2QJKC

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 51
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjkC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjkC02
1KYOE 4PV1D 2ZT9D 4QDFA 3CXHE 3L75E 2HMJA 4HJLA 4I7ZB 1FQTA 3H1JE 2BCCE 1Q90D 3GOBA 5HL4A 2GBWA 4KT0J 3TGUE 3L74E 4QUPA 3GZXA 2NWFA 4AAYB 5AEWA 4NBGD 1NYKA 4QDFB 1SQPE 3BCCE 4NBHD 4NB8D 2NUMA 1EG9A 4Y28J 3D89A 2BMOA 2NVEA 1ULIA 1NTME 2E4QA 4HM3A 3DQYA 2WPVB 4HM4A 4AIVA 5BOKA 4H13B 1G8JB 2E74B 5KLIC 2YIUC 1EZVE 1NDOA 5CXMA 3H1HE 1JB0J 1SQXE 1BE3E 2FYUE 2I7FA 2CKFA 1NU1E 1L0LE 2GBXA 2HMLA 2NUKA 2QJPC 4NBED 4QDDA 1RIEA 2BMRA 3CX5E 2E76B 1NTKE 1O7MA 1VF5B 3CWBE 3VMHD 4HM7A 4HM1A 2WSFJ 3C0DA 3EQQA 1SQQE 4H0LB 2YFIA 2B24A 2A06E 4NB9D 2B1XA 1PPJE 5KKZC 4H44B 1O7HA 2DE6D 1UUVA 2JO6A 2XRXA 2XSOA 3VMGD 4QCKA 3EN1A 2DE5D 2XR8A 4U3FE 3GZYA 4H0LD 1ZRTE 4HM6A 5KLVE 2E75B 4HM5A 2DE7D 2D2CB 2NVGA 3GTSA 3C8VA 3L73E 2HMMA 2YVJB 2HMKA 3GCEA 3VCPA 2BMQA 4H13D 2HMOA 2QJKC 2E74D 1WQLA 2E75D 2ZYLA 2NVFA 2JZAA 1G8KB 3L70E 1S5LX 4NBDD 3VCAA 1KB9E 4OGQB 1VCKA 2QIWA 4NBBD 4QDCA 1SJGA 2WSCJ 1SQVE 2WSEJ 2Q3WA 3GTEA 1UUWA 3AZCA 4OGQD 2QPZA 2HMNA 1L0NE 2E76D 1VF5D 2QSIA 3GL0A 4HKVA 3GB4A 1ULJA 5L8RJ 1BCCE 1O7NA 2QJYC 3FOUA 4IL6X 4P1CH 3L71E 1SQBE 1VM9A 4RKUJ 4H44D 3VMID 4EMJB 2E4PA 2XSHA 4QUQA 2O01J 4QURA 1O7WA 1JM1A 3GKEA 1RFSA 2D2CD 3L72E 4NBFD 4PD4E 5AEUA 3H1KE 4HM0A 4P1BH 1Q90C 1P84E 3H1LE 4HM2A 2YFJA 4NBAD 2FYNC 1O7PA 3N0QA 3GL2A 1NTZE 1O7GA 3H1IE 4PV1B 2ZT9B 2IBZE 4HM8A 2K9YA 1PP9E 2YFLA 4NBCD 3LW5J
chains in the Genus database with same CATH superfamily
1NTZD 4QDFA 5KAFE 1HUCA 2HMJA 1NTMD 2OTKE 3HE5B 5APXA 3GOBA 3GZXA 1OW6A 5AEWA 1OW7A 1ZLLA 4K35A 3O6QA 4Z1MH 2XZRA 2PFXA 2IBZI 4GOFA 1X0TA 5TJHA 3U1CA 4W7YA 1M57D 4EOTA 1EDJA 4BXLA 1BE3E 3V4QA 4DT0A 2GM4A 1L0LE 2BMRA 3KXDA 2H7HA 2JKVA 2QM8A 2A06E 1KC8Q 3TGUG 5CCHD 3M06A 2JWDA 5AVQB 2M5AA 1RF1C 5KLVE 2NPSD 1FJKA 1VF5C 1SQQG 3VP9A 5KJ7C 5E79E 1S5LX 3MUDA 1HJBA 4OGQB 1GW3A 1NKNA 2M3EA 2FYUG 1RE4C 1UIXA 1K04A 1P84D 3UIAA 5M1BA 5TISE 1Q81Q 1HGZA 2BCCJ 2FYZA 1IFPA 3L72E 3H1KE 2MKVA 4DJGA 2VRSA 1QGKB 2UWJE 1H0TB 5KAFH 2XKMA 3VMZA 2WWWA 1NTKK 3HE4B 1BDCA 1JMBA 1VQ6P 2H8PD 1IK7A 1HJ0A 1PFIA 3H1JD 3TGUD 3RK3E 4I7ZC 2ZXEB 4KHXA 1N7SB 1NTME 1SQPD 1JB0J 1SQQD 3RK2C 1YI2P 1A02F 2NUKA 3MD0A 2QG4A 1LWUA 2FYUD 1XTGB 2Q9IA 1HH0A 2R44A 4ZNCA 3CCSP 4L73A 4QCKA 3NTNA 1BDDA 1Q86Q 4U3FJ 1JO5A 5E79H 1DEEG 4UB8E 3Q5PA 1J1EC 1WQLA 1S2EA 3B4SA 3M9HA 1KORA 1Y9BA 3H1IJ 2OYIC 2WSCJ 3A7OA 2ZFCA 3L70G 5L8RJ 1BCCE 1CZQA 1IJDB 4QUQA 1KB9H 3P8CD 4HH2A 1VQKP 4UB6E 1Q90C 1P84E 3M0DA 1TU3F 1NU1K 3H32B 5AW4B 4IFDK 3RL0B 1QVGO 1W2EA 2KSJA 1CI6B 1VDFA 2XNDH 3VN0A 4GKGA 2PGDA 1QVFO 2W6BA 5HL4A 1HTLC 1EXJA 2KZJA 3GW6A 2YIUB 3CC7P 2P7JA 4QDFB 3IAOA 3L75G 1VQ8P 1KQGB 1NOHA 1GL2D 3O8ZA 3L74G 1JY3O 3P32A 2GBXA 2WITA 3GHGB 4QDDA 1R5SA 1EQ7A 2E74C 4HM1A 1SQQE 3HD7C 3L70D 4NB9D 2WT7B 1O7HA 3S1KA 1VPCA 3VCPA 1Q2NA 4WY4A 4JPZB 2R32A 1Y47A 1YQ3C 3KPEA 1EZVG 1K9MQ 2IDBA 3T97B 1VF5D 1O7NA 1JY2O 3GF7A 1SQVD 4I1LA 3H1JJ 3V2NA 1P84H 1BSNA 3L75D 1SQPJ 3G3ZA 4MN4C 3AEFC 3L74D 4PV1B 1N73C 1MV8A 3KQGA 3H6PA 3VTPC 2FYUJ 3A0HE 1NYHA 4KT0J 3RK3C 1LTJA 3CCRP 3CXHD 1AVOA 3PRJA 4NB8D 2BMOA 2NPSB 2BEQD 3HE5A 3BASA 1DIPA 2C9NY 2Z5HA 3JCUE 2I7FA 2ZYDA 1G1JA 2IFMA 5K5GB 4NBED 1ZN5A 1EZVD 4PD4I 2KIKA 3JSVC 3GMAA 2E75C 5APQA 1M7LA 3G71P 1IC2A 1RQVA 1DEBA 3RK2D 3CX5D 1UUVA 1MZ9A 3HRNA 4HM6A 2OYHC 5CCHC 1M1JC 1IZNB 2JEEA 2HMOA 2POHA 2LKMA 3L70E 1G8KB 2E42A 4GOEA 2NZ2A 1YJWP 1NKZB 3KDPB 5CCGA 1L0LG 2PRRA 1OFCX 1KQLA 5H2FH 2AEMA 1SQBE 5B66E 4EI2A 3A0BE 2YKOA 2WZ7A 2O01J 3WU2E 1JM1A 1S72P 3N0QA 5KLVG 1LT1A 1FS0E 2CK3H 3SSUA 1O7GA 1QEXA 4ASWA 2ZT9B 3E7KA 2HLOA 3H25A 3L75E 1LJ2A 5AVUB 1H88A 1Q90D 1H0TA 3L74E 1FZEA 2OQQA 4L76A 2NWFA 4EIJA 3BCCE 2FXOA 1JCCA 3CCVP 4AUWA 1ULIA 3JCUH 4D6TJ 3CLQA 5APTA 1SFCC 3L72G 1N7LA 3H1KG 3HUSC 2IPPA 1U7MA 2Q6QA 2W90A 5B5EE 4YTPC 3H1HG 4N78E 1L0LD 1SQVJ 2OARA 3II6A 3KHUA 1NVOA 3JC22 1JM0A 2A45G 