2QJKC

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
molecule keywords Cytochrome b
total genus 51
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjkC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjkC02
3GL2A 4AIVA 1PP9E 3VCAA 2QJKC 2O01J 1RFSA 1NU1E 5KLVE 1NDOA 2JO6A 4I7ZB 4OGQD 2QJYC 3EN1A 4HJLA 3VMHD 3EQQA 2D2CB 4RKUJ 1EG9A 2E4QA 4NBGD 2E74B 1ULIA 1UUWA 5AEUA 4NB8D 1VF5D 2DE5D 1O7NA 3H1HE 4HM4A 2YFLA 1EZVE 3GOBA 4NBCD 4PD4E 2HMNA 3CXHE 3FOUA 3N0QA 4HM2A 5CXMA 1SJGA 2XSOA 4Y28J 2HMJA 5KKZC 4PV1D 2QSIA 2JZAA 5HL4A 2YFJA 1VF5B 5BOKA 2NVGA 2ZYLA 1VM9A 2D2CD 1L0LE 2BMRA 4P1CH 3LW5J 4EMJB 2B1XA 3L75E 1KYOE 1VCKA 1FQTA 2A06E 4H13D 4P1BH 1ZRTE 1UUVA 1SQVE 2GBXA 2Q3WA 1NTZE 4HM3A 2XR8A 2ZT9D 4NBFD 2NVEA 3L70E 2E76B 1NYKA 2WSCJ 2DE7D 1KB9E 1Q90D 3L74E 2HMMA 3GKEA 1O7MA 3VMGD 4NBED 4HM0A 1L0NE 2NUKA 1S5LX 2QIWA 4HM6A 1NTKE 1BCCE 2YIUC 2E75D 1JM1A 4H0LB 1P84E 5L8RJ 1O7PA 2I7FA 4NBHD 2YVJB 2CKFA 1SQXE 1O7WA 4HM7A 4HM5A 4NBDD 5AEWA 4QURA 4QUPA 3H1KE 3L73E 2NWFA 2WSFJ 3L72E 3VMID 4QDCA 4QCKA 2K9YA 1NTME 2HMOA 3CX5E 3GB4A 3GZYA 3C0DA 3H1LE 4HKVA 4NBBD 2ZT9B 1O7HA 1SQQE 2HMKA 4NBAD 4QUQA 4AAYB 1G8JB 4HM8A 2GBWA 4IL6X 4NB9D 4QDDA 4H13B 2QJPC 1BE3E 1O7GA 2XSHA 4U3FE 2E4PA 1WQLA 2NUMA 4KT0J 4QDFB 4H44D 2E74D 2XRXA 3H1JE 1Q90C 1PPJE 2QPZA 4H0LD 1SQPE 1RIEA 2YFIA 2WSEJ 1SQBE 3CWBE 3GTSA 3H1IE 4HM1A 4OGQB 2FYUE 3BCCE 3GCEA 2B24A 4H44B 3AZCA 1JB0J 2E75B 3GTEA 2BMQA 3DQYA 3GZXA 2IBZE 1ULJA 2BMOA 3L71E 3VCPA 4PV1B 2FYNC 5KLIC 2WPVB 3D89A 3TGUE 2BCCE 2DE6D 3GL0A 2E76D 2NVFA 4QDFA 2HMLA 3C8VA 1G8KB
chains in the Genus database with same CATH superfamily
4AIVA 1PL5A 3CCVP 3KDPB 1R5LA 3VMXA 5B66E 3CD6P 1SQPJ 2IYOA 3EQQA 2WMMA 4HH2A 1O7NA 1RE3C 1RF0A 3ABVC 2PGDA 2QSIA 3Q5PA 2K88A 3M9BA 2LXCB 5KJ7A 2D2CD 1KYOE 1GMJA 1SQXJ 4OVNF 1VCKA 1VQNP 1LP1B 3CCRP 1VQMP 1G1JA 2HLOA 4MN4C 2A06G 1RE3A 4AUWA 3CXHH 2Y0CA 3HE4B 4C46A 1J1EC 1EDJA 2KXPB 1LTJB 1NVOA 1PP9J 1SFCB 5KJ7D 2FKWB 1NOHA 1JY2O 1G2CB 1M8OB 2NWFA 1EC5A 5AW7B 1S3JA 3H1LE 1JCCA 2QG4A 1VQ9P 3L71D 5CCGA 2G8YA 3U1CA 3CWBE 1NU1G 2W6BA 1SQXG 1LWUB 1BCCJ 2LR2A 2IZ1A 1AQTA 1NTMD 1RHZB 1N73B 4L75A 5AVSB 3GL2A 3NFQA 3SWFA 3OA7A 1RFSA 3H1KJ 2OYHC 3EFGA 2JO6A 1NHLA 3D6ZA 1ULIA 1KQSO 2E5YA 4PJ0E 3GOBA 1HWTC 1NU1D 2OYOA 3HD7A 4L76A 1LTTC 2KNCB 4N6JA 1RF1A 3B5NC 2YO3A 5AVWB 3K5BA 3PJSK 1FQTA 1L0NJ 2B9BA 2H8PD 5AW6B 5M1BA 2OQQA 5CCHD 1SQQG 1RF1B 2N1TD 1PGQA 1SFCD 4N78D 4IL6H 4L74A 5B66H 2KYVA 1T8ZA 2CKFA 3AEDC 2C0XA 2YKPA 4QDCA 3H1IJ 3VMYA 2K9YA 1VF5C 1NTZJ 2E75C 2XSHA 1DIPA 4QDFB 2NUMA 1SS1A 1H88A 4IFDK 3BCCD 3AZCA 1JB0J 1JY3O 2BMQA 1DD3A 1SFCA 3CL3D 3PP5A 1GW4A 1DD4A 3CX5H 3G6EP 2E74C 3CLQA 4EYYQ 1SVFA 1JCDA 2H43A 1G2CA 2QJYC 3VMAA 3FWNA 1HGVA 2FBWC 1S1CX 4BRYB 1QGKB 1S5LH 1EQ7A 2GUVA 4Y28J 2WITA 1L2PA 2RN0A 3L73G 2P67A 3VP8A 1OX3A 2A06E 1PGJA 2GBXA 4Z1MH 1HJ0A 2XR8A 2JJLA 1KILA 1NYKA 2WSCJ 2DE7D 4YPCA 1KB9E 4H44C 3EWKA 4YXWH 1NKNA 2NPSC 3TDKA 1PIXA 2R3SA 1TU3F 4ZNCA 1OVUA 1JM1A 2KLVA 3L74J 2HPCA 4EIJA 2FYUG 1GL2C 3V6IA 1Q86Q 1ZXGA 3P7KA 4HYTB 1A02J 4HM5A 2W27A 1NKZB 1PP9G 3GZYA 3IAOA 1OVVA 1EDLA 1G8JB 1E79H 4IL6X 3WUUA 5KAFH 1PPJD 5CJ0A 2XRXA 4DT0A 3H1IE 3GTEA 2H7HA 1SQQD 1N7SB 5BU8B 1VQ8P 1SP4A 5AW2B 2WSCH 4WY4C 1S9KD 5EFWB 1NU1E 1JOCA 3SWYA 1OVRA 1KYOI 5CCGD 1A02F 3E7KA 4HJLA 4NBGD 1KN7A 3MUDA 3V2QA 3KQGA 1LTAC 4HJGH 1P84I 2Z5IA 2ZVOB 3VN0A 3AE4C 4PV1D 1SQXK 4W80A 3GF3A 2JZAA 3L75D 1FJKA 1IK9A 1IO4A 2YFJA 1KILE 3CCLP 4Y99B 2ZYDA 1KYOH 3N4XA 3Q3DA 2ZVNB 2BEZF 3L75E 4WVZA 2OYIC 3IFMA 1N86A 3AE1C 3P32A 2Q3WA 4U3FG 1DEBA 1SQPD 2E76B 2GUSA 5APVA 3RL0g 3I56P 2KS1A 3R2PA 1PGPA 3TSIA 1N73C 2FXMA 3E1RA 3RK2D 2B87B 4PD4H 1RQUA 2I1KA 3BVHA 1W2BO 4NBDD 2CK3H 1W5CE 2JKVA 2O3JA 1GU4A 3S4RA 1BSHA 4DOJA 3RBZA 2R5DA 2AXTE 1JO5A 3MTUE 3Q5SA 2FYUE 4GOEA 1FDIA 4GODA 1J1DB 3L71E 3RK3D 4JYBA 2IX7C 5APQA 3TNUA 4EDFA 3HE4A 2OTJP 1IJDB 2QJKC 4I6MC 2HR3A 2W83C 4ASVA 5AW9B 2B89A 4PD4I 3R4YA 2E42A 4BWNA 1UUWA 2KS1B 4DJGA 2R3CA 2XNDH 3CXHE 4PJ0H 2AEJA 