3B9EA 3DBXA 4OV6F 3U36A 4CU8A 1FNLA 4MWFB 5L9DL 5C0BB 3IJYB 4X6FA 4BFGA 4HWEL 3GIZL 2FD6L 2K7QA 3DI2B 5CEZL 4GBXC 5D7IF 5JQHC 1IEBB 2RQ8A 4PRHB 3GMLA 4X6EB 1N7MH 2FO4A 1U91B 3QEGH 2DWDB 4GOSA 4Q9QL 1IL1A 1CE1L 5FO9A 4OZIE 4WFHE 1U3YA 3PL6A 4GG6E 2KPNA 2I9TB 4LHUB 1LEGA 3BHBA 4NJAH 4RFOL 4NO0A 4LBEB 4EKXA 5A43C 1CVSC 2VDPL 5CUSH 3WUWB 1IZKA 5I1HL 5LG1A 1EDQA 2YD6A 4H25B 5HI4C 3PWNB 5JIHA 3WHXA 1I7TA 4NQXB 4HF5L 4PGDA 3P9WB 3VXTB 1G9MH 1CICD 4HIXL 3L5XL 2X9WA 3MOAH 1FRGH 2X4OA 4Z78B 4D8PB 3TPKA 2JJWA 4E41D 1MLBB 3NA9L 1FJ1B 2WAHA 1VFBB 4HWBL 2NY3D 4U1IB 4DN4L 2ZKHL 4H8WH 3C8HA 4PJIA 3NGBC 2Q6WA 4Y8DC 5DDHB 3SDXE 3DRQB 3M8OH 4U7SA 4WJ5B 5HYJE 4XNXH 2LV4A 4NCDA 3MRLB 3LD8B 3TBTB 4PD4K 1XF5B 1CFNA 1K4DB 4JG1H 4NJ9L 1GSMA 5CD3B 1LEIA 4KK8C 1KNOB 1DQML 5GISL 1E6OL 1BQLH 1KCSL 1QSED 2VQ1B 4JM2C 2IBZX 3VI3E 1B4RA 5HI3C 4PJXB 3GSQA 2HFFA 4JHBA 4M5YH 5IVXF 4ZS7L 5AYQA 2ZCLH 1L9MA 1ND0A 3I6KA 3GO1L 3I85A 4HEME 3BGFB 3PG2A 5C07E 4WHYG 1JYVA 3AREB 2PYEB 4OT1H 4F7TA 2FJFA 2JJTA 4XNMB 3UTTA 4PJGB 2AEQH 2VH5L 1KJMA 5GGVL 5EUOA 3U83A 2I5YL 1TVDA 4FMKA 5EU7E 1UWXK 4XP1L 4Y16A 1KTLB 5HI5C 3QIUB 1YEHH 4Y1AB 1Q1JH 3MRQB 1J11A 3IXTA 3WL9A 1S9XB 4QOKE 2DQUL 4CU7A 2AJUH 1OY3B 4YUEH 3OR6A 3PWPB 1JPSH 4U49A 5T3ZL 2HTKC 2E5EA 4X5XA 1OAQH 4LLYB 5ADOL 1I9IH 3QNZA 1JVKA 3IFOB 2ZUVA 3HE7B 2YR3A 4F8QA 2MPAL 5MHSD 2VITA 1CXLA 5F6IC 4MXWL 4RQQA 3CH8A 4NKIH 3U7YL 5EBWB 4NM8L 1KEGH 3R06B 4P2OA 5E6IA 1I7RB 4P49A 4PJ5E 5LWYH 4MZ3A 1X5JA 2BVPA 3S35X 2WWKO 2FSEA 3TWCH 2BNRB 4CADB 4K9EC 3HNVL 3IDNA 4HFWA 5DEFB 4U05A 5J1TC 4PLJD 2JB6B 4OZHB 4F15C 2A6IB 1QKZL 3RU8H 1EUTA 2VR5A 4ZTPH 2PUQT 3OHXB 1CE6A 2FX9L 2V7NB 3BKJH 3CNKA 3KPNB 4F7PA 5SV4A 1UKQA 3QG7H 4UV7H 1EAJA 3TESA 4MB5A 3CFCH 4POYA 1Z3GL 3EYSL 4HGWB 4YR6B 3TGXA 4XBEL 1C7TA 4G8IA 2KBGA 4XVJL 3S97C 2O5XH 3LZFH 4CMMB 4CN1A 1NJ9A 3N9GL 5C92A 4DEPB 4FFZH 2ZP0T 1AGFA 5E9DD 3S34H 4PP2B 4G9FA 1E4XI 2EKJA 4PV8A 3KPOA 3MXWL 3D85A 5JXEC 3S37X 4BA8A 5J11C 1SYSA 4Z7OE 5DD5H 4J6RL 2E7LA 2NW2B 1DUZA 3I6GB 3LSOA 1FNSL 2XFXA 3MUGA 5DRNB 2VDLH 5F7KC 1SBSL 3TIEA 1PKQE 1SJHA 5CZVH 3WE6B 4YGVB 5EFIA 5I1CL 2FGWH 2DDQH 5LCVL 1QFUL 3MLUH 4G8GA 2DIAA 4X4YB 4LLVB 4M43L 1TVHA 5C9JB 1IM9A 1QPXA 3QDJB 3J7HA 5EZLB 2AI0L 1LVEA 4HKBB 3DROA 2ZCHL 1LHZA 5I8EA 2E8YA 5IB2B 1XAUA 1DANU 5I1EH 5CJOH 4NIKB 1B9ZA 4JKLA 5KS9A 3CSYB 3MOBL 1CVRA 3MLTB 4UDTA 5L88H 4I18A 4HUVA 5B38B 5B21A 3BIAX 1MREH 4HS8L 5I9QB 1A7OH 4LVOC 4M02A 1RUAH 1QHPA 3NTCL 1HNFA 1RJYB 1J87A 2EDJA 2WUCH 1FVCB 3LEYL 1WBXB 2B7DT 3QQ4B 3IFLH 3IYLW 2QL1A 2IF7A 4GRLB 4HK0A 4M7JL 4BELD 3JWNC 2R0KH 2C1PB 1T21B 5C0IB 4YQXH 1I75A 3GGWB 1W0VB 1H3GA 3OKMA 3FT4A 4OFDA 2AEWA 4OLWL 4WFED 1FZJB 3X3GL 2B39A 4IOFC 5JXAL 4HX1A 4M61B 3X3FH 4NRZB 4APQA 5GIRB 5MERA 4MMXC 5GQBA 1FGVL 2CLZA 1NEUA 4GG8B 4OAWB 3LV3B 4LCYB 3FRUB 3MRHA 2FX7L 2AJXL 3TO2A 1U95A 2X2YA 5A2KH 2OI9B 1H8SA 2B1AH 4YDKH 3ZKNC 5IW6A 3MOQA 5LGHH 1J0YA 1BZQK 35C8L 2XWBB 1FNAA 5IFJB 1Q9LA 2EIDA 3Q1SH 1MY7A 1RZKC 5IWLC 1K3ZA 5B8CB 1IKNC 3B9AA 3LIZH 2XYCA 3RZCB 2Q76B 4LHJB 4PBVC 2Z35A 3TA3D 4WENB 3VJ6A 3DYMA 1AGBA 4L4VB 2GW5A 3PWVA 5MEOA 1FAIL 1PEZA 5IQ7H 4QCIB 1KLUB 2OTUB 5I1IL 1KTRL 1A1MB 2DYPA 2F8OA 1KCUH 3CXHJ 1VEPA 3ZKQD 1A1NB 3AROA 4LPVA 1FZKB 3VFVA 2F54E 4PJHE 1HSBA 3UTQA 1WFTA 3CIQA 4MDJA 5DI8A 2Z92B 3O0RL 1JWMA 4R0LB 1KCLA 2ZOKB 1L4IA 4RISH 4KC3B 5FCUH 3ZKSD 2F5AH 5IVOA 4ZFFA 