5KKZC 4I2LC 1KILE 3I56P 1KYOI 3Q1MA 1NTKG 1KD1Q 3CWBG 5CJ0A 3GTSA 3L73E 2A06D 1X8YA 1ZR4A 2E74D 1OMIA 3B5NB 2W8ZA 1GW4A 5KLVD 3HD7D 1L4AC 1SJGA 1UIIA 2PP6A 4PD4D 5B66H 1L0NE 4Y99B 1ULJA 3WU2H 2AXCA 3AE6C 3VMID 1RF0A 5AVRB 2WSEH 2P67A 1MFZA 5BVZA 1KMIZ 1ZV8A 3L72D 1KZUB 2K9YA 2YNYA 3H1KD 3VOPA 3CC2P 1FZBA 1SQXJ 3MHVA 1JMMA 1RE3A 1URQC 2C9LY 4DOJA 1FQTA 1X79B 2WTYA 3H32A 2LR2A 3OJAB 1R8EA 2FFDC 3VMXA 1W2BO 3R2PA 3R4YA 1EDKA 2N1TC 1BCCG 5AW9B 1CI6A 3V4WA 1BGYJ 3CCLP 3LW5H 3CXHH 3DQYA 1NTKD 1LTJB 3TSIA 3SFDC 1PGQA 1GL2C 3RK3D 1Z56A 2HMLA 3S4RA 1RF1B 4B86A 2YXRB 5CJ4A 1VF5B 2QEXP 5APSA 2I1JA 2WSFJ 2FXPA 4H0LB 1NU1G 2XRXA 3GHGA 3BRVB 2PAJA 3FGAD 3V5BA 2HMMA 2HMKA 3MZWB 3CX5H 2N9YB 2QJKC 2Z5IA 3CPWO 3AE3C 2E75D 2HPCB 2N9BA 2WT7A 3VMAA 3AEDC 2Y9YA 2KLVA 2D2CC 3GTEA 3AE8C 3OAKA 1PP9J 3W67A 3L71J 4JF7A 4R4MA 2ZJSE 3Q3DA 5CBNA 1S3JA 2QA4P 5DJUB 1BCCD 2WSFH 3T97A 4PD4E 2WMMA 1FDMA 2ITAA 2W6JH 3QH9A 4NPEA 2I8DA 1BE3J 4I7ZB 1AFOA 2IBZG 1FJPA 2HG5D 4LC1A 1NYKA 3E1RA 1NU1D 2E5TA 5AW2B 4W7ZA 1EG9A 3VP8A 4HM3A 4OVNF 2WSSH 1NDOA 3H1HE 5AVVB 1NH4A 1OZHA 1VQ4P 1USDA 1FDIA 1YJ9P 4WWIA 2NPSA 1ZRTD 2QJPC 3OW2O 4BRYA 1NAYA 1NTKE 3LIDA 3CWBE 1KILC 3IF4A 1J1EB 3VMYA 2DW3A 1SFCD 4U3FE 4OGQC 1GZLA 1NTZK 2E76C 1KV4A 2YVJB 1NTMK 1GDTA 1S5LE 3BRTB 2XDJA 3L72J 4H44C 2MJZA 3VCAA 5KTBA 1PGOA 3CL3D 1K8AQ 1GMJA 3CI9A 1YTZI 1QL2A 2QSIA 2SPZA 4N3YB 1E5WA 2IBZD 2YXQB 1FE6A 4PD4H 1GTWA 2B88A 2XSHA 3G4SP 1L4AD 3EFGA 1RFSA 4P1BH 2R5DA 4NBAD 2KOGA 1NTZJ 5TISH 1NTMJ 2YKQA 1KYOE 2W6AA 4QMAA 3H1LG 3IR9A 1QX8A 2GBWA 1N7SC 4WBAA 4WVZA 3M9BA 4NBHD 2RH0A 1SQBG 2P58A 3L35A 2WPSA 1URQD 2JDIH 2E74B 2A45H 3EFFK 1ZR2A 2Y0EA 1NU1E 2N1TD 5AW6B 3USSA 5KLIB 3E1IA 4AYCA 1CSBA 4W80A 4GODA 4WB4A 5AW1B 2JO6A 4ASVA 1LT9A 3VYIA 5GTHE 1ZRTE 4WY4D 2NVGA 2M0BA 3BCCG 3C8VA 2Y0CA 3TK1A 3D6ZA 1XTCC 1FZCC 3MTUE 2QIWA 1KN7A 4QDCA 1ZP0C 1J1DB 4IOIH 3TNUB 2ZVNB 3H1LD 3B5NA 2OTJP 1AA0A 4UB8H 1MFTA 1SQPK 4BWNA 1YJNP 2M8RA 4IL6X 1HGVA 1R5LA 5KAIE 3U1AA 4RKUJ 1N73B 4QURA 1T6AA 3RL0C 3D70A 1VL2A 2D2CD 3B71A 4L75A 3FXEA 1G2CB 1SQBD 2QJYB 3EWKA 1ZXGA 3AE7C 2FYUK 1OVRA 3L73G 2IBZE 3CCMP 3RK3B 4PJ0E 4XA4A 4DCKA 2O3JA 4UB6H 2RKLA 3TGUJ 3AE9C 1L0NG 3F89A 4NBGD 1MUUA 3NXSA 2NUMA 4C7NB 2AXTE 1SQQJ 2Q3EA 1VQNP 1YQ4C 3KZIE 3BCCD 3CCJP 3L4FA 1HBWA 3AECC 4RESB 1WT6A 2GA1A 1S9KE 2FY8A 2OYHB 1O7MA 1SP4A 2GUSA 1M1JB 5GTHH 1SVFA 3WMM0 2B1XA 1FOSF 4BRYB 2Q3IA 3P7KA 4N78D 1RF1A 1GU5A 4U7JA 5AW7B 1AJYA 4HB1A 2BMQA 2KSEA 1KILD 5KJ7A 3HTKA 3MUDC 3L73D 1K73Q 4I6MC 1A02J 4OGQD 1RE4A 2HMNA 2E76D 5KAIH 2KS1B 5DJTB 3D6YA 2HPCA 2KI7B 3CD6P 1HVVA 1JY3P 1U7JA 1X9VA 5APWA 4H44D 4JYCA 1L0ND 4PV1C 4TLFA 3PHLA 3C1LA 1LNQA 3N7NA 2KXPB 3H1LE 4NPFX 5APYA 4PJ0H 4HM2A 3KYQA 2C0XA 4N6JA 2Q5UA 3AEGC 3CCEP 2Q7CA 1N86A 3ITKA 1T2KC 2FBWC 2FYNB 4HYTB 3BATA 1SS1A 1SFCB 2V7QH 2O1KA 1KB9I 3HUSB 3FWLA 4Y28J 2I1KA 1VQ7P 2BCCG 1FC2C 1AQTA 1QL1A 3V2PA 2AEJA 3A0HH 1IO4A 1JY2P 2KK7A 1N7SD 1SQVK 1M1KQ 5EFWB 5KKZB 2M3BA 3L70J 5CHXA 1IK9A 2O1JA 4HJGH 2Q1KA 1LWUC 2FXMA 4H13C 2E5YA 1LP1B 1Q7YQ 1VQLP 2XSOA 1KFMA 2DE5D 1RQUA 1L4AB 1U57A 1M8OB 2NVFA 1LT9B 2FKWB 1NHLA 3Q5RA 2OYIA 2WSEJ 5AW5B 1K05A 1M56D 3GL0A 3GB4A 3MGNA 3L75J 2JJLA 2L5GB 1IFMA 1OIPA 2ZT9C 3L74J 1O7WA 3ABVC 1LTTC 2LXCB 1DX7A 1DH3A 2KUBA 4EDFA 1SQXK 1URQB 4U3FG 2BCCD 2HYNA 2J58A 3FXDA 3M0DC 1JTHA 4YPCA 1JCDA 5AW8B 2WPQA 1EXIA 4YXDC 3A0BH 2N1TB 3LW5J 1S1CX 2B9BA 3RBZA 3RL0D 3A2AA 3H1IG 1FOSE 1FZFA 4QUPA 2KNCB 4NPDA 4A7PA 4CPGA 1GL2B 4L74A 1BGYE 1IFJA 2BEZF 1PL5A 2NVEA 4K3AA 2E4QA 1FZGA 4ZMDA 2IYPA 4HM4A 5BOKA 2KP8A 2P10A 1JNMA 4HKZH 5AVXB 3H1HD 3P8MC 2YO3A 3NMDA 2QJKB 3EQQA 2B24A 3B5NC 3I5CA 3CWBD 3EN1A 3GF3A 3WUUA 2D2CB 3CCUP 5B5EH 5BU8B 2JWAA 1WMKA 4U3FD 4WY4C 4Y99C 3C9IA 4ZKUA 1GU4A 3AZCA 1PGJA 3HTKB 1WRGA 2B87A 1PV3A 3H1ID 3W68A 3L71E 4EMJB 1YHQP 3TNUA 1PZQA 3CC4P 3GKEA 1VQOP 1LTBC 2CPSA 5APVA 3FX0A 3GL2A 1RY3A 4M3LA 1L0LK 1N73A 4PV1D 1G2CA 3RL0g 3TYYA 2V4HA 4DZOA 2QVAA 4YXWH 2BCCE 1KYOD 1LTJC 3AE2C 4GIFA 5KLVK 3CCQP 