2QJKC

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 51
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjkC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjkC02
3GKEA 1O7WA 2NVFA 1WQLA 5CXMA 2XRXA 3C8VA 2FYUE 4NBBD 4Y28J 1S5LX 2QIWA 4OGQB 5KLIC 4H13B 2HMJA 2BMOA 3N0QA 4HJLA 4QDFA 5L8RJ 1EZVE 3L74E 2FYNC 2E4PA 4HM8A 5KLVE 5AEUA 1VCKA 1NDOA 4H0LD 2D2CD 4NBED 2E75D 4OGQD 1UUVA 2DE6D 4NB8D 4AAYB 3GZYA 4HM2A 1O7PA 3EN1A 3GTSA 2DE7D 3VMHD 2E4QA 2HMNA 1UUWA 1NTME 3GL2A 1NTKE 3VMGD 2NUMA 2BMQA 1P84E 2WSEJ 4NBGD 3VCPA 2HMKA 3AZCA 1PP9E 2QJKC 2BMRA 4HM3A 2D2CB 3L75E 4QDCA 1VM9A 3H1JE 3L70E 2A06E 1VF5B 2B1XA 4KT0J 4NBDD 2WPVB 1BCCE 2HMOA 3L72E 2ZT9B 2YFLA 4H13D 1O7GA 2E76B 3LW5J 5KKZC 3CX5E 1KYOE 2WSCJ 1L0NE 3FOUA 2HMLA 2QJYC 1JM1A 2YVJB 1JB0J 1G8JB 2E74B 2Q3WA 1KB9E 2O01J 1O7MA 2NUKA 4PD4E 1NU1E 1L0LE 3CWBE 5AEWA 3D89A 2DE5D 1G8KB 4HM4A 4QUQA 2YFIA 3L71E 4U3FE 2K9YA 2XSOA 4HM0A 2QSIA 1ZRTE 4NBFD 1SQVE 1NTZE 3H1KE 3C0DA 4PV1B 4H44D 3GB4A 2NVGA 4HM1A 4NBAD 2YFJA 1SQPE 4HM7A 2QJPC 3EQQA 4QCKA 2BCCE 3GZXA 2E74D 3VCAA 1RIEA 2JO6A 1FQTA 1O7HA 4NBCD 3GTEA 4HKVA 1O7NA 1SQBE 3L73E 3VMID 4H0LB 3DQYA 2CKFA 4P1BH 3GCEA 3TGUE 1BE3E 4H44B 4PV1D 4HM5A 4QUPA 1Q90D 2E76D 4QDFB 2B24A 2HMMA 4EMJB 2E75B 5BOKA 1SQQE 3H1HE 4QURA 1EG9A 4QDDA 3H1LE 1SQXE 2GBWA 3GL0A 4NBHD 4AIVA 5HL4A 4I7ZB 3H1IE 4HM6A 2XR8A 1SJGA 4NB9D 2XSHA 2I7FA 4RKUJ 2ZYLA 1ULIA 2GBXA 2NVEA 2WSFJ 4IL6X 3GOBA 2NWFA 3BCCE 2IBZE 2ZT9D 2QPZA 1VF5D 1ULJA 2YIUC 2JZAA 1RFSA 4P1CH 1PPJE 1NYKA 3CXHE 1Q90C
chains in the Genus database with same CATH superfamily
1L0ND 1GK6A 3CXHH 3HUSB 3P7KA 3B5NB 4QDFA 1KYOI 1NDOA 3CC2P 3B4SA 2E75D 4UB8E 1UUVA 3L73G 1USDA 3GHGB 1R5SA 4C7RA 2R5DA 1ZR4A 4NBGD 1Q2NA 1M90Q 2Q3IA 1OW7A 3CX5I 3Q3DA 1NAFA 3L72E 4H13D 4LC1A 5BU5A 2VRSA 2ZXXA 1ZN5A 1DD3A 1QL1A 1G8JB 1KB9E 2O3JA 1KYOH 1L0LE 5KAFH 5CCGC 4O9BA 1NU1D 2BEZF 3RK3B 2RH0A 3RL0B 3SFEC 2E74D 1NJIQ 1BE3J 3CX5H 1DIPA 4HKVA 3M9QA 2V7QJ 5APTA 3M9BA 1L0LJ 4P1BH 1ZLLA 1VPCA 2P67A 3V2NA 4HM5A 3L72J 3V4WA 2D2CC 1LTJA 3SWKA 3A7OA 1D7MA 4UB8H 1NH4A 4U3FJ 3GHGA 1IFPA 1GW3A 1KB9D 1ULJA 1J1DB 3CXHE 2XU6A 1Q90C 2KK7A 1M8OB 1O7WA 2NVFA 2YIUB 4ZKUA 3L70D 3L4FA 1U7MA 3RK3C 2FXPA 2Y0DA 3TF5A 3TNUA 5DJUB 5APVA 2WPSA 3CCUP 1DH3A 2YKPA 2QEXP 3NXSA 3HUSC 4OWFA 1X0TA 3NTNA 1EDIA 3SFDC 3KDPB 3P8CD 1P84E 1EZVI 2KNCB 3HD7A 1X9VA 2ZXEB 2ZYAA 3G3ZA 3M91A 1YITP 3TK1A 5H2FH 2E76B 2HODB 3V2RA 3PHLA 1EXJA 1RE4C 3II6A 4I6MC 2W6AA 1VQPP 3L37A 4MN4C 3N4XA 2H88C 3H1IJ 3GHGC 4ASWA 1NTMK 2B87B 4HM7A 3D6ZA 1LWUC 4TT3H 4ZKPA 3CPWO 1M1JC 4R4LA 3TGUJ 2K9JB 3L73E 1PP9D 2IYPA 1ZXGA 3SWFA 2I1KA 4GOFA 2UWJE 1Q81Q 2HPCA 3WU2E 1LTSC 3H1LG 3HUSA 1LTTC 2Q5UA 3H32B 3L70J 1G1JA 2R3CA 1JO5A 1NU1J 1URQC 1EDKA 1MUUA 1KN7A 1PGQA 2ZYGA 4M3LA 5CXMA 2XRXA 4L74A 2BCCG 2QIWA 4H13B 5CJ4A 1EZVE 3RK3E 1PZQA 3OA7A 3L72D 2HODA 4B86A 1DEBA 1GU5A 4RO0A 3VN0A 4NB8D 2DE6D 4WBAA 1JMMA 3F89A 3AE9C 3S9OA 1U57A 2NUMA 1N7SD 2HMKA 1KFNA 1JY3N 4R4MA 3MTUE 4EDFA 1LNQA 3H1JE 1VM9A 3L70E 1WRGA 1KQFB 2A45I 1VQMP 3IAOA 1URQB 4LLHA 1IFDA 3AE2C 1FJKA 1SVFA 1L0LD 1ZRTD 2B88A 1Y47A 3I55P 4K35A 5AVUB 1GL2C 1HVVA 1FZCB 1S4XA 3CMEP 2A06D 1O7NA 1IZNB 1SQBJ 1X8YA 1K8AQ 1AVYA 1H0TB 1MFZA 1NTMJ 1CI6A 1BE3G 4EIJA 1FZFA 4AUWA 5AW5B 4DT0A 1S9KE 1SQQE 1BDCA 4OGQC 1JY2O 1OWAA 1SQBD 4QDDA 3GW6A 5HL4A 3LW5H 3MP7B 2R32A 2OQQA 1DEEG 2NWFA 2FYUD 2QG4A 4WY4C 3MD0A 1OZHA 2GM4A 1LJ2A 3CCMP 1PPJG 3JSVC 3TNUB 1NTKJ 1NTZK 3G6EP 1L2PA 2QM7A 1S3JA 1JOCA 3AZCA 4DOJA 1G2CA 3H1LJ 1OW6A 2KSJA 2KB7P 2FYUJ 3CL3D 2HFED 2N9BA 2NPSB 1JM1A 1YQ3C 4RESB 1HJBA 4W7ZA 3E7KA 4KJMA 4CPGA 2LXCB 2AEFA 2KZJA 3WU2H 2KUBA 3RL0C 5AW1B 2JO1A 1RIEA 1ZW0A 3B5ND 1BGYJ 1N73A 3GMAA 1RHZB 3PP5A 4C7NA 2OYIC 1KILA 1YQ4C 3N7NA 5AVYB 2HYNA 4H44B 3H1IG 1Q90D 3G4SP 2B24A 3Q5PA 3HE4A 4W80A 1EG9A 1VDFA 3KPEA 5APSA 2XR8A 1JEKA 2YXQB 5KJ7C 2GBXA 1PGPA 4IL6X 1YYCA 2QA4P 4DCKA 3CC4P 3U1AA 1PPJE 1NTZG 4IOIH 5BVZA 2BMOA 5CMZA 1VCKA 1RH5B 2KLUA 1X22A 4HJGH 3Q5RA 4TLFA 1KV4A 