5BV7H 4KQ3H 1FYTB 4KJWC 1UB6A 3L3OA 4G6MH 1KENH 5AD0A 1BFTA 4BKLA 4D9QD 4BH8A 1U9KA 4Z76B 4I1NB 4OCNC 4G42B 4ZTOL 5CBEA 4MS8C 5IFHL 3FB7A 4I77L 3ARFC 4Y5XB 1TPXB 4AEIL 4P5TC 5GS2H 4OZFH 2GI7A 4NKQB 2Y6SC 1KUMA 4WO4D 5A2LH 4CVZB 3V4VL 2ZNWA 4JQVC 4BSWA 1ORSA 4I4WA 2VXQL 4F58L 4YHKL 4FABL 1K8IB 3VXUA 2YPLA 1H5BB 3QAZC 1JWSB 1LEKB 2X10A 5IIEA 3N85H 2P5WE 4O02L 5DUMH 5IBLD 5C0AA 5D6CA 1AGCA 1Q0YL 2ATPA 4N0UE 4HUKB 2V7HA 3NFPA 4NYLB 1BWWA 3T4YB 4P23C 1GHFL 2NY2B 3DO7B 3RKDC 1KJ2A 4OFYA 2RGSA 2FO4B 3ZO0A 4G6JL 4D0BB 4LSSL 2OMBA 3KYNA 5FO9B 4F7CA 4LNVA 5T1LD 1R5VA 3TPUB 3QIBC 4NWTH 3T2NH 3PL6B 1HN1A 1M7IA 2EDOA 4C83A 3V5DA 2L7JA 4K7PH 1IGFL 3U6RB 4GO6B 1DN2A 2Y25A 5F89B 3ZYIA 1I8IB 4WHCA 1LE5A 4HUUB 1KPUB 3B5TA 3VXOA 1I7TB 2EDRA 2I60L 2HFTA 4GRWH 4PGDB 2VXVH 5TDNB 4HC1L 4LGRB 2AQ2A 3PIQA 5C0JA 3FFCA 2X4OB 3T3PF 3GI9L 5IB5A 3RIAF 3EOTH 5C0GB 1XF4B 3PV6A 3H0TA 3FZUD 5EWIH 4JO1L 4BQBA 4WVRA 3VXSB 4GS7C 2CK0H 1MAMH 1P7KB 3F7PC 4ODWA 3VXRD 4QTHB 2NNAB 4U1HA 3GEWB 1S5IH 4I5BA 2Q6WB 4LPWA 4PJEB 3JV4A 4MCZA 1VB9A 2YBRA 4LLMA 1IGYA 1C16B 3V0VA 4OF6A 1CXFA 2X89D 4HV8B 4ISVB 4YHZH 4PJBF 1DBJH 3SE3A 1IGJB 4IOSD 1EGJA 4NZTH 3QRFM 1BZ9A 1P9MA 2BMKA 1RUKH 3CK0H 1MF2H 4Y19E 2VR9A 5E08H 3GNML 2AK4E 1Z9MA 3S88L 4JKPL 3RDTC 5BZDA 3F6IA 1FSKC 1YY9C 4GAJH 3FN0H 3T1WA 1DN0B 1PW3A 4RFNC 2YSSA 1BBJB 4WCYL 1GPOH 2GSIA 4MB4A 1A4JB 3DARA 5C9KA 3C5ZC 1YEEH 3BP6B 4HBCH 1RUPH 4RMWA 4EEEA 4QT5A 1EXUB 3NCCB 3QDMD 1KJMB 1RFDH 5JQ6L 2YEZB 2A1WL 3HI6H 5EUOB 5IKCB 3VE0A 2LVEA 1G9NH 1VKXA 2GAZB 1I9JH 1KC5L 4OZIA 4PP1D 5L0QC 4PJ7F 3L3IB 3TLRA 3IFPA 3JTSB 4GG6A 3IXTB 3D0LA 3WL9B 1LO3L 3O4LD 1UVQA 3SOBH 1MFAL 2DJ4A 5FCSH 3QWRD 1KJVA 4TN9A 4U3HA 3MBED 4Q9CA 5HGDA 2DAVA 4BZ1H 1FFPA 1N5AA 1IC7H 2DBLL 1UH4A 3HR5B 3NABH 4MSWB 4ENED 3ABZA 1Z9SA 4X6CF 3QHZH 3MROA 3EBAA 3UC0L 1CFQA 1XGPA 4XXDB 1RIHL 3BN9D 4HKJA 5LQBL 3DTXA 1RVFL 3CXDL 5DQ9A 5EZOL 5KOVC 2HP4A 5L7XH 5JLZA 1S7VB 1ZLSL 1P4IL 4F33A 1HKLL 2DM2A 4YHML 4Y2OA 2DLIA 4PB9L 5E6IB 5F21B 5F96H 3ARSA 4OKDA 4OI9A 3SDXA 2FSEB 5HYJA 1PX4A 3VW3H 5FKPA 4POZC 3IDNB 2AXJA 3GJEA 4R90L 3UBXA 2DQJL 4FTVB 5GGRA 2BNQB 3MV9D 5ID0A 1NUFA 4X9GA 3U2SB 3O4OC 3IJSA 5F7EL 4MJ4A 4KRMB 1EFXD 4OD3H 4FFVC 4YPGA 5EIIA 3B3IA 4PJDF 5EZIL 1Y18A 5CIPB 1Q0XH 4CVUA 4UOW0 2BSSB 4L3CA 1QYGL 2RBLA 4K23L 4GQPH 1SY6L 5C07A 4PV8B 3KPOB 3H42H 3DX8A 5EG6C 4MD0B 3FT2B 2B2XL 4ONGH 1MQKH 3LEXA 1MI5B 2XFXB 3MUGB 4M03A 3GRWL 3WO4B 5HVWA 3TIEB 1FVDA 4X6DB 4Y4KA 1VPOH 5D6DC 1F3RB 3B5HA 4NN7C 2FBJH 4D94A 4YX2H 5DRXB 1S7SA 1ITCA 2EE3A 4AK1A 1TVHB 1S7TA 1FE8L 1KTDA 1NAMA 1IM9B 1DQLH 2VXTH 3BAEH 5LKNA 3CSPA 3REVB 4KK9D 3A6CL 2R2HA 1J9CT 3ARPA 1DVFC 1HOCA 4MHHI 3FN9A 3DROB 3WD5L 3MV7E 4Y4HD 3QPXL 1U8NA 4HWNA 5D7LB 1XF2A 5I66A 3BKYH 2AGJH 4JFPA 2WZPD 2J2ZA 2CKBL 4XC3H 3X11A 2QBWA 4PJ5A 4PJFF 1HXYA 1IAII 3E2HB 1CBVL 1N64H 5KSBA 4HFUH 4JPIA 5TQ2L 1RJLA 3V7AG 3WN5A 4DUXA 1CXIA 4ELME 4CAGA 4U1LA 4OKVB 4M7ZC 3BSZL 5I75C 3JWOH 3GIVA 3JWDL 2DMKA 4TULH 1XGUB 3AU1A 3E6HA 5I19H 2OL3B 4KTEL 5HYQB 4U6YB 2X4PA 5F97E 4HX1B 5IHZA 4DZBA 4APQB 4BQ6A 3IKKA 5MERB 1I8LC 2FH6A 3QZWG 5KOMC 3MRHB 1F02I 4HMCA 2D7PA 3HR6A 3TO2B 1U95B 3ZHLA 1N7ML 3TIDB 3OG4B 2MFNA 5IW6B 1ZHBA 4GAYB 2C26A 5E9DE 2DBJA 2NZ9C 1CFVH 4MAYD 1Q9LB 5JNYA 3T65B 1JK8B 3D39E 5FO8A 1DBML 1NMBL 4NN5C 4NQSB 1PKQA 5JXEA 5K59F 4XC1H 2WMPA 4LPTA 2M2DA 1CFSB 4NM4H 5EORL 4YBLB 4NJAL 