2HODB 3H1JG 2QJPB 1T2KD 3F5HA 3AE5C 3SWFA 3EQ2A 1KILB 3V2QA 1SQPG 2B89A 2G8YA 3OA7A 1G1IA 3K5BA 4H0LC 4C7NA 1L0LJ 3M91A 1EDIA 1RHZB 2YO2A 1YITP 1ZMEC 3SFEC 2IZ0A 2E76B 3VMHD 4HM7A 2QM7A 3RK2B 3Q2YA 2YFIA 1W5CE 2J5UA 1PPJE 4H44B 4IFFA 1NO4A 2KYVA 3GZYA 5KLVJ 4HM5A 2OYHA 1KQSO 3AEAC 5CCHA 1M1JA 3B8EB 4H13D 2JZAA 1VQMP 4RJTA 1RH5B 1KB9E 2J59M 3BVHA 2P1JA 2IZ1A 4C46A 1BSHA 2Q3WA 2WVRA 5CCGC 3G9RA 4HKVA 1X22A 1JUNA 3L37A 2OYIB 2E4PA 1N8RQ 4EYYQ 1FAVA 3MIWA 2XU6A 3H1KJ 2KS1A 2Y0DA 5BU5A 2YFJA 1NTZE 3H1IE 4KJMA 4HM8A 1NAFA 2K37A 3GG2A 1LTGC 3H1HJ 2ZT9D 1Q82Q 2ZAEB 1JTHB 4XFJA 2O01N 2LXBA 1ZW0A 1ZOYC 1NTKJ 3CWBJ 3AEBC 3G6EP 2IX7C 1EDLA 5GTIE 2QE7H 3IFMA 1G8JB 1IFDA 1PIXA 4ZKPA 1SFCA 3AEEC 4GT1A 5CXMA 3HUSA 2H89C 4JQ0D 5AVYB 2KB7P 2GUVA 4JYBA 2IYOA 2W27A 5AVWB 3PLNA 1AQ5A 1S4XA 1S9KD 2IFNA 1FZCB 2H88C 3D71A 3CXHI 1LTSC 3HD7B 2XNXA 1LP1A 2Z4EA 4D6TG 1LGHB 4NBDD 1NJIQ 5AVZB 4NBBD 5AVSB 3B5ND 1L4AA 2YMYA 1VQ5P 1UUWA 2AEFA 2QPZA 3N4XA 1OVVA 1EZVI 1BCCJ 1S5LH 3FOUA 3SWYA 1H8AA 2JP3A 3A3YB 4XE5B 1SQVG 3TDKA 4C7RA 1RF0C 3IN6A 2B87B 5CMZA 2WSCH 3CX5I 3PP5A 3NFQA 1YBKA 2KLUA 3SWKA 2E43A 3V2RA 3O6QB 1D7MA 1RE3C 4HJLA 1URQA 1SQQK 1NU1J 3H1JE 4OH8B 3TGUE 1T3JA 1YYCA 2FFDA 1SQPE 2N1TA 5GTIH 1EC5A 3D89A 1KYOH 2KNCA 5KLIC 2YIUC 1IFNA 1GL2A 5CBOA 2FYUE 4D6TD 3AE4C 2M5AB 2HFED 1SQXG 2YMKA 2K3RA 2R5BA 1VQPP 2R3SA 3M9QA 2BASA 3S9OA 3GHGC 4H0LD 5KJ7D 2E75B 1J1DC 2L91A 2K9JA 5H2FE 3GCEA 1BGYG 1DD4A 2ZYLA 1JY3N 5C39A 1NGMB 3U59A 1AV1A 1FDOA 3P8CE 4IL6E 2QJYC 3FWNA 3PJSK 1N2DC 1M90Q 2ZYAA 1YTZT 3I55P 2R3CA 3CMEP 5CCGD 2V7QJ 3GLMA 2KZIA 1T8ZA 4NBFD 2QRXA 1E79H 1FBMA 2XV5A 2WPRA 5APUA 2W83C 1OW8A 2OGUA 1JY2N 1PGPA 2YKPA 1SQXD 4LLHA 1PP9G 4LGDE 1L2PA 3LIEA 2OTLP 3L71G 2WQYC 4OWFA 2ZVOB 4AIVA 1LWUB 3RGUA 4H13B 3V6IA 1BGYD 2HODA 1GK4A 1VQ9P 2NPSC 3AE1C 1HF9A 1OVUA 1SLQA 3ZDMA 2AXTH 2ZYGA 1SQBK 1KILA 1BE3G 3KZIH 4TT3H 3TF5A 1KQFB 4D6TE 1YIJP 3VMGD 2XR8A 2DE7D 2A45I 2A06G 3A5TA 3Q5SA 2JR8A 2Y9ZA 5AW3B 2OYOA 3H1LJ 1QLED 1KTMA 4IL6H 1SQVE 4AQRD 1J2JB 1OWAA 1OX3A 1DD3A 4P1CH 1SQBJ 3WUTA 1VM9A 1PP9D 3MP7B 2NRGA 5AEUA 1PPJG 3L71D 1FU1A 3HE4A 3M0AA 2FYNC 1HWTC 1GD2E 2O01H 2G3AA 3CXHE 1N7SA 1KFNA 1GK6A 4AAYB 1BE3D 1LTAC 1USEA 1FZAA 3BCCJ 1JEKA 3CMAP 1NWQA 2WPVB 2FFDB 3QWOC 1EZVE 3RBXA 1SQXE 1LTIC 4GDOA 1NTZG 2CKFA 3L36A 5AW0B 1L0NK 2P2UA 1NTMG 1RIEA 1P84I 3CX5E 4JBZA 2RN0A 3C0DA 4WY4B 3WUVA 2DE6D 1LT9C 1CW5A 2HR3A 2RMZA 1IFIA 3L73J 1PPJD 3PH0A 2K1AA 1T3UA 1FZCA 1VCKA 1AVYA 1Y8AA 2K9JB 3HD7A 1L0NJ 1KB9D 2JO1A 2K88A 2CPBA 4RO0A 2ZXXA 1H89A 1OXZA 2C0WA 4O9BA 5AVTB 4R4LA 4HM0A 1JOCA 1MKMA 4IFMA 1O7PA 2H43A 3PTZA 1PP9E 2YFLA 4NBCD
chains in the Genus database with same CATH topology
2ZT9D 4QDFA 3H25A 3L75E 2HMJA 4XFJA 1Q90D 3GOBA 3L74E 3AE9C 2OQQA 3GZXA 2NWFA 1OW6A 1ZOYC 1OW7A 5AEWA 4NBGD 3AEBC 3BCCE 3O6QA 4Z1MH 2NUMA 1ULIA 1YQ4C 1G8JB 1PIXA 3AEEC 5CXMA 2H89C 1BE3E 3AECC 1L0LE 2BMRA 4YTPC 1O7MA 2A06E 2B1XA 5KKZC 2H88C 1KILE 3D71A 4U7JA 3Q1MA 5KLVE 1AJYA 1VF5C 3GTSA 3L73E 2BMQA 2E74D 1OMIA 1S5LX 4NBDD 4OGQB 4NBBD 1SJGA 1UUWA 4OGQD 2QPZA 1UIXA 2HMNA 2E76D 1L0NE 1K04A 5M1BA 3D6YA 1ULJA 3FOUA 3AE6C 3VMID 2JP3A 4H44D 4PV1C 3IN6A 3L72E 3H1KE 2MKVA 3H1LE 4HM2A 1KMIZ 3AEGC 2K9YA 2FBWC 4HJLA 1FQTA 3H1JE 1IK7A 3TGUE 1HJ0A 1R8EA 1SQPE 3R4YA 4Y28J 3D89A 3RK3E 4I7ZC 1NTME 3DQYA 5KLIC 2YIUC 3SFDC 1JB0J 2FYUE 3AE4C 2HMLA 2NUKA 4H13C 1VF5B 2WSFJ 2YMKA 2FXPA 4H0LB 2XSOA 2XRXA 3S9OA 4QCKA 2DE5D 1RQUA 4H0LD 2E75B 3FGAD 1U57A 2HMMA 2HMKA 3GCEA 3Q5PA 1DD4A 2QJKC 3AE3C 1WQLA 2E75D 2ZYLA 2NVFA 3AEDC 3Q5RA 1KORA 1Y9BA 1NGMB 2D2CC 2WSCJ 2WSEJ 3GTEA 3AE8C 1K05A 1FDOA 3GL0A 3GB4A 5L8RJ 1BCCE 2QJYC 4R4MA 3Q3DA 4QUQA 2ZT9C 1O7WA 3ABVC 4PD4E 1Q90C 1P84E 1TU3F 2V7QJ 3GLMA 1EXIA 4YXDC 4NBFD 3LW5J 1S1CX 4I7ZB 1OW8A 5HL4A 1EXJA 4QUPA 1NYKA 4QDFB 3IAOA 1KQGB 1EG9A 2WQYC 2BEZF 1PL5A 2NVEA 2E4QA 4HM3A 4HM4A 4AIVA 5BOKA 4H13B 1NDOA 3H1HE 2P10A 1FDIA 2GBXA 3AE1C 2QJPC 1HF9A 4QDDA 1NTKE 3CWBE 2E74C 4HM1A 4TT3H 3EQQA 1SQQE 2B24A 1KQFB 