2QJKC

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Electron transport
source organism Rhodobacter sphaeroides
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 51
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjkC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjkC02
3GZXA 1BE3E 1VF5D 1NDOA 5KLVE 2FYNC 3L75E 2NUKA 1KB9E 1NTZE 1SQBE 2B24A 4H13B 4PD4E 4NBCD 2CKFA 2B1XA 4H13D 1SQQE 3CX5E 2E75B 1SQVE 2E4PA 3C8VA 1WQLA 2HMNA 2E75D 3GB4A 2HMKA 2IBZE 3C0DA 3H1LE 3N0QA 1PP9E 3GCEA 4QUQA 3L70E 3VMID 1L0NE 4Y28J 5L8RJ 1O7WA 4U3FE 2QIWA 2K9YA 2BCCE 3VCAA 4HM8A 2DE7D 1ZRTE 2I7FA 3GL0A 4P1CH 2QPZA 2ZYLA 2E76B 1ULIA 1EZVE 1VCKA 3D89A 2HMLA 4NBBD 4NBHD 3H1KE 1S5LX 4QDFA 3LW5J 2QJPC 5KLIC 1NTKE 1PPJE 5AEUA 4PV1D 1UUVA 4P1BH 2QJKC 2WSFJ 4QUPA 2JZAA 2Q3WA 1JM1A 3L73E 2DE6D 3CXHE 4HM2A 4HM4A 4HM1A 3GTEA 4QURA 3DQYA 2FYUE 1SQPE 2YFJA 1O7HA 4RKUJ 1EG9A 2XRXA 4PV1B 3L74E 2O01J 2QJYC 4EMJB 4AIVA 1NU1E 4NBFD 1O7MA 2E76D 4QDDA 2NVGA 1O7GA 1P84E 5CXMA 2WPVB 4I7ZB 2E4QA 4OGQD 2D2CB 5KKZC 4NB8D 5AEWA 1Q90C 2ZT9D 2A06E 4IL6X 2NWFA 2YVJB 3VMGD 4HM5A 1VM9A 1O7PA 2WSCJ 1NYKA 3BCCE 1RFSA 2HMJA 2XSOA 1SJGA 1FQTA 1L0LE 2GBWA 2YFLA 4QDCA 2NVFA 4HJLA 1RIEA 4HM0A 3CWBE 2HMMA 2D2CD 3VMHD 1KYOE 4NBGD 2E74D 3GL2A 2YIUC 4NB9D 1O7NA 3GOBA 1UUWA 2QSIA 2BMRA 3H1JE 5HL4A 4NBDD 4HM3A 4NBED 1VF5B 4AAYB 1SQXE 4OGQB 2NVEA 2DE5D 4NBAD 4KT0J 2XSHA 1G8JB 2HMOA 1BCCE 3EQQA 4H0LB 3GKEA 4H0LD 1G8KB 3VCPA 3EN1A 3L72E 4QCKA 3AZCA 3TGUE 4HKVA 2BMOA 2WSEJ 3L71E 2YFIA 4HM6A 4H44B 1Q90D 2GBXA 4H44D 4QDFB 3GZYA 2XR8A 5BOKA 1ULJA 2ZT9B 2E74B 1NTME 2BMQA 1JB0J 3GTSA 2NUMA 4HM7A 2JO6A 3H1IE 3H1HE 3FOUA
chains in the Genus database with same CATH superfamily
1L4AA 3L4FA 2HPCA 3RK3E 3L75E 3NMDA 1KB9E 3HD7D 3K5BA 1PGPA 2A45I 3LIEA 4NBCD 2LKMA 2JP3A 1AVOA 1T2KD 3GB4A 2WSSH 1JY3N 2M5AA 2N1TA 3L70D 1U7JA 1S5LH 3CMEP 1GL2B 2E76C 1NTZK 4XFJA 1VPCA 1GU5A 3GHGB 1S5LX 3M9BA 5AEUA 1IFNA 5CCHC 1GMJA 3MGNA 2QJPB 1JEKA 3CCSP 4H13C 2XRXA 1HH0A 3RK3D 4N78D 4RJTA 1SFCD 2KS1A 2JWAA 2E4QA 2G8YA 2O1KA 5KLIB 1O7PA 1G2CA 3TGUD 4BXLA 2N1TB 1NU1J 2KI7B 1LWUB 2P67A 3L75J 3VMHD 2ZVNB 4MN4C 5KLVJ 4NB9D 1SQVJ 1SQQJ 1NYHA 3GW6A 2UWJE 3CCMP 3H1HJ 2JKVA 1L0LG 2XZRA 1VQ4P 2NVEA 1URQB 3CWBG 1AJYA 1BE3J 3RK2B 4RESB 4UB8H 2WSCH 1MUUA 2O1JA 2KOGA 4DJGA 3M06A 3GZYA 5CCGD 4HM7A 2WVRA 1NKNA 2JO6A 3GZXA 3CPWO 3CLQA 1LWUC 2B24A 1LTIC 3AEAC 1SQQE 3RBZA 3Q2YA 1X22A 1LTAC 4YXWH 5B5EH 3TF5A 3VOPA 3AEDC 2Z5HA 1VDFA 5APVA 2QPZA 1EZVE 1AQTA 1VF5C 3L74J 1CZQA 2XNXA 2G3AA 3WU2H 2QJPC 2AXTH 3TSIA 2WMMA 1BGYE 2N9YB 1L0LK 3CCQP 3DQYA 3HD7C 3HE5B 1N8RQ 2O01J 3L73D 4K3AA 1VQOP 3SWKA 2AEFA 1LTJA 1SP4A 1G1IA 1GK6A 1L0NJ 2BCCJ 1NJIQ 3GF3A 1OX3A 2D2CD 1WT6A 2BMRA 2MKVA 4L74A 4ASVA 3HE4A 2FYUJ 1KORA 2NZ2A 4W80A 3H32A 3CL3D 4H0LB 1SFCC 2OARA 3H6PA 2O3JA 5AW8B 2CPBA 5BOKA 5KTBA 3H1KJ 3GTSA 1X79B 1EZVG 1NDOA 1JO5A 2W90A 1PP9J 1KD1Q 1LT9A 1ZLLA 3E1IA 1VQLP 3VMID 4KHXA 3A0HE 1VQ9P 3AE6C 1NTKJ 3HRNA 3D70A 2Y9YA 1AVYA 3RK2D 4N78E 1SFCB 4TT3H 2ZYLA 1FZBA 1K73Q 1FZGA 4I6MC 3HD7A 2E42A 2PGDA 4Z1MH 4DCKA 1FOSE 1YYCA 4GODA 2IPPA 4QUPA 1FE6A 2AEMA 5AW5B 1RE4A 3IN6A 4D6TJ 1USDA 4GIFA 5APUA 5AVZB 5CJ0A 4PV1B 2HFED 1Q7YQ 2I1KA 5AW3B 3M0DA 5AW2B 2LXCB 3HTKA 1QL1A 1RQVA 1GW4A 2WSFH 1MFZA 2FY8A 4QMAA 3CMAP 2GUSA 3OA7A 1RIEA 1SLQA 3FWNA 3MIWA 2OYHC 1SFCA 3H1JE 3Q5RA 4NBDD 3G4SP 1H89A 3Q5PA 5KLVD 1XTCC 3LW5H 4NBAD 4JYBA 1NU1D 2AXCA 2LR2A 3O6QB 3SFDC 1VQKP 4WY4B 1NTZG 2ZXEB 3V2QA 1NTME 2XU6A 3IR9A 2IZ0A 1USEA 3PHLA 3I56P 2B9BA 2V4HA 2ZJSE 3A5TA 3GHGC 3O6QA 2D2CC 3USSA 3KQGA 2FBWC 1SQBE 1N7LA 3P8CE 1VQ7P 1NTMK 2E75B 1SQVE 1FZCB 5DJUB 1RE3C 4XA4A 1BGYJ 3H1IG 3L73G 1TU3F 3CX5D 2Q1KA 5CHXA 1N73B 1KMIZ 4HH2A 2HMLA 1IJDB 2JEEA 1KQFB 3CXHI 5BU8B 2GM4A 1GDTA 3T97A 4K35A 3TNUA 4PJ0E 1KILA 2QVAA 2JJLA 1SQBJ 4RKUJ 1GU4A 4IFDK 5CCGA 2QJYC 1NU1E 2O01H 1P84E 1O7GA 3H1KD 3R4YA 3IAOA 3RK2C 3H32B 2QM8A 1XTGB 1AQ5A 4EDFA 3CXHD 1YJ9P 1NAFA 2ZYGA 1W2BO 4W7ZA 1BSHA 2B87B 2Y9ZA 3II6A 3A7OA 3A3YB 5GTHE 3CCVP 