4DW2L 2KZWA 3JV0A 4I48A 2ZG1A 1HYRC 2OCFD 2IPUK 1IMHC 2X7LB 1QVOB 3SDAC 5ICZA 5MEOB 3LKQA 5I71B 4Z7VF 1ZLVH 2DYPB 1G9ML 5LAXA 3GMPA 3R1GH 1Q9KA 2ITDB 4OM0H 1FVEA 1FRGL 1LO5B 4C57C 3BISA 1CZ8L 4U6VH 5HVHB 1HSBB 4MDJB 2Y72A 3ZE0F 1JWMB 5ABDE 4OIIH 4QRSA 3BRDA 1V7NH 5JDJA 4I3SH 4ZFFB 3PHSA 1TCRA 1FO0A 2DLHA 4KHTH 1QLEH 5BVJB 1VFOA 5CEZD 3O6FD 2CDGA 3M8OL 5AD0B 2YUWA 4QHKI 5DEGA 1G6RB 3WIIH 3GHEH 2W60A 1A3RL 1H3WM 1T1ZA 2ID5A 4JG1L 3VD5A 3C6LA 1CLZL 5C09A 2E9BA 1RZFH 5L2KE 1LD9B 3IT8D 5EOQL 2X4RB 3LQAL 4XCEA 4ZPVA 4F9LC 3LKNA 4P4RA 4JDVA 1ZT7A 2YXMA 4G8FA 5FA4A 3VXUB 2MCPL 3ET9F 3MRRA 4MZ2A 3KPQB 2EE6A 5ISZB 2BSTA 1L9NA 4Z0BH 2W65B 5D6CB 5IB3A 1AGDA 1AGCB 1DFBH 2ATPB 2BHZA 3BE1H 3NFPB 4WFEE 3G6JE 5J3HD 2OBGA 2R2BA 2R56H 5GJSH 3GSNL 4OT1L 3GK8H 4JDZB 2VDRL 3FAWA 5L8JB 4QHMA 4Y4FB 1KJ2B 5HHOD 2QKIA 3LEVH 1GZQA 1PLGL 2Q8AL 3ESVF 5C2UB 1OAXH 1R5VB 2QSQA 4PTTA 1M7IB 4C83B 2B4CC 5ECJE 1YMMB 3GZKA 4FQXA 3TT1H 1DEEB 4UU9B 4ZS6C 4LAQH 4X80L 2AJUL 4KKLD 3F62A 1RZJH 2Y5EA 4P4KB 1KJ3H 3EYOA 1ZHKA 4XCNB 1ONQB 1WLHA 4GRMA 1RUMH 3LPGA 3VFWA 1Z5LA 1FORH 5ACZA 1DQJA 3PIQB 2F54A 3FFCB 4PJHA 3MRJB 3G08B 1K5NB 2EIBA 1FGNH 4PRIE 4E42B 1JGEA 4UBDC 4FQLH 1CDHA 4FRWA 5LWYL 3PP4L 3PWLA 2Z31B 3ARQA 4KV5E 3TWCL 4Q9BA 5FECA 4JZOA 2VSDA 3V0VB 5DJCA 3MNZB 4MJ5B 4XP4H 4U6XB 3CC5A 5IMOA 1KV3A 5KVDH 3GB7B 1H3PH 4LP5A 3RU8L 3T0BA 3BKJL 2B1HL 2HT2C 3DOSA 1YEDA 2H1PL 3KYAA 2BOBB 5KVFH 4X4XA 3SGEH 2P42B 4H1LG 3CFCL 5K9KA 5BZDB 4OF0A 4P5TA 2P5WA 4OLEA 3LZFL 1FQ9C 1TENA 3VWJB 1UB5B 4L9LA 4ZQKA 1AKJD 5DTFA 3MNVB 5CD5C 4N0UA 5B4MD 4U6TA 1AO7D 1KB5A 2YSSB 1NCWH 4FFZL 4JQVA 3CFBA 2FYYA 4UB0H 2IH1A 3OXRA 3MLPA 2A0LC 3OKKA 1P69B 1KN4H 4J2XA 1O0VA 4TRPH 1UWEH 2ZWLT 3LHPH 3VE0B 1WCQA 2Y07L 3BXNA 4MNQD 4YDIH 4OZIB 2VDLL 2XA8L 1DDHA 2QLVB 3P0GB 4LNRA 5F9JA 4ZUSB 5TFSL 3L1OH 5KAQF 1MIEL 3LKRA 1VGKB 2ENSA 3IFPB 4GG6B 4TQEH 4QXUH 4FQJH 4GBXB 2NTFA 2PYFB 3MLUL 2AK1H 4OCYL 5BZWB 3C60D 3VXMD 3VFUB 1FFPB 1N5AB 3QIWA 3KHOA 2YC1B 3ZKMD 1JNLL 1QHOA 2YN5A 3MROB 1ZANH 4EI5C 1WJ3A 3IFNL 4HKJB 1N5YH 3MV01 1MJUH 5DQ9B 3S6CA 3H7BA 3RIAK 2VKWA 4F33B 4DVRH 1J0IA 1JUFA 2X4NA 1I1FA 1EEZA 5GS0L 4V1DB 3SDXB 4EVNB 1MWAL 3KJ6H 3QWQB 1RIVL 2QR0B 3DXAD 4OD2A 3KNBA 5FKPB 1PVHA 4J3UA 4MA3A 5ESAB 3VXRE 3IFLL 3UBXB 4BUGA 3U46A 4EN3A 1R3KB 1KEMH 2ICCA 5ID0B 3W0WE 5IJVB 1J0JA 3NGBB 2CUIA 3O6LH 4XVTH 4Y19A 3NZ8A 1K3IA 3FQTB 5GRVK 1CGYA 3IF1A 2K1MA 2XG4A 1OGAE 2AK4A 3KLAA 5JOFB 5BS0D 4QYOA 3LS4H 1B4JH 3MLXH 1Y18B 1MAKA 2VE6A 5BRZD 3SJVE 3V7AE 4DUWA 4JM2B 5JHDE 1CLCA 3SGKC 4L3CB 3MJGX 4NRXA 3OF6A 3DX8B 2CO6B 1J86A 5H2BA 3UDWA 1PAMA 1IGIL 3OX8B 3WO3B 5HVGB 3NOIA 3DVIA 3TF7C 1CQKA 3CCHA 4LSRL 2DQTL 2HKFH 1IFHH 1FVDB 2P8PB 1DBBL 5HGGS 3QDME 4EDWL 1A9EB 4QOKB 4P46D 5FYJH 1MRFH 1S7SB 3CDYA 4LASH 4H88L 2VLJB 4P59H 1S7TB 2CO7B 4KRPD 2CIKA 1TDQA 3O4LE 4LLQA 1H3XA 4N9GB 3ZE2E 2R2HB 3EDKA 5JOPE 1IGTB 5CCKH 4PBWD 1A47A 1I1AC 3P0VH 1TJHL 4G5ZL 4G3YL 4RISL 5DRWB 1KIUA 1FV1A 2APFA 2VJXA 5BV7L 4KQ3L 3T09A 3X11B 4PJ5B 5I1LA 3TJHC 1WZ1H 4E41A 5DURD 3QQ3B 3QUYD 5F6IB 4OM1H 3O9WD 4ZD3L 1GGBH 3EFDH 1RJLB 5DSCA 4UQ2B 4U1LB 4R8WH 5IT2H 5DUBA 5IQ9B 3W5MA 3GIVB 5IG7A 2ICWI 4RAVA 5F7UA 4EDXB 4D3CL 3HE6C 4LLUB 4ZG1A 4KROD 4UMGA 3VFPA 1U8KA 4F15B 1RV6X 4HCRL 5SWSD 5DUML 1L0XA 5J89A 5EO9A 3UEZA 3RA7L 2ESVE 2Y5TA 1T89C 5LXGL 1IILE 2VIRA 5HHNA 3UYRH 3P9MB 3C2SA 3QXUA 4DKFL 3P77A 2Q7YA 