2ZFCA 1YQ3C 1SQBD 1VF5B 2PRRA 3L37A 1GTWA 3T97B 1XTCC 2Q7CA 1Y47A 2M5AA 2JEEA 4NBFD 2YO2A 5B5EH 4XE5B 3JC22 2HMMA 4WBAA 2QIWA 3CCEP 1OXZA 2YIUC 2YIUB 3EQ2A 3CI9A 1QL1A 4WWIA 4GKGA 2WVRA 1GDTA 2P2UA 2OARA 1NJIQ 2N9BA 1KB9H 1AA0A 1RF0C 1YJWP 3LIDA 1JM0A 1O7GA 1YJ9P 4GOFA 1X22A 3RL0C 1SQPE 1URQC 4OGQB 2OGUA 3BCCJ 3H1JD 4ZKPA 2N1TC 1ULJA 4A7PA 1EZVG 2OYHB 1LTSC 1T2KC 1G8KB 1K73Q 3WMM0 5AW0B 3KYQA 4K3AA 5KLVE 1EDKA 4AYCA 1L4AB 2QJKB 1LTIC 1VL2A 2OTLP 3A0BE 3AE8C 1NTKD 1SJGA 2B88A 1KILB 5CBNA 2JDIH 3L74D 2Y9YA 1KV4A 1H0TB 1IFDA 3V5BA 1N7LA 2KP8A 3AE2C 3H1LG 3M9QA 1ZRTE 3H32B 4PD4D 2MJZA 2ZT9D 1Q2NA 2H88C 1ZV8A 5AVRB 1O7MA 1JY3P 4U7JA 1USDA 4DZOA 4IOIH 3A5TA 1NTKE 5AW8B 2POHA 3B4SA 3L73E 2WSFJ 1S9KE 2D2CC 1FZBA 3CX5E 2IZ0A 1NTMJ 4HM8A 3CWBD 5KLVJ 4WB4A 3RL0B 5B5EE 3H1JE 4H44D 1PPJE 1KQFB 2WSEJ 4YTPC 1R8EA 1CZQA 1NO4A 2O01H 3V2NA 2DE6D 2NPSA 2WWWA 1EXIA 2HMLA 1KQGB 1M1JC 3C8VA 4O9BA 1PFIA 1YIJP 2QM8A 3MD0A 4R4LA 1PP9D 3EN1A 5CCHC 3WUVA 5AEUA 2KZJA 2KUBA 3GLMA 1VQPP 1YBKA 3L70G 4NPFX 1KQLA 2W8ZA 1HH0A 1YYCA 3VOPA 1SQVD 3TNUB 2CPBA 2B1XA 4P1BH 2RH0A 1HBWA 2M8RA 4WY4A 2J59M 4JQ0D 5CCHA 3A0HE 3MP7B 3AE7C 2UWJE 4TT3H 1GL2B 5CHXA 1BE3G 1LTJA 1QLED 1OW6A 1EZVD 3B71A 1L0LJ 2FFDA 5KJ7C 2M5AB 2Q3EA 2R5BA 1AVOA 3L72E 3TGUD 3CCUP 2C0WA 3WUTA 2ZT9B 1JUNA 1USEA 1SQVK 2QM7A 4NB9D 4H13B 2QJPC 1T3JA 4GIFA 3TGUJ 2E4PA 4WY4D 2MKVA 3BCCE 1KZUB 3OAKA 3HUSC 1RH5B 3L73D 3GL0A 3KZIE 1KILD 3EFFK 2N9YB 1KILC 1GW3A 3S9OA 3JSVC 1PP9E 3VCAA 3A2AA 3H1HJ 1RE4A 3D6YA 2XZRA 1MFTA 3AEFC 1FZFA 3HRNA 1H8AA 2E74B 2PP6A 1LTBC 1VF5D 3NMDA 1GL2A 4NBCD 1HTLC 2E43A 1NH4A 3N0QA 1FZCC 2JO1A 1Y9BA 1SQPK 2HMJA 1IFPA 2FYUD 5C39A 2NVGA 3O8ZA 4Y99C 1HJBA 1WRGA 2LXBA 1LT1A 1PV3A 1NTMG 1NTZE 1Z56A 3I5CA 1SQXD 1VQ7P 3RK3B 1JY2P 3H1LD 4HM6A 1VQ5P 2BCCG 1NTKJ 2OYHA 3RK2B 1SQBG 5AW5B 1UIXA 1BCCD 1X9VA 3RK2C 1N7SC 3C0DA 1YHQP 2A45G 3OW2O 1YJNP 1N7SD 1IFJA 4C7RA 1DEEG 1Q7YQ 1M7LA 2QPZA 5GTIE 3H1JJ 3B8EB 1M90Q 3QWOC 4D6TJ 5KLIB 2IFMA 1U7MA 2R32A 5APUA 5CBOA 3H1KG 1ZN5A 3GHGB 2JR8A 3BRTB 4D6TD 4KJMA 3W68A 1OW7A 4RKUJ 1EG9A 2GA1A 3IF4A 3H1HE 4HM4A 1OMIA 1OW8A 2FYZA 2NPSB 1URQD 1LWUC 1NAYA 2P10A 1LNQA 2IDBA 5BOKA 1YTZT 1KFNA 1P84H 2WSEH 3MZWB 1AV1A 3A0BH 4C7NA 3MHVA 4L73A 3HUSB 4W7YA 4AQRD 2C9LY 5CCGC 3ZDMA 1AJYA 1VQ4P 1RE4C 1NU1K 3VMGD 3B5ND 3GF7A 3D71A 3D70A 4H13C 2NUKA 1S5LX 4IFMA 1ZW0A 4NPDA 4UB8E 2E75D 1L4AA 5AVVB 2BCCJ 2YXQB 3E1IA 4BRYA 3TF5A 3RGUA 2W6AA 3PRJA 1Q82Q 4RO0A 1IK7A 1FDMA 3C1LA 3FWLA 4QUPA 3M0AA 4KHXA 3GB4A 5KAIE 4NBBD 1O7HA 4RESB 5KKZB 1FDOA 1N8RQ 2IYPA 5AVUB 2OYIB 2XDJA 1SQBE 1FJPA 4OH8B 1BDDA 2E5TA 2E75B 4JPZB 1XTGB 3CC4P 3VTPC 5KLIC 2RKLA 1Q81Q 3PLNA 3CC7P 1WMKA 3BCCG 1LT9A 3Q1MA 2Q9IA 2K37A 5AW3B 1KORA 3AE5C 2Q3IA 2HMNA 2BEQD 3WU2H 1SQBK 4W7ZA 4PV1C 3V2PA 2KOGA 3M9HA 1RY3A 2KNCA 2IFNA 3AE9C 1NTZD 5TISH 1SLQA 1VM9A 2BMRA 2ZYGA 3UIAA 1L0LD 5KLVG 1JNMA 3B5NB 3AEBC 2CPSA 1KFMA 4HM3A 2O1JA 3C9IA 3L74E 3MUDC 3GKEA 3H1JG 3A0HH 1OWAA 4HM0A 2WPSA 1VQLP 1G1IA 1S4XA 3P8CE 4NPEA 5KLVD 3CWBJ 2WPQA 3H1IG 3L36A 3H6PA 1FU1A 4HM7A 3FXEA 3IR9A 5KAFE 4U3FJ 2ZXXA 4QMAA 2IBZD 2L5GB 1SQQE 2VRSA 3PHLA 3I55P 1S5LE 2FYUJ 1Q90C 4EOTA 2KZIA 4U3FD 1OIPA 1ZLLA 1FZAA 1S2EA 1YTZI 2HODA 2E76D 1LTJC 2W90A 1BGYD 3H1KD 2QJPB 1LT9B 5K5GB 4I7ZC 2ZT9C 1LTGC 1P84D 2LKMA 4NB8D 2AXCA 1LP1A 4UB6H 4C7NB 1KB9D 4CPGA 1L4AC 1RQVA 2KK7A 1K9MQ 2ITAA 3AE3C 1KYOD 2SPZA 2YMYA 4M3LA 2V7QJ 3H1HG 2K9JA 2ZXEB 4H13D 3L72D 5DJUB 2N1TB 1PPJG 2PAJA 4OGQC 1LT9C 1L0NE 1JMBA 1M1JA 3CMAP 1AQ5A 2FY8A 1P84E 3GHGA 1K05A 2I7FA 1SQQK 2YVJB 2IBZG 1VQKP 1MV8A 4QURA 3L4FA 5APXA 3H1KE 2WSFH 3VP9A 4IFFA 3RK3E 1ZOYC 2YKQA 4ZKUA 2M3BA 3B5NA 2FYNB 1E5WA 2E74D 2R44A 2ZAEB 3GTSA 1X8YA 4HM1A 3GCEA 2QVAA 1L0NK 2IBZE 4HB1A 2YXRB 2BCCE 1T3UA 3SFEC 2NPSD 5AVZB 1HUCA 3CXHI 3AEGC 4H0LC 3L75G 5GTIH 3HTKA 2WTYA 2D2CB 1ZR4A 2HYNA 2A45H 2C9NY 3SSUA 1NGMB 1KMIZ 1N73A 4JBZA 3V2RA 1JMMA 1NAFA 3BRVB 4GDOA 2Q5UA 3SWKA 1IFMA 2WPRA 2XKMA 3AEAC 5APYA 1L0LE 4P1CH 2Q1KA 2ZYAA 3CCQP 1GL2D 