3M0DA 1EXIA 1VQ6P 2ZYDA 1PGJA 1QEXA 1PP9E 3P8MC 1E5WA 4PJ0E 3L71D 1XTGB 3VTPC 3IF4A 2E75C 1QVGO 2CPBA 1PL5A 4U7JA 5AVTB 4EOTA 1EC5A 3EWKA 5DJTB 2E5YA 5CBOA 3C0DA 4PV1B 1M1KQ 2NVGA 4HM1A 3HTKA 3FXDA 3WUVA 1RQUA 3HD7C 2P7JA 1NTMG 1U7JA 1O7HA 1SQVJ 5BU8B 1RE3A 3MUDA 1SLQA 1UIIA 1HTLC 5CBNA 3WUUA 2C0WA 4EI2A 3BASA 1JUNA 4NBHD 2QM8A 1KD1Q 3U1CA 2P10A 1YTZT 4RKUJ 4JPZB 1ULIA 2P2UA 4KHXA 2O01N 3FX0A 1L4AD 2ZT9D 3BCCG 3L71G 1T8ZA 4YTPC 3ZDMA 1PPJD 1NYKA 1S72P 1BSNA 2K88A 1N7SC 1QLED 1CW5A 2WT7B 2AXTH 4WWIA 4IFMA 2Y9ZA 3CX5D 3GZYA 3EN1A 2DE7D 5M1BA 2BMQA 4I7ZC 2IDBA 2M3BA 1QX8A 2LR2A 3HE4B 4QDCA 2KIKA 1VQOP 3D6YA 1RE3C 1CSBA 2RMZA 1IFNA 5GTIH 5AVQB 2WSCJ 3AE6C 2I8DA 2HMLA 2OTJP 2E74B 2N1TC 4ZMDA 2ITAA 2FKWB 2SPZA 1RF1B 2M5AA 3D89A 4OVNF 3Q5SA 5AEWA 1HUCA 2E76C 2Z5HA 4NBFD 1IFMA 1KZUB 3H1ID 4H44D 3V5BA 3RBZA 4XFJA 2KOGA 1LT9C 3USSA 2BCCE 2KS1B 1BE3D 1OIPA 1OFCX 2KSEA 5KAFE 1DX7A 1HGZA 1GU4A 1YBKA 3Q1MA 2L91A 3FXEA 1N73C 2BASA 2HMMA 3H1HE 2JR8A 1KILC 3K5BA 4NPFX 1Q82Q 3S1KA 3IN6A 1VF5D 1IK7A 3AE1C 1EDJA 3CCLP 3CWBG 2JDIH 1LWUB 1L4AB 1J1DC 3C8VA 1P84I 3CWBD 1NGMB 3VMZA 1W2BO 1PP9J 5AW8B 4AAYB 3A0BH 4HM2A 3TYYA 2AEJA 1IO4A 1SQBK 1LWUA 3W67A 5KKZB 2WZ7A 1E79H 1G1IA 2IZ0A 2NPSD 5TISE 4IL6E 3G71P 5KLVK 1WMKA 1KYOE 3AEGC 1SQPD 1YTZI 2KLVA 1RF0C 2XV5A 1FZEA 1KB9H 4QUQA 1BGYD 1SQXD 1J1EC 2MJZA 1Y8AA 4IL6H 3LIEA 5AW3B 4H0LB 5TJHA 3UIAA 2J59M 3T97A 2Z5IA 1X79B 2JEEA 5APYA 1M57D 1KB9I 3GF7A 3VYIA 2HLOA 5APWA 2LXBA 5GTHE 2FYZA 4HB1A 2JZAA 1LTIC 1NU1K 2P58A 1NVOA 3HE5A 2FYUE 1J1EB 2I1JA 2WMMA 3FWLA 1KMIZ 3BCCD 3VMYA 2ZJSE 1Q7YQ 3B8EB 4D6TD 4OGQD 1LP1A 3RK2D 1KORA 1P84H 1NTKE 4A7PA 2WSEJ 1KFMA 3H32A 2XDJA 3O8ZA 2OYIB 1JCCA 5CCGD 2JP3A 2E42A 2A06E 2B9BA 1BGYE 2B1XA 3C1LA 3B71A 3L70G 2KP8A 5AW0B 2FYNB 1NKNA 2O01J 3AECC 1FS0E 5AVZB 3VCAA 3M06A 1G8KB 2FFDA 3T97B 2K9YA 4WY4B 2K3RA 1FDOA 2YFJA 1K05A 1N7LA 2QJPC 1GL2B 1Q86Q 2CPSA 2YXRB 5AVWB 3ITKA 3CCQP 4IFDK 1SQBE 2O1JA 1IC2A 3AE7C 2A45G 2G3AA 2OYHA 1M1JA 1L0NJ 5KLIB 4L75A 3RL0D 4QURA 2V4HA 1SQXE 1T2KC 2Y0EA 2XSHA 1M7LA 2IX7C 3CCSP 2AXTE 3L74D 2O01H 3PRJA 3NFQA 1JY2N 1USEA 3I5CA 2Z4EA 4HM8A 1FOSF 2E4PA 1SFCC 4JQ0D 5CCHD 4H0LD 3CC7P 3TGUG 3CLQA 4GT1A 1NTME 4ASVA 5AW7B 1YJNP 2QJKC 1RF0A 2QE7H 3S4RA 3GG2A 2JKVA 1MZ9A 2R5BA 4AQRD 1N7SA 2RN0A 3C9IA 1RQVA 4GIFA 1NU1E 2ZVNB 2YFIA 3O6QB 1HGVA 3OAKA 4I2LC 1LT9B 1M56D 2FYUK 4Y99B 1FBMA 2YNYA 4GOEA 2KS1A 1IFJA 2JO6A 2HR3A 3H1JJ 1TU3F 2G8YA 3CI9A 3TGUE 1URQD 3RK3D 2IYOA 3TGUD 3GL0A 3H1HG 3LIDA 3H1IE 4HM6A 4WVZA 3CXHI 3RL0g 1BCCG 1KTMA 2QRXA 5KAIH 1NTZD 1KYOD 1FZAA 4HH2A 2RKLA 3L74G 3RGUA 3N0QA 3AEEC 1OMIA 3M0AA 2FYNC 1OXZA 5GTHH 2FYUG 2D2CD 4W7YA 5CCGA 1DD4A 3L73D 1Y9BA 4BXLA 4HYTB 3NMDA 3VMHD 1EQ7A 1SQBG 1R5LA 3MHVA 2ZT9C 4HKZH 1NTKG 3L73J 3P8CE 1SQXK 1LTAC 2D2CB 2PRRA 2XZRA 2FFDC 2HMOA 2K37A 3AEDC 2A06G 5CHXA 2ZVOB 3SWYA 2V7QH 2FBWC 4HM4A 3L71E 4U3FE 1ZRTE 1OVUA 2KXPB 1SFCB 1FAVA 1PGOA 5KLVG 4NBAD 2R3SA 2M8RA 4H13C 2IFNA 4JBZA 1GD2E 3H6PA 2QJPB 4NBCD 3L35A 3EFGA 2H43A 3HTKB 4AYCA 3GCEA 4XA4A 1BE3E 2WITA 1FZBA 1GDTA 1FU1A 2E76D 3B5NA 4QDFB 4D6TG 2OYIA 5AW6B 1AQ5A 2LKMA 3A0HE 2W6JH 4Y99C 2WPQA 2W8ZA 1KILE 3L72G 1SFCA 4GDOA 4BWNA 5APXA 1QL2A 3PH0A 4N78E 4NBBD 1BDDA 4OGQB 2YKOA 5B66E 2HG5D 1G2CB 1K73Q 5K5GB 2HMNA 2N9YB 2OTLP 2J5UA 3VMGD 1HWTC 2KNCA 1IK9A 1PV3A 2BMRA 2CK3H 1MFTA 4GKGA 4UB6E 4HM3A 1JCDA 4C46A 4KT0J 4NBDD 3Q2YA 4WY4A 2Q3EA 2ZT9B 1SQVD 2FFDB 1YHQP 2PGDA 3H1KD 1L0LG 1O7MA 1JMBA 2QSIA 2B89A 1AA0A 2ZAEB 1SQPG 3MGNA 1N8RQ 3CMAP 2Q7CA 1FQTA 2P1JA 1A02J 1SP4A 1NWQA 3L71J 2KI7B 3V2QA 4PV1D 5AW9B 1N86A 1GL2D 3P32A 4AIVA 3A5TA 2IBZD 3AE4C 3E1RA 1SJGA 3E1IA 4EYYQ 4YXWH 2QPZA 1T3UA 1VQ4P 4U3FG 5KTBA 2O1KA 1S9KD 1BCCJ 1LTGC 1KQGB 2HMJA 3V2PA 5KLVE 5L8RJ 3L74E 2IBZI 1SQQK 1L4AA 1NTKD 2C9LY 1AFOA 3EFFK 2WTYA 1AVOA 3MIWA 3EQ2A 1UUWA 5APQA 2A45H 4PJ0H 1FC2C 1PP9G 5KJ7A 3CCJP 4N78D 3RBXA 2AEMA 3H1HJ 4YXDC 2WPVB 3MZWB 2AXCA 3CX5E 2DW3A 1ZP0C 1HH0A 1EZVD 2Q3WA 3RK2C 3M9HA 3CWBE 1CI6B 2DE5D 