5GSRA 1GJIA 3D9AH 2BDNH 5TJWK 3L3GB 1CGSH 3CU1A 3V6BR 2ZUYA 5DS8B 5D7SH 3WLWC 1T03H 5EPMA 3BWUC 5JNYB 1EEYB 1CDBA 3BPCB 5FO8B 5FAAA 1PKQB 1XGYH 4PRPB 5J11B 1YJDH 3UYPA 1A1OB 3HPJA 3OSKA 5DVLA 1PY4A 3OB0K 2WBJD 2W0PA 4JB9H 2DQHH 3TYGL 4BK5A 2V9QA 1C08A 1X5HA 5ICZB 3LKQB 1FG2B 3QHFL 3MJ9A 1HCVA 2VXVL 1U8JB 5LAXB 3IGAB 2Q87A 4PRDA 3KPPB 1Q9KB 2CUMA 3SPVA 4GLRI 4HLZG 2P7TA 3EOTL 3MV7A 5D1ZC 2A73A 5JIKA 5A1AA 5IMMB 4XPTL 2CK0L 3GKWH 1MAML 3T08A 1FNEB 4WEMB 2D9QB 4PG2A 3L3HA 3I50H 2NXYD 4LIQH 5DEGB 4AG4H 2VXUH 3EAKA 5JMRA 5AG8A 1CXHA 3AB0C 3WFHB 1DBJL 4KRNA 1T1ZB 4N8PA 5CJQH 3ALWA 3PHOB 3QXDA 4ELMA 4G80A 3CK0L 2A6DA 4HGKC 2AXGA 4U4BA 1HH9A 5ICYA 4X7SL 5EA0L 5E08L 4LVOB 1R3IL 4P4RB 3F7YA 4JDVB 3GMMB 3P30H 1ZT7B 2NY7H 3BJ91 3CLFL 5DJAB 2R2EA 1IC4H 4H5SA 4XI5D 3ARGD 2XI9A 3MRRB 3DHMA 4KI5C 4XWGL 5AWNH 3SY0A 4GAJL 3FN0L 3CLEH 1QNZH 5E2WH 5CLWA 2XTJC 5D72H 3SDCD 1OP5H 4YHIA 2R2CA 4KI5E 1RUPL 3GBNH 5C70A 1DL7L 1MCHA 4XBPA 1RFDL 3RX7A 4JFFD 2HKHH 3TT3L 4WW2A 1I8LA 2KKQA 2QKIB 1G9NL 1GZQB 2XTJE 2YA2A 5SWZE 1I9JL 5E9DA 4JRYB 4HAFA 2E7BA 2W9LA 4ELKA 4MCYA 2C4FT 4M4RA 2QEJA 2EEBA 1S8DB 3D39A 3RVWD 5IEHB 3QEQB 3ARBD 4X7TA 1FPTH 1K8DB 1ZLWH 3KAAA 3ZDXE 3SOBL 5H94A 2X05A 3KPRB 1JN6A 4NZRL 2OXGA 3JVGC 4DTGL 1KSRA 3BDYH 1KCVL 3EYOB 4ZXBC 4XGZB 2E6PA 5IW1B 4JFXB 3DHJA 5C0ND 4GRMB 1ZEAH 3QHZL 1OW0C 4KTYA 4KPHH 5ACZB 1XR9B 1DQJB 1FBIL 2F54B 3MCLH 4Z8FH 4KAQH 3BDXA 4ZAKC 4NQCE 4O00A 1AXTH 5FM5O 1RZGB 3A6OA 1AY1L 4BQ8A 3NIDE 3PWLB 2WSKA 4PV9B 3BIBX 1T7YA 4L8SC 3OJDA 4UV4H 1KACB 1LDPH 2IAMC 3DYOA 4XAKE 5D4QA 5DJCB 1ZVSB 3VW3L 2DTML 4OZ4B 5JR1L 5IMOB 3D3VD 2YMXH 1JV5A 4OLZH 3VFGL 5CEZE 2JJUA 4WUUD 5L2KA 4KUCD 2NLJA 1NBZA 3CVHA 2QQKH 3DMMD 4GQ9L 1OAZL 2L4OA 5MEND 3ARFB 4XMKL 5C0EB 1LK2A 1WK0A 2O5YL 5BW7A 4P5TB 2A77H 3ALPA 5DC0A 5DJYA 5DYOA 4N0UB 1UXSA 1H15A 3NCJH 2YOCA 3G6JA 4LGSB 2FYYB 2AV7A 2IH1B 3NN8A 3F5WB 5T5FL 3H42L 3QAZB 5EOCJ 3OKKB 3IAPA 4ONGL 1MQKL 1PX3A 5IBTL 2CRYA 3CFDA 4Z7WB 1QFWH 5TF0A 3Q6FB 3AUVA 1MJ8H 3PNWB 1YC7A 3LKRB 1U8LB 4P23B 4RNRA 1NKRA 5HHOE 3EYQD 1BVLB 2NTFB 2NZIA 1XGRB 2NYYD 3EYUH 3LKPA 1R24A 3QUXD 2HRLA 5EU6D 4Y2DC 4X98B 3QIBB 1OAYH 4UT7H 3VDCA 3BAEL 5F6HI 4JJ5A 5DC4B 4L3AA 43CAB 2N7AA 2OR7A 1EZVY 5KSAC 2ZUQC 1Q9OA 1ADQL 4N0FB 3E6FA 4PRIA 3H7BB 1IM3B 1E4WL 1FL6B 4FQHB 43C9B 1MCIA 2AGJL 2HJLB 4MA7L 5I1GL 5C0BD 1JUFB 4X9HA 4FQIL 4OBRA 2ZUUA 2WBWB 1FN4A 1JPGA 4LSTL 1NLDL 4JQXA 3BKCH 4HFUL 4IOIB 1M7DB 4PRHD 5CILH 3MX0A 2KDGA 3FT3A 4FZEH 4MA3B 2PO6C 4CJ0A 4GS7B 1MFBL 3HTLX 3VRLE 3WJLC 5E8PB 4FQCH 5JW5B 2MQ3A 2R8SL 1I3GH 4YXHH 1E6JH 3PGDA 4LHUD 2FHCA 1DBAH 4YEFA 2AK4B 4K8RH 3KLAB 3LH2L 3PWUA 5DFWH 1FG9C 4K55A 4CDGC 3RUGE 4QHKJ 4UT6H 5A2FA 5E8DL 2L0DA 4NRXB 2A9ML 3RDTB 5GRJH 2GFBA 1FSKB 4ODBD 4KHXH 3G5XA 2YK1H 4U1SB 3UJJL 4RFNB 1OSPH 3O41B 4TVPH 2MSPA 1FLTX 2FJHB 3OKLB 4WUKH 5EOCH 3O11A 3C5ZB 2AEPL 1JGDA 4XC1L 2X70B 5D1XC 3UTZA 1WFOA 5EIQA 4MNQE 1EZVX 2JJSC 5T1LA 4MNGE 4LPYA 4FOMA 1F6LL 5L0QB 2P4AB 4LLQB 4GXUM 1F8TL 1LILA 4UTBH 4HHAB 5MI0C 4JQIH 1AXIB 1D9KC 3GMRA 4JZJC 3E3QC 3VXME 2ORBH 4OM0L 4U6VL 5GGSY 5F9WB 4D0CA 1K4CA 2I27N 1TLKA 2QADC 4MVBC 1MJ7H 4KJQD 2AJSH 1V7NL 1IQDA 1ED3A 3E3QE 1CGVA 4XXCC 4GAGL 1ERNA 5I1LB 2R23A 2UZIL 3ARED 2PYED 2BVOA 3WIIL 1T4KB 5JTWA 2ADJA 4GW5A 1AFVH 3FQRA 4NNPL 2HVKA 3VXRA 5DSCB 3HG1E 4GJTB 3LKSA 5C0CB 3G5YB 5J0BA 1RZFL 4J4PD 3QIUD 1DQDH 4Y1AD 