4DCKA 2J5UA 2HFED 1QVFO 2QA4P 5GTHH 3KXDA 2NVEA 2OTKE 1EZVI 1H0TA 4NBED 2M0BA 3P8CD 2BASA 1SFCC 2GM4A 2PFXA 5L8RJ 1WT6A 1M1KQ 1SQXE 5APSA 1FC2C 4JF7A 1UIIA 5AEWA 1HVVA 2BCCD 2YNYA 1SQBJ 1SQQJ 5KAIH 1NTME 1OZHA 2HMOA 3O6QB 2HMKA 1L0NG 2GBWA 2KSEA 2G3AA 1BE3E 1BDCA 1NWQA 3M0DC 1VDFA 4OWFA 4XFJA 2YFIA 1MKMA 2A06D 2WT7A 1NYHA 1MFZA 1JTHB 3O6QA 2Z4EA 3RBXA 1URQB 3SFDC 3H1LJ 2FXOA 2NZ2A 1QL2A 3FGAD 3HTKB 2E4QA 3L75J 1L0ND 3VMZA 1Y8AA 2DE5D 1IFIA 2WSSH 5AW1B 1JEKA 3L71G 2XSOA 2HODB 3KZIH 2WQYC 2Y0DA 3BASA 1DX7A 5GTHE 1N7SA 4HKZH 1R5SA 4N3YB 4UB8H 1PGOA 4EI2A 1NTKG 3BATA 1DH3A 3L72J 1FZGA 1UUVA 1SQVE 4I1LA 2P1JA 3QH9A 1ZR2A 2KLUA 1BE3D 2FFDB 2JP3A 3PH0A 3CX5D 3TGUG 2V4HA 5CMZA 3HE5A 3L73J 3KHUA 3CMEP 2I8DA 5BU5A 5AVQB 1NTZG 1VPCA 1GZLA 1D7MA 1EDIA 1SQVG 3HD7C 2FYUK 3MIWA 4QCKA 3TK1A 3HD7D 1H89A 1BGYJ 4QUQA 1U57A 1GU5A 1FAVA 1L4AD 3F5HA 4KT0J 2OYIA 1RIEA 3L74G 2O1KA 4H44B 3H32A 2KB7P 3DQYA 2XV5A 1M56D 3VCPA 3D89A 1J1DC 2Y9ZA 3G4SP 3WU2E 2NVFA 1YITP 2QRXA 5E79H 3GG2A 1QEXA 4D6TE 4OGQD 1GK4A 1VQOP 4YXDC 3TYYA 5E79E 3U59A 3Q2YA 3FX0A 3FOUA 4HM2A 2I1JA 1URQA 3U1AA 1KC8Q 5KKZC 3CCSP 1FZEA 1FS0E 2N1TA 3L70D 5HL4A 2Y0EA 3NXSA 3FXDA 1QVGO 1FZCB 2ZYLA 4EMJB 3LW5J 2NRGA 4XA4A 1K04A 3GW6A 2E76C 1PZQA 3MGNA 1NU1J 3L35A 2O01N 4GT1A 3M0DA 5AW4B 3G71P 3II6A 1L0LG 1AVYA 3CCMP 2JWAA 1YI2P 2AXTH 3ITKA 1IZNB 3RL0D 3M06A 3AECC 1IC2A 1ZMEC 1ZRTD 1MZ9A 1QX8A 2H89C 2WZ7A 1FZCA 2KIKA 2YKOA 4QDDA 3L70J 4UB6E 1BE3J 3N7NA 4H0LD 3Q5RA 1KB9I 4WY4B 5H2FE 1RF1C 3S1KA 5TJHA 3T97A 1FOSE 3HD7B 4K35A 5H2FH 3JCUE 4LC1A 3GHGC 3OJAB 1NDOA 1SQPG 2KI7B 1GK6A 1KTMA 5DJTB 3P8MC 1CI6B 1AFOA 3AE6C 2YFLA 1EZVE 5CXMA 3G9RA 2FFDC 3A7OA 3H1ID 2IPPA 1NTMK 1NTZK 1U7JA 2IBZI 1BCCG 4IL6E 1J2JB 1LGHB 2YMKA 2RMZA 1CSBA 2KSJA 3LIEA 4BXLA 5AVXB 3W67A 1JY2N 1Q90D 2P7JA 3RK3C 3A3YB 3CXHD 1M1JB 2QE7H 3M91A 3CPWO 2AEMA 1BCCE 5KTBA 2HPCB 4NBHD 3PTZA 1M57D 3CWBG 1N2DC 2L91A 2JWDA 3H25A 1NTKK 3VMID 1J1EB 2QJYB 2K9JB 1KD1Q 2DW3A 3GMAA 4R4MA 5APTA 1ZP0C 4U3FE 5AVYB 1WQLA 3G3ZA 4PD4E 3LW5H 2B24A 2WT7B 1OFCX 2A45I 4ZMDA 2Q6QA 2XNXA 2ZJSE 2WPVB 3H1HD 4I2LC 1BSNA 4LLHA 5APWA 4QDFA 4ASWA 3L72G 1W2EA 2HG5D 2O01J 1HGZA 4LGDE 1FBMA 4I7ZB 1BGYE 3VMHD 1L0LK 1MUUA 2J58A 2W6JH 1HF9A 3V4QA 1JTHA 3L71J 3CC2P 1JY3N 4D6TG 2B87A 1LJ2A 3IN6A 1EXJA 2M3EA 3HUSA 1VQ6P 1X79B 5KLVK 3CX5I 2V7QH 3NTNA 1FE6A 4TLFA 4RJTA 1BGYG 1T6AA 3JCUH 1S72P 2XU6A 5TISE 3F89A 3L70E 1GD2E 4B86A 1IFNA 3AEEC 1CI6A 2K3RA 2AEFA 4N78E 3CCJP 5CJ4A 1T2KD 4H0LB 3VYIA 1O7PA 4JYCA 1O7WA 3USSA 1SQVJ 2P58A 2Z5HA 1CW5A 2FXPA 4HKVA 4NBAD 5BVZA 4AAYB 2QEXP 1YQ4C 2K1AA 3KPEA 1LWUA 3GZXA 2BMOA 3V4WA 4PV1B 2FYNC 5AVTB 3TGUE 1FOSF 1K8AQ 1X0TA 3HE5B
chains in the Genus database with same CATH topology
4AIVA 2NZ2A 1PL5A 2QJKC 3FGAD 1OW7A 3EQQA 2E4QA 4RKUJ 1EG9A 3R4YA 1UUWA 2DE5D 1O7NA 3H1HE 4HM4A 1OMIA 3CXHE 1OW8A 2XSOA 3ABVC 2WQYC 1YQ3C 2QSIA 2P10A 3Q5PA 1VF5B 2IDBA 5BOKA 2D2CD 1KYOE 1GMJA 3T97B 1VCKA 1UUVA 1SQVE 4NBFD 1AJYA 2HMMA 3VMGD 2JP3A 3GF7A 3D71A 3D70A 4H13C 2NUKA 1S5LX 2QIWA 2YIUC 2E75D 1IK7A 4QUPA 2NWFA 4QCKA 3H1LE 3GB4A 4NBBD 1O7HA 4QUQA 1U57A 1FDOA 1O7GA 4KT0J 2G8YA 1SQPE 1RIEA 3CWBE 1SQBE 4OGQB 4H44B 2E75B 3DQYA 1ULJA 3VCPA 3D89A 5KLIC 2NVFA 1G8KB 3GL2A 1WMKA 1RFSA 3Q1MA 5KLVE 2JO6A 4OGQD 3D6ZA 1ULIA 1KORA 1VL2A 4YXDC 3AE8C 3AE5C 3GOBA 3Q2YA 2HMNA 2BEQD 3FOUA 4HM2A 1SJGA 4PV1C 5KKZC 5HL4A 3AE9C 2ZYLA 1VM9A 4EMJB 2BMRA 3LW5J 3AE2C 1K04A 2E76C 1FQTA 3AEBC 1ZRTE 4HM3A 5M1BA 2ZT9D 2OQQA 2H88C 3L74E 3GKEA 1O7MA 4U7JA 4HM0A 1NTKE 2CKFA 3AECC 4HM7A 3AEDC 1ZMEC 3L73E 2WSFJ 4QDCA 2D2CC 2K9YA 3CX5E 2H89C 1VF5C 1SQQE 4HM8A 2E75C 4QDDA 2XSHA 1DIPA 4QDFB 2NUMA 3H1JE 4H44D 1PPJE 4H0LD 1Q90C 1KQFB 3Q5RA 2WSEJ 3AZCA 1JB0J 4YTPC 2BMQA 1DD3A 1R8EA 1DD4A 2DE6D 2E76D 1EXIA 2HMLA 1KQGB 3C8VA 2E74C 1NDOA 4I7ZC 2ZT9C 4R4LA 2QJYC 3EN1A 1KTMA 5AEUA 4NB8D 2FBWC 1S1CX 3AE6C 2YFLA 1EZVE 3GLMA 5CXMA 3G9RA 4Y28J 1RQVA 3AE3C 2V7QJ 2YMKA 2B1XA 4H13D 2A06E 4P1BH 2GBXA 4Z1MH 1HJ0A 2XR8A 1NYKA 2WSCJ 2DE7D 