1G8KB 1KILB 2DW3A 1WRGA 1H88A 4ZMDA 3A2AA 1EXJA 2GBXA 2ZT9B 2Q5UA 1R5SA 3KDPB 4WWIA 5APTA 2CK3H 4PD4I 3IFMA 1FJKA 1K8AQ 4HKZH 3D6ZA 4L73A 3GG2A 2KXPB 3BRTB 2Q3IA 3U1AA 1OIPA 1QVGO 2Y0DA 5L8RJ 2Z5IA 1LJ2A 4W7YA 1GL2C 2E76B 1VCKA 1KILE 3JCUE 1IC2A 2W8ZA 3G3ZA 3G6EP 1M8OB 3O8ZA 1P84H 3RBXA 2R3CA 3BASA 4IFFA 2OTLP 1SQPE 3RL0D 1S4XA 3CWBD 2WZ7A 2WT7B 1FZAA 1UIIA 2KUBA 4H0LC 3HE5A 1HBWA 1NYKA 3BCCE 2P2UA 2WTYA 2M5AB 1OW8A 1IK9A 1IFJA 2IYOA 4HJLA 4HM0A 2WITA 3L74D 4NBGD 2OYOA 4UB6H 4L75A 4WVZA 1JMBA 4I1LA 3MUDC 3L75D 3V4WA 1M56D 2P10A 2Y0EA 1YBKA 1L4AC 2H43A 1NGMB 3H1LG 2HLOA 3NFQA 1Y9BA 2ZXXA 4HM6A 3KZIE 1SQQK 3CC2P 4CPGA 3FOUA 1OZHA 4O9BA 4JQ0D 2OGUA 1NOHA 3V2PA 3L72G 1WQLA 1BE3D 2E4PA 1CSBA 1MV8A 3C9IA 3H1HD 2Z4EA 1SQPG 5B66E 2QIWA 3CCJP 1N7SC 1SQQD 5CCHA 3L72J 3H1ID 1W5CE 1E5WA 2IZ1A 1URQA 3H1KE 1Q2NA 5KLIC 3HUSA 4EYYQ 2Q3WA 5GTIE 3BCCG 1NVOA 2LXBA 3HD7B 5GTHH 1YJNP 1ZRTD 2CPSA 4HJGH 2B87A 2GA1A 4DZOA 4C7NA 4LC1A 2FYUG 1IO4A 4BRYB 2OQQA 2NWFA 2H88C 1GL2D 2FKWB 3VMXA 1SJGA 1WMKA 1HWTC 5APXA 2KZJA 4AAYB 5AW9B 3HUSB 2XV5A 3VCPA 5KLVK 1M1JA 3L72E 1SQPD 1N86A 4H44B 2YKQA 2XR8A 1J2JB 4HB1A 2NUMA 1EXIA 4AUWA 5K5GB 5BVZA 2OYIB 3C1LA 5KLVE 3H1KG 4EI2A 1FU1A 3L71D 2R44A 3C8VA 3CCRP 3L70E 1SQXK 2BEQD 3CD6P 3CCEP 1LNQA 5AVWB 4JBZA 1YTZT 3GL0A 2ZAEB 3D89A 1W2EA 2KNCB 3P7KA 1QGKB 1RF0A 1DX7A 2BCCG 2L5GB 2DE6D 3M0DC 5CBNA 2RMZA 1Q82Q 2WPSA 2JWDA 2E76D 5AVTB 4ZNCA 1L4AD 3AEBC 3CWBJ 5KKZC 1PP9D 3A0BE 3VP8A 3N4XA 2HPCB 2YKOA 4GT1A 4OVNF 4R4MA 2E74D 3L74G 3AE5C 1O7NA 1T3UA 4LGDE 4GDOA 2E5TA 4D6TE 2DE5D 3A0HH 1G8JB 1PPJD 1N7SD 1PZQA 1X9VA 1CW5A 4HKVA 1FBMA 1S9KE 1SQBG 3VN0A 2HODA 4PV1C 3G9RA 4LLHA 1UIXA 3N7NA 1NTZE 3B8EB 4PD4E 2CKFA 3CX5E 4N6JA 2IBZE 5DJTB 1OWAA 4YXDC 1BE3G 3I55P 4C7RA 1KQSO 3E7KA 1L0LJ 2OYHB 1RF0C 2V7QH 3QH9A 1PGQA 1S3JA 1SQVG 4C7NB 3D71A 3L75G 2B88A 1SVFA 1KFNA 1NU1G 3V5BA 3L73E 3CXHE 1VQ8P 1Z56A 3OW2O 5KKZB 1NTZJ 2QJKB 4NBFD 5KJ7A 2SPZA 1L0LD 2RN0A 1EDJA 5AVSB 1DD4A 2D2CB 2POHA 3P8MC 3D6YA 3P32A 1RY3A 3M0AA 5APSA 2KLUA 1FZCC 5C39A 2Q7CA 4U7JA 2RKLA 3TK1A 1QEXA 3ITKA 2W6BA 5HL4A 4Y99C 2YXQB 4NBED 2KP8A 2HODB 2W6JH 4H0LD 2WQYC 3Q3DA 5M1BA 1HUCA 1DEBA 3BCCD 3GHGA 2YFIA 2QEXP 1NH4A 2IYPA 1ULJA 3KPEA 1NTZD 2R3SA 3BCCJ 3W68A 1VQNP 3V2NA 1RE3A 1EQ7A 2NRGA 3AE1C 1IFPA 1K05A 3AEFC 2KLVA 2E75D 3L71G 3GCEA 1JY2P 3VYIA 1FZEA 4WBAA 2O01N 1KILD 4IL6H 5E79H 1LP1A 1NTMJ 1G1JA 1PP9G 2N1TC 2Q9IA 1S72P 3CCLP 4PV1D 2QJKC 1M90Q 2N9BA 2JZAA 3OJAB 4HYTB 5TISE 2KIKA 3E1RA 4U3FG 3CC4P 4N3YB 1VQMP 1JY3P 1NKZB 3W67A 4NPEA 4U3FJ 4OH8B 1PPJG 2IFNA 5KAIE 1DEEG 1FQTA 1E79H 4UB8E 3G71P 2R5BA 1FDIA 2HYNA 1R8EA 1YITP 1ZR4A 2W27A 1SQPJ 1MKMA 3H1JJ 2E5YA 1KYOH 4QCKA 3L71E 1NHLA 4WY4D 3WMM0 2E74B 1P84I 1GZLA 2IBZD 1P84D 1KN7A 3R2PA 2P58A 5KJ7D 1Q81Q 2HMKA 1RF1A 2MJZA 3KYQA 1URQC 4U3FE 1O7WA 1LWUA 4BRYA 2K9YA 1YI2P 1QX8A 1HTLC 4PD4H 2FYUD 4NBHD 3H25A 1PPJE 1QLED 1JM1A 2YKPA 1K04A 1M7LA 3HE4B 1L0NG 3GTEA 2FYUE 2YFJA 3S4RA 3VMAA 1NTKK 2E75C 5APWA 3CX5I 5H2FE 1NTMD 1Q86Q 2K88A 3VMGD 1KZUB 1LT1A 3RGUA 1YHQP 1N2DC 1N73C 5AW7B 1RFSA 5EFWB 2XSOA 2N1TD 5AVYB 3WUUA 1LTJC 1KYOE 3GL2A 2A06G 1L0NK 1JCCA 1ZP0C 2C9NY 2XKMA 3SSUA 2M0BA 2K1AA 2PAJA 2FFDB 1T2KC 1U57A 1CI6A 3VMZA 3AZCA 1L2PA 1HF9A 3B4SA 1LT9C 1LTSC 1RF1C 5CBOA 1BDCA 1EDLA 4H13B 5CCHD 1JUNA 2HR3A 2B1XA 4DOJA 1BGYG 3H1IJ 1L0NE 2FYZA 2W6AA 3H1HG 2BCCE 3VCAA 4HM8A 1X8YA 4P1CH 1ULIA 2R32A 3S9OA 1PGJA 3KZIH 2ZT9C 3VTPC 4B86A 3RL0B 1M57D 1HGVA 5AVUB 4HM1A 1EDIA 2KB7P 3VP9A 1IZNB 1KTMA 1N73A 1RE4C 3PTZA 1LTBC 2OYIC 5CXMA 5AVXB 2WPVB 3F5HA 2FYNB 4NB8D 1FJPA 4WY4C 2IBZI 4HM5A 1RHZB 3MTUE 3KXDA 2WSCJ 1VL2A 2BCCD 3L72D 1L0ND 2HMMA 3KHUA 2H7HA 1KQLA 3RL0C 1JY3O 2FFDC 1YQ3C 3L73J 5CJ4A 4I7ZC 3V4QA 2KZIA 2OYHA 1JM0A 1PV3A 2AEJA 1EC5A 1RF1B 1ZOYC 2GUVA 3HTKB 1DD3A 4D6TG 3FGAD 1JB0J 3OAKA 4U3FD 3GF7A 3H1HE 1S1CX 1OW7A 1ZXGA 2V7QJ 3EFFK 1BE3E 4AQRD 3SWYA 3PP5A 2BASA 2K9JA 3TGUG 4AYCA 2WSEH 3C0DA 1NTKG 3BRVB 5H2FH 3LIDA 2P1JA 3MP7B 2JR8A 1M1JB 2RH0A 2XDJA 2PRRA 2IBZG 