3VGHA 5DUBB 1R5IA 3OMZA 1ITBB 4S11A 2XQBH 3HC0A 3QRGL 2BX5A 5FHBH 3CVIH 3QUMB 3HB3C 5HGHB 3W81A 5DJ6B 4GSDL 4O58L 2VSCA 3VFOA 2CGRL 3VFPB 1U8KB 4CW1A 4Z0BL 3MGTA 1GAFL 3SE9L 4HPOH 1VADA 3O4OB 5EO9B 3TCLA 3BE1L 5D7JC 2Y5TB 5JHDA 1AJ7H 4XVUD 1CK0L 3HE7D 5HHNB 4M1DH 5IK3A 5LGKA 3BI9X 2GJ6B 3P77B 5F1OB 2O61B 3W11C 1BBDL 2K9UA 5FK9A 3RZWA 5BRZE 4IDJH 2X4TB 3CMOH 5ESVB 2ZCKL 4OZHF 3SGKA 2NX5D 2IPTH 3FKUS 1JTPA 3BJLA 4IDLA 4ZFZA 1MIMH 1UWGL 4EXPX 3QDMA 3WJJA 1CG9B 3QZWA 1C1EL 4XPAH 3GMOB 1OCWL 3UTPD 3HAEB 1KPVA 3BH8A 1C08B 3CZFA 4JCLA 5DHVB 1P4LA 7FABH 3O4LA 4LDEB 3QWRA 1FORL 1J1OH 4NN7B 3MBEA 5IM7A 4YHOH 1C5DA 3L5WA 2HLAA 2W9EL 2J8HA 1FGNL 1F4HA 3QPQC 1P7QA 3MV7B 4NP4H 2A73B 5I8CA 1NC2A 1OQXA 4MAUH 4WI9A 3IDGA 1UZ6E 3FQXB 2G75A 1DVFB 5INDA 1UA6H 3P0YL 4QRPD 4L9DA 3NBNA 2RCSL 2CXKA 5KSVB 2ENYA 2DQDL 3S37H 2DJSA 2Z8SA 4QTIH 2RAMA 3QXDB 5KVDL 4ELMB 1H3PL 3WUWG 2A6DB 3D69B 5I73C 1MFNA 2YD5A 3F7YB 4PGZA 3CDGB 4R2GC 5KVFL 4TTDD 3TFKD 2ED7A 2F5BH 4P9MH 4U1MB 4H5SB 1ZLVK 5IJKC 1TQCC 2VLRE 4M7ZB 1Y6NR 3QDJD 5I75B 4LEOA 2N4IA 5DJ2B 1F4XH 4IM8A 1RK0B 1NCWL 4X5WA 3HE6A 2WQRA 1QA9A 4UB0L 3PQYE 1MFCH 1A6VL 4YBHA 5E8OA 5M94B 5SWSE 4YHIB 2HJFA 1SVZA 1KPRA 4XBPB 4U7KA 1F90L 5EO1A 1FCCA 3ILPA 1AR1C 5EU3A 1Q72H 1FP5A 4PGEA 3HZKA 3QFJE 5DZNA 1RHHA 5DZLA 2PXYC 1T89A 4ELKB 2NY6C 1ZE3C 4WI4A 3D39B 5EN2B 4X7TB 3WEXB 5EBLA 1CLOH 3V6ZB 4UIKL 5H94B 2AK1L 2WBJC 4DVBB 1GXEA 4WI3A 4JE4B 3D1MC 5FA3B 5TE4H 5D7IE 4DFIA 4MQ7A 1VACA 2Q86B 3ZDZF 4GRLD 4NN5B 5KG9A 1INEH 4ZO9A 1Z6JT 2F19H 3CFJB 5HHPA 1ZANL 3AAZB 2EEAA 1HWHB 1R3HA 3SKMA 1T5XA 4Q74A 1QBMH 3SDAB 3OKNA 3RPIB 1RD6A 4KMTH 4AENB 4DVRL 3RWDB 4MD5A 2VZSA 4K7FB 5DVNA 4DAGH 4UTAL 4E0RA 4Q6IA 3N1QC 1NBYA 3L3JA 3OJDB 3P4NA 1LP9E 4WV1C 2D0FA 2YA0A 5FDWA 1ORQB 5DQDL 5SWQA 1BQHB 1KEML 3S36X 5L2KB 2GT9A 4HZLA 1M05A 3O6LL 1NBZB 3S98A 1NCTA 2E7CA 4DQOH 2C1OA 4OD1H 3T2PA 2HLFD 5I8OL 4K9EL 4L4VD 1LK2B 1WBZB 2F58H 2R0LH 3LS4L 3QI9C 4WIQA 5DD6A 4A6YB 5ERWB 4TUOB 5DJYB 5DYOB 2UUDH 3DWTA 1UXSB 4NPYA 2AV7B 2IPKA 1MHEA 2ERJC 4N90D 3ARTA 4J1UA 1X3DA 5DVOA 4F57L 4IHOB 5D2LF 4XPBH 2OQJA 1G7LB 5SWZA 4FN0A 1WEJL 1T83C 4H1LA 4C56E 4N5EC 1FYTD 3JV6B 5AZEH 4RNRB 4YWGH 4JFFE 2VXSH 1T1YB 1CCZA 3ULUF 5FYJL 3LKPB 5D5MF 1A6UL 2V5TA 4XX1G 1F42A 4OCXH 2ZPKL 2CIIA 3GSUA 4HXBL 5IB1A 1ZVYA 4FP8H 2BSED 5F72S 1ETZB 2AV1B 3G5VB 1B0WA 2BY3A 3MXVL 3V95A 3JVGA 4IEFB 4XWOC 4PRIB 4GH7B 5GJTH 4NQCA 3WDJA 2GJZA 4ETQA 3UTSB 1G6RH 1NBVH 1JPGB 1JRHH 1UG9A 2H9GB 4HUWB 2XNAB 3EDDA 1HIMH 2NY2D 3LS5L 4OM1L 4ZAKA 5CKGA 3DVNA 1B6DA 3EFDL 3FT3B 4S1SH 1JZ8A 5E2JA 2JK5A 5AYUH 4R8WL 5IP4A 4YGAB 4F8TA 4TVPD 5IT2L 2W0FB 3PL6D 1A2YB 1X5FA 3MLZH 25C8H 1GVIA 5SX4H 3PGDB 3BMVA 3HC4L 2H26A 2R39A 3OAUL 1HKFA 2DQFB 2OJEB 3PWUB 3T0VA 2NMSA 4OLVH 4ZOAA 4YXKL 3EYVB 15C8H 1JTTA 5HHVH 4WW1B 3U4EB 4PJIF 3ZL4L 3JSSA 2EC8A 1KJ2H 5A3IC 5I16A 2RR3A 2GFBB 4LSPH 4YZFF 5B38G 4PJ8C 4TNVF 4TOYL 3UJIH 4P3CH 3VXSD 5IESH 3ULVD 3LB6C 4N8CL 4TPRL 1DTUA 3SDDC 5DO2D 2MKWA 3O11B 2VQUA 3DYPA 1JGDB 5DQJA 1JHLH 3TO4C 1YJDL 2EDLA 5HHOA 2R9HD 3QUXC 4HWBA 2H2SD 5F3BA 1BF2A 5GGVY 5T1LB 1ZV5A 2Y36H 1MFDL 4OUUB 4Y8AA 2FWOB 3QYCA 5CWSB 3WNLA 4K7PX 2VDOL 5BXFB 4AY0A 1RZKL 2ADFH 2HFEA 3GMRB 1UM4L 4O2EA 5EU6E 4X7EC 3ISWA 4OI8A 4KJPD 2E8ZA 2IANB 4Y2DA 4DGYH 3RWGA 2B5IC 5HD8C 5FUCC 3EO9H 3OPZH 1INQA 4NKDA 2VZ3A 3WXVH 1IQDB 1ED3B 1IEAB 2KH2B 4M9PA 3Q3GB 4EI5B 