1KB9E 1Q90D 3EWKA 4H44C 4OGQC 3AE7C 4TT3H 1PIXA 1L0NE 1OW6A 1TU3F 3B71A 1BCCE 1JM1A 1P84E 1K05A 2I7FA 4NBHD 2YVJB 4HM5A 4QURA 3H25A 3H1KE 3L72E 3VMID 3RK3E 1ZOYC 3GZYA 3IAOA 2ZT9B 3GMAA 1G8JB 4R4MA 4IL6X 4NB9D 1ZP0C 4H13B 2QJPC 4U3FE 2E4PA 1WQLA 2E74D 2XRXA 3GTSA 2MKVA 4HM1A 3H1IE 4PD4E 3BCCE 3GCEA 2B24A 3GTEA 2IBZE 2WPVB 2BCCE 3SFEC 3GL0A 4QDFA 3S9OA 1PP9E 3VCAA 2O01J 3AEGC 1NU1E 4H0LC 3D6YA 4I7ZB 3AEFC 4HJLA 3VMHD 2D2CB 4NBGD 2E74B 1HF9A 1VF5D 1NGMB 4NBCD 1KMIZ 3N0QA 2JO1A 1Y9BA 3IN6A 1EXJA 2HMJA 3AE4C 4GDOA 4PV1D 3GF3A 2JZAA 2YFJA 1KILE 2NVGA 3AEAC 1L0LE 4P1CH 3Q3DA 3L75E 2BEZF 1PV3A 2J5UA 3AE1C 2Q3WA 1NTZE 2NVEA 3L70E 2E76B 3RL0g 3AEEC 4NBED 4HM6A 4H0LB 1RQUA 5L8RJ 1O7PA 1SQXE 1O7WA 4NBDD 5AEWA 1UIXA 2FXPA 1NTME 4HKVA 2HMOA 3C0DA 4NBAD 2HMKA 4AAYB 2GBWA 2G3AA 1YQ4C 1BE3E 4XFJA 2QPZA 2YFIA 1MKMA 3Q5SA 2FYUE 1FDIA 3GZXA 2BMOA 3L71E 1NYHA 4PV1B 2FYNC 3TGUE 3O6QA 3SFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL2 A;  4AIV A;  1PP9 E;  3VCA A;  2QJK C;  2O01 J;  1RFS A;  1NU1 E;  5KLV E;  1NDO A;  2JO6 A;  4I7Z B;  4OGQ D;  2QJY C;  3EN1 A;  4HJL A;  3VMH D;  3EQQ A;  2D2C B;  4RKU J;  1EG9 A;  2E4Q A;  4NBG D;  2E74 B;  1ULI A;  1UUW A;  5AEU A;  4NB8 D;  1VF5 D;  2DE5 D;  1O7N A;  3H1H E;  4HM4 A;  2YFL A;  1EZV E;  3GOB A;  4NBC D;  4PD4 E;  2HMN A;  3CXH E;  3FOU A;  3N0Q A;  4HM2 A;  5CXM A;  1SJG A;  2XSO A;  4Y28 J;  2HMJ A;  5KKZ C;  4PV1 D;  2QSI A;  2JZA A;  5HL4 A;  2YFJ A;  1VF5 B;  5BOK A;  2NVG A;  2ZYL A;  1VM9 A;  2D2C D;  1L0L E;  2BMR A;  4P1C H;  3LW5 J;  4EMJ B;  2B1X A;  3L75 E;  1KYO E;  1VCK A;  1FQT A;  2A06 E;  4H13 D;  4P1B H;  1ZRT E;  1UUV A;  1SQV E;  2GBX A;  2Q3W A;  1NTZ E;  4HM3 A;  2XR8 A;  2ZT9 D;  4NBF D;  2NVE A;  3L70 E;  2E76 B;  1NYK A;  2WSC J;  2DE7 D;  1KB9 E;  1Q90 D;  3L74 E;  2HMM A;  3GKE A;  1O7M A;  3VMG D;  4NBE D;  4HM0 A;  1L0N E;  2NUK A;  1S5L X;  2QIW A;  4HM6 A;  1NTK E;  1BCC E;  2YIU C;  2E75 D;  1JM1 A;  4H0L B;  1P84 E;  5L8R J;  1O7P A;  2I7F A;  4NBH D;  2YVJ B;  2CKF A;  1SQX E;  1O7W A;  4HM7 A;  4HM5 A;  4NBD D;  5AEW A;  4QUR A;  4QUP A;  3H1K E;  3L73 E;  2NWF A;  2WSF J;  3L72 E;  3VMI D;  4QDC A;  4QCK A;  2K9Y A;  1NTM E;  2HMO A;  3CX5 E;  3GB4 A;  3GZY A;  3C0D A;  3H1L E;  4HKV A;  4NBB D;  2ZT9 B;  1O7H A;  1SQQ E;  2HMK A;  4NBA D;  4QUQ A;  4AAY B;  1G8J B;  4HM8 A;  2GBW A;  4IL6 X;  4NB9 D;  4QDD A;  4H13 B;  2QJP C;  1BE3 E;  1O7G A;  2XSH A;  4U3F E;  2E4P A;  1WQL A;  2NUM A;  4KT0 J;  4QDF B;  4H44 D;  2E74 D;  2XRX A;  3H1J E;  1Q90 C;  1PPJ E;  2QPZ A;  4H0L D;  1SQP E;  1RIE A;  2YFI A;  2WSE J;  1SQB E;  3CWB E;  3GTS A;  3H1I E;  4HM1 A;  4OGQ B;  2FYU E;  3BCC E;  3GCE A;  2B24 A;  4H44 B;  3AZC A;  1JB0 J;  2E75 B;  3GTE A;  2BMQ A;  3DQY A;  3GZX A;  2IBZ E;  1ULJ A;  2BMO A;  3L71 E;  3VCP A;  4PV1 B;  2FYN C;  5KLI C;  2WPV B;  3D89 A;  3TGU E;  2BCC E;  2DE6 D;  3GL0 A;  2E76 D;  2NVF A;  4QDF A;  2HML A;  3C8V A;  1G8K B; 
#chains in the Genus database with same CATH topology
 4AIV A;  1PL5 A;  3CCV P;  3KDP B;  1R5L A;  3VMX A;  5B66 E;  3CD6 P;  1SQP J;  2IYO A;  3EQQ A;  2WMM A;  4HH2 A;  1O7N A;  1RE3 C;  1RF0 A;  3ABV C;  2PGD A;  2QSI A;  3Q5P A;  2K88 A;  3M9B A;  2LXC B;  5KJ7 A;  2D2C D;  1KYO E;  1GMJ A;  1SQX J;  4OVN F;  1VCK A;  1VQN P;  1LP1 B;  3CCR P;  1VQM P;  1G1J A;  2HLO A;  4MN4 C;  2A06 G;  1RE3 A;  4AUW A;  3CXH H;  2Y0C A;  3HE4 B;  4C46 A;  1J1E C;  1EDJ A;  2KXP B;  1LTJ B;  1NVO A;  1PP9 J;  1SFC B;  5KJ7 D;  2FKW B;  1NOH A;  1JY2 O;  1G2C B;  1M8O B;  2NWF A;  1EC5 A;  5AW7 B;  1S3J A;  3H1L E;  1JCC A;  2QG4 A;  1VQ9 P;  3L71 D;  5CCG A;  2G8Y A;  3U1C A;  3CWB E;  1NU1 G;  2W6B A;  1SQX G;  1LWU B;  1BCC J;  2LR2 A;  2IZ1 A;  1AQT A;  1NTM D;  1RHZ B;  1N73 B;  4L75 A;  5AVS B;  3GL2 A;  3NFQ A;  3SWF A;  3OA7 A;  1RFS A;  3H1K J;  2OYH C;  3EFG A;  2JO6 A;  1NHL A;  3D6Z A;  1ULI A;  1KQS O;  2E5Y A;  4PJ0 E;  3GOB A;  1HWT