2QJJA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
402
Chain Sequence
b'MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKDAYGVGRGKLYYEPADASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
total genus 147
structure length 402
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjjA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjjA01
3R11A 2PP0A 3NZGA 3JW7A 3PFRA 2XH0A 3UJEA 1R6WA 1XPYA 3DERA 2XGZA 3CYJA 2PP3A 3TWBA 5FJUA 4H83A 3CXOA 3NO1A 3RO6A 2OLAA 4DYEA 1ELSA 3DG6A 5BOEA 3V5FA 2QDDA 3ZLGA 4JHMA 3GC2A 3QPEA 2HXTA 3R10A 2PS2A 4ENLA 4JN8A 3UXLA 3MY9A 3VDGA 1JPDX 3R0KA 3N6JA 3I6TA 4IZGA 2PTZA 2OKTA 3UJFA 2OZ3A 1ECQA 1EC9A 3VC6A 3RITA 2P0IA 3TJIA 4G8TA 1PDZA 3UXKA 1KD0A 4IP5A 3I6EA 4G7FA 4J1OA 1MRAA 2AL2B 3S47A 3CT2A 1SJDA 3TW9A 3U9IA 5FJRA 3OTRA 1IYXA 2P8CA 3KUMA 3DFYA 3RCYA 1R0MA 1KKRA 4M0XA 3U4FA 3BOXA 4IL0A 3JZUA 4J3ZA 2PMQA 1EBHA 4IT1A 4KEMA 1P48A 2OFJA 1DTNA 4E4UA 2P3ZA 3N4EA 3STPA 3V3WA 2PGEA 2P8BA 2MNRA 2OQYA 2MUCA 2OQHA 3UJRA 3V4BA 1WUFA 2PP1A 4JN7A 3GO2A 3H70A 4X2PA 4ROPA 1OEPA 4H2HA 2QDEA 2PODA 4Z1YA 1MDLA 1MNSA 4GYPA 1TE6A 3SN4A 4GYPC 2XSXA 1KCZA 5ENLA 2FKPA 3P93A 6ENLA 2OZTA 3IK4A 2I5QA 3IJQA 2GDQA 4E8GA 3FV9A 2HZGA 3DESA 3P3BA 1JCTA 2QJJA 3H12A 4HPNA 2XH2A 4MMWA 4H19A 3QN3A 3N6HA 3THUA 3SJNA 3TJ4A 1MUCA 3ZVHA 4GGHA 4Z17A 5IDZA 3NFUA 3NXLA 1TZZA 3VFCA 3RGTA 3TQPA 4HNLA 3GD6A 3OPSA 2QJNA 1W6TA 3IJLA 4KPLA 1EC8A 4HN8A 1YEYA 3VCCA 3ES7A 1WUEA 2QGYA 3DGBA 3CAWA 3D47A 5EU9A 4ZA0A 1XS2A 5FJPA 3H8AA 1EBGA 3D46A 3RR1A 2PCEA 1KKOA 4GIRA 1SJCA 3HPFA 3OP2A 3OW1A 5BOFA 1SJBA 2GGJA 4A3RA 3P0WA 2GGIA 4FI4A 3K1GA 2OX4A 3N4FA 1JDFA 4ZCWA 3RRAA 1JPMA 1F9CA 4A35A 4IHCA 4A6GA 2PA6A 3H7VA 2PTWA 3QKEA 4FP1A 4E5TA 3MSYA 3ENLA 1MDRA 3BJSA 2PGWA 2OZ8A 3FCPA 5FJOA 3ES8A 4K2SA 3FVDA 2AKMA 7ENLA 3QTPA 1PDYA 2POZA 2PU1A 4YWSA 4MGGA 3I4KA 1ONEA 4HCLA 3QLDA 3DG3A 3T4WA 2AKZA 4IP4A 4HCDA 1EC7A 4K8GA 2ZC8A 2QJMA 1FHUA 2XH7A 3R25A 2AL1A 3EKGA 4F4RA 2DW6A 2PSNA 3MWCA 3ZLHA 2P88A 3R0UA 1TKKA 1NELA 4GFIA 3ZLFA 4DXKA 3PWGA 3TTEA 4GGBA 2PU0A 2ONEA 4GMEA 3FJ4A 4DWDA 3UCCA 3FYYA 3MQTA 3JVAA 4E6MA 4HCHA 2XH4A 3IJIA 3UCDA 2GGGA 2HNEA 3ZVIA 1BQGA 3MZNA 3BSMA 5J04A 4DN1A 3OZMA 3ZVHB 2PPGA 3VA8A 4DHGA 2GSHA 3TWAA 2PTXA 2OO6A 3CK5A 4HNCA 2DW7A 2QVHA 3TOYA 2OVLA 2PTYA 3VC5A 3Q4DA 1NU5A 2O56A 2AL2A 2FYMA 2OG9A 2GL5A 3R1ZA 2GGHA 3MKCA 4KT2A 3GY1A 5FJTA 1L8PA 3DEQA 4IL2A 2CHRA 2NQLA 3B97A 3SN0A 3OZYA 3T6CA 2HXUA 3S5SA 2GGEA 3MUCA 3DDMA 3T9PA 3SBFA 1E9IA 4M6UA 3TCSA 3FXGA 4K1WA 2QQ6A 3V5CA 1RVKA 1FHVA 3UGVA 3T8QA 3PWIA 4E4FA 2RDXA 3EEZA 3UJSA 1SJAA 3DFHA 4EWJA 3Q45A 4KWSA 3SQSA 4MKSA 3UJ2A 3SN1A 3PK7A 1BKHA 2OPJA 4HYRA 3CB3A 3VCNA 3SSZA 2ZADA 3DIPA 3DG7A 4H1ZA 4DX3A 4GISA 1P43A
chains in the Genus database with same CATH superfamily
4ECLA 4EX4A 3FDGA 4HMNA 1FDYA 1KRAC 5C9WA 1XPYA 3CS2A 3DERA 4FX9A 3EUB3 4XBJA 4DYKA 2V5BA 4XVDA 3W74A 1PCWA 5F2IA 1A5BA 2V9DA 1ZLPA 1DWAM 3IARA 2WC4A 1S1PA 3C6CA 4QG8A 1K1DA 4F0HA 2QDDA 4GNVA 4E4PA 1PUDA 1TIWA 5EMLA 1HFBA 1GOXA 3GC2A 4FF7A 2WSKA 4L1GA 1ZAJA 3UNTA 3VNJA 1B5TA 3S5NA 3EWWA 3BV4A 2YCLB 1PB0A 1SZGA 1U5JA 4HPJA 1CX9A 2HQMA 1S5MA 3MUZ1 3E6EA 4C7FA 5FSEC 3PNUA 4ZOAA 2WVSA 2HNHA 3W82A 2C1HA 4MG4A 1A80A 2F9RA 3SURA 4P2VA 3CT2A 4LNCA 2WWDA 5E9XA 3GK0A 2PRLA 2C8NA 1OFQA 3MP5A 5HANA 5KSWA 1W54A 2ZZBA 4AD4A 1TVPA 1QI2A 1YLVA 4FLSA 4IH3A 3SRKA 3UZXA 3G1SA 1NAL1 5D9PA 3SJ3A 2O4MA 1FH7A 2BP1A 3T42A 1E1CA 1AH4A 4KEMA 1QT1A 3N4AA 2GJPA 3N14A 4NI8A 4IMAA 5CZJA 2MNRA 3WQVA 1D7YA 1V6WA 2EPMX 4W8LA 4LOCA 6TAAA 1WYGA 2QULA 3TN6A 4FLOA 5BU6A 3R89A 2QUUA 4HTYA 2NVKX 2VI0A 4A3HA 1C3FA 4JAWA 2GUYA 3BQ5A 3AJXA 2O9RA 2GFTA 4G2DA 4Z1YA 2WBGA 4LAUA 3OGRA 3SCRA 3PTQA 3TW6A 1KTCA 4HSNA 4H7ZA 3P93A 3IUHA 5I3IA 4H9MA 3SGUA 2J78A 2CBIA 2JIWA 4H9XA 4E2VA 2CLMA 5E1QA 1W56A 5GNZA 1XP3A 3S2NA 2I5QA 4JXCA 2NVCA 3CEPA 3NWRA 4MJMA 2BY3A 2D20A 1DKWA 4I90A 5LKYA 3N04A 4XSMA 3N18A 3MA8A 3O6AA 3VD4A 1T40A 2AAQA 3QN3A 2UZ9A 1PEZA 4CD5A 1FRBA 4DJDD 1FWSA 4IGSA 2QEZA 2WOWA 3KBJA 1XBVA 5D03A 1TQJA 4Y7EA 3VFCA 5AVNA 1S2CA 1EDGA 3S9IA 4PEKA 4PL2A 2WSPA 3PUEA 3VTRA 4KPLA 4OU1A 1N7KA 5AYZA 3UZ5A 5JCIA 1TB3A 1FDZA 4QP0A 5D2WA 5AZ1A 2ZUSA 1H09A 2EJ1A 4U4MA 4EAYA 1MXSA 3NZ1A 2FLIA 1O7AA 1QNVA 1VFUA 1A5AA 2DT3A 1F8MA 2J75A 3S5OA 1DQXA 1JRPA 1TV3A 3UD6A 4LIIA 3ARWA 4HGXA 5ABEA 3KDOA 5F4SA 4DAFA 4ZQRA 4JBRA 4GQQA 4JTQA 2IKJA 3AICA 5LA0A 1X8FA 3PBUA 2PTDA 4DB7A 4M80A 3I4EA 4GKLA 1ISVA 4GABA 3Q37A 4HP5A 1VB9A 1QW8A 4LC8A 4TX6A 3ZJ8A 4ICMA 1UB3A 3WF0A 3F5KA 3LTSA 2GK1B 4RW5A 1O95A 4H9UA 1KFBA 3T0AA 1JDAA 1P0BA 1KFKA 1GCYA 4WD0A 4ADUA 2EAWA 1MUMA 2CLEA 2ZZ7A 3E2QA 1DQUA 1QHZA 5BXSA 1QK0A 7XIMA 4IMEA 4PRRA 3R0UA 2R94A 2G41A 1VJIA 1JULA 4MOZA 3GQYA 1KNWA 3MO7A 5F2MA 3TYEA 1BPLB 4GCAA 2E9LA 1T7LA 1XW8A 3SCPA 4ATLA 4BZYA 3GYEA 3V0UA 1XRVA 3VNKA 2W92A 3WL1A 2Z7KA 2E6DA 2HNEA 5HQMA 2FTYA 1FUYA 3S1XA 3A24A 1L0PA 3MHFA 5J04A 1DWFM 1UASA 1YPFA 2EPNA 5TF0A 3UPWA 1PZ0A 1V6VA 4H4QA 1TX0A 1TTQA 4OT7A 3QGVA 3SGZA 2J8TA 2AQWA 3EMQA 1V4YA 5ECUA 4CD6A 