2R0WH 2R23B 1W72B 2BVOB 2VO5A 1GC1H 2ADJB 2HJKB 1EGJH 5DUPL 2O5ZL 3MYJB 5CJQL 2HVKB 3VXRB 3IDXL 1BM3L 4Y5VA 3LKSB 5DJ0A 5GZND 3W0WB 5IHUH 5F7MC 3CFEA 1FL5B 1PZ5A 3DJ9A 1QO3A 1T7ZA 4J3TA 2RFXB 4X0KA 1OGAB 4QRTA 3OZ9L 3WJLA 5AWNL 1AXSA 1XGTB 3MGTB 3ZDYF 3MUHL 5E2WL 1VADB 5GGSB 3RUGA 2XOTA 3WKML 1NFKA 4LU5H 3SJVB 2D7NA 5JHDB 4X83A 5DK0A 4CL7A 2VL5A 4PBXA 3FMGL 3Q2CA 5GRYA 2NTSP 1AKJA 4DN3L 1AO7A 3OR7A 3HCVA 1B0RA 3C5JA 5E6ID 1SJEB 3L3KB 2GUOB 4ZFZB 1NUGA 1FPTL 1S78D 1PZUB 2ICWB 5IMLA 4OFVA 4HS3A 4FXKB 4RMRA 4JN1L 4AIZB 2J8UB 1H8OA 2DWEB 5IMKA 2J7LA 4MNQA 4N0RA 4FQ2L 1ZKAA 4UOJA 4MNGA 3JWDC 4FTVD 2BNQD 1P4LB 2EZ0D 3SKOA 3QDHA 1ZS8B 1V7MH 3NACH 4JY5H 1AQDB 2FHFA 2DLTA 1JYWA 4KPHL 5D1XA 4TUJA 2EXWC 4NZUL 4XNYH 3VXMA 4S0TD 2JCCB 3QH3A 2HLAB 4NC0B 5F1IB 1P7QB 3FB6B 5T3XL 3BZEB 3IDIA 2BVTA 1AXTL 3L9RA 1NCDH 3QEHA 5I8CB 4X99A 1DLFL 1NC2B 1C5BL 1U6AH 3VXPA 4PJXE 1D9KA 4GKZA 3G04B 3IDGB 4JZJA 5ICXA 1CQYA 5INDB 32C2A 3ZZ1A 4UV4L 3O3DA 5K9JH 3S96A 1A14H 1I1AB 3RNKA 3RWEA 5LVEA 2C3VB 4JFYB 3GSOA 4JLRB 3B2UD 2H32B 1BD2B 4PJ9D 1X7QB 1CXEA 5F6HJ 1K2DA 4OLZL 4EI6A 3AMLA 3CUPB 3HG1A 1HWGB 1MI5D 4XXCA 4JO4H 3PF2A 2XZAL 4JPKH 4F2MA 3DXAA 4NNYA 4PUBH 1B0GA 3K74B 3WLBB 1IAKA 1I4FA 4AM0A 2A77L 4Z5RA 1IM9D 1OTTD 1G9MC 2P24A 4DGVL 3V6OC 4ZNEE 3NCJL 1EAPB 2ESVB 3HE6B 1QA9B 5KS9F 2Y4SA 5E8OB 4NUJB 2HJFB 5GRUL 3UZEA 4OJFH 3MRCB 5D7KD 1LGVA 5BRZA 2FEDC 3V6OE 4PGEB 1QFWL 4KI1A 3HZKB 4PPTA 5D7LD 5DJXB 1EO8L 1S7XB 1RHHB 1MJ8L 1TTGA 1YQVH 1J1XH 5DD3H 3NZHL 1MLCA 3V4UL 1ES0B 4NO5B 3W2DL 3ZE1F 4GMSL 1XEDA 1JPTL 3IB4A 1ZA6A 5HVFB 1DE4A 1WCBA 4XNQA 4TYUA 4IS6A 2NX5E 3MCKA 1C7SA 1NAMH 3RVTC 4IIQC 4JVPA 1VACB 1YYLL 4ZOBA 1OAYL 3LQAC 4UT7L 1WC7A 5KG9B 4HJJL 4P46A 4G7VH 3DO3A 3ZT6A 2OSLB 2EDQA 3NAAL 4LEXL 1V3KA 4DGIL 3EIFA 4Z0XA 3SKMB 4LDLB 2HN7A 1T5XB 5I2IB 2MWCA 3QQ9C 3BD4A 1OP5K 3DVFA 4APQD 3H7LA 1MHHB 2VLKB 4XX1E 2OR8A 2VKXA 4AJ0A 3M1BA 4N9OB 3L3JB 4K3EL 4Q9RL 3DIFA 4JY4A 5D1ZB 1GOHA 4W6WB 5ILTL 3T3PE 1BWMA 4FZEL 2XZZA 2EYTA 4JG0H 4HH8A 1ZLWK 5SWQB 4R6UA 5CHNA 1NGXB 4QRPE 2ITCA 2VLLB 1A5FH 1I3GL 3MV8E 4YXHL 3G9VA 5FYLL 3QUYA 4MQXC 3ULUL 2HWZH 3BH9B 2C1OB 3O9WA 3RWCA 3AB0B 1KYOK 2XXMB 1E27A 2Q8BH 3RY6C 5AZ2L 1AR2A 4K8RL 1RUQL 4DZ8B 5GRZA 4PJBE 1CYGA 3BGAA 5A16B 2W1NA 3I2CH 2LAGB 4NPYB 3PQYA 1MHEB 5SWSA 5C1MB 3QDJE 5CP7A 1CF8L 3T2QA 5IJKA 3T4AA 1BF8A 3ARXA 4AMKH 1IAIL 2OQJB 1OSPL 3ZKXC 5SWZB 2XTJB 3T77B 3O6KH 3QFJA 3VRJA 5FGRA 2OJZH 5EOCL 5DRZA 3ZYJA 1J7VR 3O6MH 4PJAB 4WFFD 4LCCC 1EK3A 5TGBA 4I3RH 2H6PA 5D7IA 2PXYA 3IDJB 5ITBL 4PY7A 1FL3A 1ZOXA 4PLKD 5C7XH 2Z93A 4M1CC 4HT1H 1I7UB 4G43B 5IB1B 4HIHA 1J0ZA 1EVUA 4PJ7E 2WBJA 2WP3T 2DMBA 2G9HA 2PF6A 3VXUD 1CL7H 2O26U 1MJ7L 4TUKL 5E4IA 4NQCB 4ZXBB 1JYXA 5ISZD 3FO1B 1N59A 1FO0H 4QO1A 3LN4B 2GJZB 1JF1A 4ETQB 1X5GA 1PD6A 4XP9L 1MH5A 1KFAH 2DTSA 3DUHA 4J12A 5IOPB 3QJHA 1LP9A 4S1RL 2QHRH 4ZAKB 4Y4FD 1AFVL 3CX5J 4YDJA 3DVNB 4LVEA 3TBWB 5ADPL 4N1HB 4X9BA 3T3MF 3LAFA 1NGPH 3MMEA 1I8KB 4NO2B 3QUZC 3S5LB 1PSKH 1KCRL 4L8SB 4POUB 3ZTNH 2YRPA 5IUSA 2XQBL 1SJXA 5FHBL 2C3HA 1YMMD 2IAMB 2WINA 1WIOA 2D0HA 5ENWA 3QR2A 3KXFB 2H26B 1A4KA 4DJMA 4NKOB 1QR1B 4ORGB 4P4KD 2OK0L 5E2VH 1KGCE 1BEYH 4HKZA 5CZXD 4B5EA 3FO0L 4YDVA 4LHQB 3KWWA 1IBGH 1AJ7L 1Y6KR 1XCTB 3INUL 3RTQC 4XTRD 3NA4A 4L4VE 1JHKH 4L8DA 3FFCD 3ARRA 5I16B 4XMPH 2V5RA 3OJ2C 2OZ4A 5KAQG 3CZJA 3HZVB 5GS0C 4XP5H 4C56A 2Z31D 2M8XA 