3JCUE 1VQLP 5AVVB 2H7HA 1NTZE 2YO3A 3L36A 2E43A 2BCCJ 3VMXA 3GB4A 1GZLA 2WQYC 2XNXA 2H89C 3GZXA 1IFIA 3GTEA 3L75J 1R8EA 2PP6A 1M1JB 1GK4A 2Y9YA 1S5LH 3O6QA 1N2DC 3OW2O 1URQA 1HJ0A 2WSSH 5CJ0A 2M0BA 2GBWA 1SQQG 3H1KJ 1LT1A 1FZCC 2Q6QA 2NVEA 4I1LA 3BCCE 1FDIA 3B5NC 3IFMA 2YIUC 1RFSA 3KQGA 3QWOC 3AEAC 3FGAD 2WSEH 3MUDC 4D6TJ 1S1CX 1MKMA 4N3YB 1KILB 3GTSA 2E4QA 4WY4D 2WPRA 2E5TA 3GL2A 3A2AA 3F5HA 3VCPA 1LTBC 1ZR2A 1NTMD 3HRNA 3HD7D 1JM0A 1JNMA 1BSHA 1SQXJ 1H0TA 1NTKK 1L0NE 4DZOA 1RF1A 2OYHC 2W83C 1NU1G 2NPSA 2YO2A 2XSOA 3AEFC 5C39A 3W68A 1FZCA 3RK2B 1SQQD 3BRTB 1EZVG 4JYCA 3VOPA 3I56P 2OARA 1GW4A 3KHUA 3DQYA 2CKFA 1OX3A 3VP8A 1RE4A 1QVFO 1AJYA 5B5EE 4QUPA 2JJLA 3V4QA 3PTZA 1SQPJ 2E75B 2JWAA 1FOSE 3QH9A 4I7ZB 4NB9D 1YIJP 2L5GB 1JTHA 3CXHD 2K1AA 1GTWA 2W6BA 1JY3P 1NO4A 1LT9A 4WB4A 1JTHB 4NPDA 5EFWB 3HD7B 3GKEA 2ZFCA 1FJPA 1YJWP 1VQ8P 3KXDA 4YPCA 2NPSC 5KJ7D 1LP1B 1NYHA 4NBED 1J2JB 2QVAA 3D70A 1FDMA 3AE5C 3IR9A 5H2FE 2YKQA 2PAJA 4BRYB 3KZIE 1S5LE 1L4AC 2WVRA 2M3EA 3CCRP 2IFMA 1L0NG 1OVVA 2HPCB 5E79E 2R44A 3VMAA 3AEBC 4QMAA 1FE6A 4U3FD 3FOUA 2QJYC 1JB0J 4C7NB 2K9JA 2PFXA 1T3JA 2WWWA 1WT6A 1W5CE 1OVRA 3FWNA 1AV1A 1KQLA 3WUTA 3GLMA 1K9MQ 1KILD 3PLNA 4PV1C 1SQPE 3EQQA 4PD4I 3BATA 3H1KG 2Y0CA 1YI2P 1CZQA 1PIXA 1VQ5P 1VF5C 1A02F 2YMKA 2OYHB 2N1TD 3OJAB 1S2EA 1EDLA 3L75G 1IJDB 3H1JG 2QJYB 4N6JA 2E74C 1N7SB 4H44C 3H1LE 4XE5B 5AVXB 3R4YA 1L0NK 2C9NY 1SQXG 2J58A 2I7FA 1NKZB 3BRVB 1GL2A 1BGYG 1LGHB 2N1TB 1SS1A 1UIXA 3CD6P 4PD4H 2OGUA 2XNDH 5APUA 1O7GA 4IFFA 2YVJB 3WMM0 2M5AB 1ZMEC 3VP9A 5TISH 2KZIA 4HJLA 1NHLA 5AEUA 1VQKP 2XKMA 3SSUA 2QJKB 4NPEA 3V6IA 1RF1C 2NZ2A 5CCHA 4BRYA 3M0DC 1LTJB 2B87A 4JYBA 1JY3O 1SQQJ 2WT7A 1VL2A 3CCEP 4PD4E 3BCCJ 2IBZG 1W2EA 3R2PA 4HM0A 3KYQA 2W27A 4L73A 1AQTA 3H1KE 2OYOA 2FY8A 3A3YB 3H25A 4K3AA 1P84D 1LTJC 3VMID 2POHA 1HF9A 3G9RA 2Q1KA 1VQ7P 1OW8A 2WSFH 2FXOA 2NRGA 4EMJB 3U59A 5BOKA 2IPPA 1NTZJ 1Z56A 1KC8Q 4D6TE 1SFCD 2BCCD 5CCHC 2WSFJ 3GOBA 1VQNP 2FXMA 4DJGA 1SQVG 5GTIE 4P1CH 1HBWA 1L0LK 1WQLA 4Y28J 1S5LX 5KLIC 5E79H 3A0HH 1SQPK 1BCCD 3TSIA 3H1LD 3H1JD 3CCVP 1O7PA 3A0BE 3KZIH 3AE8C 2C0XA 5B66H 1ZOYC 4ZNCA 3HE5B 2JWDA 3BVHA 2Q9IA 1RY3A 1JY2P 1VQ9P 2YMYA 1H8AA 5KLVJ 3L75E 1NOHA 1VF5B 1BCCE 3JC22 1H88A 2YFLA 3TDKA 3LW5J 5KKZC 1GMJA 5AVRB 1QGKB 5KAIE 3JCUH 4L76A 2NUKA 2OTKE 2W90A 4PD4D 5AVSB 3AE3C 4Z1MH 4LGDE 1SQVK 3ABVC 3CWBJ 5AW4B 1SQVE 3L75D 4RJTA 1YJ9P 1H89A 1T2KD 4UB6H 1NAYA 3H1HD 2N1TA 1KQSO 4GODA 4QCKA 5B5EH 5AW2B 2WSCH 2H8PD 1ZV8A 4JF7A 1PFIA 2KYVA 5KLVD 2MKVA 4H0LC 2GA1A 1K04A 1MV8A 1N73B 4OH8B 2GUVA 1XTCC 1T6AA 3L74J 2ZYLA 3PJSK 2IZ1A 2BEQD 1FZGA 2IBZE 3D71A 3GF3A 2GUSA
chains in the Genus database with same CATH topology
2BMOA 4QDFA 4HM8A 2E4PA 1S1CX 1VCKA 1MKMA 1NDOA 4H0LD 2E75D 1UUVA 3Q5RA 1EXIA 3GTSA 2E4QA 3GL2A 1NTME 4NBGD 3VCPA 1PP9E 1OW7A 2QJKC 3Q3DA 3L72E 4H13D 1L0NE 2E75C 1DD3A 1RQVA 1G8JB 1KB9E 1NU1E 1L0LE 1PL5A 4U7JA 2YFIA 3EWKA 2XSOA 3AEFC 3C0DA 4PV1B 2BEZF 2NVGA 4HM1A 1RQUA 3SFEC 2E74D 2JO6A 1O7HA 1DIPA 4HKVA 1TU3F 2V7QJ 3DQYA 2CKFA 4P1BH 2G8YA 3TGUE 1AJYA 4HM5A 4QUPA 2E75B 2D2CC 3GL0A 4NBHD 4I7ZB 3H1IE 4HM6A 2P10A 4NB9D 4RKUJ 1ULIA 3RL0g 1KTMA 2ZT9D 1ULJA 4YTPC 1NYKA 3CXHE 1Q90C 3GKEA 1O7WA 2NVFA 3N0QA 2FXPA 3AEEC 1OMIA 2FYNC 1NYHA 2D2CD 4NBED 3D70A 3GZYA 3AE5C 1DD4A 1Y9BA 3EN1A 3VMHD 2DE7D 5M1BA 3SFDC 2BMQA 1P84E 2ZT9C 4I7ZC 2IDBA 2D2CB 4QDCA 3D6YA 2HMOA 3AEDC 2E76B 3AEBC 2WSCJ 3AE6C 3FOUA 1EXJA 2HMLA 2QJYC 1JB0J 2E74B 2H88C 5AEWA 2FBWC 4HM4A 3Q5SA 3D89A 3L71E 4U3FE 2E76C 1ZRTE 4NBFD 3GLMA 4H44D 4NBAD 4XFJA 4PV1C 4H13C 1SQPE 4HM7A 3EQQA 3D6ZA 4TT3H 2BCCE 1PIXA 4R4LA 1VF5C 4NBCD 3L73E 3GCEA 2YMKA 1BE3E 3Q1MA 2E76D 4QDFB 2HMMA 3H1HE 2E74C 4H44C 3H1LE 3R4YA 2I7FA 1KILE 1UIXA 3IN6A 1VF5D 1IK7A 4GDOA 3AE1C 1O7GA 2YVJB 5CXMA 2XRXA 1ZMEC 3C8VA 4NBBD 1NGMB 2QIWA 4OGQB 4H13B 4HJLA 1EZVE 3RK3E 5AEUA 4NB8D 2DE6D 4AAYB 4HM2A 3AE9C 2HMNA 3S9OA 1U57A 2J5UA 2NUMA 3VMGD 2NZ2A 2HMKA 1PV3A 4R4MA 2BMRA 4HM3A 1VM9A 3H1JE 3L70E 4KT0J 