C;  1NU1 D;  2OYO A;  3HD7 A;  4L76 A;  1LTT C;  2KNC B;  4N6J A;  1RF1 A;  3B5N C;  2YO3 A;  5AVW B;  3K5B A;  3PJS K;  1FQT A;  1L0N J;  2B9B A;  2H8P D;  5AW6 B;  5M1B A;  2OQQ A;  5CCH D;  1SQQ G;  1RF1 B;  2N1T D;  1PGQ A;  1SFC D;  4N78 D;  4IL6 H;  4L74 A;  5B66 H;  2KYV A;  1T8Z A;  2CKF A;  3AED C;  2C0X A;  2YKP A;  4QDC A;  3H1I J;  3VMY A;  2K9Y A;  1VF5 C;  1NTZ J;  2E75 C;  2XSH A;  1DIP A;  4QDF B;  2NUM A;  1SS1 A;  1H88 A;  4IFD K;  3BCC D;  3AZC A;  1JB0 J;  1JY3 O;  2BMQ A;  1DD3 A;  1SFC A;  3CL3 D;  3PP5 A;  1GW4 A;  1DD4 A;  3CX5 H;  3G6E P;  2E74 C;  3CLQ A;  4EYY Q;  1SVF A;  1JCD A;  2H43 A;  1G2C A;  2QJY C;  3VMA A;  3FWN A;  1HGV A;  2FBW C;  1S1C X;  4BRY B;  1QGK B;  1S5L H;  1EQ7 A;  2GUV A;  4Y28 J;  2WIT A;  1L2P A;  2RN0 A;  3L73 G;  2P67 A;  3VP8 A;  1OX3 A;  2A06 E;  1PGJ A;  2GBX A;  4Z1M H;  1HJ0 A;  2XR8 A;  2JJL A;  1KIL A;  1NYK A;  2WSC J;  2DE7 D;  4YPC A;  1KB9 E;  4H44 C;  3EWK A;  4YXW H;  1NKN A;  2NPS C;  3TDK A;  1PIX A;  2R3S A;  1TU3 F;  4ZNC A;  1OVU A;  1JM1 A;  2KLV A;  3L74 J;  2HPC A;  4EIJ A;  2FYU G;  1GL2 C;  3V6I A;  1Q86 Q;  1ZXG A;  3P7K A;  4HYT B;  1A02 J;  4HM5 A;  2W27 A;  1NKZ B;  1PP9 G;  3GZY A;  3IAO A;  1OVV A;  1EDL A;  1G8J B;  1E79 H;  4IL6 X;  3WUU A;  5KAF H;  1PPJ D;  5CJ0 A;  2XRX A;  4DT0 A;  3H1I E;  3GTE A;  2H7H A;  1SQQ D;  1N7S B;  5BU8 B;  1VQ8 P;  1SP4 A;  5AW2 B;  2WSC H;  4WY4 C;  1S9K D;  5EFW B;  1NU1 E;  1JOC A;  3SWY A;  1OVR A;  1KYO I;  5CCG D;  1A02 F;  3E7K A;  4HJL A;  4NBG D;  1KN7 A;  3MUD A;  3V2Q A;  3KQG A;  1LTA C;  4HJG H;  1P84 I;  2Z5I A;  2ZVO B;  3VN0 A;  3AE4 C;  4PV1 D;  1SQX K;  4W80 A;  3GF3 A;  2JZA A;  3L75 D;  1FJK A;  1IK9 A;  1IO4 A;  2YFJ A;  1KIL E;  3CCL P;  4Y99 B;  2ZYD A;  1KYO H;  3N4X A;  3Q3D A;  2ZVN B;  2BEZ F;  3L75 E;  4WVZ A;  2OYI C;  3IFM A;  1N86 A;  3AE1 C;  3P32 A;  2Q3W A;  4U3F G;  1DEB A;  1SQP D;  2E76 B;  2GUS A;  5APV A;  3RL0 g;  3I56 P;  2KS1 A;  3R2P A;  1PGP A;  3TSI A;  1N73 C;  2FXM A;  3E1R A;  3RK2 D;  2B87 B;  4PD4 H;  1RQU A;  2I1K A;  3BVH A;  1W2B O;  4NBD D;  2CK3 H;  1W5C E;  2JKV A;  2O3J A;  1GU4 A;  3S4R A;  1BSH A;  4DOJ A;  3RBZ A;  2R5D A;  2AXT E;  1JO5 A;  3MTU E;  3Q5S A;  2FYU E;  4GOE A;  1FDI A;  4GOD A;  1J1D B;  3L71 E;  3RK3 D;  4JYB A;  2IX7 C;  5APQ A;  3TNU A;  4EDF A;  3HE4 A;  2OTJ P;  1IJD B;  2QJK C;  4I6M C;  2HR3 A;  2W83 C;  4ASV A;  5AW9 B;  2B89 A;  4PD4 I;  3R4Y A;  2E42 A;  4BWN A;  1UUW A;  2KS1 B;  4DJG A;  2R3C A;  2XND H;  3CXH E;  4PJ0 H;  2AEJ A;  2ZFC A;  1YQ3 C;  1SQB D;  1VF5 B;  2PRR A;  3L37 A;  1GTW A;  3T97 B;  1XTC C;  2Q7C A;  1Y47 A;  2M5A A;  2JEE A;  4NBF D;  2YO2 A;  5B5E H;  4XE5 B;  3JC2 2;  2HMM A;  4WBA A;  2QIW A;  3CCE P;  1OXZ A;  2YIU C;  2YIU B;  3EQ2 A;  3CI9 A;  1QL1 A;  4WWI A;  4GKG A;  2WVR A;  1GDT A;  2P2U A;  2OAR A;  1NJI Q;  2N9B A;  1KB9 H;  1AA0 A;  1RF0 C;  1YJW P;  3LID A;  1JM0 A;  1O7G A;  1YJ9 P;  4GOF A;  1X22 A;  3RL0 C;  1SQP E;  1URQ C;  4OGQ B;  2OGU A;  3BCC J;  3H1J D;  4ZKP A;  2N1T C;  1ULJ A;  4A7P A;  1EZV G;  2OYH B;  1LTS C;  1T2K C;  1G8K B;  1K73 Q;  3WMM 0;  5AW0 B;  3KYQ A;  4K3A A;  5KLV E;  1EDK A;  4AYC A;  1L4A B;  2QJK B;  1LTI C;  1VL2 A;  2OTL P;  3A0B E;  3AE8 C;  1NTK D;  1SJG A;  2B88 A;  1KIL B;  5CBN A;  2JDI H;  3L74 D;  2Y9Y A;  1KV4 A;  1H0T B;  1IFD A;  3V5B A;  1N7L A;  2KP8 A;  3AE2 C;  3H1L G;  3M9Q A;  1ZRT E;  3H32 B;  4PD4 D;  2MJZ A;  2ZT9 D;  1Q2N A;  2H88 C;  1ZV8 A;  5AVR B;  1O7M A;  1JY3 P;  4U7J A;  1USD A;  4DZO A;  4IOI H;  3A5T A;  1NTK E;  5AW8 B;  2POH A;  3B4S A;  3L73 E;  2WSF J;  1S9K E;  2D2C C;  1FZB A;  3CX5 E;  2IZ0 A;  1NTM J;  4HM8 A;  3CWB D;  5KLV J;  4WB4 A;  3RL0 B;  5B5E E;  3H1J E;  4H44 D;  1PPJ E;  1KQF B;  2WSE J;  4YTP C;  1R8E A;  1CZQ A;  1NO4 A;  2O01 H;  3V2N A;  2DE6 D;  2NPS A;  2WWW A;  1EXI A;  2HML A;  1KQG B;  1M1J C;  3C8V A;  4O9B A;  1PFI A;  