4NB9D 1O7HA 3VMGD 3EN1A 2XR8A 4U3FE 3GF3A 4OGQC 2DE7D 2D2CB 2E76C 2YVJB 3VCPA 1WMKA 3Q5SA 4H44C 3VCAA 1YQ3C 1KTMA 1SQVE 1GMJA 2IDBA 3AZCA 3T97B 1VF5D 2QSIA 1PV3A 1O7NA 1DD3A 3GF7A 3L71E 4P1CH 1VM9A 4EMJB 2XSHA 3GKEA 1RFSA 5AEUA 4P1BH 4NBAD 2FYNC 3AEFC 3GL2A 4PV1B 4PV1D 1KYOE 2G3AA 3CXHE 3RL0g 1NYHA 2BCCE 2GBWA 4KT0J 3AE2C 4AAYB 4NBHD 4NB8D 2BMOA 2BEQD 2WPVB 3AE5C 1DIPA 2E74B 1EZVE 2G8YA 1SQXE 4GDOA 2I7FA 2CKFA 1NU1E 4H0LC 4NBED 1ZMEC 3SFEC 1RIEA 3GMAA 3CX5E 2E76B 3VMHD 4HM7A 2E75C 3C0DA 2YFIA 1RQVA 2J5UA 1PPJE 4H44B 2DE6D 1UUVA 2JO6A 3GZYA 1ZRTE 4HM6A 4HM5A 2NVGA 3C8VA 3AEAC 4H13D 2HMOA 3D6ZA 2JZAA 1G8KB 3L70E 2NZ2A 1KB9E 1VCKA 2QIWA 4QDCA 1ZP0C 2Q3WA 3G9RA 4HKVA 4IL6X 1SQBE 2JO1A 4RKUJ 2E4PA 2O01J 4QURA 1JM1A 3D70A 1VL2A 2D2CD 3B71A 4R4LA 4HM0A 1MKMA 3EWKA 2YFJA 3N0QA 1O7PA 3AE7C 1NTZE 1O7GA 3H1IE 2ZT9B 2IBZE 4HM8A 3Q2YA 1PP9E 2YFLA 4NBCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO E;  4PV1 D;  2ZT9 D;  4QDF A;  3CXH E;  3L75 E;  2HMJ A;  4HJL A;  4I7Z B;  1FQT A;  3H1J E;  2BCC E;  1Q90 D;  3GOB A;  5HL4 A;  2GBW A;  4KT0 J;  3TGU E;  3L74 E;  4QUP A;  3GZX A;  2NWF A;  4AAY B;  5AEW A;  4NBG D;  1NYK A;  4QDF B;  1SQP E;  3BCC E;  4NBH D;  4NB8 D;  2NUM A;  1EG9 A;  4Y28 J;  3D89 A;  2BMO A;  2NVE A;  1ULI A;  1NTM E;  2E4Q A;  4HM3 A;  3DQY A;  2WPV B;  4HM4 A;  4AIV A;  5BOK A;  4H13 B;  1G8J B;  2E74 B;  5KLI C;  2YIU C;  1EZV E;  1NDO A;  5CXM A;  3H1H E;  1JB0 J;  1SQX E;  1BE3 E;  2FYU E;  2I7F A;  2CKF A;  1NU1 E;  1L0L E;  2GBX A;  2HML A;  2NUK A;  2QJP C;  4NBE D;  4QDD A;  1RIE A;  2BMR A;  3CX5 E;  2E76 B;  1NTK E;  1O7M A;  1VF5 B;  3CWB E;  3VMH D;  4HM7 A;  4HM1 A;  2WSF J;  3C0D A;  3EQQ A;  1SQQ E;  4H0L B;  2YFI A;  2B24 A;  2A06 E;  4NB9 D;  2B1X A;  1PPJ E;  5KKZ C;  4H44 B;  1O7H A;  2DE6 D;  1UUV A;  2JO6 A;  2XRX A;  2XSO A;  3VMG D;  4QCK A;  3EN1 A;  2DE5 D;  2XR8 A;  4U3F E;  3GZY A;  4H0L D;  1ZRT E;  4HM6 A;  5KLV E;  2E75 B;  4HM5 A;  2DE7 D;  2D2C B;  2NVG A;  3GTS A;  3C8V A;  3L73 E;  2HMM A;  2YVJ B;  2HMK A;  3GCE A;  3VCP A;  2BMQ A;  4H13 D;  2HMO A;  2QJK C;  2E74 D;  1WQL A;  2E75 D;  2ZYL A;  2NVF A;  2JZA A;  1G8K B;  3L70 E;  1S5L X;  4NBD D;  3VCA A;  1KB9 E;  4OGQ B;  1VCK A;  2QIW A;  4NBB D;  4QDC A;  1SJG A;  2WSC J;  1SQV E;  2WSE J;  2Q3W A;  3GTE A;  1UUW A;  3AZC A;  4OGQ D;  2QPZ A;  2HMN A;  1L0N E;  2E76 D;  1VF5 D;  2QSI A;  3GL0 A;  4HKV A;  3GB4 A;  1ULJ A;  5L8R J;  1BCC E;  1O7N A;  2QJY C;  3FOU A;  4IL6 X;  4P1C H;  3L71 E;  1SQB E;  1VM9 A;  4RKU J;  4H44 D;  3VMI D;  4EMJ B;  2E4P A;  2XSH A;  4QUQ A;  2O01 J;  4QUR A;  1O7W A;  1JM1 A;  3GKE A;  1RFS A;  2D2C D;  3L72 E;  4NBF D;  4PD4 E;  5AEU A;  3H1K E;  4HM0 A;  4P1B H;  1Q90 C;  1P84 E;  3H1L E;  4HM2 A;  2YFJ A;  4NBA D;  2FYN C;  1O7P A;  3N0Q A;  3GL2 A;  1NTZ E;  1O7G A;  3H1I E;  4PV1 B;  2ZT9 B;  2IBZ E;  4HM8 A;  2K9Y A;  1PP9 E;  2YFL A;  4NBC D;  3LW5 J; 
#chains in the Genus database with same CATH topology
 1NTZ D;  4QDF A;  5KAF E;  1HUC A;  2HMJ A;  1NTM D;  2OTK E;  3HE5 B;  5APX A;  3GOB A;  3GZX A;  1OW6 A;  5AEW A;  1OW7 A;  1ZLL A;  4K35 A;  3O6Q A;  4Z1M H;  2XZR A;  2PFX A;  2IBZ I;  4GOF A;  1X0T A;  5TJH A;  3U1C A;  4W7Y A;  1M57 D;  4EOT A;  1EDJ A;  4BXL A;  1BE3 E;  3V4Q A;  4DT0 A;  2GM4 A;  1L0L E;  2BMR A;  3KXD A;  2H7H A;  2JKV A;  2QM8 A;  2A06 E;  1KC8 Q;  3TGU G;  5CCH D;  3M06 A;  2JWD A;  5AVQ B;  2M5A A;  1RF1 C;  5KLV E;  2NPS D;  1FJK A;  1VF5 C;  1SQQ G;  3VP9 A;  5KJ7 C;  5E79 E;  1S5L X;  3MUD A;  1HJB A;  4OGQ B;  1GW3 A;  1NKN A;  2M3E A;  2FYU G;  1RE4 C;  1UIX A;  1K04 A;  1P84 D;  3UIA A;  5M1B A;  5TIS E;  1Q81 Q;  1HGZ A;  2BCC J;  2FYZ A;  1IFP A;  3L72 E;  3H1K E;  2MKV A;  4DJG A;  2VRS A;  1QGK B;  2UWJ E;  1H0T B;  5KAF H;  2XKM A;  3VMZ A;  2WWW A;  1NTK K;  3HE4 B;  1BDC A;  1JMB A;  1VQ6 P;  2H8P D;  1IK7 A;  1HJ0 A;  1PFI A;  3H1J D;  3TGU D;  3RK3 E;  4I7Z C;  