4UTIA 3R8RA 3LZ5A 1Y8BA 4IQLA 3TTYA 4A8RA 1NU5A 4P5UA 1KV8A 2DSWA 3N2XA 1XIMA 1JJKA 3AO0A 1RBOB 3A7RA 2V67A 2GPTA 3FSUA 5CPQA 4PMYA 5B7ZA 2JALA 1ZCCA 3VX0A 5DMNA 2HXUA 3K46A 5CG0A 3KEHA 2GGEA 1TUXA 3PN8A 1BZLA 3UPMA 4HA1A 1O5QA 1E4NA 2VC5A 4LVDA 1M7XA 1W9DM 2GJLA 2ZRZA 1E9IA 1V77A 3UWZA 3XIMA 1HG3A 1HGWA 3N25A 1F74A 1DHPA 1RQHA 3HG5A 1E40A 1OCBA 9XIAA 4DBSA 4PCTA 3LYEA 4NUWA 1XDJA 1QI3A 1XYMA 3C52A 3ABXA 3THCA 1W9VA 5LNRA 2I1OA 1BWLA 2VR2A 3SQSA 4MKSA 4MWAE 4DNAA 1V08A 4JZ5A 3NM1A 5G2IA 3MS8A 3TUUA 3WUEA 3KOFA 3FY1A 2ZADA 3E9AA 5KITA 1S5NA 3G0UA 3EKZA 4H1ZA 4PN2A 2HBXA 2QXWA 2E40A 1NY1A 2VP8A 3OZPA 3CHFA 3NZGA 3LQLA 3UJEA 1EIXA 1TA3B 3CYJA 1EXBA 3ZJ7A 4H83A 3WFLA 3WMSA 2KX9A 3VDHA 4XAPA 3IRSA 3GD3A 4O1FA 4AIOA 4HA4A 1ELSA 3V18A 4B91A 5A8GA 2CCRA 1F05A 4JHMA 2ZZ1A 1KTNA 3QLLA 1VFLA 2VZUA 2H3DA 3VNDA 1EA0A 3FDKA 2VD8A 3LBMA 3DUGA 2QUMA 4HB7A 1IT0A 2FHFA 3ONCA 4B5SA 3FG2P 1UC5A 5MHBA 2GQWA 4WGHA 4UOQA 5CZTA 1FCBA 5H6HA 2ZVIA 4KS0A 1F6PA 4O16A 1LUCB 1RD5A 1EDQA 4HSHA 2VUYA 3S2MA 4ML4A 3W25A 4BI5A 1GRAA 3RCYA 3Q65A 2WXDM 1P0DA 1TWSA 3D3FA 1H0IA 1QHPA 3U4FA 4H4UA 5LNSA 4N0RA 3UWUA 1GPWA 3EKLA 1DJQA 3LUTA 1P48A 3PUGA 4R88A 3TU9A 1P6BA 1WZKA 4BV6A 3N4EA 4UFMA 4LANA 5HJLA 1TPH1 1JNDA 1TWZA 1JCNA 1Q6OA 2QPXA 4OBSA 1V8EA 2A4AA 3S5YA 3GXDA 4RZ6A 4Y9OA 1EF2A 3WLSA 5TQLA 2J7DA 4U3CA 1GHRA 5J5RA 1S7MA 3PBWA 4LYRA 1LZOA 3TZNA 3RLVA 2PC4A 3L5AA 1ZBCA 2JK2A 1DJYA 1R7OA 1JCJA 2V5JA 3SN4A 4IGMA 1FWTA 1KCZA 3NVWB 1FXQA 3HW2A 3AIRA 2OSWA 1T8QA 3LCGA 1UC4A 1CYGA 1CW2A 4H6QA 3H2CA 3VIPA 5EBKA 2YLLA 3A21A 3UETA 4GUGA 2HZGA 3GZ3A 4M24A 2J7CA 4HPNA 2TODA 3B8DA 5KMYA 2E6FA 3BDKA 2G4JA 3ARSA 3TYBA 2V6AA 5T91A 1FVPA 1PIFA 1W17A 5CSRA 2VQUA 4JEQA 3QYSA 4ZO6A 4V1XA 4QDMA 4QIUA 3TQPA 1Y5VA 1E1EA 1EWEA 1UWSA 2FVMA 1EC8A 2OYLA 3LN3A 1AJ0A 1EJSC 3HA1A 3N3MA 2X50A 2BBFA 5L9FA 5EU9A 1E9LA 2QCMA 1HP5A 1GZGA 2ZX9A 3K5XA 3GLCA 4F0RA 4PMVA 2OEMA 4L7ZA 1CNVA 2D0FA 2XG9A 5HMEA 1FWNA 2B7PA 3AC0A 3GZAA 3HPFA 1SJBA 1PIIA 3P0WA 1A0EA 3M6YA 3BLDA 3WK0A 2EGZA 1XG3A 4A21A 1KXHA 4HJFA 1E0WA 4O54A 2Y89A 1XI3A 3PZTA 3T08A 2QYGA 2P1FA 2VGFA 4KCWA 1LRQA 3Q6JA 1TV7A 1ZAIA 4JIRA 2E8ZA 1JZ3A 1YDOA 1UIOA 4RE4A 3H7VA 4WY0A 5I6SA 1JL8A 4MVAA 3WUGA 3GFYA 4HJWA 1KGUA 1T41A 4S3GA 1R38A 5JH2A 1K4QA 5HA7A 4DQWA 4KGJA 3QSTA 1ML1A 1L2UA 3H4KA 4M56A 2A7PA 3QV8A 3M41A 1XJBA 4F40A 3KBNA 1SO6A 2PDHA 1AUSL 1PBGA 1LWIA 3ISIX 2ZDSA 4Q8PA 2XFYA 2IUZA 2FIQA 5A2BA 1IIGA 4J3VA 5I06A 3U2CA 3QFAA 1EOKA 2VWSA 2PDXA 4JTLA 1RCOB 1FBAA 2DT1A 3POCA 1IGSA 1IF2A 4V27A 1BRLA 1A49A 4PMUA 4O0QA 4UC5A 3G6MA 2PDPA 1JDCA 3CGCA 3PZOA 4OV4A 3UYCA 3CV2A 2VCBA 1MZRA 2VMFA 4WOZA 5K7JA 4ZOBA 4FLRA 5CZ0A 3CMGA 2OX1A 4TUFA 3S2CA 1OGSA 3E74A 1BSLA 3ZZ1A 3NQBA 4L4OA 4ZB0A 3L7RA 1OX4B 3P82A 5I07A 1JZ2A 4RDYA 2HSAA 3LBCA 3CU2A 4TO8A 4OV9A 3VGGA 3W1AA 2BOGX 5HR6A 4NJIA 1J10A 1SVDA 2VR5A 1R3TA 2GGHA 4JQ2A 1E9ZB 1T6MA 5JRBA 3W02A 3S0CA 3W1NA 2QNEA 2I57A 4PMQA 1TTIA 1M6IA 4CNSA 2G37A 2Z1KA 5D9OA 4KEUA 3S5SA 4ZO8A 3GG8A 1VZWA 4W5ZA 2WC3A 4M52A 3ABQA 3T07A 3AS2A 4CCEA 2P76A 3CWHA 1W3KA 1GVOA 2W91A 3EAUA 2ZE3A 1SZRA 1N55A 3VOJA 5BRPA 2ZXBA 2DP3A 1SSDA 3QFBA 1U1UA 3K8MA 1S3HA 1BF2A 4AEEA 2PD5A 4IFKB 4DWSC 4JTJA 1Q8JA 1OF6A 3Q45A 2VEPA 4IP7A 4WVXA 1A5UA 3M4HA 3GDLA 2V2DA 4IIHA 3QJAA 4AD5A 1S5WA 4Q8NA 1Q7MA 4MM1A 4IUOA 1VF8A 1CXEA 2Y8UA 2CNCA 3R11A 3ID7A 1FWWA 3BH4A 3W1UA 4I7UA 4OUIA 3FSTA 4F9JA 4XZBA 1A0DA 1JVNA 3LQGA 1LBMA 3I7RA 5EMJA 1ME7A 3UNDA 3WDRA 4CNPA 1GG0A 4EANA 1C9DA 2BVDA 2GH5A 2G50A 4IMCA 5LA2A 4LAZA 1MFVA 2O7QA 1HL2A 1N82A 4W7VA 5U25A 1AK5A 1TPB1 1LRTA 2H6RA 4ERAA 1WA3A 4X3ZA 4K38A 3QW4B 4GHRA 4XK2A 1AG1O 1RZMA 1EC9A 2GQAA 1JEZA 1PDZA 1V7YA 2OJPA 2DEPA 4BQ5A 3EDJA 3QM3A 1K03A 2EF9A 3TW9A 2CZEA 2A3LA 2CZDA 3CV7A 2FPVA 4IIFA 1W91A 3FHQA 4US5D 4H6KA 3DC8A 2WC7A 1WOBA 1AJZA 4AX6A 4FX8A 2WVVB 3PZNA 2PDBA 2OEJA 4C6FA 5FF0A 3PZQA 3FAXA 4BWLA 3NM3A 2PGEA 4P8WA 3H7UA 3CTLA 5CPNA 2UY2A 5CBIA 2B7NA 1XD1A 2NUWA 5ABTA 2QIIA 2RGLA 1PTAA 3HGRA 3B03A 1KTBA 3A3WA 4UWMA 5C9RA 1YHTA 1ONRA 5KINA 3EMCA 1S2UA 3BJTA 3NQMA 1CXKA 3DENA 3TMLA 3SECA 1EGMA 4UMBA 3D6NA 2BC0A 1VBJA 4GYPC 3SM0A 2V30A 3W7GA 1PPIA 2WZHA 1EYEA 1LRNA 3BQ6A 3SCVA 4Y2WA 2X8CA 1B0IA 2RAGA 3PBGA 2FTWA 4QS5A 1M3UA 4F8XA 2BV9A 5J8LA 1K02A 2C13A 4DVOA 4PBEA 1FWGC 4AMCA 2V0TA 3K4DA 1DE5A 1NARA 1XHCA 2VKZG 5GPRA 2WCAA 3VMPA 2PDIA 2G3NA 4B9ZA 3HM7A 1HUVA 1P6CA 4FOJA 1T3QC 1HO4A 1AFSA 1FWAC 2VFIA 1NFBA 3PB2A 5DANA 4K1GA 3IPWA 4WKFA 1W3TA 2YXGA 1ZX9A 2A7NA 3KDNA 2D69A 2X8GA 5H8PA 1POKA 5K3VA 1EDTA 4AWEA 4YL2A 4L1XA 3NUKA 3PBVA 3ARVA 2CLIA 3MWAA 2W9MA 3GXTA 4O8AA 3C0JA 1UA3A 3G1FA 5D09A 4UTFA 3T09A 4MB1A 1Y5WA 1XFCA 1HJUA 4PYSA 2J7BA 1W1YA 3EGJA 2BGSA 3VGDA 4V2XA 4MB4A 3RRAA 3B9JB 3ONBA 3I3DA 3MSDA 3W7HA 4TV6A 3O1NA 2ZWZA 1QVBA 3WQEA 3B0YA 4NHVA 3N3TA 1A5KC 3GXPA 3KCJA 1GOQA 4IIDA 3IIOA 3BVJA 1XFBA 2XUCA 1GJWA 4AHPA 2CXEA 4NP7A 4JTEA 1W1VA 1MDRA 5LHFA 2JE8A 2YZ5A 4K2SA 1D3HA 5HQLA 2NX3A 4MWAD 4AWTA 1Z8AA 2FMOA 1JUEA 4MJZA 4HCLA 2ZWYA 4GRSA 4IMGA 3EXSA 4IUGA 3DK9A 