4QDFA 2QM7A 3AE8C 1SQXJ 3PH0A 1ZW0A 1PIXA 1JNMA 3AE7C 4HM2A 1YTZI 5CMZA 2IFMA 4WY4A 2ZFCA 1YJWP 1EG9A 3H1JG 1GW3A 1KILC 1KFMA 1SQVD 1FZCA 1DIPA 1OW6A 2YVJB 1OFCX 3NTNA 2YFLA 4GOEA 2K3RA 3WUTA 2A45H 3CX5H 4EIJA 1GTWA 4HM3A 1DH3A 4Y99B 2M8RA 4KT0J 2HMOA 1J1EC 2NPSC 3EFGA 1Y47A 2QE7H 2C0XA 3TGUE 1SQVK 2Y0CA 1VQ5P 4H44D 3AE9C 1SQBD 1A02J 3H1IE 3I5CA 1BCCG 2YMKA 1PFIA 1SQXG 1VQ6P 4M3LA 4ASWA 1JOCA 3L70J 5AVVB 3RK3B 3H1LJ 3T97B 1HJ0A 3JCUH 4L76A 3AEEC 3M91A 3H1LE 3N0QA 3L36A 1OMIA 1PP9E 4QUQA 4YPCA 2YXRB 2WT7A 3M9QA 2K37A 3L71J 2PP6A 1J1EB 2NPSB 2I7FA 1SQBK 3RL0g 4NPDA 1LTGC 2KYVA 3LW5J 2ZYAA 5KJ7C 1T6AA 4UB6E 1FDMA 4A7PA 3CC7P 1IFMA 3L35A 1URQD 1YQ4C 1K9MQ 1LGHB 1O7HA 3AE3C 3AEGC 4EMJB 4AIVA 1RH5B 4QDDA 2C9LY 5AVQB 1AA0A 3FX0A 5AW1B 1L4AB 1FAVA 3M9HA 4OGQD 5AEWA 4IL6X 2H89C 1VM9A 1KB9I 2FYUK 2HMJA 3EWKA 1L0LE 3EQ2A 3CWBE 1BCCD 2AXTE 3B5ND 5TJHA 4ZKPA 1VF5B 2I1JA 1SQXE 4KJMA 2XSHA 4IFMA 2KK7A 2FXOA 4BWNA 4C46A 5APQA 3EN1A 1LTTC 3NXSA 2WSEJ 2OTJP 3ZDMA 2E74C 5GTIH 1G2CB 1JMMA 5BU5A 1SQPK 2YMYA 5B66H 1QVFO 1S2EA 3PJSK 1ZN5A 3MD0A 1MFTA 4GOFA 2Q6QA 1N7SA 1X0TA 5AVRB 2HMNA 1VQPP 3V6IA 1NTKD 1AFOA 1ZRTE 2M3BA 1SQQG 1FDOA 5KLVG 2WWWA 1JTHB 1KQGB 1NU1K 3BATA 1UUVA 4P1BH 5AW4B 2ITAA 2R5DA 4RO0A 2PFXA 1JTHA 2A06D 3HUSC 3BVHA 2NPSD 1NAYA 2NVGA 1BDDA 2YNYA 2KNCA 4H44C 2ZT9D 2B89A 2A06E 3FXEA 1OXZA 1T3JA 2ZYDA 1GK4A 3PLNA 5E79E 2H8PD 3CCUP 4JF7A 1LP1B 4EOTA 4GKGA 1JCDA 1NO4A 4NPFX 1LTJB 1FS0E 1MZ9A 3CI9A 1EDKA 4JPZB 1CI6B 5TISH 2QSIA 1EZVD 1IFIA 3H1JD 5KAIH 4OGQB 2QA4P 2YIUB 1KC8Q 4IOIH 5AW0B 2QG4A 1HJBA 2BMOA 3S1KA 1Q90D 2W83C 2JDIH 1A02F 3GLMA 3MHVA 1AV1A 1H0TB 1M1JC 4OWFA 1OVVA 1VF5D 2ZVOB 2E43A 1J1DC 3TYYA 2VRSA 3B5NC 2M3EA 1H0TA 4Y28J 3H1LD 2QRXA 2I8DA 4OGQC 1T8ZA 1NWQA 2J5UA 4NBBD 4JYCA 4ZKUA 2OTKE 3V2RA 2WSFJ 1M1KQ 3AE2C 3TDKA 4HM4A 1BCCJ 1ZR2A 1FC2C 3A0BH 1PGOA 1KB9H 2Q3EA 2P7JA 3UIAA 1LT9B 3B5NB 1O7MA 1QL2A 2C0WA 1SS1A 2IX7C 3B71A 3SFEC 3GMAA 4QDCA 2NVFA 1IFDA 3QWOC 2YIUC 3GOBA 3AE4C 4PJ0H 3Q1MA 2FXPA 2BEZF 3RK3C 1U7MA 3EQQA 1N7SB 3JC22 3JSVC 4WB4A 1J1DB 2J58A 3L70G 4QDFB 3B5NA 1KB9D 3SWFA 2QJYB 1RQUA 2FXMA 1H8AA 3FWLA 1OVUA 3IF4A 5KAFH 3F89A 2FYNC 2NUKA 2XNDH 5AW6B 1NTMG 3ABVC 3Q5SA 2L91A 4H13D 1BSNA 1BGYD 1KYOD 1KV4A 1ZV8A 2DE7D 4PD4D 3TGUJ 1D7MA 3PRJA 2YO3A 3U59A 1NTKE 4XE5B 3MZWB 3U1CA 3FXDA 4YTPC 1GL2A 2A45G 3VMYA 1S5LE 1YIJP 2OYIA 4QURA 2IDBA 2YO2A 3L74E 2J59M 4DT0A 1OVRA 4I7ZB 3L37A 5B5EE 3P8CD 2HG5D 1Q90C 5CCGC 2KSJA 1HGZA 2FFDA 1PL5A 2KSEA 2WPRA 2GBWA 1FOSF 2KS1B 3WU2E 2JO1A 2NPSA 1EZVI 1GD2E 1ZMEC 1SQXD 1UUWA 3CXHH 1FZFA 3TNUB 1HVVA 1Y8AA 1S9KD 5APYA 1BCCE 5KAFE 1IK7A 4R4LA 3GKEA 2K9JB 4IL6E 3MUDA 1R5LA 1JY2N 4D6TD 1KYOI 1JY2O 2BMQA 4I2LC 3WUVA 2WPQA 3AECC 4TLFA
chains in the Genus database with same CATH topology
2YMKA 3RK3E 3L75E 1KB9E 3AE1C 3T97B 1HJ0A 1K05A 3AEFC 3D6ZA 4NBCD 2JP3A 3AEEC 2E75D 3GB4A 3H1LE 3N0QA 1OMIA 1PP9E 3GCEA 4QUQA 5L8RJ 2E76C 2I7FA 4XFJA 3RL0g 2E76B 1VCKA 1KILE 1S5LX 3LW5J 5AEUA 4PV1D 2QJKC 2JZAA 1GMJA 1YQ4C 1SQPE 1O7HA 4H13C 2XRXA 3AE3C 3AEGC 4EMJB 4AIVA 4QDDA 2E4QA 2G8YA 4OGQD 5AEWA 4IL6X 4H0LC 2H89C 1VM9A 1O7PA 1NYKA 3BCCE 1OW8A 2HMJA 3EWKA 1FQTA 1L0LE 4HJLA 4HM0A 3CWBE 3VMHD 4NBGD 4NB9D 1NYHA 1FDIA 1R8EA 1VF5B 1SQXE 2NVEA 2P10A 2XSHA 1MKMA 1AJYA 3EN1A 4QCKA 1NGMB 2WSEJ 3L71E 1Y9BA 4HM6A 3GZYA 2E74B 4HM7A 2JO6A 2E74C 3FOUA 3GZXA 2B24A 3AEAC 1SQQE 3Q2YA 2E4PA 1WQLA 2HMNA 2HMKA 1O7WA 4U3FE 2QIWA 2K9YA 3AEDC 1ZRTE 2QPZA 1EZVE 1FDOA 1VF5C 4NBHD 3H1KE 1KQGB 2G3AA 3H25A 2QJPC 5KLIC 1PPJE 1UUVA 4P1BH 2Q3WA 1JM1A 1K04A 3GTEA 3DQYA 2FYUE 2YFJA 2O01J 2E75C 2NVGA 4H44C 2ZT9D 2A06E 2OQQA 2NWFA 3VMGD 2H88C 1RFSA 2XSOA 1SJGA 1WMKA 3GF3A 2D2CD 1KYOE 3GL2A 2QSIA 2BMRA 1ZP0C 2MKVA 4AAYB 4OGQB 1KORA 2NZ2A 4H0LB 3VCPA 1U57A 3L72E 3AZCA 2BMOA 4H44B 1HF9A 1Q90D 5BOKA 2XR8A 3GTSA 2NUMA 3GLMA 1EXIA 1VF5D 1NDOA 5KLVE 4H13B 2B1XA 3C8VA 3VMID 3L70E 1L0NE 4Y28J 2BEQD 3AE6C 4OGQC 2BCCE 3D70A 3VCAA 4HM8A 3GL0A 4P1CH 2J5UA 4TT3H 2ZYLA 1ULIA 4NBBD 3D89A 3S9OA 