2ZXE B;  4KHX A;  1N7S B;  1NTM E;  1SQP D;  1JB0 J;  1SQQ D;  3RK2 C;  1YI2 P;  1A02 F;  2NUK A;  3MD0 A;  2QG4 A;  1LWU A;  2FYU D;  1XTG B;  2Q9I A;  1HH0 A;  2R44 A;  4ZNC A;  3CCS P;  4L73 A;  4QCK A;  3NTN A;  1BDD A;  1Q86 Q;  4U3F J;  1JO5 A;  5E79 H;  1DEE G;  4UB8 E;  3Q5P A;  1J1E C;  1WQL A;  1S2E A;  3B4S A;  3M9H A;  1KOR A;  1Y9B A;  3H1I J;  2OYI C;  2WSC J;  3A7O A;  2ZFC A;  3L70 G;  5L8R J;  1BCC E;  1CZQ A;  1IJD B;  4QUQ A;  1KB9 H;  3P8C D;  4HH2 A;  1VQK P;  4UB6 E;  1Q90 C;  1P84 E;  3M0D A;  1TU3 F;  1NU1 K;  3H32 B;  5AW4 B;  4IFD K;  3RL0 B;  1QVG O;  1W2E A;  2KSJ A;  1CI6 B;  1VDF A;  2XND H;  3VN0 A;  4GKG A;  2PGD A;  1QVF O;  2W6B A;  5HL4 A;  1HTL C;  1EXJ A;  2KZJ A;  3GW6 A;  2YIU B;  3CC7 P;  2P7J A;  4QDF B;  3IAO A;  3L75 G;  1VQ8 P;  1KQG B;  1NOH A;  1GL2 D;  3O8Z A;  3L74 G;  1JY3 O;  3P32 A;  2GBX A;  2WIT A;  3GHG B;  4QDD A;  1R5S A;  1EQ7 A;  2E74 C;  4HM1 A;  1SQQ E;  3HD7 C;  3L70 D;  4NB9 D;  2WT7 B;  1O7H A;  3S1K A;  1VPC A;  3VCP A;  1Q2N A;  4WY4 A;  4JPZ B;  2R32 A;  1Y47 A;  1YQ3 C;  3KPE A;  1EZV G;  1K9M Q;  2IDB A;  3T97 B;  1VF5 D;  1O7N A;  1JY2 O;  3GF7 A;  1SQV D;  4I1L A;  3H1J J;  3V2N A;  1P84 H;  1BSN A;  3L75 D;  1SQP J;  3G3Z A;  4MN4 C;  3AEF C;  3L74 D;  4PV1 B;  1N73 C;  1MV8 A;  3KQG A;  3H6P A;  3VTP C;  2FYU J;  3A0H E;  1NYH A;  4KT0 J;  3RK3 C;  1LTJ A;  3CCR P;  3CXH D;  1AVO A;  3PRJ A;  4NB8 D;  2BMO A;  2NPS B;  2BEQ D;  3HE5 A;  3BAS A;  1DIP A;  2C9N Y;  2Z5H A;  3JCU E;  2I7F A;  2ZYD A;  1G1J A;  2IFM A;  5K5G B;  4NBE D;  1ZN5 A;  1EZV D;  4PD4 I;  2KIK A;  3JSV C;  3GMA A;  2E75 C;  5APQ A;  1M7L A;  3G71 P;  1IC2 A;  1RQV A;  1DEB A;  3RK2 D;  3CX5 D;  1UUV A;  1MZ9 A;  3HRN A;  4HM6 A;  2OYH C;  5CCH C;  1M1J C;  1IZN B;  2JEE A;  2HMO A;  2POH A;  2LKM A;  3L70 E;  1G8K B;  2E42 A;  4GOE A;  2NZ2 A;  1YJW P;  1NKZ B;  3KDP B;  5CCG A;  1L0L G;  2PRR A;  1OFC X;  1KQL A;  5H2F H;  2AEM A;  1SQB E;  5B66 E;  4EI2 A;  3A0B E;  2YKO A;  2WZ7 A;  2O01 J;  3WU2 E;  1JM1 A;  1S72 P;  3N0Q A;  5KLV G;  1LT1 A;  1FS0 E;  2CK3 H;  3SSU A;  1O7G A;  1QEX A;  4ASW A;  2ZT9 B;  3E7K A;  2HLO A;  3H25 A;  3L75 E;  1LJ2 A;  5AVU B;  1H88 A;  1Q90 D;  1H0T A;  3L74 E;  1FZE A;  2OQQ A;  4L76 A;  2NWF A;  4EIJ A;  3BCC E;  2FXO A;  1JCC A;  3CCV P;  4AUW A;  1ULI A;  3JCU H;  4D6T J;  3CLQ A;  5APT A;  1SFC C;  3L72 G;  1N7L A;  3H1K G;  3HUS C;  2IPP A;  1U7M A;  2Q6Q A;  2W90 A;  5B5E E;  4YTP C;  3H1H G;  4N78 E;  1L0L D;  1SQV J;  2OAR A;  3II6 A;  3KHU A;  1NVO A;  3JC2 2;  1JM0 A;  2A45 G;  5KKZ C;  4I2L C;  1KIL E;  3I56 P;  1KYO I;  3Q1M A;  1NTK G;  1KD1 Q;  3CWB G;  5CJ0 A;  3GTS A;  3L73 E;  2A06 D;  1X8Y A;  1ZR4 A;  2E74 D;  1OMI A;  3B5N B;  2W8Z A;  1GW4 A;  5KLV D;  3HD7 D;  1L4A C;  1SJG A;  1UII A;  2PP6 A;  4PD4 D;  5B66 H;  1L0N E;  4Y99 B;  1ULJ A;  3WU2 H;  2AXC A;  3AE6 C;  3VMI D;  1RF0 A;  5AVR B;  2WSE H;  2P67 A;  1MFZ A;  5BVZ A;  1KMI Z;  1ZV8 A;  3L72 D;  1KZU B;  2K9Y A;  2YNY A;  3H1K D;  3VOP A;  3CC2 P;  1FZB A;  1SQX J;  3MHV A;  1JMM A;  1RE3 A;  1URQ C;  2C9L Y;  4DOJ A;  1FQT A;  1X79 B;  2WTY A;  3H32 A;  2LR2 A;  3OJA B;  1R8E A;  2FFD C;  3VMX A;  1W2B O;  3R2P A;  3R4Y A;  1EDK A;  2N1T C;  1BCC G;  5AW9 B;  1CI6 A;  3V4W A;  1BGY J;  3CCL P;  3LW5 H;  3CXH H;  3DQY A;  1NTK D;  1LTJ B;  3TSI A;  3SFD C;  1PGQ A;  1GL2 C;  3RK3 D;  1Z56 A;  2HML A;  3S4R A;  1RF1 B;  4B86 A;  2YXR B;  5CJ4 A;  1VF5 B;  2QEX P;  5APS A;  2I1J A;  2WSF J;  2FXP A;  4H0L B;  1NU1 G;  2XRX A;  3GHG A;  3BRV B;  2PAJ A;  3FGA D;  3V5B A;  2HMM A;  2HMK A;  3MZW B;  3CX5 H;  2N9Y B;  2QJK C;  2Z5I A;  3CPW O;  3AE3 C;  2E75 D;  2HPC B;  2N9B A;  2WT7 A;  3VMA A;  3AED C;  2Y9Y A;  2KLV A;  2D2C C;  3GTE A;  3AE8 C;  3OAK A;  1PP9 J;  3W67 A;  3L71 J;  4JF7 A;  4R4M A;  2ZJS E;  3Q3D A;  5CBN A;  1S3J A;  2QA4 P;  5DJU B;  1BCC D;  2WSF H;  3T97 A;  4PD4 E;  