1ZCOA 3FA3A 1DIDA 4FAMA 2ZC8A 3FGCA 4JTTA 3ITXA 4XB3A 2J88A 4NZ1A 2QCCA 4LWWA 2YKKA 2AL1A 4F4RA 4JKMA 1I0DA 2D2OA 2NZLA 2YA1A 3CXBA 4YNGA 5LNVA 1EOMA 3WNKA 5AC8A 2KZHA 1UKOA 3DBPA 2NVDA 4LALA 2E8YA 2VX4A 4WCJA 2XIJA 4XZHA 3FYYA 3KX6A 2GRTA 3K13A 2DH2A 1TPEA 1EZWA 2V3BA 1RLDA 3PAJA 1SW3A 4G1NA 1QI5A 2G4FA 3DGZA 1WBJA 3BSMA 1D3GA 3OG3A 1RAKA 2FZNA 1MW1A 8XIMA 4IXHA 2OT0A 2ATMA 5DMMA 4Y9AA 5G4HC 4GE8A 4DBEA 2ESCA 4HNCA 2XIMA 4C6LA 5BROA 4DBDA 4EP8C 1AMKA 5HQEA 1EP1A 2VX7A 3DZ1A 3APGA 4FDCB 3Q4DA 4DJFA 2J3NA 1QWGA 1RJQA 3OGVA 3BCJA 4L9ZA 1ISXA 1F61A 3R1ZA 3WJZA 2AMXA 4XKYA 6PTDA 4Q4RA 3N2TA 3GB6A 2X2GA 1VYRA 3GE7A 3BG3A 5LHEA 2CLHA 1E72M 4XG1A 4ZXOA 3T8LA 1B3ZA 4AF0B 3U2ZA 5CZKA 2YVFA 1GEHA 2RHGA 2V5CA 3WZ0E 4FNTA 3FHAA 1H7PA 2FDMA 1W32A 2WJDA 4C1NB 2CU0A 1ITXA 4GUIA 4ICNA 3TR9A 4GRTA 3LS9A 1Q1WA 3G5EA 4C6JA 2DT0A 1ZMDA 4P8VA 1GYNA 1BXBA 3WLNA 2ABAA 4E8CA 1XDIA 3BUVA 3KWXA 2V3GA 3IS4A 1H51A 1W1A1 2PDKA 2J7EA 2QHAA 3O07A 4GPNA 1K7XA 3CUJA 3PG9A 3OHIA 1XLJA 4DJEC 3CB3A 3UESA 3II1A 3QOKA 3CUXA 2VDHA 1I75A 2W67A 1Q66A 4GX8A 3B0UX 3ERPA 2CFFA 3GNDA 3CUFA 3HMCA 3CL8A 1GONA 5BYWA 1J5SA 1ZJBA 1DPMA 1HTIA 1P0KA 1IR1A 3QH2A 3NL3A 3W1LA 3UFYA 3DX5A 4ADWA 3CZGA 4AZCB 4N6EA 4M82A 1DVJA 1XLLA 3ZM8A 5CXPA 1QO2A 1VKFA 1OZMA 3W7IA 4NAEB 2PUZA 1W3LA 5F2LA 2QT3A 3S9ZA 1H3GA 3QFWA 1BAGA 1TPUA 1US3A 1I60A 3AZSA 3URNA 2V2CA 5DY3A 4IG2A 1XLGA 4PUNA 1J5TA 3VFLA 4QAWA 3CQJA 3USBA 3N73A 4H9VA 5CBBA 1H7NA 2NV9A 4JIIX 3B9AA 3ZR5A 3TJIA 2WNQA 4HHPA 3QR0A 2RJHA 2VTFA 4XVEA 4WDTA 3TOPA 1F8IA 4YN5A 4RNJA 4IFRA 3VM5A 2VR4A 4M7TA 3T44A 1MWOA 2F6XA 4J40A 4XD5A 1H6VA 1IWBA 2Z2AA 3GR8A 4RNIA 4M0XA 1K8CA 4R34A 4YTSA 2YCEA 4WZHA 1UOKA 3JZUA 1FKXA 2PMQA 2VYOA 4ATDA 1GSNA 4A8LA 2ZA3A 1G69A 1BEUA 1W5MA 2CPUA 3HFTA 1LOSA 1WXZA 3I68A 1KCLA 3MT1A 2QUVA 3QV7A 3MC5A 3NOEA 2AGTA 1I6NA 1MO9A 4S3BA 3CASA 3A4JA 2PLJA 5TNVA 1JFHA 2PDYA 4DWSB 4XBSA 3U4AA 2PRMA 2W27A 1UH4A 1GVYA 3D0CA 4A3QA 1BQCA 3N1AA 3UXIA 2YOCA 1GG1A 3CWNA 2H8XA 3B3DA 2FKPA 3B40A 1J12A 3EOLA 2VVNA 3JUGA 4OZOA 4C5ZA 2A2IA 3A9IA 4EACA 3B9EA 2L5HA 1JGIA 5ABHA 1ZY8A 1J2WA 1VPYA 2GQ9A 3WD2A 4Z2IA 1ZENA 3PTKA 1STZA 4G9PA 2OU4A 5HR7A 3GDTA 1VFSA 3CV1A 2BSLA 1TJ2A 3EX6A 4C6CA 1RP9A 1C8YA 4NG3A 1R85A 4I9MA 3TSDA 4W87A 1YEYA 3WQDA 2G96A 3NO5A 2I7GA 2HS8A 1S39A 1XBXA 3AMKA 3QC3A 4L4PA 4AU0A 3R79A 1YTEA 2OQLA 4LUYA 5AYXA 1NQ6A 6XIMA 5I2UA 4EM4A 4PTNA 4KESA 3U5YA 2HE5A 3AXHA 3NIYA 3ABRA 5CPSA 2V8ZA 4JTDA 1GOMA 1BLIA 3MZ2A 3EPOA 1AW1A 5G1TA 4MZYA 3GUWA 1F9CA 3COTA 3PPFA 2WMJA 1LLWA 3TLQA 5BXTA 1RR2A 4M5PA 1OX6A 3CPRA 3KVLA 5L6UA 2DZVA 2PA6A 3GC4A 5FAGA 1V0LA 2F2KA 4Q8VA 3UVAA 2Y4SA 3UR7A 1XIJA 5BZAA 1J0ZA 3LXBA 2EBNA 2BODX 1TMQA 3QKEA 1HO1A 1TV8A 4FP1A 3O6YX 3GG1A 4RZBA 2CLFA 4JTIA 3QKZA 4DZHA 2Y62A 4GQ0A 3AIQA 4PMRA 3QTPA 1R47A 2BG5A 1K3UA 2PE4A 4XISA 4GINA 3IIPA 4HCDA 2INFA 4Y9NA 2VFGA 3EB2A 1OJXA 3DOPA 2CBVA 5C0QA 4IPIA 4NNBA 1GQJA 3T0BA 2DSKA 3D9XA 1J0JA 1OVDA 1JD7A 1I8JA 3MWCA 3UG3A 1VFFA 1K70A 3MW7A 4NT0A 4BURA 2W63A 3S2JA 4NX0A 1K9FA 3NZQA 4FOUA 1WDWA 3ZS4A 4XD6A 1SMDA 1EPXA 1JCLA 2Z6JA 3T7VA 1R2RA 4Q32A 4DWDA 1Q5MA 1B90A 3VM7A 1ITUA 1HKJA 2JKAA 3XISA 4JQ4A 4N02A 3AIUA 4Z1BA 2B7OA 3HV9A 2GR3A 1CPUA 3LPPA 2FB2A 3R12A 3FA5A 1GT8A 1A0CA 1TR9A 1J2BA 1QPRA 4PCFA 4AC1X 3WD1A 3RMEA 1S2TA 3VA8A 2CXGA 5AHNA 4WDXA 1VIZA 1VQTA 2O9PA 3W7MA 1U83A 5G4EA 1G7VA 1SO3A 3LNPA 2CERA 4ZQNA 1EEXA 3OVPA 1I2OA 4OOZA 1I2QA 3FEMA 2ALDA 1OZQA 8XIAA 4DAIA 2BTMA 1GOOA 1R3YA 3CUHA 4OFCA 3P60A 4GYJA 1C93A 1HVXA 7CGTA 2XWDA 3NVDA 2OSXA 3BXWA 3M44A 1OINA 1GVFA 4UZUA 4UFKA 1A4MA 3MBDA 1K9DA 1J0KA 3W4RA 3DFOA 1W3JA 4CU6A 1V3KA 2PLKA 3MPGA 3UA4A 4BF5A 3WQFA 2VWTA 4A2RA 1A5LC 4FB7A 3G1RA 3UR5A 1LQAA 3EOEA 2X1TA 3ARYA 1VQZA 1TG7A 6REQB 4KWWA 4PMXA 1RVKA 3WLPA 3ZJ6A 3GU9A 4JQAA 3KRUA 3M0ZA 3NDZA 4H7VA 3UJSA 4NQ1A 2ZOXA 1KGWA 3S4TA 4MY1A 3EX3A 4ZE5A 3TSBA 3WH6A 3BMXA 3M46A 3AXKA 4HYVA 3DG7A 1BF6A 2Z1BA 1I2PA 2YCKX 1C8VA 5CC6A 3PJTA 3F2BA 3B9DA 2DIEA 3N6QA 3AJ7A 3Q58A 5A6MA 4RPQA 2BWGA 3AUOA 5C2GA 2VENA 3W1XA 4LQ1A 2NUXA 5I0DA 3T2OA 2D23A 4C6IA 1QDSA 3C0SA 1J6OA 4YHGA 3NEVA 4O28A 3RO6A 1E51A 5BXPA 5DELA 4L61A 1NIUA 4FR6A 5FL0A 4ZTYA 1VC4A 1M5WA 3SCWA 5FI8A 2WSQA 2D2JA 3WH8A 1EHNA 3UXLA 1N60C 1SU5A 4LV4A 3R2GA 4DYJA 5AC7A 3UG8A 4V15A 1JI2A 1N8IA 1H1YA 3VNIA 1ECQA 3ITVA 5C2CA 3HV8A 4PMDA 2YCJA 1GTEA 2X0HA 2YB1A 1RV8A 1OYCA 1HGYA 4IQEA 1AQFA 3A7AA 3NL6A 4CU8A 3LRKA 4X63A 3W1PA 2HBVA 4WSJA 5G2WA 3G24A 2YIHA 3DHFA 4FSAA 2Z2UA 4OTKA 4FNSA 4F2UA 1BWVA 3APTA 2QW5A 4XIMA 3W73A 4MB5A 1Q6CA 2E3TA 4FF5A 1V3MA 1FWDC 4QM1A 1FWFC 3K8LA 2BGNE 3W9ZA 1F6KA 3QGKC 3B04A 3ZMRA 1GUVA 1VIWA 2OOGA 1XLAA 1OB0A 3GSMA 1XC4A 2Y7EA 4S3FA 4H2HA 2YX0A 1FH8A 4UFHA 2OKOA 3IVUA 3OZOA 4K8DA 4GBUA 4LY8A 3KLJA 1B4KA 4MF4A 2XVGA 1GORA 1TE6A 3PNZA 1FP8A 2EQ7A 4PUMA 4QTGA 2QIWA 2TPSA 1EJUC 1WXYA 3PB0A 1P4CA 3WJYA 3NAVA 1FWEC 1FXPA 3WNNA 3VINA 1TZ7A 2HVMA 1R3VA 3DESA 1I1WA 3NPVA 3BG5A 5F1UA 2POTA 4MB3A 4Q7NA 4CD4A 1KBJA 3BG9A 1KBIA 3H2MA 3KBSA 4GUFA 4TV5A 4AB4A 3WQOA 