4Z1MH 2ZT9C 2WSFJ 4QUPA 3AE2C 2DE6D 4HM4A 3IN6A 4HM1A 4PV1B 1KTMA 2E76D 1O7MA 5CXMA 3AEBC 2WPVB 5KKZC 4NB8D 1RQVA 3B71A 3SFEC 4HM5A 2WSCJ 1VL2A 3GMAA 4QDCA 2NVFA 1RIEA 2HMMA 4R4MA 2E74D 3AE5C 2YIUC 1O7NA 3GOBA 3H1JE 3AE4C 3Q5RA 1YQ3C 3Q1MA 4NBDD 4GDOA 3Q5PA 2FXPA 2BEZF 2DE5D 4NBAD 1G8JB 4I7ZC 3EQQA 1PV3A 4HKVA 1ZOYC 3SFDC 4QDFB 1DD3A 1NTME 3FGAD 1JB0J 3GF7A 4PV1C 2V7QJ 1S1CX 1OW7A 1RQUA 3H1HE 3G9RA 1BE3E 1UIXA 3O6QA 2D2CC 2FYNC 2NUKA 2FBWC 1NTZE 1SQBE 3ABVC 3Q5SA 4PD4E 2CKFA 4H13D 3CX5E 2E75B 1SQVE 2IBZE 3C0DA 4YXDC 1TU3F 2DE7D 1KMIZ 2HMLA 3D71A 1KQFB 4QDFA 1NTKE 3AE8C 3L73E 1PIXA 4YTPC 3AE7C 3CXHE 4HM2A 4QURA 2IDBA 4RKUJ 1EG9A 3L74E 2QJYC 1NU1E 4NBFD 1O7GA 1P84E 1DD4A 4I7ZB 3R4YA 2D2CB 1DIPA 3IAOA 1OW6A 1Q90C 3D6YA 2YVJB 1PL5A 2GBWA 2YFLA 4U7JA 2JO1A 1ZMEC 1UUWA 5HL4A 4HM3A 4NBED 4KT0J 2HMOA 1BCCE 1IK7A 4R4LA 3GKEA 4H0LD 1G8KB 2WQYC 3Q3DA 5M1BA 3TGUE 2YFIA 1EXJA 4H44D 2GBXA 1ULJA 2ZT9B 2BMQA 3AE9C 3H1IE 3AECC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZX A;  1BE3 E;  1VF5 D;  1NDO A;  5KLV E;  2FYN C;  3L75 E;  2NUK A;  1KB9 E;  1NTZ E;  1SQB E;  2B24 A;  4H13 B;  4PD4 E;  4NBC D;  2CKF A;  2B1X A;  4H13 D;  1SQQ E;  3CX5 E;  2E75 B;  1SQV E;  2E4P A;  3C8V A;  1WQL A;  2HMN A;  2E75 D;  3GB4 A;  2HMK A;  2IBZ E;  3C0D A;  3H1L E;  3N0Q A;  1PP9 E;  3GCE A;  4QUQ A;  3L70 E;  3VMI D;  1L0N E;  4Y28 J;  5L8R J;  1O7W A;  4U3F E;  2QIW A;  2K9Y A;  2BCC E;  3VCA A;  4HM8 A;  2DE7 D;  1ZRT E;  2I7F A;  3GL0 A;  4P1C H;  2QPZ A;  2ZYL A;  2E76 B;  1ULI A;  1EZV E;  1VCK A;  3D89 A;  2HML A;  4NBB D;  4NBH D;  3H1K E;  1S5L X;  4QDF A;  3LW5 J;  2QJP C;  5KLI C;  1NTK E;  1PPJ E;  5AEU A;  4PV1 D;  1UUV A;  4P1B H;  2QJK C;  2WSF J;  4QUP A;  2JZA A;  2Q3W A;  1JM1 A;  3L73 E;  2DE6 D;  3CXH E;  4HM2 A;  4HM4 A;  4HM1 A;  3GTE A;  4QUR A;  3DQY A;  2FYU E;  1SQP E;  2YFJ A;  1O7H A;  4RKU J;  1EG9 A;  2XRX A;  4PV1 B;  3L74 E;  2O01 J;  2QJY C;  4EMJ B;  4AIV A;  1NU1 E;  4NBF D;  1O7M A;  2E76 D;  4QDD A;  2NVG A;  1O7G A;  1P84 E;  5CXM A;  2WPV B;  4I7Z B;  2E4Q A;  4OGQ D;  2D2C B;  5KKZ C;  4NB8 D;  5AEW A;  1Q90 C;  2ZT9 D;  2A06 E;  4IL6 X;  2NWF A;  2YVJ B;  3VMG D;  4HM5 A;  1VM9 A;  1O7P A;  2WSC J;  1NYK A;  3BCC E;  1RFS A;  2HMJ A;  2XSO A;  1SJG A;  1FQT A;  1L0L E;  2GBW A;  2YFL A;  4QDC A;  2NVF A;  4HJL A;  1RIE A;  4HM0 A;  3CWB E;  2HMM A;  2D2C D;  3VMH D;  1KYO E;  4NBG D;  2E74 D;  3GL2 A;  2YIU C;  4NB9 D;  1O7N A;  3GOB A;  1UUW A;  2QSI A;  2BMR A;  3H1J E;  5HL4 A;  4NBD D;  4HM3 A;  4NBE D;  1VF5 B;  4AAY B;  1SQX E;  4OGQ B;  2NVE A;  2DE5 D;  4NBA D;  4KT0 J;  2XSH A;  1G8J B;  2HMO A;  1BCC E;  3EQQ A;  4H0L B;  3GKE A;  4H0L D;  1G8K B;  3VCP A;  3EN1 A;  3L72 E;  4QCK A;  3AZC A;  3TGU E;  4HKV A;  2BMO A;  2WSE J;  3L71 E;  2YFI A;  4HM6 A;  4H44 B;  1Q90 D;  2GBX A;  4H44 D;  4QDF B;  3GZY A;  2XR8 A;  5BOK A;  1ULJ A;  2ZT9 B;  2E74 B;  1NTM E;  2BMQ A;  1JB0 J;  3GTS A;  2NUM A;  4HM7 A;  2JO6 A;  3H1I E;  3H1H E;  3FOU A; 
#chains in the Genus database with same CATH topology
 1L4A A;  3L4F A;  2HPC A;  3RK3 E;  3L75 E;  3NMD A;  1KB9 E;  3HD7 D;  3K5B A;  1PGP A;  2A45 I;  3LIE A;  4NBC D;  2LKM A;  2JP3 A;  1AVO A;  1T2K D;  3GB4 A;  2WSS H;  1JY3 N;  2M5A A;  2N1T A;  3L70 D;  1U7J A;  1S5L H;  3CME P;  1GL2 B;  2E76 C;  1NTZ K;  4XFJ A;  1VPC A;  1GU5 A;  3GHG B;  1S5L X;  3M9B A;  5AEU A;  1IFN A;  5CCH C;  1GMJ A;  3MGN A;  2QJP B;  1JEK A;  3CCS P;  4H13 C;  2XRX A;  1HH0 A;  3RK3 D;  4N78 D;  4RJT A;  1SFC D;  2KS1 A;  2JWA A;  2E4Q A;  2G8Y A;  2O1K A;  5KLI B;  1O7P A;  1G2C A;  3TGU D;  4BXL A;  2N1T B;  1NU1 J;  2KI7 B;  1LWU B;  2P67 A;  3L75 J;  3VMH D;  2ZVN B;  4MN4 C;  5KLV J;  4NB9 D;  1SQV J;  1SQQ J;  1NYH A;  3GW6 A;  2UWJ E;  3CCM P;  3H1H J;  2JKV A;  1L0L G;  2XZR A;  1VQ4 P;  2NVE A;  1URQ B;  3CWB G;  1AJY A;  1BE3 J;  3RK2 B;  4RES B;  4UB8 H;  2WSC H;  1MUU A;  2O1J A;  2KOG A;  4DJG A;  3M06 