4NBDD 3Q2YA 1KQFB 2ZT9B 1WMKA 3AEGC 1KYOE 1VL2A 3IAOA 1O7MA 4PD4E 3AE2C 4QUQA 4HM0A 2QSIA 3H1KE 3H25A 1FQTA 1O7NA 3VMID 4H0LB 1HF9A 3G9RA 1OW8A 4PV1D 4EMJB 5BOKA 1SQQE 4OGQC 4QDDA 4AIVA 5HL4A 3AE4C 3GF7A 1SJGA 2OQQA 2WSFJ 3GOBA 2NWFA 2QPZA 2JZAA 4P1CH 1WQLA 2FYUE 4Y28J 1S5LX 5KLIC 1KQGB 2HMJA 5L8RJ 5KLVE 1KMIZ 3L74E 4OGQD 1KORA 1O7PA 3AE8C 1ZOYC 1UUWA 1NTKE 2WSEJ 3AZCA 2JP3A 3L75E 3FGAD 2A06E 1VF5B 1OW6A 2B1XA 4YXDC 2WPVB 1BCCE 2YFLA 3B71A 3LW5J 5KKZC 3CX5E 1GMJA 1JM1A 1ZP0C 2Q3WA 1YQ3C 2O01J 2NUKA 4Z1MH 3AE3C 3AECC 3CWBE 3VCAA 2DE5D 1G8KB 3T97B 3ABVC 2K9YA 1SQVE 1NTZE 1FDOA 3GB4A 2YFJA 1K05A 2QJPC 2WQYC 4QCKA 2H89C 3GZXA 2JO1A 1RIEA 3GTEA 3GMAA 1SQBE 1R8EA 1YQ4C 3AE7C 3O6QA 2G3AA 4H44B 1Q90D 2B24A 2MKVA 1HJ0A 4H0LC 3Q5PA 4QURA 1K04A 1EG9A 1SQXE 2GBWA 2XR8A 2XSHA 2ZYLA 2GBXA 2NVEA 4IL6X 3BCCE 1FDIA 2YIUC 1RFSA 2BEQD 1PPJE 3AEAC 2IBZE 3D71A 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKE A;  1O7W A;  2NVF A;  1WQL A;  5CXM A;  2XRX A;  3C8V A;  2FYU E;  4NBB D;  4Y28 J;  1S5L X;  2QIW A;  4OGQ B;  5KLI C;  4H13 B;  2HMJ A;  2BMO A;  3N0Q A;  4HJL A;  4QDF A;  5L8R J;  1EZV E;  3L74 E;  2FYN C;  2E4P A;  4HM8 A;  5KLV E;  5AEU A;  1VCK A;  1NDO A;  4H0L D;  2D2C D;  4NBE D;  2E75 D;  4OGQ D;  1UUV A;  2DE6 D;  4NB8 D;  4AAY B;  3GZY A;  4HM2 A;  1O7P A;  3EN1 A;  3GTS A;  2DE7 D;  3VMH D;  2E4Q A;  2HMN A;  1UUW A;  1NTM E;  3GL2 A;  1NTK E;  3VMG D;  2NUM A;  2BMQ A;  1P84 E;  2WSE J;  4NBG D;  3VCP A;  2HMK A;  3AZC A;  1PP9 E;  2QJK C;  2BMR A;  4HM3 A;  2D2C B;  3L75 E;  4QDC A;  1VM9 A;  3H1J E;  3L70 E;  2A06 E;  1VF5 B;  2B1X A;  4KT0 J;  4NBD D;  2WPV B;  1BCC E;  2HMO A;  3L72 E;  2ZT9 B;  2YFL A;  4H13 D;  1O7G A;  2E76 B;  3LW5 J;  5KKZ C;  3CX5 E;  1KYO E;  2WSC J;  1L0N E;  3FOU A;  2HML A;  2QJY C;  1JM1 A;  2YVJ B;  1JB0 J;  1G8J B;  2E74 B;  2Q3W A;  1KB9 E;  2O01 J;  1O7M A;  2NUK A;  4PD4 E;  1NU1 E;  1L0L E;  3CWB E;  5AEW A;  3D89 A;  2DE5 D;  1G8K B;  4HM4 A;  4QUQ A;  2YFI A;  3L71 E;  4U3F E;  2K9Y A;  2XSO A;  4HM0 A;  2QSI A;  1ZRT E;  4NBF D;  1SQV E;  1NTZ E;  3H1K E;  3C0D A;  4PV1 B;  4H44 D;  3GB4 A;  2NVG A;  4HM1 A;  4NBA D;  2YFJ A;  1SQP E;  4HM7 A;  2QJP C;  3EQQ A;  4QCK A;  2BCC E;  3GZX A;  2E74 D;  3VCA A;  1RIE A;  2JO6 A;  1FQT A;  1O7H A;  4NBC D;  3GTE A;  4HKV A;  1O7N A;  1SQB E;  3L73 E;  3VMI D;  4H0L B;  3DQY A;  2CKF A;  4P1B H;  3GCE A;  3TGU E;  1BE3 E;  4H44 B;  4PV1 D;  4HM5 A;  4QUP A;  1Q90 D;  2E76 D;  4QDF B;  2B24 A;  2HMM A;  4EMJ B;  2E75 B;  5BOK A;  1SQQ E;  3H1H E;  4QUR A;  1EG9 A;  4QDD A;  3H1L E;  1SQX E;  2GBW A;  3GL0 A;  4NBH D;  4AIV A;  5HL4 A;  4I7Z B;  3H1I E;  4HM6 A;  2XR8 A;  1SJG A;  4NB9 D;  2XSH A;  2I7F A;  4RKU J;  2ZYL A;  1ULI A;  2GBX A;  2NVE A;  2WSF J;  4IL6 X;  3GOB A;  2NWF A;  3BCC E;  2IBZ E;  2ZT9 D;  2QPZ A;  1VF5 D;  1ULJ A;  2YIU C;  2JZA A;  1RFS A;  4P1C H;  1PPJ E;  1NYK A;  3CXH E;  1Q90 C; 
#chains in the Genus database with same CATH topology
 1L0N D;  1GK6 A;  3CXH H;  3HUS B;  3P7K A;  3B5N B;  4QDF A;  1KYO I;  1NDO A;  3CC2 P;  3B4S A;  2E75 D;  4UB8 E;  1UUV A;  3L73 G;  1USD A;  3GHG B;  1R5S A;  4C7R A;  2R5D A;  1ZR4 A;  4NBG D;  1Q2N A;  1M90 Q;  2Q3I A;  1OW7 A;  3CX5 I;  3Q3D A;  1NAF A;  3L72 E;  4H13 D;  4LC1 A;  5BU5 A;  2VRS A;  2ZXX A;  1ZN5 A;  1DD3 A;  1QL1 A;  1G8J B;  1KB9 E;  2O3J A;  1KYO H;  1L0L E;  5KAF H;  5CCG C;  4O9B A;  1NU1 D;  2BEZ F;  3RK3 B;  2RH0 A;  3RL0 B;  3SFE C;  2E74 D;  1NJI Q;  1BE3 J;  3CX5 H;  1DIP A;  4HKV A;  3M9Q A;  2V7Q J;  5APT A;  3M9B A;  1L0L J;  4P1B H;  1ZLL A;  1VPC A;  2P67 A;  3V2N A;  4HM5 A;  3L72 J;  3V4W A;  2D2C C;  1LTJ A;  3SWK A;  3A7O A;  1D7M A;  4UB8 H;  1NH4 A;  4U3F J;  3GHG A;  1IFP A;  1GW3 A;  1KB9 D;  1ULJ A;  1J1D B;  3CXH E;  2XU6 A;  1Q90 C;  2KK7 A;  1M8O B;  1O7W A;  2NVF A;  2YIU B;  4ZKU A;  3L70 D;  3L4F A;  1U7M A;  3RK3 C;  2FXP A;  2Y0D A;  3TF5 A;  3TNU