1YIJ P;  2QM8 A;  3MD0 A;  4R4L A;  1PP9 D;  3EN1 A;  5CCH C;  3WUV A;  5AEU A;  2KZJ A;  2KUB A;  3GLM A;  1VQP P;  1YBK A;  3L70 G;  4NPF X;  1KQL A;  2W8Z A;  1HH0 A;  1YYC A;  3VOP A;  1SQV D;  3TNU B;  2CPB A;  2B1X A;  4P1B H;  2RH0 A;  1HBW A;  2M8R A;  4WY4 A;  2J59 M;  4JQ0 D;  5CCH A;  3A0H E;  3MP7 B;  3AE7 C;  2UWJ E;  4TT3 H;  1GL2 B;  5CHX A;  1BE3 G;  1LTJ A;  1QLE D;  1OW6 A;  1EZV D;  3B71 A;  1L0L J;  2FFD A;  5KJ7 C;  2M5A B;  2Q3E A;  2R5B A;  1AVO A;  3L72 E;  3TGU D;  3CCU P;  2C0W A;  3WUT A;  2ZT9 B;  1JUN A;  1USE A;  1SQV K;  2QM7 A;  4NB9 D;  4H13 B;  2QJP C;  1T3J A;  4GIF A;  3TGU J;  2E4P A;  4WY4 D;  2MKV A;  3BCC E;  1KZU B;  3OAK A;  3HUS C;  1RH5 B;  3L73 D;  3GL0 A;  3KZI E;  1KIL D;  3EFF K;  2N9Y B;  1KIL C;  1GW3 A;  3S9O A;  3JSV C;  1PP9 E;  3VCA A;  3A2A A;  3H1H J;  1RE4 A;  3D6Y A;  2XZR A;  1MFT A;  3AEF C;  1FZF A;  3HRN A;  1H8A A;  2E74 B;  2PP6 A;  1LTB C;  1VF5 D;  3NMD A;  1GL2 A;  4NBC D;  1HTL C;  2E43 A;  1NH4 A;  3N0Q A;  1FZC C;  2JO1 A;  1Y9B A;  1SQP K;  2HMJ A;  1IFP A;  2FYU D;  5C39 A;  2NVG A;  3O8Z A;  4Y99 C;  1HJB A;  1WRG A;  2LXB A;  1LT1 A;  1PV3 A;  1NTM G;  1NTZ E;  1Z56 A;  3I5C A;  1SQX D;  1VQ7 P;  3RK3 B;  1JY2 P;  3H1L D;  4HM6 A;  1VQ5 P;  2BCC G;  1NTK J;  2OYH A;  3RK2 B;  1SQB G;  5AW5 B;  1UIX A;  1BCC D;  1X9V A;  3RK2 C;  1N7S C;  3C0D A;  1YHQ P;  2A45 G;  3OW2 O;  1YJN P;  1N7S D;  1IFJ A;  4C7R A;  1DEE G;  1Q7Y Q;  1M7L A;  2QPZ A;  5GTI E;  3H1J J;  3B8E B;  1M90 Q;  3QWO C;  4D6T J;  5KLI B;  2IFM A;  1U7M A;  2R32 A;  5APU A;  5CBO A;  3H1K G;  1ZN5 A;  3GHG B;  2JR8 A;  3BRT B;  4D6T D;  4KJM A;  3W68 A;  1OW7 A;  4RKU J;  1EG9 A;  2GA1 A;  3IF4 A;  3H1H E;  4HM4 A;  1OMI A;  1OW8 A;  2FYZ A;  2NPS B;  1URQ D;  1LWU C;  1NAY A;  2P10 A;  1LNQ A;  2IDB A;  5BOK A;  1YTZ T;  1KFN A;  1P84 H;  2WSE H;  3MZW B;  1AV1 A;  3A0B H;  4C7N A;  3MHV A;  4L73 A;  3HUS B;  4W7Y A;  4AQR D;  2C9L Y;  5CCG C;  3ZDM A;  1AJY A;  1VQ4 P;  1RE4 C;  1NU1 K;  3VMG D;  3B5N D;  3GF7 A;  3D71 A;  3D70 A;  4H13 C;  2NUK A;  1S5L X;  4IFM A;  1ZW0 A;  4NPD A;  4UB8 E;  2E75 D;  1L4A A;  5AVV B;  2BCC J;  2YXQ B;  3E1I A;  4BRY A;  3TF5 A;  3RGU A;  2W6A A;  3PRJ A;  1Q82 Q;  4RO0 A;  1IK7 A;  1FDM A;  3C1L A;  3FWL A;  4QUP A;  3M0A A;  4KHX A;  3GB4 A;  5KAI E;  4NBB D;  1O7H A;  4RES B;  5KKZ B;  1FDO A;  1N8R Q;  2IYP A;  5AVU B;  2OYI B;  2XDJ A;  1SQB E;  1FJP A;  4OH8 B;  1BDD A;  2E5T A;  2E75 B;  4JPZ B;  1XTG B;  3CC4 P;  3VTP C;  5KLI C;  2RKL A;  1Q81 Q;  3PLN A;  3CC7 P;  1WMK A;  3BCC G;  1LT9 A;  3Q1M A;  2Q9I A;  2K37 A;  5AW3 B;  1KOR A;  3AE5 C;  2Q3I A;  2HMN A;  2BEQ D;  3WU2 H;  1SQB K;  4W7Z A;  4PV1 C;  3V2P A;  2KOG A;  3M9H A;  1RY3 A;  2KNC A;  2IFN A;  3AE9 C;  1NTZ D;  5TIS H;  1SLQ A;  1VM9 A;  2BMR A;  2ZYG A;  3UIA A;  1L0L D;  5KLV G;  1JNM A;  3B5N B;  3AEB C;  2CPS A;  1KFM A;  4HM3 A;  2O1J A;  3C9I A;  3L74 E;  3MUD C;  3GKE A;  3H1J G;  3A0H H;  1OWA A;  4HM0 A;  2WPS A;  1VQL P;  1G1I A;  1S4X A;  3P8C E;  4NPE A;  5KLV D;  3CWB J;  2WPQ A;  3H1I G;  3L36 A;  3H6P A;  1FU1 A;  4HM7 A;  3FXE A;  3IR9 A;  5KAF E;  4U3F J;  2ZXX A;  4QMA A;  2IBZ D;  2L5G B;  1SQQ E;  2VRS A;  3PHL A;  3I55 P;  1S5L E;  2FYU J;  1Q90 C;  4EOT A;  2KZI A;  4U3F D;  1OIP A;  1ZLL A;  1FZA A;  1S2E A;  1YTZ I;  2HOD A;  2E76 D;  1LTJ C;  2W90 A;  1BGY D;  3H1K D;  2QJP B;  1LT9 B;  5K5G B;  4I7Z C;  2ZT9 C;  1LTG C;  1P84 D;  2LKM A;  4NB8 D;  2AXC A;  1LP1 A;  4UB6 H;  4C7N B;  1KB9 D;  4CPG A;  1L4A C;  1RQV A;  2KK7 A;  1K9M Q;  2ITA A;  3AE3 C;  1KYO D;  2SPZ A;  2YMY A;  4M3L A;  2V7Q J;  3H1H G;  2K9J A;  2ZXE B;  4H13 D;  3L72 D;  5DJU B;  2N1T B;  1PPJ G;  2PAJ A;  4OGQ C;  1LT9 C;  1L0N E;  1JMB A;  1M1J A;  3CMA P;  1AQ5 A;  2FY8 A;  1P84 E;  3GHG A;  1K05 A;  2I7F A;  1SQQ K;  2YVJ B;  2IBZ G;  1VQK P;  1MV8 A;  4QUR A;  3L4F A;  5APX A;  3H1K E;  2WSF H;  3VP9 