4KF1A 1G5AA 2O55A 3KOZA 4B3ZA 4N9BA 3W83A 1KFJA 3EWXA 3SSJA 5B80A 3MSRA 3BCFA 4L64A 3R8GA 3CQHA 3NVTA 2VURA 3DGBA 3D47A 1REQA 3OYZA 1FECA 1ZTVA 4ZENA 1ZPTA 2VOTA 3CGEA 3PG8A 4MJ4A 4QISA 3H2FA 3RFAA 2QKFA 1P6WA 3D46A 1FWIC 4GI4A 3T0CA 1SZEA 1BG9A 5EFFA 1G7UA 3EEGA 2WQDA 3UA3A 5BOFA 4XO7A 3TN4A 1AQHA 1P1MA 4DF1A 4MPKA 2D3NA 1Q63A 1X6LA 3HQPA 1WKDA 1E0XA 1G94A 1S1RA 1YDYA 5D05A 1MEWA 2XGBA 1UWUA 1XIEA 5I3HA 3PTDA 2ZE0A 1W3IA 4KEVA 5E70A 3SDOA 4NSBA 4KRZA 5HXMA 1GYMA 4GJ1A 3MI2A 1PX4A 3GAKA 4S3DA 4E5TA 4JD4A 5GNXA 2PI6A 1JZ8A 4O4VA 5CAHA 3ARQA 1BGAA 1TO3A 1LPFA 4M7SA 3DFSA 2POZA 3KLKA 1ZAHA 1QOPA 3ARPA 4YWSA 4ADSA 3DG3A 4YS1A 1PAMA 4HU8A 3KLLA 4L9XA 5C71A 3U2EA 4ZQOA 3F4DA 4DELA 1IEXA 2P88A 5BMXA 3RN6A 4TR9A 2VFFA 1Q6EA 1W9UA 4PUDA 4XV0A 3QGAC 3GRSA 1YADA 3VIGA 3WMBA 4TX9A 3CZKA 2GVLA 3G0XA 4EQWA 4H4VA 4FNQA 2WP6A 2YCIX 1ODUA 4KBXA 4S2BA 3S83A 5A6BA 4UB9A 1PXGA 3OA3A 2WBKA 3CMJA 1RY0A 1CTNA 3FJNA 3GFXA 5E09A 1KM1A 1U2YA 1UUMA 4B90A 4R7JA 3L23A 3WNPA 1TYGA 1W0MA 3G77A 2YVJA 5CEWA 1LORA 1A3XA 3LOTA 2GSHA 3NCOA 2PBGA 3EAOA 1V0KA 3O0FA 1KM5A 1W3NA 5A94A 1C7SA 5H8MA 1MUWA 3U0HA 3P62A 4UOJA 4YU1A 2ZZ4A 4H3DA 3GIYA 2C6QA 2FYMA 3U57A 3EF6A 2VO5A 3CZ8A 3GR7A 4W5UA 1S5VA 3KTCA 3OVRA 1UBSA 4F2BA 1JEHA 1TQXA 1E4LA 3M0KA 3RPMA 4HA3A 5D2XA 1Q1RA 3B97A 3HURA 4K68A 5A8OA 1M7PA 1WCGA 2C0HA 3TIMA 2ACRA 4CKQA 3WLMA 1CGTA 5D2YA 2PD9A 1GW9A 1VP5A 3TJXA 1G4TA 3HG2A 4GVGA 4RDWA 1Z7AA 2Y0FA 1OBAA 2C18A 2W61A 2G3JA 4NJHA 3UGVA 1M1BA 5G1YA 4WLCA 4E4FA 4NAFA 5H91A 3TVAA 4ZB5A 2CW6A 5FA5A 9XIMA 5BU9A 3EOSA 3IVSA 1ZUAX 1XYFA 2JKEA 3I6RA 2F6KA 4S3JA 3TKFA 3RRXA 2XDFA 3WUFA 1R86A 1TPDA 2W5FA 4CVWA 4LU0A 3WD3A 4DZAA 1W1PA 2G3FA 1B9ZA 1SW7A 3W7QA 1U22A 1FWRA 2J62A 1DXEA 1E1FA 3NVYB 4M6PA 1KC7A 1XIDA 3WK2A 3RPDA 3FJ6A 3UZYA 3UR2A 1E71M 2VEIA 1YKWA 3RX2A 1JAKA 4ACZA 1MQRA 1G6CA 4LFYA 4S2CA 3LENA 1EQPA 3ZOAA 7REQB 4M19A 1DBTA 4Q6XA 2X40A 4PTMA 3SUSA 3GXMA 3NQGA 5A95A 4LH8A 4NZ3A 5CSUA 1LP6A 2V82A 4AG0A 1PKNA 3PZIA 4XZWA 5T8GA 2C91A 1TPVA 4Y6GA 4XIAA 3ABSA 5I09A 3MUIA 3PFMA 3PPHA 3EX2A 4WKHA 3VOCA 1QWKA 1TIMA 1XDMA 2YDSA 4GCXA 2DIKA 2WHKA 5HJYA 2XSAA 3L4XA 1MZHA 5E0FA 1MRAA 3S47A 3VOHA 2JQXA 3M5XA 3HRDC 1GEUA 1IYXA 2WZIA 1IZKA 1Z48A 3FIGA 4NIRA 3ZWSA 2PDUA 3VD7A 2PAJA 2PLCA 3MP4A 1EBHA 3GH7A 3VZZA 3E0FA 3VX1A 3B8UA 4UFJA 1DTNA 4O4WA 4I5RA 2BGQA 4O17A 4E4UA 1CXIA 3QZAA 3M47A 3V3WA 5A2AA 3BSHA 3UJRA 3HG3A 2V3EA 1CGXA 3FN9A 1NDVA 1XF0A 1XPGA 2PP1A 3WN6A 4X2PA 3N13A 1XLKA 1VCGA 2VEFA 3KBVA 4GLEA 4Q8WA 2PODA 5DT5A 1E4IA 4AX7A 3LXAA 3GDKA 4FX6M 4B5XA 1C8QA 1QHOA 1UD8A 1AZ2A 2BHUA 3U5UA 4CQBA 5LIKX 2ZZ3A 3BLKA 4ZZ9A 4I5XA 2OZTA 2R1LA 4H8VA 2VEKA 3QY7A 2J25A 3L4UA 3SY5A 4AFYA 1KV5A 3IJQA 2WM0A 3WBAA 3AZRA 3RCNA 3L0KA 2NX1A 4NJKA 4MADA 2WPGA 1OD8A 1US2A 3T78A 3PJXA 3I3BA 4REQA 5M03A 1OIMA 3N6HA 3LGEA 1ZB5A 4GIAA 3WDHA 5DF0A 3I3EA 1X7IA 4LS0A 3UYIA 1DWGM 3GIPA 3BAKA 2HTMA 2E0PA 4TVWA 1W6TA 3QVQA 4CUCA 4J27A 1UZ1A 4QE1A 2ZXDA 4CCZA 4JCLA 1QNSA 5EKYA 2ISDA 4GX9A 5E0KA 3URBA 4PUJA 3PUOA 2D0HA 3A4AA 4A29A 3MO4A 3OGSA 1UKQA 2OLSA 3L21A 1KB3A 4A3YA 4EWND 4MKVA 4MNJA 4DM2A 2V5LA 3IIZA 3SIZA 5FL1A 3OP2A 4BJHA 1UH2A 2GGJA 3SUTA 1WE5A 3TQVA 4X22A 1H7WA 3HTWA 2DVXA 1OFRA 2ZYFA 1TJ0A 1GQNA 3RU6A 3RJYA 4XD3A 2R9RA 3ZQ9A 4BI7A 5CC3A 1NFGA 3OU8A 1UP2A 3AXXA 5A5WA 2VGIA 3A9BA 4X0VA 2CWNA 4GYFA 1XV8A 4QLJA 1XL9A 1J9YA 4IJBA 4JFVA 4PUUA 3REQB 1Y65A 4UTUA 2VVSA 5A1AA 5LYRA 2W55A 5CJ5A 1PX3A 3HU7A 1EYWA 1UQYA 1DNCA 3GNRA 1EO5A 1QNQA 4D2JA 3LHUA 2IW0A 3GW0A 2V81A 4DBWA 1R3QA 2JGYA 1ZALA 1PSCA 4IQDA 3WQWA 3IAPA 2DZPA 2WHJA 1FHUA 2Y7GA 1L9WA 2WHMA 4H4ZA 3HQNA 2WZMA 1TKKA 2QUNA 4ORMA 5T26A 1RM6B 1DHKA 2BOFX 4Q8OA 4ICCX 1EFZA 3DYOA 1ALDA 1POJA 3RU8X 3LCHA 1AW5A 3GIQA 4TVDA 5MKGA 1E5NA 1J79A 2VFHA 4W88A 3CHVA 1JNEA 2I9UA 5M5DA 4O1AA 5C9XA 3U3HA 2C3ZA 3ZVIA 4B16A 3S9YA 2E9MA 3HFYA 3MBFA 2CLKA 2YAUA 3UY8A 1KFEA 2B81A 3WJXA 5IHRA 5C6MA 1YMYA 2GUBA 5A8QA 1OYBA 3DI0A 3TWAA 4NKCA 2OO6A 4O18A 4U3AA 2Y85A 2QVHA 4NU7A 3WENA 3GRIA 3WLHA 3TN5A 3VC5A 1IT8A 3P7YA 3AHTA 1H0GA 5D2TA 2ZUUA 5AC6A 1Y7VA 3S42A 4CGTA 9RUBA 1I9CB 1HKKA 2E3ZA 1UWIA 3A6OA 3W6LA 1YTKA 4INFA 1L6YA 3AYTA 5G1MA 2QCLA 2KAUC 1OABA 5CBJA 1VFTA 2WV8A 3VGHA 4BEUA 3TTSA 2BNJA 3CYVA 5C9ZA 2J4GA 4EKJA 2WP5A 1UPPA 2QPSA 3NGFA 3NVVB 3OQEA 2ZFAA 1JIBA 5AOUA 3RF9A 5I02A 1B4EA 4GH3A 4O8RA 4JGDA 1KGXA 5BMWA 2TYSA 1QR7A 3WMLA 1GV4A 1QNOA 1Q13A 3W2KA 4A4AA 2I14A 5I78A 4LVFA 4JS3A 4MFEA 4RNFA 2A1YA 3FNDA 3SFWA 4AY1A 5DBTA 2PURA 2R1MA 4HNNA 4IX2A 3WH5A 3W7CA 3DKJA 2HROA 3A5FA 4GR1A 2UY5A 4QS6A 2I56A 3LNMA 1XKYA 2W6RA 3KHDA 1FFVC 5H2ZA 1ZGDA 2J24A 5JCMA 2NVAA 4XTIA 3LB0A 3TW7A 2GOKA 3EXRA 2R1KA 2DY3A 2XM1A 1WDRA 5IHSA 1JUKA 4AVNA 1UR9A 3RNMA 3V0TA 5FS9A 2J47A 1LVLA 3E96A 4D6DA 4H2CA 1ONXA 4ZQMA 1O4UA 3PZVA 2WJFA 1NDAA 4N4PA 2JF6A 1H5VA 4HK7A 4IZGA 4Z0JA 2YA2A 3LXCA 1X1ZA 2J6VA 2OZ3A 3UJFA 2GR1A 2ICSA 4KKXA 5FSDC 4F0KA 1H5YA 3O0HA 3QQ1A 2J77A 1S5TA 1IEVA 1N62C 1FWBC 4QG9A 2AL2B 4FNUA 1LCOA 1QASA 1Z41A 3RYSA 2BY1A 1X6NA 3T1GA 3URAA 2P8CA 