A;  3GZY A;  5CCG D;  4HM7 A;  2WVR A;  1NKN A;  2JO6 A;  3GZX A;  3CPW O;  3CLQ A;  1LWU C;  2B24 A;  1LTI C;  3AEA C;  1SQQ E;  3RBZ A;  3Q2Y A;  1X22 A;  1LTA C;  4YXW H;  5B5E H;  3TF5 A;  3VOP A;  3AED C;  2Z5H A;  1VDF A;  5APV A;  2QPZ A;  1EZV E;  1AQT A;  1VF5 C;  3L74 J;  1CZQ A;  2XNX A;  2G3A A;  3WU2 H;  2QJP C;  2AXT H;  3TSI A;  2WMM A;  1BGY E;  2N9Y B;  1L0L K;  3CCQ P;  3DQY A;  3HD7 C;  3HE5 B;  1N8R Q;  2O01 J;  3L73 D;  4K3A A;  1VQO P;  3SWK A;  2AEF A;  1LTJ A;  1SP4 A;  1G1I A;  1GK6 A;  1L0N J;  2BCC J;  1NJI Q;  3GF3 A;  1OX3 A;  2D2C D;  1WT6 A;  2BMR A;  2MKV A;  4L74 A;  4ASV A;  3HE4 A;  2FYU J;  1KOR A;  2NZ2 A;  4W80 A;  3H32 A;  3CL3 D;  4H0L B;  1SFC C;  2OAR A;  3H6P A;  2O3J A;  5AW8 B;  2CPB A;  5BOK A;  5KTB A;  3H1K J;  3GTS A;  1X79 B;  1EZV G;  1NDO A;  1JO5 A;  2W90 A;  1PP9 J;  1KD1 Q;  1LT9 A;  1ZLL A;  3E1I A;  1VQL P;  3VMI D;  4KHX A;  3A0H E;  1VQ9 P;  3AE6 C;  1NTK J;  3HRN A;  3D70 A;  2Y9Y A;  1AVY A;  3RK2 D;  4N78 E;  1SFC B;  4TT3 H;  2ZYL A;  1FZB A;  1K73 Q;  1FZG A;  4I6M C;  3HD7 A;  2E42 A;  2PGD A;  4Z1M H;  4DCK A;  1FOS E;  1YYC A;  4GOD A;  2IPP A;  4QUP A;  1FE6 A;  2AEM A;  5AW5 B;  1RE4 A;  3IN6 A;  4D6T J;  1USD A;  4GIF A;  5APU A;  5AVZ B;  5CJ0 A;  4PV1 B;  2HFE D;  1Q7Y Q;  2I1K A;  5AW3 B;  3M0D A;  5AW2 B;  2LXC B;  3HTK A;  1QL1 A;  1RQV A;  1GW4 A;  2WSF H;  1MFZ A;  2FY8 A;  4QMA A;  3CMA P;  2GUS A;  3OA7 A;  1RIE A;  1SLQ A;  3FWN A;  3MIW A;  2OYH C;  1SFC A;  3H1J E;  3Q5R A;  4NBD D;  3G4S P;  1H89 A;  3Q5P A;  5KLV D;  1XTC C;  3LW5 H;  4NBA D;  4JYB A;  1NU1 D;  2AXC A;  2LR2 A;  3O6Q B;  3SFD C;  1VQK P;  4WY4 B;  1NTZ G;  2ZXE B;  3V2Q A;  1NTM E;  2XU6 A;  3IR9 A;  2IZ0 A;  1USE A;  3PHL A;  3I56 P;  2B9B A;  2V4H A;  2ZJS E;  3A5T A;  3GHG C;  3O6Q A;  2D2C C;  3USS A;  3KQG A;  2FBW C;  1SQB E;  1N7L A;  3P8C E;  1VQ7 P;  1NTM K;  2E75 B;  1SQV E;  1FZC B;  5DJU B;  1RE3 C;  4XA4 A;  1BGY J;  3H1I G;  3L73 G;  1TU3 F;  3CX5 D;  2Q1K A;  5CHX A;  1N73 B;  1KMI Z;  4HH2 A;  2HML A;  1IJD B;  2JEE A;  1KQF B;  3CXH I;  5BU8 B;  2GM4 A;  1GDT A;  3T97 A;  4K35 A;  3TNU A;  4PJ0 E;  1KIL A;  2QVA A;  2JJL A;  1SQB J;  4RKU J;  1GU4 A;  4IFD K;  5CCG A;  2QJY C;  1NU1 E;  2O01 H;  1P84 E;  1O7G A;  3H1K D;  3R4Y A;  3IAO A;  3RK2 C;  3H32 B;  2QM8 A;  1XTG B;  1AQ5 A;  4EDF A;  3CXH D;  1YJ9 P;  1NAF A;  2ZYG A;  1W2B O;  4W7Z A;  1BSH A;  2B87 B;  2Y9Z A;  3II6 A;  3A7O A;  3A3Y B;  5GTH E;  3CCV P;  1G8K B;  1KIL B;  2DW3 A;  1WRG A;  1H88 A;  4ZMD A;  3A2A A;  1EXJ A;  2GBX A;  2ZT9 B;  2Q5U A;  1R5S A;  3KDP B;  4WWI A;  5APT A;  2CK3 H;  4PD4 I;  3IFM A;  1FJK A;  1K8A Q;  4HKZ H;  3D6Z A;  4L73 A;  3GG2 A;  2KXP B;  3BRT B;  2Q3I A;  3U1A A;  1OIP A;  1QVG O;  2Y0D A;  5L8R J;  2Z5I A;  1LJ2 A;  4W7Y A;  1GL2 C;  2E76 B;  1VCK A;  1KIL E;  3JCU E;  1IC2 A;  2W8Z A;  3G3Z A;  3G6E P;  1M8O B;  3O8Z A;  1P84 H;  3RBX A;  2R3C A;  3BAS A;  4IFF A;  2OTL P;  1SQP E;  3RL0 D;  1S4X A;  3CWB D;  2WZ7 A;  2WT7 B;  1FZA A;  1UII A;  2KUB A;  4H0L C;  3HE5 A;  1HBW A;  1NYK A;  3BCC E;  2P2U A;  2WTY A;  2M5A B;  1OW8 A;  1IK9 A;  1IFJ A;  2IYO A;  4HJL A;  4HM0 A;  2WIT A;  3L74 D;  4NBG D;  2OYO A;  4UB6 H;  4L75 A;  4WVZ A;  1JMB A;  4I1L A;  3MUD C;  3L75 D;  3V4W A;  1M56 D;  2P10 A;  2Y0E A;  1YBK A;  1L4A C;  2H43 A;  1NGM B;  3H1L G;  2HLO A;  3NFQ A;  1Y9B A;  2ZXX A;  4HM6 A;  3KZI E;  1SQQ K;  3CC2 P;  4CPG A;  3FOU A;  1OZH A;  4O9B A;  4JQ0 D;  2OGU A;  1NOH A;  3V2P A;  3L72 G;  1WQL A;  1BE3 D;  2E4P A;  1CSB A;  1MV8 A;  3C9I A;  3H1H D;  2Z4E A;  1SQP G;  5B66 E;  2QIW A;  3CCJ P;  1N7S C;  1SQQ D;  5CCH A;  3L72 J;  3H1I D;  1W5C E;  1E5W A;  2IZ1 A;  1URQ A;  3H1K E;  1Q2N A;  5KLI C;  3HUS A;  4EYY Q;  2Q3W A;  5GTI E;  3BCC G;  1NVO A;  2LXB A;  3HD7 B;  5GTH H;  1YJN P;  1ZRT D;  2CPS A;  4HJG H;  2B87 A;  2GA1 A;  4DZO A;  4C7N A;  4LC1 A;  2FYU G;  1IO4 A;  