A;  4IFF A;  3RK3 E;  1ZOY C;  2YKQ A;  4ZKU A;  2M3B A;  3B5N A;  2FYN B;  1E5W A;  2E74 D;  2R44 A;  2ZAE B;  3GTS A;  1X8Y A;  4HM1 A;  3GCE A;  2QVA A;  1L0N K;  2IBZ E;  4HB1 A;  2YXR B;  2BCC E;  1T3U A;  3SFE C;  2NPS D;  5AVZ B;  1HUC A;  3CXH I;  3AEG C;  4H0L C;  3L75 G;  5GTI H;  3HTK A;  2WTY A;  2D2C B;  1ZR4 A;  2HYN A;  2A45 H;  2C9N Y;  3SSU A;  1NGM B;  1KMI Z;  1N73 A;  4JBZ A;  3V2R A;  1JMM A;  1NAF A;  3BRV B;  4GDO A;  2Q5U A;  3SWK A;  1IFM A;  2WPR A;  2XKM A;  3AEA C;  5APY A;  1L0L E;  4P1C H;  2Q1K A;  2ZYA A;  3CCQ P;  1GL2 D;  4DCK A;  2J5U A;  2HFE D;  1QVF O;  2QA4 P;  5GTH H;  3KXD A;  2NVE A;  2OTK E;  1EZV I;  1H0T A;  4NBE D;  2M0B A;  3P8C D;  2BAS A;  1SFC C;  2GM4 A;  2PFX A;  5L8R J;  1WT6 A;  1M1K Q;  1SQX E;  5APS A;  1FC2 C;  4JF7 A;  1UII A;  5AEW A;  1HVV A;  2BCC D;  2YNY A;  1SQB J;  1SQQ J;  5KAI H;  1NTM E;  1OZH A;  2HMO A;  3O6Q B;  2HMK A;  1L0N G;  2GBW A;  2KSE A;  2G3A A;  1BE3 E;  1BDC A;  1NWQ A;  3M0D C;  1VDF A;  4OWF A;  4XFJ A;  2YFI A;  1MKM A;  2A06 D;  2WT7 A;  1NYH A;  1MFZ A;  1JTH B;  3O6Q A;  2Z4E A;  3RBX A;  1URQ B;  3SFD C;  3H1L J;  2FXO A;  2NZ2 A;  1QL2 A;  3FGA D;  3HTK B;  2E4Q A;  3L75 J;  1L0N D;  3VMZ A;  1Y8A A;  2DE5 D;  1IFI A;  2WSS H;  5AW1 B;  1JEK A;  3L71 G;  2XSO A;  2HOD B;  3KZI H;  2WQY C;  2Y0D A;  3BAS A;  1DX7 A;  5GTH E;  1N7S A;  4HKZ H;  1R5S A;  4N3Y B;  4UB8 H;  1PGO A;  4EI2 A;  1NTK G;  3BAT A;  1DH3 A;  3L72 J;  1FZG A;  1UUV A;  1SQV E;  4I1L A;  2P1J A;  3QH9 A;  1ZR2 A;  2KLU A;  1BE3 D;  2FFD B;  2JP3 A;  3PH0 A;  3CX5 D;  3TGU G;  2V4H A;  5CMZ A;  3HE5 A;  3L73 J;  3KHU A;  3CME P;  2I8D A;  5BU5 A;  5AVQ B;  1NTZ G;  1VPC A;  1GZL A;  1D7M A;  1EDI A;  1SQV G;  3HD7 C;  2FYU K;  3MIW A;  4QCK A;  3TK1 A;  3HD7 D;  1H89 A;  1BGY J;  4QUQ A;  1U57 A;  1GU5 A;  1FAV A;  1L4A D;  3F5H A;  4KT0 J;  2OYI A;  1RIE A;  3L74 G;  2O1K A;  4H44 B;  3H32 A;  2KB7 P;  3DQY A;  2XV5 A;  1M56 D;  3VCP A;  3D89 A;  1J1D C;  2Y9Z A;  3G4S P;  3WU2 E;  2NVF A;  1YIT P;  2QRX A;  5E79 H;  3GG2 A;  1QEX A;  4D6T E;  4OGQ D;  1GK4 A;  1VQO P;  4YXD C;  3TYY A;  5E79 E;  3U59 A;  3Q2Y A;  3FX0 A;  3FOU A;  4HM2 A;  2I1J A;  1URQ A;  3U1A A;  1KC8 Q;  5KKZ C;  3CCS P;  1FZE A;  1FS0 E;  2N1T A;  3L70 D;  5HL4 A;  2Y0E A;  3NXS A;  3FXD A;  1QVG O;  1FZC B;  2ZYL A;  4EMJ B;  3LW5 J;  2NRG A;  4XA4 A;  1K04 A;  3GW6 A;  2E76 C;  1PZQ A;  3MGN A;  1NU1 J;  3L35 A;  2O01 N;  4GT1 A;  3M0D A;  5AW4 B;  3G71 P;  3II6 A;  1L0L G;  1AVY A;  3CCM P;  2JWA A;  1YI2 P;  2AXT H;  3ITK A;  1IZN B;  3RL0 D;  3M06 A;  3AEC C;  1IC2 A;  1ZME C;  1ZRT D;  1MZ9 A;  1QX8 A;  2H89 C;  2WZ7 A;  1FZC A;  2KIK A;  2YKO A;  4QDD A;  3L70 J;  4UB6 E;  1BE3 J;  3N7N A;  4H0L D;  3Q5R A;  1KB9 I;  4WY4 B;  5H2F E;  1RF1 C;  3S1K A;  5TJH A;  3T97 A;  1FOS E;  3HD7 B;  4K35 A;  5H2F H;  3JCU E;  4LC1 A;  3GHG C;  3OJA B;  1NDO A;  1SQP G;  2KI7 B;  1GK6 A;  1KTM A;  5DJT B;  3P8M C;  1CI6 B;  1AFO A;  3AE6 C;  2YFL A;  1EZV E;  5CXM A;  3G9R A;  2FFD C;  3A7O A;  3H1I D;  2IPP A;  1NTM K;  1NTZ K;  1U7J A;  2IBZ I;  1BCC G;  4IL6 E;  1J2J B;  1LGH B;  2YMK A;  2RMZ A;  1CSB A;  2KSJ A;  3LIE A;  4BXL A;  5AVX B;  3W67 A;  1JY2 N;  1Q90 D;  2P7J A;  3RK3 C;  3A3Y B;  3CXH D;  1M1J B;  2QE7 H;  3M91 A;  3CPW O;  2AEM A;  1BCC E;  5KTB A;  2HPC B;  4NBH D;  3PTZ A;  1M57 D;  3CWB G;  1N2D C;  2L91 A;  2JWD A;  3H25 A;  1NTK K;  3VMI D;  1J1E B;  2QJY B;  2K9J B;  1KD1 Q;  2DW3 A;  3GMA A;  4R4M A;  5APT A;  1ZP0 C;  4U3F E;  5AVY B;  1WQL A;  3G3Z A;  4PD4 E;  3LW5 H;  2B24 A;  2WT7 B;  1OFC X;  2A45 I;  4ZMD A;  2Q6Q A;  2XNX A;  2ZJS E;  2WPV B;  3H1H D;  4I2L C;  1BSN A;  4LLH A;  5APW A;  4QDF A;  4ASW A;  3L72 G;  1W2E A;  2HG5 D;  2O01 J;  1HGZ A;  4LGD E;  1FBM A;  4I7Z B;  1BGY E;  3VMH D;  1L0L K;  1MUU A;  2J58 A;  2W6J H;  1HF9 A;  3V4Q A;  1JTH A;  3L71 J;  3CC2 P;  1JY3 N;  4D6T G;  