1KR0A 3U7VA 3WX7A 5T9CE 3AN1A 2A79A 2OMAA 4J3ZA 2VRQA 3UZZA 4YTUA 1H63A 3B8VA 1QOQA 3Q94A 1VBRA 2FPTA 2GYIA 4W9TA 3W26A 1VRXA 3DKLA 4RPPA 3W27A 3TMQA 2ASHA 3LCFA 4JL2A 1OY0A 4PODA 1UR0A 4LEFA 1GRGA 1ZP4A 3QZ6A 3GO2A 3WLQA 3VZYA 4K8EA 3H2NA 4Q4PA 4LRSA 4NYYA 1YNQA 3KFTA 3FX4A 2Z28A 3UG5A 2XN0A 3MV11 3W1TA 2VOMA 5EGRA 1O94A 4QG6A 4JYDA 5BXRA 1V02E 3LHWA 4GZ7A 1YBQB 3KM8A 4QDPA 2WMFA 4ILSA 2XGIA 4FS9A 3UG4A 5BNKA 2YDRA 2QJJA 4NI3A 5DX7A 2OO0A 1VBGA 3CGTA 4ZVJA 4G6CA 4GIYA 1PZ1A 4YMZA 4C6OA 3C0LA 2IKIA 3EDKA 3GWQA 2Y7FA 3FYOA 1JCXA 3VE9A 4JDRA 1RJRA 4AEOA 1QBAA 3EDDA 3ZXWA 5ECVA 1GJPA 4XSLA 2EQDA 2X1IA 2CFYA 1GYLA 4AXKA 3EYPA 3RR4A 4EF8A 1GVRA 2NLIA 2NWRA 5G2HA 2YYUA 1KLZA 4S39A 2D2GA 1QFEA 1R46A 5FMHA 2SFPA 4F66A 4EMIA 4CD8A 1WZAA 1E9YB 1TELA 4PMOA 4URIA 4JIQA 3KW3A 4XAGA 4Y90A 4IISA 4I6VA 2CHOA 3OOQA 2NT1A 3WQPA 1ZBVA 3A12A 2ZTKA 5C2XA 2BHYA 3NYZA 4L56A 1XBYA 4IHCA 4Y9PA 2Y24A 3NPWA 3H23A 3GXNA 3G1HA 1MRQA 4GXWA 1CLKA 1YXDA 4O1EA 2Y8VA 5JU6A 4HYWA 4ALDA 1E1CB 5BOOA 3GDBA 4HNTA 1EJWC 4J28A 4EAMA 2DZUA 6TIMA 5LXXA 4UNIA 4JFWA 3TNOA 3I7SA 3TJLA 3R4IA 1FY6A 3M64A 3QLDA 4GJIA 2X0SA 4IP4A 1EC7A 1Q7ZA 3RM4A 1T0OA 4PA8A 1GRFA 1W9PA 4XWUA 3PS7A 3HBLA 4K7YA 3CPGA 4WKAA 3QHOA 4JFTA 1QMLA 3WIJA 2OZ0A 2ZX7A 1YBQA 2DT2A 1W8GA 3A47A 3TTEA 3LY0A 1B3WA 3CWOX 3AS0A 2BB0A 4AEFA 1A3WA 1UR2A 3AYVA 3WQCA 2AAMA 3HJEA 3OQ8A 4E6MA 1KFWA 3EDFA 2D0GA 3TYCA 2X8RA 2ZZCA 3FFSA 2QAFA 2J13A 4HKPA 1NHRA 1LG1A 1S2AA 1FCQA 4DN1A 3C56A 3OZMA 4I8YA 2PLMA 4IICA 4NZCA 5LGZA 3ITLA 3G0SA 2PDLA 2F61A 3QPYA 4HOZA 3KTXA 1Q2SA 3VOFA 1MEIA 3II4A 4PCNA 3N34A 4HU4A 2QGHA 1Q85A 4O1CA 2BY2A 1Q4WA 2P10A 4FXFA 1BXCA 1V3LA 4PUKA 4PUEA 2BFGA 3LHTA 4EPDC 1OFAA 3PZ9A 2ZIDA 3UZWA 3HN3A 2FB3A 4IQJA 2FJUB 1R87A 4NZFA 4WXZA 2WJEA 1WP6A 1Q6DA 2O4QA 2ZX6A 3QSRA 4O1BA 3CC1A 1RY8A 4R9OA 4AC7C 2IXUA 3GXFA 1JQXA 3M43A 1XUUA 2EG6A 4B15A 1J01A 3TYAA 1NP2A 3F2CA 1FIQB 4J57A 3UGRA 1CB7B 4CQ9A 1UQZA 3AYRA 3LXDA 3FXGA 3VYLA 3C61A 2FVKA 3AFBA 3A4WA 1OFEA 4LSBA 4KCTA 2QQ6A 3LM7A 2QCGA 4Q4KA 3W87A 1U5VA 4J2PA 3P81A 3M5YA 3TLLA 2DZSA 1IR2A 2D24A 4GQBA 3DFHA 2A3CA 3V35A 1B54A 3MMWA 4J7RA 2Z27A 3SN1A 3N12A 4BF9A 2EG8A 2C71A 3ITYA 4LVAA 3WDQA 1SMAA 3USZA 3L0GA 3U8GA 4F0LA 3W37A 2AGKA 4J3TA 1KBBA 4KRTA 3MHUA 1Q45A 3CGDA 3GHTA 1XIFA 3PFRA 3PZGA 1R6WA 4GJJA 3FA4A 2YW4A 3EWUA 2ON3A 3P84A 3CQIA 5AB3A 5FJUA 3AXMA 2XWEA 3QBUA 1DYSA 1EJXC 4JTSA 3RJXA 4B5WA 3SZ8A 3UEQA 5BWFA 2C3DA 4UCFA 1XLCA 1G4EA 3SRFA 1XM3A 1IXOA 3EX4A 2PWVA 3SUWA 4DNHA 1MYRA 1BWCA 3H24A 1EGVA 1UR1A 5EA9A 3IC9A 1Z42A 3QPEA 2ATSA 1W9XA 2PZNA 3CEUA 3O2LA 3VKDA 3E2VA 1K7EA 3CTTA 4G7EA 1WKFA 2E28A 3PJWA 4MDPA 3ZSTA 2PCQA 1NSJA 3ARXA 5BRBA 3O6DA 1EHAA 3M6DA 2XFRA 1Q6FA 4IP5A 4AZBA 4UTLA 1K9EA 3GFZA 3HPAA 2JFEX 1VHCA 2ZX8A 5EY5A 4Z2LA 4I9JA 3MCMA 4P7LA 2REQA 3N19B 3PC0A 1CDGA 1DIKA 1U33A 1LT8A 4Q3MA 4OUEA 1KLYA 1VENA 3BOXA 1D9EA 4BEQA 3NQ6A 4IPJA 4QSFA 5D4YA 4PCSA 3GVQA 4TQTA 3WCZA 1PZ2A 2YDAA 4R33A 2RGMA 1TE1A 3STPA 1GOKA 4XZIA 3XINA 1G4SA 8A3HA 2A0NA 4BWLC 1RSCA 1UD6A 1Z9AA 1YXCA 1WUFA 1D7FA 3CB8A 3THQA 5DT7A 2HDJA 4PB5A 4NRRA 3A23A 2QDEA 1MNSA 2RDUA 5GVJA 3SGGA 4QJ3B 1YXYA 1XHGA 4YHEA 1LM1A 4WJEA 2J6XA 4EOUA 1CWYA 4QX4A 4LVGA 3ELFA 4FNRA 1ZK7A 1DP0A 1TZ9A 3ARTA 4BQ3A 2X16A 4M6QA 4DWSD 4E8GA 2Y5JA 1OSEA 1WDDA 2HISA 4FIRA 5REQA 3C2OA 1AJ2A 1SQ7A 3C3NA 3P3BA 3Q67A 4CNNA 2FGBA 3AI0A 4YYFA 2B31A 3L67A 3V1HA 3PAOA 4MY9A 4S1FA 1GKPA 1B3YA 3TJ4A 2VDIA 1EH9A 4FEZA 4Z17A 3VNMA 1IT7A 3S6TA 1OT2A 4MZ8A 3O8AA 4JFSA 1ZSXA 3UP8A 2ZTJA 4HZ8A 3C0QA 3ES7A 3LRMA 4TIMA 3JU2A 3HIJA 4EXQA 4XKMA 1D8WA 2YZRA 5H8UA 1FFQA 4JYFA 3E0IA 1UD4A 2E5BA 1RQBA 1SFSA 2WNZA 4GG9A 4BFAA 1ONFA 3LTPA 1V6TA 1XYCA 4R7OA 3VI2A 4C6DA 1KBLA 1F2JA 5G4WA 4D72A 2F7FA 2D3LA 3N4FA 1NWRA 3URHA 3IK2A 2CZ5A 1EUNA 2TMDA 1KFLA 3D5HA 3KZPA 4GQGA 1PTDA 2CIPA 1XH2A 5MF5A 4JOMA 4PL1A 3KCLA 5KZEA 3QR1A 2BDQA 1XRSA 2G97A 1TX2A 1R3RA 4C6KA 2ZBTA 3MSYA 3GKAA 3D3AA 4WR3A 3ATYA 4TVCA 4LUSA 3RLUA 2C19A 2FFCA 3M0MA 3TR2A 2V63A 1HVQA 4AWUA 3GH4A 1MXGA 1UROA 1WOAA 3ITTA 1P0EA 2NX9A 1NF0A 5FACA 4CLMA 1KRMA 3SCOA 2XH7A 5FEXA 5AHIA 3KL0A 4N4QA 1GQIA 3GTIA 5KTLA 2VCAA 2ISVA 4WSHA 1ITCA 3NDYA 4QLLA 1I1XA 4DXKA 4GK8A 4PRTA 2I5IA 3ZFHA 3RO8A 1E6XM 3CUGA 4GMEA 1X38A 2VHLA 4A3UA 1GERA 5HNTA 3SI9A 2FFIA 4AAJA 1US0A 3W22A 2ISSA 3A3XA 3DAQA 1RUSA 1FQ0A 4G5DA 3PUDA 3NTYA 1XSIA 2Z1WA 2VX5A 1M41A 5DQPA 3IJ6A 2W54A 4ASTA 4P8UA 1SFJA 4QE4A 2UY3A 3QMSA 1TV4A 4PTVA 3C5QA 3E3HA 2QLYA 1PO9A 3BZGA 3CJPA 2QV5A 2GL5A 5D9NA 4ZTXA 3UF9A 4DJFC 1SYTA 1B3OA 4S38A 3GC5A 3SQPA 3GY1A 4LEQA 3H2AA 1UP0A 1TTJA 1L8PA 3WEOA 4BY3A 2Y5SA 3PY2A 3SCSA 3DXIA 1XKJA 4AWSA 1AMYA 3MJMA 2CEQA 1DXFA 3VKKA 3VAVA 2E6YA 3UCQA 5LIXX 3HMJG 2F38A 2PWDA 3S1VA 4NF7A 1NFPA 2WYSA 1C92A 1OCQA 1RBAA 4M6UA 3BW3A 1H7RA 2FMNA 4FR1A 3ORWA 2W4XA 2X42A 4WY0B 1EL3A 2XZ7A 1OGBA 1ZNNA 3PWIA 4C90A 3V16A 3NQVA 4EWJA 3SRDA 3ZT7A 3WH7A 3QQ0A 3LPFA 1XWYA 1W1B1 2GJXA 1J11A 5TIMA 1LT7A 2EQ9A 4KFPA 4IXXA 3QC0A 1XGEA 2FJKA 3SFKA 1C91A 2NV1A 4HPHA 2YL6A 1BXNA 5A6KA 