2WMM A;  1FDM A;  2ITA A;  2W6J H;  3QH9 A;  4NPE A;  2I8D A;  1BE3 J;  4I7Z B;  1AFO A;  2IBZ G;  1FJP A;  2HG5 D;  4LC1 A;  1NYK A;  3E1R A;  1NU1 D;  2E5T A;  5AW2 B;  4W7Z A;  1EG9 A;  3VP8 A;  4HM3 A;  4OVN F;  2WSS H;  1NDO A;  3H1H E;  5AVV B;  1NH4 A;  1OZH A;  1VQ4 P;  1USD A;  1FDI A;  1YJ9 P;  4WWI A;  2NPS A;  1ZRT D;  2QJP C;  3OW2 O;  4BRY A;  1NAY A;  1NTK E;  3LID A;  3CWB E;  1KIL C;  3IF4 A;  1J1E B;  3VMY A;  2DW3 A;  1SFC D;  4U3F E;  4OGQ C;  1GZL A;  1NTZ K;  2E76 C;  1KV4 A;  2YVJ B;  1NTM K;  1GDT A;  1S5L E;  3BRT B;  2XDJ A;  3L72 J;  4H44 C;  2MJZ A;  3VCA A;  5KTB A;  1PGO A;  3CL3 D;  1K8A Q;  1GMJ A;  3CI9 A;  1YTZ I;  1QL2 A;  2QSI A;  2SPZ A;  4N3Y B;  1E5W A;  2IBZ D;  2YXQ B;  1FE6 A;  4PD4 H;  1GTW A;  2B88 A;  2XSH A;  3G4S P;  1L4A D;  3EFG A;  1RFS A;  4P1B H;  2R5D A;  4NBA D;  2KOG A;  1NTZ J;  5TIS H;  1NTM J;  2YKQ A;  1KYO E;  2W6A A;  4QMA A;  3H1L G;  3IR9 A;  1QX8 A;  2GBW A;  1N7S C;  4WBA A;  4WVZ A;  3M9B A;  4NBH D;  2RH0 A;  1SQB G;  2P58 A;  3L35 A;  2WPS A;  1URQ D;  2JDI H;  2E74 B;  2A45 H;  3EFF K;  1ZR2 A;  2Y0E A;  1NU1 E;  2N1T D;  5AW6 B;  3USS A;  5KLI B;  3E1I A;  4AYC A;  1CSB A;  4W80 A;  4GOD A;  4WB4 A;  5AW1 B;  2JO6 A;  4ASV A;  1LT9 A;  3VYI A;  5GTH E;  1ZRT E;  4WY4 D;  2NVG A;  2M0B A;  3BCC G;  3C8V A;  2Y0C A;  3TK1 A;  3D6Z A;  1XTC C;  1FZC C;  3MTU E;  2QIW A;  1KN7 A;  4QDC A;  1ZP0 C;  1J1D B;  4IOI H;  3TNU B;  2ZVN B;  3H1L D;  3B5N A;  2OTJ P;  1AA0 A;  4UB8 H;  1MFT A;  1SQP K;  4BWN A;  1YJN P;  2M8R A;  4IL6 X;  1HGV A;  1R5L A;  5KAI E;  3U1A A;  4RKU J;  1N73 B;  4QUR A;  1T6A A;  3RL0 C;  3D70 A;  1VL2 A;  2D2C D;  3B71 A;  4L75 A;  3FXE A;  1G2C B;  1SQB D;  2QJY B;  3EWK A;  1ZXG A;  3AE7 C;  2FYU K;  1OVR A;  3L73 G;  2IBZ E;  3CCM P;  3RK3 B;  4PJ0 E;  4XA4 A;  4DCK A;  2O3J A;  4UB6 H;  2RKL A;  3TGU J;  3AE9 C;  1L0N G;  3F89 A;  4NBG D;  1MUU A;  3NXS A;  2NUM A;  4C7N B;  2AXT E;  1SQQ J;  2Q3E A;  1VQN P;  1YQ4 C;  3KZI E;  3BCC D;  3CCJ P;  3L4F A;  1HBW A;  3AEC C;  4RES B;  1WT6 A;  2GA1 A;  1S9K E;  2FY8 A;  2OYH B;  1O7M A;  1SP4 A;  2GUS A;  1M1J B;  5GTH H;  1SVF A;  3WMM 0;  2B1X A;  1FOS F;  4BRY B;  2Q3I A;  3P7K A;  4N78 D;  1RF1 A;  1GU5 A;  4U7J A;  5AW7 B;  1AJY A;  4HB1 A;  2BMQ A;  2KSE A;  1KIL D;  5KJ7 A;  3HTK A;  3MUD C;  3L73 D;  1K73 Q;  4I6M C;  1A02 J;  4OGQ D;  1RE4 A;  2HMN A;  2E76 D;  5KAI H;  2KS1 B;  5DJT B;  3D6Y A;  2HPC A;  2KI7 B;  3CD6 P;  1HVV A;  1JY3 P;  1U7J A;  1X9V A;  5APW A;  4H44 D;  4JYC A;  1L0N D;  4PV1 C;  4TLF A;  3PHL A;  3C1L A;  1LNQ A;  3N7N A;  2KXP B;  3H1L E;  4NPF X;  5APY A;  4PJ0 H;  4HM2 A;  3KYQ A;  2C0X A;  4N6J A;  2Q5U A;  3AEG C;  3CCE P;  2Q7C A;  1N86 A;  3ITK A;  1T2K C;  2FBW C;  2FYN B;  4HYT B;  3BAT A;  1SS1 A;  1SFC B;  2V7Q H;  2O1K A;  1KB9 I;  3HUS B;  3FWL A;  4Y28 J;  2I1K A;  1VQ7 P;  2BCC G;  1FC2 C;  1AQT A;  1QL1 A;  3V2P A;  2AEJ A;  3A0H H;  1IO4 A;  1JY2 P;  2KK7 A;  1N7S D;  1SQV K;  1M1K Q;  5EFW B;  5KKZ B;  2M3B A;  3L70 J;  5CHX A;  1IK9 A;  2O1J A;  4HJG H;  2Q1K A;  1LWU C;  2FXM A;  4H13 C;  2E5Y A;  1LP1 B;  1Q7Y Q;  1VQL P;  2XSO A;  1KFM A;  2DE5 D;  1RQU A;  1L4A B;  1U57 A;  1M8O B;  2NVF A;  1LT9 B;  2FKW B;  1NHL A;  3Q5R A;  2OYI A;  2WSE J;  5AW5 B;  1K05 A;  1M56 D;  3GL0 A;  3GB4 A;  3MGN A;  3L75 J;  2JJL A;  2L5G B;  1IFM A;  1OIP A;  2ZT9 C;  3L74 J;  1O7W A;  3ABV C;  1LTT C;  2LXC B;  1DX7 A;  1DH3 A;  2KUB A;  4EDF A;  1SQX K;  1URQ B;  4U3F G;  2BCC D;  2HYN A;  2J58 A;  3FXD A;  3M0D C;  1JTH A;  4YPC A;  1JCD A;  5AW8 B;  2WPQ A;  1EXI A;  4YXD C;  3A0B H;  2N1T B;  3LW5 J;  1S1C X;  2B9B A;  3RBZ A;  3RL0 D;  3A2A A;  3H1I G;  1FOS E;  1FZF A;  4QUP A;  2KNC B;  4NPD A;  4A7P A;  4CPG A;  1GL2 B;  4L74 A;  1BGY E;  1IFJ A;  2BEZ F;  1PL5 A;  2NVE A;  4K3A A;  2E4Q A;  1FZG A;  4ZMD A;  2IYP A;  4HM4 A;  5BOK A;  2KP8 A;  2P10 A;  1JNM A;  