1PBYA 5CFHA 4JO2H 5JA8B 3PXJA 4JFFA 4NGHH 1MHCB 3S35L 5HHOB 1DLHA 4XPAL 3HNSH 3LRHA 3F58H 3MBXL 1FYTE 5DFVD 3ARZA 5C71A 3QCTH 5KW9H 5D70H 1EJ6A 3VRIA 7FABL 4KKBD 1BREA 4R7NB 1BVKB 1J1OL 4XRCB 5GS3A 3UPAA 2AXFB 1OM3H 4O2EB 4YHOL 3U0PB 3QNXB 2XWJB 3ARDC 4Y2DB 4PTUA 1H8NA 1TFHA 5T1MA 2GQHA 4LRNH 3RWFB 1INQB 3VWJD 4OFPA 2APBA 2D0GA 1UT9A 4RWYH 2PTTA 2XZQL 5TDPB 4JDTH 3VGFA 5KSAB 2ZUQB 4GG6F 1D5MB 3AMKA 4TSAH 1F2QA 4Y0GA 1TJIL 4OCSH 1CGTA 4OTXH 3A6BH 4C4KT 4O4YL 3C8KA 4WFHD 2IADA 5DJ0B 1F4WH 2ARJQ 4PRAA 4R26H 5HY9A 3TN0C 1LNUB 1PZ5B 1QO3B 1SYVA 4GBXD 2Q1EA 4HGMA 3PWJB 1I1YB 3D3VA 2PO6B 1B90A 4QRTB 1RULL 5BCAA 3HI1A 3GSXA 1LWRA 5DEZA 1JWUA 1KB5H 1CU4L 5L8KB 5CS7A 4A6YL 3RUGB 4QGTA 1TVBA 4NKMB 4QRQB 2VL5B 1UFUA 1SMOA 3SDXF 1YNTA 2R4SH 2H2PD 3W5NA 3IRZA 3AXLB 5J12C 5BV7C 3LKOB 5HI4D 5J9PA 3X17A 1P2CA 1YEGH 1QBAA 3RVVC 2BCKA 2LTQC 1V3MA 4V1DD 3MJ8A 2DKUA 3KPLA 4WHYH 3VXSE 1D5XA 4U31A 3ULVE 1ZWIA 5TE4L 3KPSE 2ZJSL 2EKSB 2YD8A 2D7QA 3MLWL 4M7LH 4LRIA 3SDDA 4PJEE 4G8EA 3W82A 5BMFH 1FDLL 2F19L 2A6JA 1NC4A 5D1XB 4TUJB 4UNUA 3QUXA 4M8QB 4L8CA 5CP3A 5C2BH 5EU6A 4XCCL 1BZ7A 1GGIH 3EFFB 3P4OB 3IDIB 4KK8D 3MA7A 3L9RB 1MUJA 4Q58C 4X99B 2GK2A 1WBYA 5MI0B 3VGBA 3NVQA 4KKNA 2HT3C 4DAGL 4JRXB 1D9KB 4JM2D 1YN6B 4JZJB 5ICXB 1NDGB 3PJSA 1OQOA 3PGFH 5HI3D 1CLYL 4M48H 4Z7VE 4OGXH 4H0IA 4HH9A 3S96B 3RWEB 3MUY1 3BX7C 4WEBH 2QADB 4U2ZA 4Z7QF 3O8XC 3SGJC 4FFWC 4MWFA 4U3CA 3IJYA 3HG1B 1SY6A 4K3GA 5F3HB 5GZNC 2G5BA 4LCIH 4C58B 1YEIL 1NMAL 4OD1L 1F11A 4NNYB 4X6EA 1NFDB 4PRHA 4UDUB 5CZKA 4QOKD 3A67H 1U91A 3MRNA 4ZUVB 2DWDA 3GRWA 5I30H 3ZTJG 1IAKB 2F58L 1I4FB 1Z2KA 2R0LL 2VLJD 3H3KA 5HI5D 4Z5RB 2P24B 3D2UA 2I9TA 2PR4L 4LLDA 4LBEA 1JF6A 4YFEA 3IKCA 3WUWA 2CMRH 1MPAH 3BW9A 5SX5H 5KSBF 4XPBL 4H25A 1WUNT 3PWNA 5ANMB 3X12B 4NQXA 2GKIA 5BRZB 2CJUH 3HLAB 5D7JB 1N6QL 1K6QH 4QEGA 5C0RH 5E5UB 4Z78A 4YWGL 3OKEA 2OR9L 2PTUA 4AT6B 3NPSC 1MLBA 4G6KL 4U3XA 1FJ1A 4IS6B 1PDKA 1PFCA 1H0DA 1BIIB 4OCXL 1WC7B 4AEFA 1TCMA 3DRQA 3MYZA 5I74C 3MRLA 3TBTA 1FLRH 3ZHKA 1XF5A 4WI7A 2HH0H 4AEEA 8FABB 2HN7B 4FTVE 4LK4A 3RBSA 3S8WA 5E00A 3IU4L 1DSFH 1HZHH 5D1QC 4Z7OF 3HRZA 1VEMA 1CDYA 1U8PB 3U0WH 1G7IB 4PJCB 4PJXA 3BD5A 3AFLA 1JMZA 2WBKA 1J5OH 1NEZB 1NBVL 1OLZA 2VUOA 4RMTA 4LPCA 4P9HL 4JY4B 1HIML 3IVKB 1W72L 4R7DA 1G9NC 1KIRB 4OCWH 4X8JA 2FIKB 2EYTB 1N8ZA 1NMCB 2A9NH 1M7XA 1TZGL 2PYEA 4XNMA 3RKPA 5JXED 5T33L 3T0AA 3O3BB 4PRPD 4JHWH 3QISA 1WITA 1NPUA 1E27B 1M1SA 2WP3O 1MI5E 4KDTC 3BFOA 4NDMB 4OF3A 4J4PA 3QIUA 3TBVB 3V5KA 5DMIL 5CJ8A 3MRQA 2VLRB 4OLVL 5I73B 2ZNXA 4RGNC 5JORA 1D3CA 5BJTB 4R2GB 5LGJA 3E0GA 3LN9A 3PQYB 1A7PL 1MCOH 5SWSB 1JFQH 3VG0H 4LSPL 3VD3A 1TQCB 2OTPA 4RGNE 3V6OA 4P3CL 4XCYB 2J4WL 4KVNH 3QFJB 2NY4C 3VRJB 5EDXA 4WU5B 3UBXG 2LE9A 3HE7A 3AS0A 5C6TL 1AC6A 4RRPG 5CLTA 5DRZB 1JHLL 4DWHA 3RVUD 4JHAH 4Q6YA 5D7LE 1KN2L 1I9RH 5T1DH 1C5CH 3HZMA 2NX5A 5TGBB 1I7RA 2H6PB 3KLDA 2PXYB 5D7IB 4PY7B 3KPMA 2NY6B 3MJ9H 4FQQB 5E2TL 4O2FB 3GBML 1D6EA 3G9AB 2ADFL 1R5WA 3MSPA 4H20H 2WBJB 5DEFA 2JB6A 1EHAA 2G9HB 1JJUA 4DGYL 3C5SA 5CAYB 4N1EA 2UUDK 2YKLL 4I0PC 5D71H 3MRGB 3EO9L 2VUYA 4Q0XH 3OHXA 2V7NA 1N59B 2J88H 3BD3A 3KPNA 3GUTB 1C12B 4IOFD 2D7TL 5FM4A 1JF5A 3QJHB 1XIWC 4YR6A 1LP9B 4LQFL 2UYLB 4YDJB 1IKFH 4CMMA 2I26N 2J6EL 3GSNA 4KY1L 1LK3L 4JRYD 1MCPH 4PP2A 1WZLA 3VFRB 1R3JA 1PJ9A 4QRPA 3D5OF 3QEQD 4UILH 4WV1B 1TTUA 1FZMB 4HUNB 2DI8A 2EC9T 4B0MM 