4C6PA 5K2ZA 3FW6A 1QCWA 3UWVA 5HNUA 1FO4A 1W1ZA 4WK9A 1V51A 3IGHX 2Z29A 1BRLB 1E6RA 1FFRA 3RXZA 1J18A 1V79A 4ZEPA 1VPQA 1MI3A 2ZICA 5BOEA 2EG7A 3V5FA 1TPC1 1NWSA 5FF7A 4TXEA 4D6FA 1XQLA 2WCSA 4XAYA 3NDOA 1TVNA 3FXYA 3WLJA 4JN8A 1P7TA 1CLXA 3PANA 2ACQA 3SQLA 4EQRA 3GVRA 3L5LA 4BS0A 5I3JA 3LSCA 4EQSA 3C8NA 3F03K 5ABFA 4G8TA 3AIEA 1S3TC 4AD3A 3VD9A 2CYGA 3TTOA 1OG0A 4PTWA 4DM1A 3NQDA 5KVHA 4UQCA 1LL6A 4MWAA 3H4GA 3E2SA 1ITQA 3RAOA 1O66A 3MVTA 5JQ9A 7A3HA 3OVGA 3BWWA 1XRFA 5LIWX 2GR0A 4Z2KA 3W88A 3ARZA 2XM2A 3GW3A 2OFJA 2QJGA 3H55A 2VQTA 2A85A 1OX5A 4LTSA 2ACSA 2Y70A 2VT0A 2DPEA 4TMBA 3AS3A 2E5AA 5H1WA 3KBMA 3CAQA 4DNMA 3W85A 1HT6A 2YR1A 3W7PA 4FXJA 5CPMA 2YXXA 1OC5A 3H70A 3CT7A 1K6WA 2FTPA 1FWHC 3QY8A 1D7KA 4JNYA 4AD1A 2H9AA 3C2VA 3CGBA 4Q6JA 4PE8A 3O7UA 3GTHA 4GVHA 3VD5A 3L4WA 3YPIA 3LPOA 1HP4A 1PYFA 2Z1SA 3VD3A 1EBDA 1DTUA 3E0LA 2J9YA 6A3HA 4EMWA 2PDFA 4GVFA 1W3HA 3F4WA 4JTGA 3HQ1A 3FV9A 1CXLA 1H61A 2QVNA 1DJHA 2PB1A 2XH2A 4H19A 4DJED 1QATA 1ZBWA 3N2BA 2X05A 3ZVHA 3QMTA 4WIWA 3WNOA 2NQJA 2VC7A 5HNNA 3W00A 3GM8A 3NXLA 4ZE4A 2WM1A 3OVQA 3BAXA 3PG6A 2J7HA 4D8LA 3OPSA 3OLDA 3CO4A 4Z0SA 1GVIA 1BFNA 1HL9A 4X0NA 3LM3A 3F1QA 5JCLA 3KAOA 1CCWB 3RM8A 5HWNA 4O0KA 2X99A 3CAKA 1R3SA 1OFPA 1UW9A 1Q65A 1X2GA 5CSYA 3C2YA 2ZKMX 5FJPA 3UQNA 4LYKA 3L2LA 3U2OA 5A6SA 1KKOA 4HPXA 3EZ4A 1C8XA 1QUMA 4NEWA 1TRDA 4QNEA 4A3RA 2CETA 3WD4A 3JR2A 4UQ9A 1OD0A 4E8DA 4NNAA 5KZDA 3THDA 1SUXA 3W70A 1F3PA 2GR2A 3TYUA 2ZRUA 4A8NA 4LB3A 1A5CA 1E15A 5D8ZA 1KN0A 2WMIA 4J5NA 4S3AA 4Y8FA 3QFEA 5KZ6A 1TRIA 4Y9MA 3B06A 1CXFA 1NDYA 1OCJA 4YXGA 4AVOA 4W4QA 4Y8EA 4CQCA 4Q8QA 4HMCA 3TAOA 4DO4A 3NQAA 4I5UA 3WBEA 1LL7A 1CGUA 1E6QM 1H7XA 2CWXA 1NHQA 3KP0A 1JAEA 2PU1A 1W5QA 4GXMA 5IFPA 4GZIA 4DLMA 1AH0A 1DORA 4CCCA 2E77A 3M7WA 3RLGA 4R7WA 2DUZA 2G3IA 4ES4A 3CH9A 4IGHA 3DECA 2QJMA 2ZUTA 1L6WA 2WNWA 1GPFA 1NWUA 3EKGA 1OWQA 2Y61A 2FH6A 2HVNA 4JYEA 1L8NA 1Q7QA 4MPQA 3WLTA 3IWPA 3VIMA 2WBAA 1IE7C 1OQFA 2NW0A 3HPSA 2W3ZA 1Q6QA 1H62A 1MMFA 3H2EA 5JIPA 1XYAA 4EQXA 3FJ4A 3MQTA 1YE6A 3MMDA 4HCHA 2ZVRA 2J27A 2X1SA 4EMJA 1QNRA 4KFNA 1IGWA 1U1JA 3KOXA 3GG7A 4NZ4A 5CH9A 4CCDA 1ICQA 3TONA 4OHQA 2R1NA 4X60A 3ANYA 3CBWA 4UQEA 5DMYA 4RUBA 3W38A 3R5EA 2GOUA 4N9CA 4JQ3A 2HPIA 1OHLA 2FHCA 1OYAA 5TD4A 3AHVA 3PR2A 4KT2A 2X1RA 1F76A 3HJZA 5KVIA 4JHZA 1XUZA 4ZOCA 1NF7A 1ADSA 1G0CA 1ME9A 4O11A 1XD0A 3VVGA 3CUIA 4Z1DA 4M51A 1PWLA 1XSJA 4R27A 4HU0A 1E0UA 3I10A 2QS8A 3E12A 4DRSA 2Q3RA 3T55A 3ZT6A 4F0MA 3VOGA 3GX9A 4H41A 4KIEA 3VKAA 4CNUA 1FP9A 1QK2A 4I3GA 5HNRA 1JXKA 1ZFJA 3CZJA 3L2IA 2YYTA 1GRHA 2QDHA 2DORA 5HJXA 3LHYA 1HKVA 3VDAA 1TR1A 1LLOA 2CLPA 2GVYA 4RDVA 1TPFA 2ZZ5A 5EFDA 3LCWA 1NDZA 3VCNA 3FGCB 4FIQA 4OIFA 1I2RA 2FZ8A 4HOXA 3STEA 4DX3A 5AECA 1BYAA 4CQAA 2UWFA 3AIVA 1E55A 3UT0A 1ESWA 1I45A 4I7VA 1ZY9A 5E6ZA 3GNXA 1HQTA 2CKSA 1J4EA 5CQ1A 3ALGA 1EJ7L 4NNCA 1LBFA 3GVWA 1SPQA 2PP3A 2ZZ2A 1E6NA 2XFWA 4ACYA 4BK9A 1X1NA 3S46A 3NZRA 1JUBA 1E56A 3DK4A 2BHZA 2OYKA 3NEHA 3VNLA 1TPWA 1I0BA 4JTAA 5LNUA 1TJPA 4JR5A 4ZOHB 2XYLA 4BHYA 3LERA 4L4MA 3TAKA 1GEQA 3R10A 4YWOA 1ZP3A 1G67A 3QMRA 5ABGA 4A05A 1Q6GA 2OKTA 3E02A 2PWEA 2R91A 1A53A 3MDWA 4X9SA 4O1DA 4R9XA 3L68A 1R9XA 5A6JA 5EMYA 2CBUA 1DV7A 1VLWA 2GUUA 4XKYB 5FJRA 4HVXA 4JIEA 4UTWC 3NSXA 4D6EA 3TP4A 4LRTA 2VGBA 1NOUA 5D30A 4DI9A 2V68A 3IJDA 3WJSA 5I5RA 3QHMA 4MYAA 4AZ5A 2P8BA 3IGSA 1GQKA 1VYSX 5A8NA 3P2VA 5J5DA 2VZTA 5M1TA 1AD1A 4D1JA 3AWNA 1UMLA 5PTDA 1DWHM 2WW5A 3DGRA 5FS8A 2WLYA 4ROPA 3WDJA 1VEMA 3MP3A 4XTDA 1QW7A 4JNMA 4LB4A 1E0TA 3R6IA 5CC7A 1KXTA 5HMFA 1ZJAA 2I5GA 3G3MA 4X61A 1VAHA 2OB3A 3F4NA 4NXKA 5GQBA 1EX5A 1W37A 2OWXA 2PDWA 5CPOA 5FCZA 2A5HA 2OWCA 1RBLA 1QXLA 5CJMA 1W2PA 1ECEA 4GO9A 1N5WC 3BMWA 1XLIA 5JCKA 3EWDA 3DH7A 4P61A 3BICA 4YPJA 3BV7A 1YDNA 1UZDA 1OC7A 3VIHA 2G0WA 2F5ZA 1R9YA 4E0CA 1OC6A 2DSUA 3BARA 4LAMA 4E38A 2PF8A 4IIEA 3OB8A 2Y63A 3NFUA 4C91A 5IBXA 1R8LA 1MW2A 5AHMA 4L4LA 3GD6A 2QJNA 1HIZA 3DJJA 4WY0F 4QITA 1E6ZA 2C1IA 2RJGA 2IPWA 2AAAA 3AROA 3LADA 3DCPA 4NYUA 2ACUA 3KTSA 4C1LA 1DIEA 4JX6A 4IG2B 3TYZA 1FCUA 1PYMA 2C0AA 3VGFA 3H8AA 3UW6A 3NA8A 3PF3A 3G1AA 1RVGA 1QNPA 3GS6A 3CHEA 4FX7A 4GIRA 3O0KA 2BVWA 5C7VA 4UTKA 2EPHA 2F2HA 3DU0A 1JYWA 4JKKA 4Z08A 6XIAA 3MSGA 2O9OA 1PHWA 3NPXA 1JZ6A 4O19A 3DFQA 4I8DA 3WO8A 1IIHA 1WZLA 3WG6A 4M29A 4H04A 5AHEA 1ICPA 1VPXA 4KCVA 4CN6A 1QPKA 4GNKB 1RPKA 1XIGA 3NQEA 3SR6B 3B8SA 4LUTA 2Q3OA 4R53A 3GTFA 1TTPA 3MKVA 2CDUA 3STFA 1U30A 3FVDA 1CZ1A 2TSYA 3GH5A 1J0IA 2QAPA 1LLZA 1LL4A 3HG4A 1ONEA 2GVJA 4K7VA 5CJNA 1HJWA 4MAZA 3WEZA 4D6IA 1EPVA 1F4AA 4KWUA 2EJAA 2A7RA 3ITCA 3AIWA 3IIXA 4LYQA 1F3XA 3FS2A 3EA1A 2AQOA 4XUYA 3MYPA 3UXDA 3W6YA 5I23A 2OXNA 5AZ0A 3OA5A 1NJJA 3RG6A 2F6UA 1LBLA 3FKKA 3W7EA 3BPWA 4V33A 3M7SA 1GRBA 3N29A 3MUY1 3UCCA 2HMCA 4LA1A 2BC1A 1L2QA 4R3UA 2MANA 1LJYA 3W72A 4HHHA 3H4WA 1WKYA 1SM9A 4AISA 5U1OA 4EXAA 1FHLA 4LJ3A 4DIAA 3EX1A 3O16A 4GI6A 4YLWA 3WBYA 1OJTA 1V7AA 1OM0A 3FOKA 2YCLA 3JZEA 2V38A 4DHGA 3TQKA 4B3LA 4HT3A 4AYGA 5F1VA 3O15A 3URQA 1VDVA 4PEEA 1CT5A 1PZ3A 2GJNA 