4HKZ H;  5AVX B;  3H1H D;  3P8M C;  2YO3 A;  3NMD A;  2QJK B;  3EQQ A;  2B24 A;  3B5N C;  3I5C A;  3CWB D;  3EN1 A;  3GF3 A;  3WUU A;  2D2C B;  3CCU P;  5B5E H;  5BU8 B;  2JWA A;  1WMK A;  4U3F D;  4WY4 C;  4Y99 C;  3C9I A;  4ZKU A;  1GU4 A;  3AZC A;  1PGJ A;  3HTK B;  1WRG A;  2B87 A;  1PV3 A;  3H1I D;  3W68 A;  3L71 E;  4EMJ B;  1YHQ P;  3TNU A;  1PZQ A;  3CC4 P;  3GKE A;  1VQO P;  1LTB C;  2CPS A;  5APV A;  3FX0 A;  3GL2 A;  1RY3 A;  4M3L A;  1L0L K;  1N73 A;  4PV1 D;  1G2C A;  3RL0 g;  3TYY A;  2V4H A;  4DZO A;  2QVA A;  4YXW H;  2BCC E;  1KYO D;  1LTJ C;  3AE2 C;  4GIF A;  5KLV K;  3CCQ P;  2HOD B;  3H1J G;  2QJP B;  1T2K D;  3F5H A;  3AE5 C;  3SWF A;  3EQ2 A;  1KIL B;  3V2Q A;  1SQP G;  2B89 A;  2G8Y A;  3OA7 A;  1G1I A;  3K5B A;  4H0L C;  4C7N A;  1L0L J;  3M91 A;  1EDI A;  1RHZ B;  2YO2 A;  1YIT P;  1ZME C;  3SFE C;  2IZ0 A;  2E76 B;  3VMH D;  4HM7 A;  2QM7 A;  3RK2 B;  3Q2Y A;  2YFI A;  1W5C E;  2J5U A;  1PPJ E;  4H44 B;  4IFF A;  1NO4 A;  2KYV A;  3GZY A;  5KLV J;  4HM5 A;  2OYH A;  1KQS O;  3AEA C;  5CCH A;  1M1J A;  3B8E B;  4H13 D;  2JZA A;  1VQM P;  4RJT A;  1RH5 B;  1KB9 E;  2J59 M;  3BVH A;  2P1J A;  2IZ1 A;  4C46 A;  1BSH A;  2Q3W A;  2WVR A;  5CCG C;  3G9R A;  4HKV A;  1X22 A;  1JUN A;  3L37 A;  2OYI B;  2E4P A;  1N8R Q;  4EYY Q;  1FAV A;  3MIW A;  2XU6 A;  3H1K J;  2KS1 A;  2Y0D A;  5BU5 A;  2YFJ A;  1NTZ E;  3H1I E;  4KJM A;  4HM8 A;  1NAF A;  2K37 A;  3GG2 A;  1LTG C;  3H1H J;  2ZT9 D;  1Q82 Q;  2ZAE B;  1JTH B;  4XFJ A;  2O01 N;  2LXB A;  1ZW0 A;  1ZOY C;  1NTK J;  3CWB J;  3AEB C;  3G6E P;  2IX7 C;  1EDL A;  5GTI E;  2QE7 H;  3IFM A;  1G8J B;  1IFD A;  1PIX A;  4ZKP A;  1SFC A;  3AEE C;  4GT1 A;  5CXM A;  3HUS A;  2H89 C;  4JQ0 D;  5AVY B;  2KB7 P;  2GUV A;  4JYB A;  2IYO A;  2W27 A;  5AVW B;  3PLN A;  1AQ5 A;  1S4X A;  1S9K D;  2IFN A;  1FZC B;  2H88 C;  3D71 A;  3CXH I;  1LTS C;  3HD7 B;  2XNX A;  1LP1 A;  2Z4E A;  4D6T G;  1LGH B;  4NBD D;  1NJI Q;  5AVZ B;  4NBB D;  5AVS B;  3B5N D;  1L4A A;  2YMY A;  1VQ5 P;  1UUW A;  2AEF A;  2QPZ A;  3N4X A;  1OVV A;  1EZV I;  1BCC J;  1S5L H;  3FOU A;  3SWY A;  1H8A A;  2JP3 A;  3A3Y B;  4XE5 B;  1SQV G;  3TDK A;  4C7R A;  1RF0 C;  3IN6 A;  2B87 B;  5CMZ A;  2WSC H;  3CX5 I;  3PP5 A;  3NFQ A;  1YBK A;  2KLU A;  3SWK A;  2E43 A;  3V2R A;  3O6Q B;  1D7M A;  1RE3 C;  4HJL A;  1URQ A;  1SQQ K;  1NU1 J;  3H1J E;  4OH8 B;  3TGU E;  1T3J A;  1YYC A;  2FFD A;  1SQP E;  2N1T A;  5GTI H;  1EC5 A;  3D89 A;  1KYO H;  2KNC A;  5KLI C;  2YIU C;  1IFN A;  1GL2 A;  5CBO A;  2FYU E;  4D6T D;  3AE4 C;  2M5A B;  2HFE D;  1SQX G;  2YMK A;  2K3R A;  2R5B A;  1VQP P;  2R3S A;  3M9Q A;  2BAS A;  3S9O A;  3GHG C;  4H0L D;  5KJ7 D;  2E75 B;  1J1D C;  2L91 A;  2K9J A;  5H2F E;  3GCE A;  1BGY G;  1DD4 A;  2ZYL A;  1JY3 N;  5C39 A;  1NGM B;  3U59 A;  1AV1 A;  1FDO A;  3P8C E;  4IL6 E;  2QJY C;  3FWN A;  3PJS K;  1N2D C;  1M90 Q;  2ZYA A;  1YTZ T;  3I55 P;  2R3C A;  3CME P;  5CCG D;  2V7Q J;  3GLM A;  2KZI A;  1T8Z A;  4NBF D;  2QRX A;  1E79 H;  1FBM A;  2XV5 A;  2WPR A;  5APU A;  2W83 C;  1OW8 A;  2OGU A;  1JY2 N;  1PGP A;  2YKP A;  1SQX D;  4LLH A;  1PP9 G;  4LGD E;  1L2P A;  3LIE A;  2OTL P;  3L71 G;  2WQY C;  4OWF A;  2ZVO B;  4AIV A;  1LWU B;  3RGU A;  4H13 B;  3V6I A;  1BGY D;  2HOD A;  1GK4 A;  1VQ9 P;  2NPS C;  3AE1 C;  1HF9 A;  1OVU A;  1SLQ A;  3ZDM A;  2AXT H;  2ZYG A;  1SQB K;  1KIL A;  1BE3 G;  3KZI H;  4TT3 H;  3TF5 A;  1KQF B;  4D6T E;  1YIJ P;  3VMG D;  2XR8 A;  2DE7 D;  2A45 I;  2A06 G;  3A5T A;  3Q5S A;  2JR8 A;  2Y9Z A;  5AW3 B;  2OYO A;  3H1L J;  1QLE D;  1KTM A;  4IL6 H;  1SQV E;  4AQR D;  1J2J B;  1OWA A;  1OX3 A;  1DD3 A;  4P1C H;  1SQB J;  3WUT A;  1VM9 A;  1PP9 D;  3MP7 B;  2NRG A;  5AEU A;  1PPJ G;  3L71 D;  1FU1 A;  3HE4 A;  3M0A A;  2FYN C;  1HWT C;  1GD2 E;  2O01 H;  2G3A A;  3CXH E;  1N7S A;  1KFN A;  1GK6 A;  4AAY B;  1BE3 D;  1LTA C;  1USE A;  1FZA A;  3BCC J;  1JEK A;  3CMA P;  