A;  5DJU B;  5APV A;  2WPS A;  3CCU P;  1DH3 A;  2YKP A;  2QEX P;  3NXS A;  3HUS C;  4OWF A;  1X0T A;  3NTN A;  1EDI A;  3SFD C;  3KDP B;  3P8C D;  1P84 E;  1EZV I;  2KNC B;  3HD7 A;  1X9V A;  2ZXE B;  2ZYA A;  3G3Z A;  3M91 A;  1YIT P;  3TK1 A;  5H2F H;  2E76 B;  2HOD B;  3V2R A;  3PHL A;  1EXJ A;  1RE4 C;  3II6 A;  4I6M C;  2W6A A;  1VQP P;  3L37 A;  4MN4 C;  3N4X A;  2H88 C;  3H1I J;  3GHG C;  4ASW A;  1NTM K;  2B87 B;  4HM7 A;  3D6Z A;  1LWU C;  4TT3 H;  4ZKP A;  3CPW O;  1M1J C;  4R4L A;  3TGU J;  2K9J B;  3L73 E;  1PP9 D;  2IYP A;  1ZXG A;  3SWF A;  2I1K A;  4GOF A;  2UWJ E;  1Q81 Q;  2HPC A;  3WU2 E;  1LTS C;  3H1L G;  3HUS A;  1LTT C;  2Q5U A;  3H32 B;  3L70 J;  1G1J A;  2R3C A;  1JO5 A;  1NU1 J;  1URQ C;  1EDK A;  1MUU A;  1KN7 A;  1PGQ A;  2ZYG A;  4M3L A;  5CXM A;  2XRX A;  4L74 A;  2BCC G;  2QIW A;  4H13 B;  5CJ4 A;  1EZV E;  3RK3 E;  1PZQ A;  3OA7 A;  3L72 D;  2HOD A;  4B86 A;  1DEB A;  1GU5 A;  4RO0 A;  3VN0 A;  4NB8 D;  2DE6 D;  4WBA A;  1JMM A;  3F89 A;  3AE9 C;  3S9O A;  1U57 A;  2NUM A;  1N7S D;  2HMK A;  1KFN A;  1JY3 N;  4R4M A;  3MTU E;  4EDF A;  1LNQ A;  3H1J E;  1VM9 A;  3L70 E;  1WRG A;  1KQF B;  2A45 I;  1VQM P;  3IAO A;  1URQ B;  4LLH A;  1IFD A;  3AE2 C;  1FJK A;  1SVF A;  1L0L D;  1ZRT D;  2B88 A;  1Y47 A;  3I55 P;  4K35 A;  5AVU B;  1GL2 C;  1HVV A;  1FZC B;  1S4X A;  3CME P;  2A06 D;  1O7N A;  1IZN B;  1SQB J;  1X8Y A;  1K8A Q;  1AVY A;  1H0T B;  1MFZ A;  1NTM J;  1CI6 A;  1BE3 G;  4EIJ A;  1FZF A;  4AUW A;  5AW5 B;  4DT0 A;  1S9K E;  1SQQ E;  1BDC A;  4OGQ C;  1JY2 O;  1OWA A;  1SQB D;  4QDD A;  3GW6 A;  5HL4 A;  3LW5 H;  3MP7 B;  2R32 A;  2OQQ A;  1DEE G;  2NWF A;  2FYU D;  2QG4 A;  4WY4 C;  3MD0 A;  1OZH A;  2GM4 A;  1LJ2 A;  3CCM P;  1PPJ G;  3JSV C;  3TNU B;  1NTK J;  1NTZ K;  3G6E P;  1L2P A;  2QM7 A;  1S3J A;  1JOC A;  3AZC A;  4DOJ A;  1G2C A;  3H1L J;  1OW6 A;  2KSJ A;  2KB7 P;  2FYU J;  3CL3 D;  2HFE D;  2N9B A;  2NPS B;  1JM1 A;  1YQ3 C;  4RES B;  1HJB A;  4W7Z A;  3E7K A;  4KJM A;  4CPG A;  2LXC B;  2AEF A;  2KZJ A;  3WU2 H;  2KUB A;  3RL0 C;  5AW1 B;  2JO1 A;  1RIE A;  1ZW0 A;  3B5N D;  1BGY J;  1N73 A;  3GMA A;  1RHZ B;  3PP5 A;  4C7N A;  2OYI C;  1KIL A;  1YQ4 C;  3N7N A;  5AVY B;  2HYN A;  4H44 B;  3H1I G;  1Q90 D;  3G4S P;  2B24 A;  3Q5P A;  3HE4 A;  4W80 A;  1EG9 A;  1VDF A;  3KPE A;  5APS A;  2XR8 A;  1JEK A;  2YXQ B;  5KJ7 C;  2GBX A;  1PGP A;  4IL6 X;  1YYC A;  2QA4 P;  4DCK A;  3CC4 P;  3U1A A;  1PPJ E;  1NTZ G;  4IOI H;  5BVZ A;  2BMO A;  5CMZ A;  1VCK A;  1RH5 B;  2KLU A;  1X22 A;  4HJG H;  3Q5R A;  4TLF A;  1KV4 A;  3M0D A;  1EXI A;  1VQ6 P;  2ZYD A;  1PGJ A;  1QEX A;  1PP9 E;  3P8M C;  1E5W A;  4PJ0 E;  3L71 D;  1XTG B;  3VTP C;  3IF4 A;  2E75 C;  1QVG O;  2CPB A;  1PL5 A;  4U7J A;  5AVT B;  4EOT A;  1EC5 A;  3EWK A;  5DJT B;  2E5Y A;  5CBO A;  3C0D A;  4PV1 B;  1M1K Q;  2NVG A;  4HM1 A;  3HTK A;  3FXD A;  3WUV A;  1RQU A;  3HD7 C;  2P7J A;  1NTM G;  1U7J A;  1O7H A;  1SQV J;  5BU8 B;  1RE3 A;  3MUD A;  1SLQ A;  1UII A;  1HTL C;  5CBN A;  3WUU A;  2C0W A;  4EI2 A;  3BAS A;  1JUN A;  4NBH D;  2QM8 A;  1KD1 Q;  3U1C A;  2P10 A;  1YTZ T;  4RKU J;  4JPZ B;  1ULI A;  2P2U A;  4KHX A;  2O01 N;  3FX0 A;  1L4A D;  2ZT9 D;  3BCC G;  3L71 G;  1T8Z A;  4YTP C;  3ZDM A;  1PPJ D;  1NYK A;  1S72 P;  1BSN A;  2K88 A;  1N7S C;  1QLE D;  1CW5 A;  2WT7 B;  2AXT H;  4WWI A;  4IFM A;  2Y9Z A;  3CX5 D;  3GZY A;  3EN1 A;  2DE7 D;  5M1B A;  2BMQ A;  4I7Z C;  2IDB A;  2M3B A;  1QX8 A;  2LR2 A;  3HE4 B;  4QDC A;  2KIK A;  1VQO P;  3D6Y A;  1RE3 C;  1CSB A;  2RMZ A;  1IFN A;  5GTI H;  5AVQ B;  2WSC J;  3AE6 C;  2I8D A;  2HML A;  2OTJ P;  2E74 B;  2N1T C;  4ZMD A;  2ITA A;  2FKW B;  2SPZ A;  1RF1 B;  2M5A A;  3D89 A;  4OVN F;  3Q5S A;  5AEW A;  1HUC A;  2E76 C;  2Z5H A;  4NBF D;  1IFM A;  1KZU B;  3H1I D;  4H44 D;  3V5B A;  3RBZ A;  4XFJ A;  2KOG A;  1LT9 C;  3USS A;  2BCC E;  2KS1 B;  1BE3 D;  1OIP A;  1OFC X;  2KSE