4BRY B;  2OQQ A;  2NWF A;  2H88 C;  1GL2 D;  2FKW B;  3VMX A;  1SJG A;  1WMK A;  1HWT C;  5APX A;  2KZJ A;  4AAY B;  5AW9 B;  3HUS B;  2XV5 A;  3VCP A;  5KLV K;  1M1J A;  3L72 E;  1SQP D;  1N86 A;  4H44 B;  2YKQ A;  2XR8 A;  1J2J B;  4HB1 A;  2NUM A;  1EXI A;  4AUW A;  5K5G B;  5BVZ A;  2OYI B;  3C1L A;  5KLV E;  3H1K G;  4EI2 A;  1FU1 A;  3L71 D;  2R44 A;  3C8V A;  3CCR P;  3L70 E;  1SQX K;  2BEQ D;  3CD6 P;  3CCE P;  1LNQ A;  5AVW B;  4JBZ A;  1YTZ T;  3GL0 A;  2ZAE B;  3D89 A;  1W2E A;  2KNC B;  3P7K A;  1QGK B;  1RF0 A;  1DX7 A;  2BCC G;  2L5G B;  2DE6 D;  3M0D C;  5CBN A;  2RMZ A;  1Q82 Q;  2WPS A;  2JWD A;  2E76 D;  5AVT B;  4ZNC A;  1L4A D;  3AEB C;  3CWB J;  5KKZ C;  1PP9 D;  3A0B E;  3VP8 A;  3N4X A;  2HPC B;  2YKO A;  4GT1 A;  4OVN F;  4R4M A;  2E74 D;  3L74 G;  3AE5 C;  1O7N A;  1T3U A;  4LGD E;  4GDO A;  2E5T A;  4D6T E;  2DE5 D;  3A0H H;  1G8J B;  1PPJ D;  1N7S D;  1PZQ A;  1X9V A;  1CW5 A;  4HKV A;  1FBM A;  1S9K E;  1SQB G;  3VN0 A;  2HOD A;  4PV1 C;  3G9R A;  4LLH A;  1UIX A;  3N7N A;  1NTZ E;  3B8E B;  4PD4 E;  2CKF A;  3CX5 E;  4N6J A;  2IBZ E;  5DJT B;  1OWA A;  4YXD C;  1BE3 G;  3I55 P;  4C7R A;  1KQS O;  3E7K A;  1L0L J;  2OYH B;  1RF0 C;  2V7Q H;  3QH9 A;  1PGQ A;  1S3J A;  1SQV G;  4C7N B;  3D71 A;  3L75 G;  2B88 A;  1SVF A;  1KFN A;  1NU1 G;  3V5B A;  3L73 E;  3CXH E;  1VQ8 P;  1Z56 A;  3OW2 O;  5KKZ B;  1NTZ J;  2QJK B;  4NBF D;  5KJ7 A;  2SPZ A;  1L0L D;  2RN0 A;  1EDJ A;  5AVS B;  1DD4 A;  2D2C B;  2POH A;  3P8M C;  3D6Y A;  3P32 A;  1RY3 A;  3M0A A;  5APS A;  2KLU A;  1FZC C;  5C39 A;  2Q7C A;  4U7J A;  2RKL A;  3TK1 A;  1QEX A;  3ITK A;  2W6B A;  5HL4 A;  4Y99 C;  2YXQ B;  4NBE D;  2KP8 A;  2HOD B;  2W6J H;  4H0L D;  2WQY C;  3Q3D A;  5M1B A;  1HUC A;  1DEB A;  3BCC D;  3GHG A;  2YFI A;  2QEX P;  1NH4 A;  2IYP A;  1ULJ A;  3KPE A;  1NTZ D;  2R3S A;  3BCC J;  3W68 A;  1VQN P;  3V2N A;  1RE3 A;  1EQ7 A;  2NRG A;  3AE1 C;  1IFP A;  1K05 A;  3AEF C;  2KLV A;  2E75 D;  3L71 G;  3GCE A;  1JY2 P;  3VYI A;  1FZE A;  4WBA A;  2O01 N;  1KIL D;  4IL6 H;  5E79 H;  1LP1 A;  1NTM J;  1G1J A;  1PP9 G;  2N1T C;  2Q9I A;  1S72 P;  3CCL P;  4PV1 D;  2QJK C;  1M90 Q;  2N9B A;  2JZA A;  3OJA B;  4HYT B;  5TIS E;  2KIK A;  3E1R A;  4U3F G;  3CC4 P;  4N3Y B;  1VQM P;  1JY3 P;  1NKZ B;  3W67 A;  4NPE A;  4U3F J;  4OH8 B;  1PPJ G;  2IFN A;  5KAI E;  1DEE G;  1FQT A;  1E79 H;  4UB8 E;  3G71 P;  2R5B A;  1FDI A;  2HYN A;  1R8E A;  1YIT P;  1ZR4 A;  2W27 A;  1SQP J;  1MKM A;  3H1J J;  2E5Y A;  1KYO H;  4QCK A;  3L71 E;  1NHL A;  4WY4 D;  3WMM 0;  2E74 B;  1P84 I;  1GZL A;  2IBZ D;  1P84 D;  1KN7 A;  3R2P A;  2P58 A;  5KJ7 D;  1Q81 Q;  2HMK A;  1RF1 A;  2MJZ A;  3KYQ A;  1URQ C;  4U3F E;  1O7W A;  1LWU A;  4BRY A;  2K9Y A;  1YI2 P;  1QX8 A;  1HTL C;  4PD4 H;  2FYU D;  4NBH D;  3H25 A;  1PPJ E;  1QLE D;  1JM1 A;  2YKP A;  1K04 A;  1M7L A;  3HE4 B;  1L0N G;  3GTE A;  2FYU E;  2YFJ A;  3S4R A;  3VMA A;  1NTK K;  2E75 C;  5APW A;  3CX5 I;  5H2F E;  1NTM D;  1Q86 Q;  2K88 A;  3VMG D;  1KZU B;  1LT1 A;  3RGU A;  1YHQ P;  1N2D C;  1N73 C;  5AW7 B;  1RFS A;  5EFW B;  2XSO A;  2N1T D;  5AVY B;  3WUU A;  1LTJ C;  1KYO E;  3GL2 A;  2A06 G;  1L0N K;  1JCC A;  1ZP0 C;  2C9N Y;  2XKM A;  3SSU A;  2M0B A;  2K1A A;  2PAJ A;  2FFD B;  1T2K C;  1U57 A;  1CI6 A;  3VMZ A;  3AZC A;  1L2P A;  1HF9 A;  3B4S A;  1LT9 C;  1LTS C;  1RF1 C;  5CBO A;  1BDC A;  1EDL A;  4H13 B;  5CCH D;  1JUN A;  2HR3 A;  2B1X A;  4DOJ A;  1BGY G;  3H1I J;  1L0N E;  2FYZ A;  2W6A A;  3H1H G;  2BCC E;  3VCA A;  4HM8 A;  1X8Y A;  4P1C H;  1ULI A;  2R32 A;  3S9O A;  1PGJ A;  3KZI H;  2ZT9 C;  3VTP C;  4B86 A;  3RL0 B;  1M57 D;  1HGV A;  5AVU B;  4HM1 A;  1EDI A;  2KB7 P;  3VP9 A;  1IZN B;  1KTM A;  1N73 A;  1RE4 C;  3PTZ A;  1LTB C;  2OYI C;  5CXM A;  5AVX B;  2WPV B;  3F5H A;  2FYN B;  4NB8 D;  1FJP A;  4WY4 C;  2IBZ I;  4HM5 A;  1RHZ B;  3MTU E;  3KXD A;  2WSC J;  1VL2 A;  2BCC D;  3L72 D;  1L0N D;  2HMM