4AY8A 3STCA 2V3DA 1VCFA 4RE3A 3KL3A 4W86A 3QHNA 4PBGA 4YTQA 3AOFA 4G1KA 3QF0A 1C29A 3IUDA 2WOVA 1MQPA 2HK0A 3CH0A 4U31A 3SCQA 2Z0IA 1CBGA 4OE7A 4U10A 1L6SA 2Z7GA 4B5NA 4CEXC 4GO8A 2CHRA 3JRKA 2BCPA 3AZTA 1VBUA 4GZEA 3H54A 2YQUA 4LYPA 1CB2A 4QAIA 3DN5A 2RABA 4UFLA 3BW2A 5KETA 1KQZA 4K7ZA 1WAWA 5JBFA 3OBAA 2BX7A 5I3DA 1XIBA 2BMBA 1F3TA 3VIKA 1FFUC 2IQ0A 5ER0A 1FHVA 3DYPA 3SUVA 1E0VA 4H4YA 3ZO9A 1XYZA 1VCVA 3L8KA 4KWSA 3F2DA 3WQ5A 1NOWA 2OLHA 3VMOA 2NWSA 1GKRA 1VFOA 3TC6A 2A3BA 3B9NA 3BURA 1UJQA 5AHFA 2PWGA 1PV8A 4TTUA 3P0XA 2R9ZA 4GXPA 3AU2A 1UKTA 3BLPX 4ORIA 2INZA 2DZAA 3H26A 3NQ2A 3TXVA 2XGZA 1X96A 3U48A 4DZIA 4HOWA 3OIXA 3K2GA 4EK7A 1YTDA 3B0VC 3CXOA 3TA6A 1W1IE 5F4WA 2OLAA 1AZ1A 2XJ7A 3EWCA 4DYEA 3N9SA 3E49A 2VDGA 4D1IA 4DUXA 3NL5A 5U7SA 4MJ2A 4Z2GA 1A3HA 2HWGA 3U6WA 4LV9A 3DFNA 1HX0A 4ENLA 3JS3A 5IM51 2XU2A 3GHUA 3ARRA 4W7WA 2AQVA 1M01A 4AXNA 1F4HA 1GOWA 1E3XA 4ZOEA 4WQ6A 2ZUWA 1K8ZA 3NQ7A 3AM9A 2VXNA 3ZYZA 4RV3A 4MNLA 1R9ZA 4RV8A 5FS6A 1MW3A 3GNNA 3HPZA 4NILA 4K36A 1SJDA 5LIUX 3ZR6A 4JTCA 2NQ9A 4L6DA 5I7GA 3KUMA 1R0MA 3SCTA 3WF1A 3HZ3A 1SZFA 4DXXA 2R24A 3AS1A 2ZRXA 4IL0A 4C6EA 4S3CA 4H9YA 4P7NA 2DZBA 2GK1A 1MQQA 4JNZA 4ZBCA 2HCVA 2P3ZA 2G3MA 3RDKA 3O05A 2H90A 2OQYA 1BKSA 1B9BA 1JF6A 2JKPA 1ISWA 1M9HA 1V3JA 2D2HA 4KWOA 2WQPA 1Z89A 1BTMA 5DRIA 4I7WA 3GTNA 1BYDA 5I3GA 3GBEA 5CPTA 3OJGA 5F7UA 2CBJA 1X97A 4W85A 3BW4A 4OECA 2GJRA 3SY1A 6ENLA 4IJRA 1WYIA 3W7JA 1I4NA 5A6LA 3CO8A 3N2OA 5AVHA 1HF6A 1AD4A 2EKCA 1NTHA 3ITGA 3V36A 2WAGA 4EPKA 4KETA 5LNWA 3M1ZA 3NR0A 2NPXA 2WPEA 4FK9A 3AMLA 1HNYA 3S1GA 1JCTA 3SB0A 4MMWA 5K9XA 1A50A 4A2SA 3VIIA 1S46A 4GFSA 3SJNA 5FJJA 1XRTA 4M6VA 1UWRA 2DSVA 4RE2A 2A8XA 4OGZA 4O10A 4C1KA 3IJLA 1EEPA 4R5EA 3OLGA 3KP1A 3K4AA 3WQ6A 3ZIZA 1SR0A 3CAWA 5DXXA 1Z32X 4ZXLA 2DQWA 3KHJA 1UP3A 3W1QA 4E2OA 2G5WA 2QZRA 1LF1A 1KA9F 2DU2A 1JGMA 2PF0A 1O6IA 3SCNA 3H22A 1ZU8A 2HK1A 3BSGA 3K1GA 5CGMA 5CCZA 2P50A 3EOOA 4UNKA 2XPKA 3SR7A 1M7OA 4OOUA 3PM6A 3UR8A 1H7OA 3SIMA 3BCDA 3PZUA 3WBWA 1E6SM 3NOYA 2PTWA 1WNOA 1CLVA 1DXLA 2QF7A 2J9ZA 2J79A 4D6GA 2Y1HA 3J7HA 1ZJIA 2QMJA 1TFVA 3AMZA 3ENLA 3R13A 1WZMA 4AYSA 5BWAA 3BJSA 1XCWA 3FCPA 2V6OA 2W0UA 1SR9A 2QUTA 3WEMA 3ME3A 4JTKA 2NXHA 2AKMA 1UWQA 3WUBA 2X0YA 3C4UA 3LMYA 3FYPA 4XBKA 4AIUA 5DFAA 3RCMA 3W2LA 4GACA 2BXVA 1M03A 1CENA 2GSJA 4RZ4A 4XX6A 3DHDA 1BVNP 3TXZA 3F7JA 1TYTA 4FHAA 4Q22A 5XINA 5D2VA 2XIBA 1JG9A 3CMFA 2WKJA 4B5TA 3WK3A 1TA3A 4HN4A 1OFOA 3PWGA 3HGOA 4F0SA 4C6MA 3OLEA 2PU0A 3FKRA 1GVEA 2FH8A 1OK6A 1V3HA 1DXIA 1IXQA 4QCEA 2Z1VA 1Z6KA 3S1UA 3NQ8A 1HJVA 4V1YA 2GQ3A 4DO7A 4FLQA 2Y88A 4KFOA 1JDEA 4WX2A 5D02A 1DIOA 3LHZA 3SEPA 3VIFA 4ZFMA 5JBDA 2CZVA 3TDFA 3H53A 1WX0A 3AXIA 2UBPC 3N9RA 3LRLA 3GUGA 4POCA 4XAZA 2V5DA 2WO5A 3W7NA 2YJQA 4H6EA 1WO2A 3W2MA 5HUOA 1REQB 3LGGA 4UQBA 4N9DA 3VMNA 1PVNA 2V3AA 3W23A 1YQZA 1LUCA 4IX0A 8TIMA 1FTXA 1KM4A 3KRBA 1WKEA 5FJTA 2QF8A 1XINA 4O50A 5E9AA 5I24A 4ZMGA 4WUIA 3L5OA 5A69A 4TMCA 3WLKX 1P1XA 5FEZA 3CZEA 3KZSA 3WYZA 3NVZB 4UTWA 3E1F1 3ATZA 3C3UA 3M0VA 3P5ZA 5FEPA 4BKNA 4OKDA 1QPNA 1SFLA 4PR4A 4TVUA 2EHHA 3M5ZA 3DFTA 1SFTA 4MTVA 3ZT5A 1EUAA 2CESA 3NXFA 1MNZA 4NVTA 4KMQA 5I77A 5HWJA 2GVGA 1RCQA 4M1RA 2NQ5A 3RM9A 2WPBA 3GYCA 3EA3A 3VNZA 1UD2A 1UJPA 5K9CA 1T99A 4BI6A 2AMGA 4QDWA 1BKHA 2OPJA 4YIWA 4HYRA 3OBKA 3QOMA 4DJDC 4AZIA 3R0DA 2DVTA 4GOAA 1R30A 2PGRA 4GISA 4UR9A 3CNYA 4P7RA 3PZMA 5TBOA 5DRCA 4LY4A 2JBMA 5B7YA 2DZTA 2R82A 4QXIA 3VUPA 1XYBA 3W7LA 3AQUA 2I9EA 5FIPA 3MUAA 4YVVA 4IIGA 4YYCA 1JRCA 2Z00A 2HV5A 3NO1A 2XIIA 3BAIA 4FMVA 3M0YA 3L9CA 1RALA 4HZ6A 4RLIA 2XVNA 2FDSA 3VXGA 1XIHA 3PVFA 5D37A 1UD5A 3N2CA 2QCEA 6CGTA 2WANA 5JUVA 2TRSA 2H3BA 2OT1A 1VFHA 4CEUC 4NRSA 3UU0A 1HN1A 3R0KA 3N6JA 2GQ8A 5HUPA 1R2SA 4US6A 1FDJA 3CL6A 1N5XA 2VZOA 2ZZ0A 1W5NA 1VJZA 4NX5A 3FVMA 1CGYA 4ERIA 1EF3A 1FKWA 1IWAA 1F07A 4HK5A 4X9YA 4K37A 3OIHA 3RHGA 1DJWA 2Q71A 2NT0A 3HQOA 3BAWA 1KKRA 2PDJA 4YWIA 2C14A 3EWBX 3S6OA 1QI4A 3S2LA 3VZXA 3EANA 1UKPA 5EB8A 4IT1A 1AA1B 1DJGA 3DK8A 5AC4A 3MDUA 1AQ0A 3UPBA 1MOKA 2J7FA 3UWQA 4WDWA 2MUCA 3V4BA 4ZQPA 2BLEA 1OF8A 5EMMA 4NL1A 3UVIA 4NAFB 4Q4OA 3E5PA 1PHQA 1KRBC 1Z69A 1BWKA 1BHGA 2WVUA 3VO0A 1LG2A 3LV5A 2C7FA 2Y5EA 4YVPA 2ZA2A 4QLKA 4HHMA 2PFHA 3LB8A 3DJGX 2F8QA 1RJPA 1G9HA 3VCRA 4WF7A 2VZSA 4HMDA 1H49A 4QJ5B 4QSHA 1ZJHA 4O14A 3DC0A 4GVIA 1H2IA 2GDQA 1E5JA 5JXQA 4L80A 3O63A 5D8WA 1DJXA 1IHIA 5FEWA 4TX8A 1MUCA 4GGHA 1D2KA 2RUSA 4N9EA 4GC3A 3PULA 4ACZB 3RGTA 2DV0A 1GWJA 1K7FA 3C8FA 4JEJA 1OX4A 4FA3A 5K4ZA 1UHVA 1YRRA 3ANUA 3B05A 3EB4A 4N42A 4DO6A 2I16A 3CV6A 2QGYA 4HD5A 4ZODA 4ZA0A 3CUZA 4IOTA 4AZ6A 3OODA 1RK5A 3RR1A 3OBEA 2B4GA 1L6FA 2XIQA 2PWFA 4WEVX 4GH1A 3WLRA 1VEPA 2YBTA 1NHPA 4JHOA 1IQ8A 1T5AA 1IEIA 1XXXA 1DJZA 4Z1CA 4LGXA 3BGAA 1Q3NA 3LCXA 2YL5A 1GTHA 1IV8A 3TK7A 4C5YA 5IFTA 4ZO7A 2P53A 3LU2A 1UCWA 4C7DA 4PGLA 4LAKA 4H4WA 2R14A 4C6NA 1ZZMA 4HHLA 1V3IA 2VCCA 3MCNA 3P6LA 2VFDA 5E5CA 4PTDA 4IFKA 1NH6A 5HINA 4HZMA 2ZRVA 3PHAA 1MEHA 5SWUA 4Z1AA 3C2FA 1UBPC 4AZGA 4GA8A 1QOXA 2EQ6A 1CECA 1PDYA 4GC4A 