A;  5KAF E;  1DX7 A;  1HGZ A;  1GU4 A;  1YBK A;  3Q1M A;  2L91 A;  3FXE A;  1N73 C;  2BAS A;  2HMM A;  3H1H E;  2JR8 A;  1KIL C;  3K5B A;  4NPF X;  1Q82 Q;  3S1K A;  3IN6 A;  1VF5 D;  1IK7 A;  3AE1 C;  1EDJ A;  3CCL P;  3CWB G;  2JDI H;  1LWU B;  1L4A B;  1J1D C;  3C8V A;  1P84 I;  3CWB D;  1NGM B;  3VMZ A;  1W2B O;  1PP9 J;  5AW8 B;  4AAY B;  3A0B H;  4HM2 A;  3TYY A;  2AEJ A;  1IO4 A;  1SQB K;  1LWU A;  3W67 A;  5KKZ B;  2WZ7 A;  1E79 H;  1G1I A;  2IZ0 A;  2NPS D;  5TIS E;  4IL6 E;  3G71 P;  5KLV K;  1WMK A;  1KYO E;  3AEG C;  1SQP D;  1YTZ I;  2KLV A;  1RF0 C;  2XV5 A;  1FZE A;  1KB9 H;  4QUQ A;  1BGY D;  1SQX D;  1J1E C;  2MJZ A;  1Y8A A;  4IL6 H;  3LIE A;  5AW3 B;  4H0L B;  5TJH A;  3UIA A;  2J59 M;  3T97 A;  2Z5I A;  1X79 B;  2JEE A;  5APY A;  1M57 D;  1KB9 I;  3GF7 A;  3VYI A;  2HLO A;  5APW A;  2LXB A;  5GTH E;  2FYZ A;  4HB1 A;  2JZA A;  1LTI C;  1NU1 K;  2P58 A;  1NVO A;  3HE5 A;  2FYU E;  1J1E B;  2I1J A;  2WMM A;  3FWL A;  1KMI Z;  3BCC D;  3VMY A;  2ZJS E;  1Q7Y Q;  3B8E B;  4D6T D;  4OGQ D;  1LP1 A;  3RK2 D;  1KOR A;  1P84 H;  1NTK E;  4A7P A;  2WSE J;  1KFM A;  3H32 A;  2XDJ A;  3O8Z A;  2OYI B;  1JCC A;  5CCG D;  2JP3 A;  2E42 A;  2A06 E;  2B9B A;  1BGY E;  2B1X A;  3C1L A;  3B71 A;  3L70 G;  2KP8 A;  5AW0 B;  2FYN B;  1NKN A;  2O01 J;  3AEC C;  1FS0 E;  5AVZ B;  3VCA A;  3M06 A;  1G8K B;  2FFD A;  3T97 B;  2K9Y A;  4WY4 B;  2K3R A;  1FDO A;  2YFJ A;  1K05 A;  1N7L A;  2QJP C;  1GL2 B;  1Q86 Q;  2CPS A;  2YXR B;  5AVW B;  3ITK A;  3CCQ P;  4IFD K;  1SQB E;  2O1J A;  1IC2 A;  3AE7 C;  2A45 G;  2G3A A;  2OYH A;  1M1J A;  1L0N J;  5KLI B;  4L75 A;  3RL0 D;  4QUR A;  2V4H A;  1SQX E;  1T2K C;  2Y0E A;  2XSH A;  1M7L A;  2IX7 C;  3CCS P;  2AXT E;  3L74 D;  2O01 H;  3PRJ A;  3NFQ A;  1JY2 N;  1USE A;  3I5C A;  2Z4E A;  4HM8 A;  1FOS F;  2E4P A;  1SFC C;  4JQ0 D;  5CCH D;  4H0L D;  3CC7 P;  3TGU G;  3CLQ A;  4GT1 A;  1NTM E;  4ASV A;  5AW7 B;  1YJN P;  2QJK C;  1RF0 A;  2QE7 H;  3S4R A;  3GG2 A;  2JKV A;  1MZ9 A;  2R5B A;  4AQR D;  1N7S A;  2RN0 A;  3C9I A;  1RQV A;  4GIF A;  1NU1 E;  2ZVN B;  2YFI A;  3O6Q B;  1HGV A;  3OAK A;  4I2L C;  1LT9 B;  1M56 D;  2FYU K;  4Y99 B;  1FBM A;  2YNY A;  4GOE A;  2KS1 A;  1IFJ A;  2JO6 A;  2HR3 A;  3H1J J;  1TU3 F;  2G8Y A;  3CI9 A;  3TGU E;  1URQ D;  3RK3 D;  2IYO A;  3TGU D;  3GL0 A;  3H1H G;  3LID A;  3H1I E;  4HM6 A;  4WVZ A;  3CXH I;  3RL0 g;  1BCC G;  1KTM A;  2QRX A;  5KAI H;  1NTZ D;  1KYO D;  1FZA A;  4HH2 A;  2RKL A;  3L74 G;  3RGU A;  3N0Q A;  3AEE C;  1OMI A;  3M0A A;  2FYN C;  1OXZ A;  5GTH H;  2FYU G;  2D2C D;  4W7Y A;  5CCG A;  1DD4 A;  3L73 D;  1Y9B A;  4BXL A;  4HYT B;  3NMD A;  3VMH D;  1EQ7 A;  1SQB G;  1R5L A;  3MHV A;  2ZT9 C;  4HKZ H;  1NTK G;  3L73 J;  3P8C E;  1SQX K;  1LTA C;  2D2C B;  2PRR A;  2XZR A;  2FFD C;  2HMO A;  2K37 A;  3AED C;  2A06 G;  5CHX A;  2ZVO B;  3SWY A;  2V7Q H;  2FBW C;  4HM4 A;  3L71 E;  4U3F E;  1ZRT E;  1OVU A;  2KXP B;  1SFC B;  1FAV A;  1PGO A;  5KLV G;  4NBA D;  2R3S A;  2M8R A;  4H13 C;  2IFN A;  4JBZ A;  1GD2 E;  3H6P A;  2QJP B;  4NBC D;  3L35 A;  3EFG A;  2H43 A;  3HTK B;  4AYC A;  3GCE A;  4XA4 A;  1BE3 E;  2WIT A;  1FZB A;  1GDT A;  1FU1 A;  2E76 D;  3B5N A;  4QDF B;  4D6T G;  2OYI A;  5AW6 B;  1AQ5 A;  2LKM A;  3A0H E;  2W6J H;  4Y99 C;  2WPQ A;  2W8Z A;  1KIL E;  3L72 G;  1SFC A;  4GDO A;  4BWN A;  5APX A;  1QL2 A;  3PH0 A;  4N78 E;  4NBB D;  1BDD A;  4OGQ B;  2YKO A;  5B66 E;  2HG5 D;  1G2C B;  1K73 Q;  5K5G B;  2HMN A;  2N9Y B;  2OTL P;  2J5U A;  3VMG D;  1HWT C;  2KNC A;  1IK9 A;  1PV3 A;  2BMR A;  2CK3 H;  1MFT A;  4GKG A;  4UB6 E;  4HM3 A;  1JCD A;  4C46 A;  4KT0 J;  4NBD D;  3Q2Y A;  4WY4 A;  2Q3E A;  2ZT9 B;  1SQV D;  2FFD B;  1YHQ P;  2PGD A;  3H1K D;  1L0L G;  1O7M A;  1JMB A;  2QSI A;  2B89 A;  1AA0 A;  2ZAE B;  1SQP G;  3MGN A;  1N8R Q;  3CMA P;  2Q7C A;  1FQT A;  2P1J A;  1A02 J;  1SP4 A;  1NWQ A;  3L71 J;  2KI7 B;  3V2Q A;  4PV1 