A;  3KHU A;  2H7H A;  1KQL A;  3RL0 C;  1JY3 O;  2FFD C;  1YQ3 C;  3L73 J;  5CJ4 A;  4I7Z C;  3V4Q A;  2KZI A;  2OYH A;  1JM0 A;  1PV3 A;  2AEJ A;  1EC5 A;  1RF1 B;  1ZOY C;  2GUV A;  3HTK B;  1DD3 A;  4D6T G;  3FGA D;  1JB0 J;  3OAK A;  4U3F D;  3GF7 A;  3H1H E;  1S1C X;  1OW7 A;  1ZXG A;  2V7Q J;  3EFF K;  1BE3 E;  4AQR D;  3SWY A;  3PP5 A;  2BAS A;  2K9J A;  3TGU G;  4AYC A;  2WSE H;  3C0D A;  1NTK G;  3BRV B;  5H2F H;  3LID A;  2P1J A;  3MP7 B;  2JR8 A;  1M1J B;  2RH0 A;  2XDJ A;  2PRR A;  2IBZ G;  4QDF A;  2QM7 A;  3AE8 C;  1SQX J;  3PH0 A;  1ZW0 A;  1PIX A;  1JNM A;  3AE7 C;  4HM2 A;  1YTZ I;  5CMZ A;  2IFM A;  4WY4 A;  2ZFC A;  1YJW P;  1EG9 A;  3H1J G;  1GW3 A;  1KIL C;  1KFM A;  1SQV D;  1FZC A;  1DIP A;  1OW6 A;  2YVJ B;  1OFC X;  3NTN A;  2YFL A;  4GOE A;  2K3R A;  3WUT A;  2A45 H;  3CX5 H;  4EIJ A;  1GTW A;  4HM3 A;  1DH3 A;  4Y99 B;  2M8R A;  4KT0 J;  2HMO A;  1J1E C;  2NPS C;  3EFG A;  1Y47 A;  2QE7 H;  2C0X A;  3TGU E;  1SQV K;  2Y0C A;  1VQ5 P;  4H44 D;  3AE9 C;  1SQB D;  1A02 J;  3H1I E;  3I5C A;  1BCC G;  2YMK A;  1PFI A;  1SQX G;  1VQ6 P;  4M3L A;  4ASW A;  1JOC A;  3L70 J;  5AVV B;  3RK3 B;  3H1L J;  3T97 B;  1HJ0 A;  3JCU H;  4L76 A;  3AEE C;  3M91 A;  3H1L E;  3N0Q A;  3L36 A;  1OMI A;  1PP9 E;  4QUQ A;  4YPC A;  2YXR B;  2WT7 A;  3M9Q A;  2K37 A;  3L71 J;  2PP6 A;  1J1E B;  2NPS B;  2I7F A;  1SQB K;  3RL0 g;  4NPD A;  1LTG C;  2KYV A;  3LW5 J;  2ZYA A;  5KJ7 C;  1T6A A;  4UB6 E;  1FDM A;  4A7P A;  3CC7 P;  1IFM A;  3L35 A;  1URQ D;  1YQ4 C;  1K9M Q;  1LGH B;  1O7H A;  3AE3 C;  3AEG C;  4EMJ B;  4AIV A;  1RH5 B;  4QDD A;  2C9L Y;  5AVQ B;  1AA0 A;  3FX0 A;  5AW1 B;  1L4A B;  1FAV A;  3M9H A;  4OGQ D;  5AEW A;  4IL6 X;  2H89 C;  1VM9 A;  1KB9 I;  2FYU K;  2HMJ A;  3EWK A;  1L0L E;  3EQ2 A;  3CWB E;  1BCC D;  2AXT E;  3B5N D;  5TJH A;  4ZKP A;  1VF5 B;  2I1J A;  1SQX E;  4KJM A;  2XSH A;  4IFM A;  2KK7 A;  2FXO A;  4BWN A;  4C46 A;  5APQ A;  3EN1 A;  1LTT C;  3NXS A;  2WSE J;  2OTJ P;  3ZDM A;  2E74 C;  5GTI H;  1G2C B;  1JMM A;  5BU5 A;  1SQP K;  2YMY A;  5B66 H;  1QVF O;  1S2E A;  3PJS K;  1ZN5 A;  3MD0 A;  1MFT A;  4GOF A;  2Q6Q A;  1N7S A;  1X0T A;  5AVR B;  2HMN A;  1VQP P;  3V6I A;  1NTK D;  1AFO A;  1ZRT E;  2M3B A;  1SQQ G;  1FDO A;  5KLV G;  2WWW A;  1JTH B;  1KQG B;  1NU1 K;  3BAT A;  1UUV A;  4P1B H;  5AW4 B;  2ITA A;  2R5D A;  4RO0 A;  2PFX A;  1JTH A;  2A06 D;  3HUS C;  3BVH A;  2NPS D;  1NAY A;  2NVG A;  1BDD A;  2YNY A;  2KNC A;  4H44 C;  2ZT9 D;  2B89 A;  2A06 E;  3FXE A;  1OXZ A;  1T3J A;  2ZYD A;  1GK4 A;  3PLN A;  5E79 E;  2H8P D;  3CCU P;  4JF7 A;  1LP1 B;  4EOT A;  4GKG A;  1JCD A;  1NO4 A;  4NPF X;  1LTJ B;  1FS0 E;  1MZ9 A;  3CI9 A;  1EDK A;  4JPZ B;  1CI6 B;  5TIS H;  2QSI A;  1EZV D;  1IFI A;  3H1J D;  5KAI H;  4OGQ B;  2QA4 P;  2YIU B;  1KC8 Q;  4IOI H;  5AW0 B;  2QG4 A;  1HJB A;  2BMO A;  3S1K A;  1Q90 D;  2W83 C;  2JDI H;  1A02 F;  3GLM A;  3MHV A;  1AV1 A;  1H0T B;  1M1J C;  4OWF A;  1OVV A;  1VF5 D;  2ZVO B;  2E43 A;  1J1D C;  3TYY A;  2VRS A;  3B5N C;  2M3E A;  1H0T A;  4Y28 J;  3H1L D;  2QRX A;  2I8D A;  4OGQ C;  1T8Z A;  1NWQ A;  2J5U A;  4NBB D;  4JYC A;  4ZKU A;  2OTK E;  3V2R A;  2WSF J;  1M1K Q;  3AE2 C;  3TDK A;  4HM4 A;  1BCC J;  1ZR2 A;  1FC2 C;  3A0B H;  1PGO A;  1KB9 H;  2Q3E A;  2P7J A;  3UIA A;  1LT9 B;  3B5N B;  1O7M A;  1QL2 A;  2C0W A;  1SS1 A;  2IX7 C;  3B71 A;  3SFE C;  3GMA A;  4QDC A;  2NVF A;  1IFD A;  3QWO C;  2YIU C;  3GOB A;  3AE4 C;  4PJ0 H;  3Q1M A;  2FXP A;  2BEZ F;  3RK3 C;  1U7M A;  3EQQ A;  1N7S B;  3JC2 2;  3JSV C;  4WB4 A;  1J1D B;  2J58 A;  3L70 G;  4QDF B;  3B5N A;  1KB9 D;  3SWF A;  2QJY B;  1RQU A;  2FXM A;  1H8A A;  3FWL A;  1OVU A;  3IF4 A;  5KAF H;  3F89 A;  2FYN C;  2NUK A;  2XND H;  5AW6 B;  1NTM G;  3ABV C;  3Q5S A;  2L91 A;  4H13 D;  1BSN A;  1BGY D;  1KYO D;  1KV4 A;  1ZV8 A;  2DE7 D;  4PD4 D;  3TGU J;  1D7M A;  3PRJ A;  2YO3 A;  3U59 A;  1NTK E;  4XE5 B;  3MZW B;  