2B87 A;  1LJ2 A;  3IN6 A;  1EXJ A;  2M3E A;  3HUS A;  1VQ6 P;  1X79 B;  5KLV K;  3CX5 I;  2V7Q H;  3NTN A;  1FE6 A;  4TLF A;  4RJT A;  1BGY G;  1T6A A;  3JCU H;  1S72 P;  2XU6 A;  5TIS E;  3F89 A;  3L70 E;  1GD2 E;  4B86 A;  1IFN A;  3AEE C;  1CI6 A;  2K3R A;  2AEF A;  4N78 E;  3CCJ P;  5CJ4 A;  1T2K D;  4H0L B;  3VYI A;  1O7P A;  4JYC A;  1O7W A;  3USS A;  1SQV J;  2P58 A;  2Z5H A;  1CW5 A;  2FXP A;  4HKV A;  4NBA D;  5BVZ A;  4AAY B;  2QEX P;  1YQ4 C;  2K1A A;  3KPE A;  1LWU A;  3GZX A;  2BMO A;  3V4W A;  4PV1 B;  2FYN C;  5AVT B;  3TGU E;  1FOS F;  1K8A Q;  1X0T A;  3HE5 B; 
#chains in the Genus database with same CATH homology
 4AIV A;  2NZ2 A;  1PL5 A;  2QJK C;  3FGA D;  1OW7 A;  3EQQ A;  2E4Q A;  4RKU J;  1EG9 A;  3R4Y A;  1UUW A;  2DE5 D;  1O7N A;  3H1H E;  4HM4 A;  1OMI A;  3CXH E;  1OW8 A;  2XSO A;  3ABV C;  2WQY C;  1YQ3 C;  2QSI A;  2P10 A;  3Q5P A;  1VF5 B;  2IDB A;  5BOK A;  2D2C D;  1KYO E;  1GMJ A;  3T97 B;  1VCK A;  1UUV A;  1SQV E;  4NBF D;  1AJY A;  2HMM A;  3VMG D;  2JP3 A;  3GF7 A;  3D71 A;  3D70 A;  4H13 C;  2NUK A;  1S5L X;  2QIW A;  2YIU C;  2E75 D;  1IK7 A;  4QUP A;  2NWF A;  4QCK A;  3H1L E;  3GB4 A;  4NBB D;  1O7H A;  4QUQ A;  1U57 A;  1FDO A;  1O7G A;  4KT0 J;  2G8Y A;  1SQP E;  1RIE A;  3CWB E;  1SQB E;  4OGQ B;  4H44 B;  2E75 B;  3DQY A;  1ULJ A;  3VCP A;  3D89 A;  5KLI C;  2NVF A;  1G8K B;  3GL2 A;  1WMK A;  1RFS A;  3Q1M A;  5KLV E;  2JO6 A;  4OGQ D;  3D6Z A;  1ULI A;  1KOR A;  1VL2 A;  4YXD C;  3AE8 C;  3AE5 C;  3GOB A;  3Q2Y A;  2HMN A;  2BEQ D;  3FOU A;  4HM2 A;  1SJG A;  4PV1 C;  5KKZ C;  5HL4 A;  3AE9 C;  2ZYL A;  1VM9 A;  4EMJ B;  2BMR A;  3LW5 J;  3AE2 C;  1K04 A;  2E76 C;  1FQT A;  3AEB C;  1ZRT E;  4HM3 A;  5M1B A;  2ZT9 D;  2OQQ A;  2H88 C;  3L74 E;  3GKE A;  1O7M A;  4U7J A;  4HM0 A;  1NTK E;  2CKF A;  3AEC C;  4HM7 A;  3AED C;  1ZME C;  3L73 E;  2WSF J;  4QDC A;  2D2C C;  2K9Y A;  3CX5 E;  2H89 C;  1VF5 C;  1SQQ E;  4HM8 A;  2E75 C;  4QDD A;  2XSH A;  1DIP A;  4QDF B;  2NUM A;  3H1J E;  4H44 D;  1PPJ E;  4H0L D;  1Q90 C;  1KQF B;  3Q5R A;  2WSE J;  3AZC A;  1JB0 J;  4YTP C;  2BMQ A;  1DD3 A;  1R8E A;  1DD4 A;  2DE6 D;  2E76 D;  1EXI A;  2HML A;  1KQG B;  3C8V A;  2E74 C;  1NDO A;  4I7Z C;  2ZT9 C;  4R4L A;  2QJY C;  3EN1 A;  1KTM A;  5AEU A;  4NB8 D;  2FBW C;  1S1C X;  3AE6 C;  2YFL A;  1EZV E;  3GLM A;  5CXM A;  3G9R A;  4Y28 J;  1RQV A;  3AE3 C;  2V7Q J;  2YMK A;  2B1X A;  4H13 D;  2A06 E;  4P1B H;  2GBX A;  4Z1M H;  1HJ0 A;  2XR8 A;  1NYK A;  2WSC J;  2DE7 D;  1KB9 E;  1Q90 D;  3EWK A;  4H44 C;  4OGQ C;  3AE7 C;  4TT3 H;  1PIX A;  1L0N E;  1OW6 A;  1TU3 F;  3B71 A;  1BCC E;  1JM1 A;  1P84 E;  1K05 A;  2I7F A;  4NBH D;  2YVJ B;  4HM5 A;  4QUR A;  3H25 A;  3H1K E;  3L72 E;  3VMI D;  3RK3 E;  1ZOY C;  3GZY A;  3IAO A;  2ZT9 B;  3GMA A;  1G8J B;  4R4M A;  4IL6 X;  4NB9 D;  1ZP0 C;  4H13 B;  2QJP C;  4U3F E;  2E4P A;  1WQL A;  2E74 D;  2XRX A;  3GTS A;  2MKV A;  4HM1 A;  3H1I E;  4PD4 E;  3BCC E;  3GCE A;  2B24 A;  3GTE A;  2IBZ E;  2WPV B;  2BCC E;  3SFE C;  3GL0 A;  4QDF A;  3S9O A;  1PP9 E;  3VCA A;  2O01 J;  3AEG C;  1NU1 E;  4H0L C;  3D6Y A;  4I7Z B;  3AEF C;  4HJL A;  3VMH D;  2D2C B;  4NBG D;  2E74 B;  1HF9 A;  1VF5 D;  1NGM B;  4NBC D;  1KMI Z;  3N0Q A;  2JO1 A;  1Y9B A;  3IN6 A;  1EXJ A;  2HMJ A;  3AE4 C;  4GDO A;  4PV1 D;  3GF3 A;  2JZA A;  2YFJ A;  1KIL E;  2NVG A;  3AEA C;  1L0L E;  4P1C H;  3Q3D A;  3L75 E;  2BEZ F;  1PV3 A;  2J5U A;  3AE1 C;  2Q3W A;  1NTZ E;  2NVE A;  3L70 E;  2E76 B;  3RL0 g;  3AEE C;  4NBE D;  4HM6 A;  4H0L B;  1RQU A;  5L8R J;  1O7P A;  1SQX E;  1O7W A;  4NBD D;  5AEW A;  1UIX A;  2FXP A;  1NTM E;  4HKV A;  2HMO A;  3C0D A;  4NBA D;  2HMK A;  4AAY B;  2GBW A;  2G3A A;  1YQ4 C;  1BE3 E;  4XFJ A;  2QPZ A;  2YFI A;  1MKM A;  3Q5S A;  2FYU E;  1FDI A;  3GZX A;  2BMO A;  3L71 E;  1NYH A;  4PV1 B;  2FYN C;  3TGU E;  3O6Q A;  3SFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...