D;  5AW9 B;  1N86 A;  1GL2 D;  3P32 A;  4AIV A;  3A5T A;  2IBZ D;  3AE4 C;  3E1R A;  1SJG A;  3E1I A;  4EYY Q;  4YXW H;  2QPZ A;  1T3U A;  1VQ4 P;  4U3F G;  5KTB A;  2O1K A;  1S9K D;  1BCC J;  1LTG C;  1KQG B;  2HMJ A;  3V2P A;  5KLV E;  5L8R J;  3L74 E;  2IBZ I;  1SQQ K;  1L4A A;  1NTK D;  2C9L Y;  1AFO A;  3EFF K;  2WTY A;  1AVO A;  3MIW A;  3EQ2 A;  1UUW A;  5APQ A;  2A45 H;  4PJ0 H;  1FC2 C;  1PP9 G;  5KJ7 A;  3CCJ P;  4N78 D;  3RBX A;  2AEM A;  3H1H J;  4YXD C;  2WPV B;  3MZW B;  2AXC A;  3CX5 E;  2DW3 A;  1ZP0 C;  1HH0 A;  1EZV D;  2Q3W A;  3RK2 C;  3M9H A;  3CWB E;  1CI6 B;  2DE5 D;  3JCU E;  1VQL P;  5AVV B;  2H7H A;  1NTZ E;  2YO3 A;  3L36 A;  2E43 A;  2BCC J;  3VMX A;  3GB4 A;  1GZL A;  2WQY C;  2XNX A;  2H89 C;  3GZX A;  1IFI A;  3GTE A;  3L75 J;  1R8E A;  2PP6 A;  1M1J B;  1GK4 A;  2Y9Y A;  1S5L H;  3O6Q A;  1N2D C;  3OW2 O;  1URQ A;  1HJ0 A;  2WSS H;  5CJ0 A;  2M0B A;  2GBW A;  1SQQ G;  3H1K J;  1LT1 A;  1FZC C;  2Q6Q A;  2NVE A;  4I1L A;  3BCC E;  1FDI A;  3B5N C;  3IFM A;  2YIU C;  1RFS A;  3KQG A;  3QWO C;  3AEA C;  3FGA D;  2WSE H;  3MUD C;  4D6T J;  1S1C X;  1MKM A;  4N3Y B;  1KIL B;  3GTS A;  2E4Q A;  4WY4 D;  2WPR A;  2E5T A;  3GL2 A;  3A2A A;  3F5H A;  3VCP A;  1LTB C;  1ZR2 A;  1NTM D;  3HRN A;  3HD7 D;  1JM0 A;  1JNM A;  1BSH A;  1SQX J;  1H0T A;  1NTK K;  1L0N E;  4DZO A;  1RF1 A;  2OYH C;  2W83 C;  1NU1 G;  2NPS A;  2YO2 A;  2XSO A;  3AEF C;  5C39 A;  3W68 A;  1FZC A;  3RK2 B;  1SQQ D;  3BRT B;  1EZV G;  4JYC A;  3VOP A;  3I56 P;  2OAR A;  1GW4 A;  3KHU A;  3DQY A;  2CKF A;  1OX3 A;  3VP8 A;  1RE4 A;  1QVF O;  1AJY A;  5B5E E;  4QUP A;  2JJL A;  3V4Q A;  3PTZ A;  1SQP J;  2E75 B;  2JWA A;  1FOS E;  3QH9 A;  4I7Z B;  4NB9 D;  1YIJ P;  2L5G B;  1JTH A;  3CXH D;  2K1A A;  1GTW A;  2W6B A;  1JY3 P;  1NO4 A;  1LT9 A;  4WB4 A;  1JTH B;  4NPD A;  5EFW B;  3HD7 B;  3GKE A;  2ZFC A;  1FJP A;  1YJW P;  1VQ8 P;  3KXD A;  4YPC A;  2NPS C;  5KJ7 D;  1LP1 B;  1NYH A;  4NBE D;  1J2J B;  2QVA A;  3D70 A;  1FDM A;  3AE5 C;  3IR9 A;  5H2F E;  2YKQ A;  2PAJ A;  4BRY B;  3KZI E;  1S5L E;  1L4A C;  2WVR A;  2M3E A;  3CCR P;  2IFM A;  1L0N G;  1OVV A;  2HPC B;  5E79 E;  2R44 A;  3VMA A;  3AEB C;  4QMA A;  1FE6 A;  4U3F D;  3FOU A;  2QJY C;  1JB0 J;  4C7N B;  2K9J A;  2PFX A;  1T3J A;  2WWW A;  1WT6 A;  1W5C E;  1OVR A;  3FWN A;  1AV1 A;  1KQL A;  3WUT A;  3GLM A;  1K9M Q;  1KIL D;  3PLN A;  4PV1 C;  1SQP E;  3EQQ A;  4PD4 I;  3BAT A;  3H1K G;  2Y0C A;  1YI2 P;  1CZQ A;  1PIX A;  1VQ5 P;  1VF5 C;  1A02 F;  2YMK A;  2OYH B;  2N1T D;  3OJA B;  1S2E A;  1EDL A;  3L75 G;  1IJD B;  3H1J G;  2QJY B;  4N6J A;  2E74 C;  1N7S B;  4H44 C;  3H1L E;  4XE5 B;  5AVX B;  3R4Y A;  1L0N K;  2C9N Y;  1SQX G;  2J58 A;  2I7F A;  1NKZ B;  3BRV B;  1GL2 A;  1BGY G;  1LGH B;  2N1T B;  1SS1 A;  1UIX A;  3CD6 P;  4PD4 H;  2OGU A;  2XND H;  5APU A;  1O7G A;  4IFF A;  2YVJ B;  3WMM 0;  2M5A B;  1ZME C;  3VP9 A;  5TIS H;  2KZI A;  4HJL A;  1NHL A;  5AEU A;  1VQK P;  2XKM A;  3SSU A;  2QJK B;  4NPE A;  3V6I A;  1RF1 C;  2NZ2 A;  5CCH A;  4BRY A;  3M0D C;  1LTJ B;  2B87 A;  4JYB A;  1JY3 O;  1SQQ J;  2WT7 A;  1VL2 A;  3CCE P;  4PD4 E;  3BCC J;  2IBZ G;  1W2E A;  3R2P A;  4HM0 A;  3KYQ A;  2W27 A;  4L73 A;  1AQT A;  3H1K E;  2OYO A;  2FY8 A;  3A3Y B;  3H25 A;  4K3A A;  1P84 D;  1LTJ C;  3VMI D;  2POH A;  1HF9 A;  3G9R A;  2Q1K A;  1VQ7 P;  1OW8 A;  2WSF H;  2FXO A;  2NRG A;  4EMJ B;  3U59 A;  5BOK A;  2IPP A;  1NTZ J;  1Z56 A;  1KC8 Q;  4D6T E;  1SFC D;  2BCC D;  5CCH C;  2WSF J;  3GOB A;  1VQN P;  2FXM A;  4DJG A;  1SQV G;  5GTI E;  4P1C H;  1HBW A;  1L0L K;  1WQL A;  4Y28 J;  1S5L X;  5KLI C;  5E79 H;  3A0H H;  1SQP K;  1BCC D;  3TSI A;  3H1L D;  3H1J D;  3CCV P;  1O7P A;  3A0B E;  3KZI H;  3AE8 C;  2C0X A;  5B66 H;  1ZOY C;  4ZNC A;  3HE5 B;  2JWD A;  3BVH A;  2Q9I A;  1RY3 A;  1JY2 P;  1VQ9 P;  2YMY A;  1H8A A;  5KLV J;  3L75 E;  1NOH A;  1VF5 B;  1BCC E;  3JC2 2;  