3OYXA 5HATA 2ZUMA 3T4WA 4K8GA 3FK4A 4J3WA 5JIWA 5CPLA 2CZFA 3N9KA 3WNLA 3NSNA 2OOFA 3R25A 4UQAA 4IGNA 2XIOA 5LGXA 2DW6A 2PSNA 5A6AA 4HA0A 2HS6A 3NQCA 1DJNA 4XD4A 1JZ4A 3VUSA 4D6JA 4FNPA 1O5RA 1NELA 2CLOA 4NJGA 4XZNX 1UMYA 2X41A 1V6UA 3AIBA 2PWHA 3S3GA 2JEQA 4ERGA 1DL3A 5AKQA 2GDUA 2YLAA 1HL8A 3W7RA 2NV2A 2O7SA 3IJIA 2XH4A 1SSGA 3AUJA 1JQVA 1XDLA 1JI1A 1VRDA 4L6OA 2WK2A 1B3VA 1V6XA 4REQB 3RIKA 2A21A 2W3SA 1BQGA 3UWEA 4GUJA 3VNYA 4DLFA 1TMLA 4YCPA 5I3KA 3RUBL 4YTTA 3NPUA 1YX1A 1UG6A 2TAAA 5TR3A 3O3RA 3WF2A 2WJZA 3EPMA 5G5GB 4YVXA 4AY7A 2OVLA 1ADOA 3C2RA 2PDNA 3M5VA 4GYKA 2J7GA 3ECQA 3F4VA 1FH9A 3E0WA 4XAFA 1VHNA 1K8YA 3VDBA 1ZS2A 2DIJA 2NQLA 1YQ2A 3OZYA 2WVVA 1C90A 4DEFA 4H9TA 4XZLX 2VFEA 4QRNA 4AH7A 3EWZA 1QAPA 3BAJA 1RA0A 3DDMA 1K9TA 4MNMA 3K4WA 3T9PA 4EE9A 1JCYA 1E6PA 4ML9A 1GREA 1P5BA 1JCMP 3VIJA 1TJRA 3T8QA 4LCQA 1OADA 4IPLA 5JMUA 3BE7A 4QQUA 4GUHA 1MVYA 1SW0A 1KM0A 3PK7A 1XR2A 2INEA 3SSZA 4J2MA 1BG4A 4EF9A 1S38A 3W3OA 3PSWA 3FAWA 5CGQA 1LQ2A 4DO5A 1A5SA 5LIYX 4IWWA 2PP0A 3AYSA 4R85A 3A7UA 4MNKA 5HBFA 3MI6A 2C79A 2YBVA 2YVGA 3T0DA 3T2PA 1GNXA 4ADTA 2PDQA 1XISA 3E5BA 2DJXA 4B2DA 1U5HA 4H8HA 5MKGB 5AN7A 4QR6A 5FD0A 3WFAA 2VC9A 4Q8TA 4W7UA 2VEMA 4ZL1A 4H4RA 1W5OA 5DCEA 4PCPA 2PWUA 4H4TA 2VL4A 4RJEA 3VDGA 3BMVA 1ADDA 1T8XA 4QGCA 4B4HA 5CLWA 3GVGA 1ZQ5A 1QBBA 3MI3A 3GNOA 4QEHA 1XLMA 3LMZA 1NHSA 2G95A 2HJPA 3I6EA 2FQIA 3IIVA 5HMDA 4EPEC 1E73M 2P5NA 2R6OA 2ZCGA 3PSVA 4IF2A 1VS1A 1XICA 4W8BA 5F2GA 3OTRA 2NSOA 5LA1A 2WMGA 3L4VA 4QNWA 5EBAA 3BTNA 4MDOA 4CQDA 5DMLA 3DFPA 5FJIA 3WKZA 3TC7A 1GVQA 5C55A 5D9MA 3TFXA 2OTDA 3OHMB 1MFUA 5M17A 4TTGA 1IEWA 1MO0A 2XN1A 3WMCA 1GOIA 3NRZB 1OT1A 4CVUA 2DDXA 5BW6A 3LI0A 2OCZA 2HE8A 4JX5A 3IV8A 4JN7A 1XCFA 3ZSSA 2DUAA 1QRQA 2NQHA 3TEVA 1WB0A 3STGA 2WPFA 5HULA 4CU7A 1RQEA 5FS7A 4DXVA 2XSXA 5ENLA 3TFCA 1Y5XA 3NS1B 1XYLA 3E2RA 1Z3NA 2ZQ0A 2F84A 1VR6A 1G01A 1WAUA 4H00A 1PKMA 2JGQA 3O9NA 3UZJA 1A47A 3W81A 3QPZA 1BVWA 1NQKA 4HQVA 2WWCA 3GTXA 3I7QA 3W1RA 3RPTA 3TNBA 2FZBA 1UR4A 1F3WA 5G5IA 3MV01 1DOSA 3AHYA 1BTCA 4WOQA 4IPNB 1D3CA 2H8ZA 1BSIA 4PC8A 2Z2BA 3M0LA 5CSSA 3GVVA 3HO8A 3W2NA 4RE0A 7TAAA 3LCLA 3PPCA 4MSSA 5IDIA 3WLLA 1N61C 1ICSA 1RXOB 5C8BB 3G1VA 3LX9A 2OELA 3IUIA 4U2ZA 1SJCA 3R94A 3OW1A 3PBYA 3W1MA 1AH3A 2YDQA 5BCAA 1EP3A 3P80A 2RDTA 4AHQA 4AF0A 2GGIA 1YE4A 4PH6A 4A22A 2EPLX 1VGAA 3W7OA 4Q4MA 3N17A 4PFMA 3P74A 3PJUA 1QPOA 2D73A 4KQNA 1WDSA 4A6GA 3W2UA 4C1NA 4E2DA 3H7RA 1IZJA 2Y6ZA 4W93A 1LWHA 3WFZA 3GG0A 4OVXA 1MW0A 1KW1A 1AOGA 3PBMA 4H7CA 2QCHA 3KBWA 4PSPA 4JN6A 3ALFA 3ES8A 3ETRB 2HPMA 1TV5A 3TE9A 1J8VA 4IMDA 1FX6A 3I4KA 1FEBA 1EX1A 4M81A 1Q6RA 2QR6A 4DJDA 1EQCA 1SO5A 4JDBA 3GDMA 5DY2A 3BANA 1KXQA 1HKWA 2WOQA 3CM4A 4XO6A 2W66A 3VDCA 4WSKA 2C1GA 4AZCA 1V97A 3F5LA 4MIMA 2ONEA 4GY1A 1H4PA 1ZHAA 1AL8A 4NAEA 3JVAA 2XINA 3WLIA 3EDEA 3G8EA 1LYXA 3W29A 5DCDA 4A8IA 2PZ0A 1CGVA 3RX3A 2ZRWA 1X98A 1W2VA 4RR4A 3V5OA 5D32A 4QJ4B 1ZXIC 2J8FA 4J3SA 3T2QA 5HDRA 3AHZA 4OQVA 4B4FA 2YFOA 2Y2WA 4J4KA 3R07C 1EP2A 1HW6A 2Q8XA 4ZQCA 4Z2JA 3VPLA 3L5MA 4TU1A 4O52A 4OBRA 3WDPP 4H4SA 2PTYA 5CZSA 2NLYA 1QO5A 1T96A 3IACA 2O56A 4KEZA 5FESA 4MAVA 3N2MA 3BJFA 4HPGA 2X2YA 4Q4SA 2RDWA 3S5ZA 3L4YA 4N7QA 2ZUNA 4ZSTA 2XN2A 3I65A 2E1WA 4Q8UA 2BY0A 2VX6A 3SN0A 4BA0A 3GR4A 5HPCA 4TOQA 1UR3M 1EA9C 3VK5A 5FF2A 3TH6A 4ZGYA 1FEAA 2R1PA 5IOBA 3CL7A 1QPQA 4I6KA 1K77A 1VD6A 3HB9A 1IEQA 4DWSA 5KZMA 3VKCA 3SUUA 1RPXA 1U1HA 3TV8A 2ZX5A 3BK0A 4NASA 3NURA 2XHYA 4RCXA 2QJIA 1RCXB 3H21A 3WQ8A 1GK8A 2YGYA 4YTRA 4LF2A 5FOOA 1V59A 3ARUA 1DWIM 3WD0A 1SB3B 3E0VA 1WQ5A 3PTMA 1P0NA 4ZB2A 3GAYA 4IMFA 2DSZA 4LBUA 1MSSA 3MCOA 4RW3A 2ODOA 1GETA 1RD6A 3NSMA 1LDCA 4S3KA 4AD0A 1DQWA 4KWVA 4AUBA 3AISA 3K30A 3MHGA 4GQRA 3LI1A 1N8FA 3DI1A 2JEPA 1IWPA 1B3XA 4FXRA 1DEDA 1E3ZA 3TROA 1XG4A 2EEXA 2XFFA 1A5MC 3BGJA 1ZRQA 4AIEA 2XVLA 1NPXA 3MY9A 5HWMA 4GI9A 3EPNA 1TCMA 3SY8A 1XANA 5JCNA 3MANA 4UTTC 4AIBA 4MLRA 4XZ9A 2W0HA 4F48A 1KM6A 4MUZA 1HXJA 5EMUA 1DWJM 3POHA 4BR1A 1FOBA 3IRDA 2P0IA 3UXKA 2BZNA 2WKLA 3P5YA 4MLJA 2CKRA 4G7FA 1IXPA 1ZMCA 3B8WA 1XX1A 9CGTA 3WF3A 3A22A 4IJCA 4HNVA 1X7FA 1GW1A 4JY8A 4U28A 4LT9A 3ZR4A 4HK6A 4MWAC 4H8NA 3DFYA 3BGGA 3LD5A 4WHBA 3V0SA 3WQGA 1GQLA 3VKBA 3UERA 1PX8A 2O92A 1F8WA 4RK8A 4LS1A 5EBUA 4DJFD 2WB5A 4KIRA 1OG6A 1TSIA 2IPGA 1R7AA 2Z4GA 3M0HA 3A5VA 3AMCA 4RXFA 2TPRA 5GJPA 1QU4A 4J9JA 1JROA 5AC5A 1L6GA 1GHSA 1KFCA 1OCNA 4RXGA 4UMAA 1XCXA 3DGHA 2IQTA 1RLCL 3BOFA 3AMDA 3TX9A 3FJLA 2BXZA 5DCBA 4GYPA 5BRQA 5C9UA 2AOSA 2EO7A 4O12A 5G5HB 3BL3A 2WMHA 4PMNA 1M65A 1YW1A 3LLFA 4YJ5A 3IK4A 3A64A 1W9BM 3VILA 3S6DA 2PGFA 3VIOA 4GWEA 3IJ9A 4LNYA 1JPHA 4GKTA 3CHDA 1BVZA 2A6LA 4UR8A 2EPOA 3QY6A 3RX4A 1XH0A 2O9TA 1MXDA 2HRWA 3E38A 3G22A 1W1TA 1TZZA 3NO3A 1PTGA 1UA7A 4HNLA 5KEZA 1GZ1A 1PS9A 4MFDA 1NP0A 4JTFA 1ODZA 4JY9A 3VCCA 4PB3A 1H60A 3IGXA 3TQ0A 1WUEA 4OJYA 4CD7A 3OC4A 1GGOA 1V03A 3R58A 1XS2A 2PDCA 3WNMA 1UOZA 4G7EB 3T81A 3L12A 5E6YA 3MTWA 3LG3A 2E9BA 1N63C 1S2WA 1AVAA 3GDRA 3WH9A 2BASA 4FI4A 2E7FA 3T40A 2OX4A 3ZWTA 1JPMA 4JCMA