1NWQ A;  2WPV B;  2FFD B;  3QWO C;  1EZV E;  3RBX A;  1SQX E;  1LTI C;  4GDO A;  1NTZ G;  2CKF A;  3L36 A;  5AW0 B;  1L0N K;  2P2U A;  1NTM G;  1RIE A;  1P84 I;  3CX5 E;  4JBZ A;  2RN0 A;  3C0D A;  4WY4 B;  3WUV A;  2DE6 D;  1LT9 C;  1CW5 A;  2HR3 A;  2RMZ A;  1IFI A;  3L73 J;  1PPJ D;  3PH0 A;  2K1A A;  1T3U A;  1FZC A;  1VCK A;  1AVY A;  1Y8A A;  2K9J B;  3HD7 A;  1L0N J;  1KB9 D;  2JO1 A;  2K88 A;  2CPB A;  4RO0 A;  2ZXX A;  1H89 A;  1OXZ A;  2C0W A;  4O9B A;  5AVT B;  4R4L A;  4HM0 A;  1JOC A;  1MKM A;  4IFM A;  1O7P A;  2H43 A;  3PTZ A;  1PP9 E;  2YFL A;  4NBC D; 
#chains in the Genus database with same CATH homology
 2ZT9 D;  4QDF A;  3H25 A;  3L75 E;  2HMJ A;  4XFJ A;  1Q90 D;  3GOB A;  3L74 E;  3AE9 C;  2OQQ A;  3GZX A;  2NWF A;  1OW6 A;  1ZOY C;  1OW7 A;  5AEW A;  4NBG D;  3AEB C;  3BCC E;  3O6Q A;  4Z1M H;  2NUM A;  1ULI A;  1YQ4 C;  1G8J B;  1PIX A;  3AEE C;  5CXM A;  2H89 C;  1BE3 E;  3AEC C;  1L0L E;  2BMR A;  4YTP C;  1O7M A;  2A06 E;  2B1X A;  5KKZ C;  2H88 C;  1KIL E;  3D71 A;  4U7J A;  3Q1M A;  5KLV E;  1AJY A;  1VF5 C;  3GTS A;  3L73 E;  2BMQ A;  2E74 D;  1OMI A;  1S5L X;  4NBD D;  4OGQ B;  4NBB D;  1SJG A;  1UUW A;  4OGQ D;  2QPZ A;  1UIX A;  2HMN A;  2E76 D;  1L0N E;  1K04 A;  5M1B A;  3D6Y A;  1ULJ A;  3FOU A;  3AE6 C;  3VMI D;  2JP3 A;  4H44 D;  4PV1 C;  3IN6 A;  3L72 E;  3H1K E;  2MKV A;  3H1L E;  4HM2 A;  1KMI Z;  3AEG C;  2K9Y A;  2FBW C;  4HJL A;  1FQT A;  3H1J E;  1IK7 A;  3TGU E;  1HJ0 A;  1R8E A;  1SQP E;  3R4Y A;  4Y28 J;  3D89 A;  3RK3 E;  4I7Z C;  1NTM E;  3DQY A;  5KLI C;  2YIU C;  3SFD C;  1JB0 J;  2FYU E;  3AE4 C;  2HML A;  2NUK A;  4H13 C;  1VF5 B;  2WSF J;  2YMK A;  2FXP A;  4H0L B;  2XSO A;  2XRX A;  3S9O A;  4QCK A;  2DE5 D;  1RQU A;  4H0L D;  2E75 B;  3FGA D;  1U57 A;  2HMM A;  2HMK A;  3GCE A;  3Q5P A;  1DD4 A;  2QJK C;  3AE3 C;  1WQL A;  2E75 D;  2ZYL A;  2NVF A;  3AED C;  3Q5R A;  1KOR A;  1Y9B A;  1NGM B;  2D2C C;  2WSC J;  2WSE J;  3GTE A;  3AE8 C;  1K05 A;  1FDO A;  3GL0 A;  3GB4 A;  5L8R J;  1BCC E;  2QJY C;  4R4M A;  3Q3D A;  4QUQ A;  2ZT9 C;  1O7W A;  3ABV C;  4PD4 E;  1Q90 C;  1P84 E;  1TU3 F;  2V7Q J;  3GLM A;  1EXI A;  4YXD C;  4NBF D;  3LW5 J;  1S1C X;  4I7Z B;  1OW8 A;  5HL4 A;  1EXJ A;  4QUP A;  1NYK A;  4QDF B;  3IAO A;  1KQG B;  1EG9 A;  2WQY C;  2BEZ F;  1PL5 A;  2NVE A;  2E4Q A;  4HM3 A;  4HM4 A;  4AIV A;  5BOK A;  4H13 B;  1NDO A;  3H1H E;  2P10 A;  1FDI A;  2GBX A;  3AE1 C;  2QJP C;  1HF9 A;  4QDD A;  1NTK E;  3CWB E;  2E74 C;  4HM1 A;  4TT3 H;  3EQQ A;  1SQQ E;  2B24 A;  1KQF B;  4NB9 D;  1O7H A;  3VMG D;  3EN1 A;  2XR8 A;  4U3F E;  3GF3 A;  4OGQ C;  2DE7 D;  2D2C B;  2E76 C;  2YVJ B;  3VCP A;  1WMK A;  3Q5S A;  4H44 C;  3VCA A;  1YQ3 C;  1KTM A;  1SQV E;  1GMJ A;  2IDB A;  3AZC A;  3T97 B;  1VF5 D;  2QSI A;  1PV3 A;  1O7N A;  1DD3 A;  3GF7 A;  3L71 E;  4P1C H;  1VM9 A;  4EMJ B;  2XSH A;  3GKE A;  1RFS A;  5AEU A;  4P1B H;  4NBA D;  2FYN C;  3AEF C;  3GL2 A;  4PV1 B;  4PV1 D;  1KYO E;  2G3A A;  3CXH E;  3RL0 g;  1NYH A;  2BCC E;  2GBW A;  4KT0 J;  3AE2 C;  4AAY B;  4NBH D;  4NB8 D;  2BMO A;  2BEQ D;  2WPV B;  3AE5 C;  1DIP A;  2E74 B;  1EZV E;  2G8Y A;  1SQX E;  4GDO A;  2I7F A;  2CKF A;  1NU1 E;  4H0L C;  4NBE D;  1ZME C;  3SFE C;  1RIE A;  3GMA A;  3CX5 E;  2E76 B;  3VMH D;  4HM7 A;  2E75 C;  3C0D A;  2YFI A;  1RQV A;  2J5U A;  1PPJ E;  4H44 B;  2DE6 D;  1UUV A;  2JO6 A;  3GZY A;  1ZRT E;  4HM6 A;  4HM5 A;  2NVG A;  3C8V A;  3AEA C;  4H13 D;  2HMO A;  3D6Z A;  2JZA A;  1G8K B;  3L70 E;  2NZ2 A;  1KB9 E;  1VCK A;  2QIW A;  4QDC A;  1ZP0 C;  2Q3W A;  3G9R A;  4HKV A;  4IL6 X;  1SQB E;  2JO1 A;  4RKU J;  2E4P A;  2O01 J;  4QUR A;  1JM1 A;  3D70 A;  1VL2 A;  2D2C D;  3B71 A;  4R4L A;  4HM0 A;  1MKM A;  3EWK A;  2YFJ A;  3N0Q A;  1O7P A;  3AE7 C;  1NTZ E;  1O7G A;  3H1I E;  2ZT9 B;  2IBZ E;  4HM8 A;  3Q2Y A;  1PP9 E;  2YFL A;  4NBC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...