1H88 A;  2YFL A;  3TDK A;  3LW5 J;  5KKZ C;  1GMJ A;  5AVR B;  1QGK B;  5KAI E;  3JCU H;  4L76 A;  2NUK A;  2OTK E;  2W90 A;  4PD4 D;  5AVS B;  3AE3 C;  4Z1M H;  4LGD E;  1SQV K;  3ABV C;  3CWB J;  5AW4 B;  1SQV E;  3L75 D;  4RJT A;  1YJ9 P;  1H89 A;  1T2K D;  4UB6 H;  1NAY A;  3H1H D;  2N1T A;  1KQS O;  4GOD A;  4QCK A;  5B5E H;  5AW2 B;  2WSC H;  2H8P D;  1ZV8 A;  4JF7 A;  1PFI A;  2KYV A;  5KLV D;  2MKV A;  4H0L C;  2GA1 A;  1K04 A;  1MV8 A;  1N73 B;  4OH8 B;  2GUV A;  1XTC C;  1T6A A;  3L74 J;  2ZYL A;  3PJS K;  2IZ1 A;  2BEQ D;  1FZG A;  2IBZ E;  3D71 A;  3GF3 A;  2GUS A; 
#chains in the Genus database with same CATH homology
 2BMO A;  4QDF A;  4HM8 A;  2E4P A;  1S1C X;  1VCK A;  1MKM A;  1NDO A;  4H0L D;  2E75 D;  1UUV A;  3Q5R A;  1EXI A;  3GTS A;  2E4Q A;  3GL2 A;  1NTM E;  4NBG D;  3VCP A;  1PP9 E;  1OW7 A;  2QJK C;  3Q3D A;  3L72 E;  4H13 D;  1L0N E;  2E75 C;  1DD3 A;  1RQV A;  1G8J B;  1KB9 E;  1NU1 E;  1L0L E;  1PL5 A;  4U7J A;  2YFI A;  3EWK A;  2XSO A;  3AEF C;  3C0D A;  4PV1 B;  2BEZ F;  2NVG A;  4HM1 A;  1RQU A;  3SFE C;  2E74 D;  2JO6 A;  1O7H A;  1DIP A;  4HKV A;  1TU3 F;  2V7Q J;  3DQY A;  2CKF A;  4P1B H;  2G8Y A;  3TGU E;  1AJY A;  4HM5 A;  4QUP A;  2E75 B;  2D2C C;  3GL0 A;  4NBH D;  4I7Z B;  3H1I E;  4HM6 A;  2P10 A;  4NB9 D;  4RKU J;  1ULI A;  3RL0 g;  1KTM A;  2ZT9 D;  1ULJ A;  4YTP C;  1NYK A;  3CXH E;  1Q90 C;  3GKE A;  1O7W A;  2NVF A;  3N0Q A;  2FXP A;  3AEE C;  1OMI A;  2FYN C;  1NYH A;  2D2C D;  4NBE D;  3D70 A;  3GZY A;  3AE5 C;  1DD4 A;  1Y9B A;  3EN1 A;  3VMH D;  2DE7 D;  5M1B A;  3SFD C;  2BMQ A;  1P84 E;  2ZT9 C;  4I7Z C;  2IDB A;  2D2C B;  4QDC A;  3D6Y A;  2HMO A;  3AED C;  2E76 B;  3AEB C;  2WSC J;  3AE6 C;  3FOU A;  1EXJ A;  2HML A;  2QJY C;  1JB0 J;  2E74 B;  2H88 C;  5AEW A;  2FBW C;  4HM4 A;  3Q5S A;  3D89 A;  3L71 E;  4U3F E;  2E76 C;  1ZRT E;  4NBF D;  3GLM A;  4H44 D;  4NBA D;  4XFJ A;  4PV1 C;  4H13 C;  1SQP E;  4HM7 A;  3EQQ A;  3D6Z A;  4TT3 H;  2BCC E;  1PIX A;  4R4L A;  1VF5 C;  4NBC D;  3L73 E;  3GCE A;  2YMK A;  1BE3 E;  3Q1M A;  2E76 D;  4QDF B;  2HMM A;  3H1H E;  2E74 C;  4H44 C;  3H1L E;  3R4Y A;  2I7F A;  1KIL E;  1UIX A;  3IN6 A;  1VF5 D;  1IK7 A;  4GDO A;  3AE1 C;  1O7G A;  2YVJ B;  5CXM A;  2XRX A;  1ZME C;  3C8V A;  4NBB D;  1NGM B;  2QIW A;  4OGQ B;  4H13 B;  4HJL A;  1EZV E;  3RK3 E;  5AEU A;  4NB8 D;  2DE6 D;  4AAY B;  4HM2 A;  3AE9 C;  2HMN A;  3S9O A;  1U57 A;  2J5U A;  2NUM A;  3VMG D;  2NZ2 A;  2HMK A;  1PV3 A;  4R4M A;  2BMR A;  4HM3 A;  1VM9 A;  3H1J E;  3L70 E;  4KT0 J;  4NBD D;  3Q2Y A;  1KQF B;  2ZT9 B;  1WMK A;  3AEG C;  1KYO E;  1VL2 A;  3IAO A;  1O7M A;  4PD4 E;  3AE2 C;  4QUQ A;  4HM0 A;  2QSI A;  3H1K E;  3H25 A;  1FQT A;  1O7N A;  3VMI D;  4H0L B;  1HF9 A;  3G9R A;  1OW8 A;  4PV1 D;  4EMJ B;  5BOK A;  1SQQ E;  4OGQ C;  4QDD A;  4AIV A;  5HL4 A;  3AE4 C;  3GF7 A;  1SJG A;  2OQQ A;  2WSF J;  3GOB A;  2NWF A;  2QPZ A;  2JZA A;  4P1C H;  1WQL A;  2FYU E;  4Y28 J;  1S5L X;  5KLI C;  1KQG B;  2HMJ A;  5L8R J;  5KLV E;  1KMI Z;  3L74 E;  4OGQ D;  1KOR A;  1O7P A;  3AE8 C;  1ZOY C;  1UUW A;  1NTK E;  2WSE J;  3AZC A;  2JP3 A;  3L75 E;  3FGA D;  2A06 E;  1VF5 B;  1OW6 A;  2B1X A;  4YXD C;  2WPV B;  1BCC E;  2YFL A;  3B71 A;  3LW5 J;  5KKZ C;  3CX5 E;  1GMJ A;  1JM1 A;  1ZP0 C;  2Q3W A;  1YQ3 C;  2O01 J;  2NUK A;  4Z1M H;  3AE3 C;  3AEC C;  3CWB E;  3VCA A;  2DE5 D;  1G8K B;  3T97 B;  3ABV C;  2K9Y A;  1SQV E;  1NTZ E;  1FDO A;  3GB4 A;  2YFJ A;  1K05 A;  2QJP C;  2WQY C;  4QCK A;  2H89 C;  3GZX A;  2JO1 A;  1RIE A;  3GTE A;  3GMA A;  1SQB E;  1R8E A;  1YQ4 C;  3AE7 C;  3O6Q A;  2G3A A;  4H44 B;  1Q90 D;  2B24 A;  2MKV A;  1HJ0 A;  4H0L C;  3Q5P A;  4QUR A;  1K04 A;  1EG9 A;  1SQX E;  2GBW A;  2XR8 A;  2XSH A;  2ZYL A;  2GBX A;  2NVE A;  4IL6 X;  3BCC E;  1FDI A;  2YIU C;  1RFS A;  2BEQ D;  1PPJ E;  3AEA C;  2IBZ E;  3D71 A;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...