3U1C A;  3FXD A;  4YTP C;  1GL2 A;  2A45 G;  3VMY A;  1S5L E;  1YIJ P;  2OYI A;  4QUR A;  2IDB A;  2YO2 A;  3L74 E;  2J59 M;  4DT0 A;  1OVR A;  4I7Z B;  3L37 A;  5B5E E;  3P8C D;  2HG5 D;  1Q90 C;  5CCG C;  2KSJ A;  1HGZ A;  2FFD A;  1PL5 A;  2KSE A;  2WPR A;  2GBW A;  1FOS F;  2KS1 B;  3WU2 E;  2JO1 A;  2NPS A;  1EZV I;  1GD2 E;  1ZME C;  1SQX D;  1UUW A;  3CXH H;  1FZF A;  3TNU B;  1HVV A;  1Y8A A;  1S9K D;  5APY A;  1BCC E;  5KAF E;  1IK7 A;  4R4L A;  3GKE A;  2K9J B;  4IL6 E;  3MUD A;  1R5L A;  1JY2 N;  4D6T D;  1KYO I;  1JY2 O;  2BMQ A;  4I2L C;  3WUV A;  2WPQ A;  3AEC C;  4TLF A; 
#chains in the Genus database with same CATH homology
 2YMK A;  3RK3 E;  3L75 E;  1KB9 E;  3AE1 C;  3T97 B;  1HJ0 A;  1K05 A;  3AEF C;  3D6Z A;  4NBC D;  2JP3 A;  3AEE C;  2E75 D;  3GB4 A;  3H1L E;  3N0Q A;  1OMI A;  1PP9 E;  3GCE A;  4QUQ A;  5L8R J;  2E76 C;  2I7F A;  4XFJ A;  3RL0 g;  2E76 B;  1VCK A;  1KIL E;  1S5L X;  3LW5 J;  5AEU A;  4PV1 D;  2QJK C;  2JZA A;  1GMJ A;  1YQ4 C;  1SQP E;  1O7H A;  4H13 C;  2XRX A;  3AE3 C;  3AEG C;  4EMJ B;  4AIV A;  4QDD A;  2E4Q A;  2G8Y A;  4OGQ D;  5AEW A;  4IL6 X;  4H0L C;  2H89 C;  1VM9 A;  1O7P A;  1NYK A;  3BCC E;  1OW8 A;  2HMJ A;  3EWK A;  1FQT A;  1L0L E;  4HJL A;  4HM0 A;  3CWB E;  3VMH D;  4NBG D;  4NB9 D;  1NYH A;  1FDI A;  1R8E A;  1VF5 B;  1SQX E;  2NVE A;  2P10 A;  2XSH A;  1MKM A;  1AJY A;  3EN1 A;  4QCK A;  1NGM B;  2WSE J;  3L71 E;  1Y9B A;  4HM6 A;  3GZY A;  2E74 B;  4HM7 A;  2JO6 A;  2E74 C;  3FOU A;  3GZX A;  2B24 A;  3AEA C;  1SQQ E;  3Q2Y A;  2E4P A;  1WQL A;  2HMN A;  2HMK A;  1O7W A;  4U3F E;  2QIW A;  2K9Y A;  3AED C;  1ZRT E;  2QPZ A;  1EZV E;  1FDO A;  1VF5 C;  4NBH D;  3H1K E;  1KQG B;  2G3A A;  3H25 A;  2QJP C;  5KLI C;  1PPJ E;  1UUV A;  4P1B H;  2Q3W A;  1JM1 A;  1K04 A;  3GTE A;  3DQY A;  2FYU E;  2YFJ A;  2O01 J;  2E75 C;  2NVG A;  4H44 C;  2ZT9 D;  2A06 E;  2OQQ A;  2NWF A;  3VMG D;  2H88 C;  1RFS A;  2XSO A;  1SJG A;  1WMK A;  3GF3 A;  2D2C D;  1KYO E;  3GL2 A;  2QSI A;  2BMR A;  1ZP0 C;  2MKV A;  4AAY B;  4OGQ B;  1KOR A;  2NZ2 A;  4H0L B;  3VCP A;  1U57 A;  3L72 E;  3AZC A;  2BMO A;  4H44 B;  1HF9 A;  1Q90 D;  5BOK A;  2XR8 A;  3GTS A;  2NUM A;  3GLM A;  1EXI A;  1VF5 D;  1NDO A;  5KLV E;  4H13 B;  2B1X A;  3C8V A;  3VMI D;  3L70 E;  1L0N E;  4Y28 J;  2BEQ D;  3AE6 C;  4OGQ C;  2BCC E;  3D70 A;  3VCA A;  4HM8 A;  3GL0 A;  4P1C H;  2J5U A;  4TT3 H;  2ZYL A;  1ULI A;  4NBB D;  3D89 A;  3S9O A;  4Z1M H;  2ZT9 C;  2WSF J;  4QUP A;  3AE2 C;  2DE6 D;  4HM4 A;  3IN6 A;  4HM1 A;  4PV1 B;  1KTM A;  2E76 D;  1O7M A;  5CXM A;  3AEB C;  2WPV B;  5KKZ C;  4NB8 D;  1RQV A;  3B71 A;  3SFE C;  4HM5 A;  2WSC J;  1VL2 A;  3GMA A;  4QDC A;  2NVF A;  1RIE A;  2HMM A;  4R4M A;  2E74 D;  3AE5 C;  2YIU C;  1O7N A;  3GOB A;  3H1J E;  3AE4 C;  3Q5R A;  1YQ3 C;  3Q1M A;  4NBD D;  4GDO A;  3Q5P A;  2FXP A;  2BEZ F;  2DE5 D;  4NBA D;  1G8J B;  4I7Z C;  3EQQ A;  1PV3 A;  4HKV A;  1ZOY C;  3SFD C;  4QDF B;  1DD3 A;  1NTM E;  3FGA D;  1JB0 J;  3GF7 A;  4PV1 C;  2V7Q J;  1S1C X;  1OW7 A;  1RQU A;  3H1H E;  3G9R A;  1BE3 E;  1UIX A;  3O6Q A;  2D2C C;  2FYN C;  2NUK A;  2FBW C;  1NTZ E;  1SQB E;  3ABV C;  3Q5S A;  4PD4 E;  2CKF A;  4H13 D;  3CX5 E;  2E75 B;  1SQV E;  2IBZ E;  3C0D A;  4YXD C;  1TU3 F;  2DE7 D;  1KMI Z;  2HML A;  3D71 A;  1KQF B;  4QDF A;  1NTK E;  3AE8 C;  3L73 E;  1PIX A;  4YTP C;  3AE7 C;  3CXH E;  4HM2 A;  4QUR A;  2IDB A;  4RKU J;  1EG9 A;  3L74 E;  2QJY C;  1NU1 E;  4NBF D;  1O7G A;  1P84 E;  1DD4 A;  4I7Z B;  3R4Y A;  2D2C B;  1DIP A;  3IAO A;  1OW6 A;  1Q90 C;  3D6Y A;  2YVJ B;  1PL5 A;  2GBW A;  2YFL A;  4U7J A;  2JO1 A;  1ZME C;  1UUW A;  5HL4 A;  4HM3 A;  4NBE D;  4KT0 J;  2HMO A;  1BCC E;  1IK7 A;  4R4L A;  3GKE A;  4H0L D;  1G8K B;  2WQY C;  3Q3D A;  5M1B A;  3TGU E;  2YFI A;  1EXJ A;  4H44 D;  2GBX A;  1ULJ A;  2ZT9 B;  2BMQ A;  3AE9 C;  3H1I E;  3AEC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...