1UACH 2NW2A 4IRZH 3ZKND 3I6GA 1MRDH 4PJHF 3KPRD 1A4KB 4UIMA 5DRNA 1P1ZA 4LVNC 2DQCL 1LO2L 3ZSTA 3KYKL 4PJBA 4YGVA 1UJTA 4HKZB 2P46B 4G9DB 2D7OA 3BP5A 3WNMA 4X4YA 1U92B 1HHJB 4LLVA 2F54D 2DLEA 3G6DL 1JNNH 2GCYA 3PV7A 3QDJA 5GZOC 3QI9B 1MEXL 5GPRA 2W38A 5IVXB 2WUBL 4F9PA 3V52H 2DL2A 3CSBA 2R4RH 4YE4L 5EZLA 4C4KO 4HKBA 4XHJC 2VOTA 4C56B 2ERJB 4RSVA 2HTLD 1MNUH 1T1WB 3NH7H 1DLHB 2VAAB 3N1PC 2QSCH 1F6FB 5EOTA 4M6NH 3L5HA 3U4AA 1A7RL 4KJWD 5B38A 2YD4A 3NACL 4WFFE 3U9PH 1PG7L 2EE2A 4X4ME 1VFAA 1M4KA 1RJYA 1WICA 4LCCA 4X4ZA 3LDBC 1FVCA 1D5ZB 5IB4B 4W70A 3QQ4A 1KELH 3ARFD 5GGUB 3FOMB 2XQYK 2AJYL 2WIIB 4GRLA 2VR4A 5T1MB 3U30C 1JPFA 4P5TD 5DJZB 2FX8L 4M4PA 2C1PA 1ODAA 3U1SL 2Y6SD 3GGWA 2PTTB 1W0VA 5HDQH 1EHXA 3TV3H 1AI1H 1FZJA 2FO1A 2F8VA 4N8VG 1O7SA 1A14L 4GW1B 1NQBA 4M61A 4NQEE 5ISZE 3H9HB 4NRZA 5GIRA 1YEJH 5D9SB 2X4SB 2WWMC 3NCYP 4GG8A 2EIZB 2C7UB 1N4XH 3LV3A 2W92A 1EO5A 2VDKH 3C8KB 1FNGB 2IADB 3CVHH 4LCYA 3FRUA 4HJ0C 3DVGB 4ALAH 4P23D 4JPKL 1SVCP 5EUKB 3RKDD 2D2OA 4YXLH 3PUCA 5CSZB 4HZAA 1BX2B 1KT2B 1NCBL 3NFNB 3GMQA 2JE8A 3QIBD 1HEZA 3QUZA 2IQAB 3RWHA 5B8CA 4KGLA 1IT9H 2Q76A 1B88A 3WS6C 1VDGA 3CFKB 3I3EA 3B9KC 4OIAA 4L4VA 4WRLA 5T3XD 4HIIB 4QCIA 4ODHH 1KLUA 1NGWB 2OTUA 5IHBA 3VFTA 1AD9B 4I2XE 4MJIB 1P2CB 1FZKA 1MCQA 1YQVL 2X1QA 4HG4K 1P4BL 2ADGA 3MJ8B 1WVZA 2MJWA 3KPLB 4IMKC 1MCFA 4PY8I 1Y6MR 3GI8L 3VD9A 1HINH 2EYSB 1D5XB 3BP7A 4NBXB 2CQVA 3KJ4C 4PJ8B 4JJHA 2HMIC 2DLFH 1JMXA 1ZSDA 2YXFA 3RY5A 1FYTA 3LRGA 2B4CH 1CD1B 5JO5B 3SDDB 1MWAA 5FIEA 4ONHA 4AYFA 5FFLA 4Z76A 3TO4B 4ERSL 2A6JB 1NC4B 2ATKB 4G42A 4OV5B 3QUXB 4L8CB 5EU6B 1BZ7B 4ONFL 1CDUA 3QO0A 1MUJB 1HI6A 1U8HA 3B43A 4WI2A 4EOWL 5D2NC 2EDNA 1K8IA 1VEOA 2JLLA 3PJSB 1H5BA 4OSUL 5FUOL 1JWSA 4HH9B 4MQTB 4PREA 3RDTD 4M7KL 2B5IB 3MLRH 3SE8H 2PW1B 4TSCL 1CR9L 4EBQH 1YY9D 4CMHC 4CUCA 2DICA 3DSFH 2P1YA 4JG0L 4NYLA 3MRKA 5D2NE 3UYOD 1ZTXL 2G5BB 4LLAA 3T4YA 2BRRH 1A5FL 4O9HH 5BQ7B 2X42A 2MNUA 3C5ZD 4S1QH 2HWZL 3DO7A 2ARWA 1F11B 2YZ1A 4FA8A 3M17A 1A21A 3CH1A 3MRNB 1EMTH 2Q8BL 4D0BA 5JHLL 2XN9B 1F3DH 4JR9H 3TPUA 1NCCL 3VFNB 1K9TA 2AJZB 2XRAH 3FQUB 1MCRA 3CGTA 2VDNH 5GSVB 4P0DA 3D2UB 3I2CL 1H9VA 3BPNC 1ACYL 3U6RA 2YRLA 4UNTA 5I1DB 1V3JA 4P5KA 3FCTB 4LLDB 2QSTA 5F89A 2MQCA 4NQUA 1I8IA 3IKCB 1TJGL 3WXWL 1ZGLB 4XMLH 2H2PC 3MRMB 3BW9B 4RDQG 4HUUA 1KPUA 4OQ1A 4UI2A 3O6KL 5TDNA 1ZT4B 3I84A 1RU9L 3MLSH 3OKEB 3PHQB 2ICES 3P4LA 1XF4A 4JFQA 5ALBH 5C0GA 3C08L 1X6LA 3DRTB 1RQ5A 3VXSA 2CKBB 1P7KA 3KPSA 4I3RL 4QTHA 1H0DB 2NNAA 4NFDA 4IRJC 5C0CD 3MODL 5C7XL 1B2WL 4PJEA 4V1DE 1M6OB 1C16A 5D8JH 4HV8A 4ISVA 1F4YH 2FEEI 1IGJA 1S7UA 4JPVH 4POZD 4NSKA 3ROLB 5E1AA 5E00B 3TC9A 4CN6A 3P73A 4FQ1L 3HRZB 2GK0A 2I25N 4UZGA 2DQIH 3X13B 2X40A 4HCRA 2NQCA 2YWZA 4Z7VA 4KK5C 1P7HL 5EC2A 4FFVD 2QHRL 4R7DB 4J3OC 2GJ6D 1DN0A 2PW2A 1SEBB 4JFZL 4X8JB 3AY4C 5T1KB 4BFBD 5IV2B 5F9OL 1RZ7H 4PG9A 1N8ZB 4LSQL 1BBJA 4BFIA 4D0DA 1JNHA 1QEWA 2UV3A 1A4JA 3M07A 1NL0H 3BP6A 3OQ3B 5B3JE 5L6YL 3VFMA 1VFMA 4I9WE 1A6ZB 2DI7A 1EXUA 3ZYZA 4DOHB 5TE6H 2YEZA 1VERA 3O8XA 5IKCA 4NHUA 1AQKL 4M3JA 3SGJA 2GAZA 2YPVH 5J57B 4JFDE 3V5KB 1J8HE 1HCFX 3L3IA 3JTSA 1BEYL 3MLYH 1IBGL 5JORB 5LGJB 5GHWH 1U8IA 2VLJE 3OL2A 1AGEB 3HR5A 4MSWA 4U1JB 4XMPL 4JFEE 4YO0B 3NIFE 1BQUA 1PYWA 2E7MA 3MV7D 4NNXB 3S3JA 2G60H 5DMKB 2Y7QA 2LAAA 3SGEI 4XXDA 1F3JA 1DVFD 3OBAA 4NGHL 4ZUTB 3LQMA 4PGCB 3I02A 1S7VA 3THML 4JM4H 3HZMB