2QJKC

Crystal structure analysis of mutant rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Electron transport
total genus 51
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qjkC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qjkC02
1ULJA 2BMOA 1NYKA 2QPZA 2E4QA 4H0LB 1ULIA 3H1KE 2E74B 2BMRA 2ZYLA 5HL4A 4H13B 4NBBD 1VM9A 2YVJB 4RKUJ 4NB8D 2QSIA 1SQBE 2NVEA 5AEUA 5KLVE 1JM1A 2NWFA 4HKVA 4AIVA 2E75B 1O7MA 2A06E 1Q90D 2HMOA 1SJGA 3DQYA 3VMID 4OGQB 2NUKA 2E76D 1FQTA 1JB0J 4QDDA 1SQXE 2HMLA 1KYOE 2K9YA 2HMKA 2ZT9D 3GTSA 5KLIC 3BCCE 3C8VA 3GZXA 2YIUC 1ZRTE 2Q3WA 1VCKA 3C0DA 2B24A 4QCKA 4I7ZB 2B1XA 1NTME 2GBXA 4HM5A 2D2CB 1BCCE 1L0LE 1NDOA 1S5LX 2DE6D 3EQQA 2DE5D 4HM0A 2IBZE 2O01J 1SQVE 4Y28J 1BE3E 4KT0J 2XSOA 1UUVA 3H1LE 5KKZC 4H0LD 4PV1B 4HM1A 2E74D 1VF5B 4H13D 2QJYC 3CX5E 4QUPA 5CXMA 1NTZE 1O7PA 1UUWA 1RIEA 3GB4A 4HM3A 1WQLA 2HMJA 1EG9A 1L0NE 2E75D 3GZYA 2YFIA 4QDCA 1KB9E 4H44D 4OGQD 2WSFJ 3GOBA 4HM6A 4AAYB 2WSCJ 4EMJB 2BCCE 3CWBE 2XSHA 4NBGD 2BMQA 2XR8A 1PPJE 3GTEA 2HMMA 4NBAD 2NUMA 3VCAA 1O7NA 1SQPE 5BOKA 3GCEA 4QDFB 1NTKE 3AZCA 2D2CD 1O7GA 1RFSA 2HMNA 4IL6X 2NVFA 3FOUA 5L8RJ 3GL0A 3D89A 4HM8A 4QDFA 2GBWA 3N0QA 2NVGA 1EZVE 4PV1D 3L75E 1PP9E 2QJKC 1SQQE 1VF5D 2XRXA 4HJLA 3LW5J 2JO6A 4NB9D 1O7HA 2E4PA 4NBHD 3L73E 4PD4E 3H1HE 4P1BH 4NBED 2FYUE 2E76B 1NU1E 2DE7D 3VMGD 2I7FA 2YFLA 2WPVB 4HM4A 4P1CH 2CKFA 2WSEJ 3GKEA 4QURA 5AEWA 3TGUE 2ZT9B 2YFJA 4HM7A 1P84E 4H44B 2JZAA 1Q90C 3L70E 4NBCD 2QIWA 3L74E 4NBDD 3VMHD 3L72E 4NBFD 3GL2A 3H1IE 4U3FE 1O7WA 3VCPA 4HM2A 2FYNC 3EN1A 4QUQA 2QJPC 1G8JB 1G8KB 3H1JE 3L71E 3CXHE
chains in the Genus database with same CATH superfamily
1LTIC 1SQXG 2Y0EA 3H32A 2FXOA 1G2CA 1OIPA 1EDLA 1AVOA 1SQBE 3CCSP 5KLVE 5KLIB 5CJ4A 2ZAEB 1IFMA 3CMEP 3I56P 5KAFH 2K9YA 3L35A 4H44C 2Q3WA 1AV1A 3L70D 4I7ZB 1JEKA 5AVQB 3BATA 4NPFX 3EQQA 4HM0A 1JY2P 1NU1K 2BCCG 3CWBG 4H0LD 2OYIC 1X0TA 2K37A 3M0AA 2M0BA 4OVNF 1NTKK 1H0TB 5AW3B 4IFFA 1CSBA 4I6MC 4JPZB 3U59A 1LT9B 1T8ZA 4HM6A 1RQVA 1IO4A 1SQQG 2FXPA 1DIPA 3H1KG 5KAIH 4DT0A 3VCAA 1NTZJ 2QJKB 3A0HH 1NKNA 4IL6X 2CPSA 3L75J 2NVGA 1OMIA 4HJLA 2XZRA 4U3FG 3MTUE 3E1IA 2KOGA 2HFED 1KQGB 1BCCG 2JR8A 2IYPA 3R2PA 4EIJA 2FKWB 1JY3P 1O7WA 1SQVD 1G8KB 1GW3A 1IJDB 4CPGA 2BMOA 3T97A 3KZIH 2O1KA 1VQ9P 3H1KE 2YMKA 2B88A 4NB8D 2QSIA 2NVEA 4H0LC 2E75B 1QVFO 3VMID 2IBZG 2NUKA 1ZW0A 2KB7P 3CI9A 3C0DA 3CL3D 1KILB 3L74D 1JY2N 5APQA 3SFDC 4QCKA 1BCCE 1M7LA 3H1ID 4N78E 1NAFA 1LTJC 3HD7A 4GOFA 1SQVE 1Q2NA 1DD3A 3B5NA 1KZUB 1NWQA 5KJ7A 3GHGA 2KIKA 1E5WA 2WT7B 3CXHH 3HE4A 1P84D 2YNYA 2J59M 2WSCJ 1EZVG 3PJSK 1KYOD 1VL2A 2Q7CA 1LTGC 2W6BA 2K9JB 2FYUK 3CXHI 2L91A 4L74A 5CMZA 3L37A 1L0NJ 3GMAA 4GOEA 1NH4A 1BDDA 2K3RA 2WSFH 3KQGA 2WQYC 3V4WA 4K3AA 2OYOA 1JY3N 1SVFA 3K5BA 1SFCA 1FJKA 1P84E 2XKMA 3EQ2A 2KZIA 2ZFCA 2Z5IA 2MJZA 2A45H 2MKVA 1SQPD 3LIDA 3KHUA 2JWAA 2QPZA 3L73J 4EOTA 2R32A 3CC7P 1HBWA 4H13B 4GODA 1ZR2A 1PP9D 4Z1MH 3WUUA 2A45I 4D6TD 3HUSB 1T3UA 3PH0A 5GTIE 2HMLA 1SP4A 2NPSB 5KLIC 2XU6A 1VCKA 1AFOA 4ZMDA 2WZ7A 2Q6QA 4OWFA 1GTWA 2DE5D 1JM0A 2IZ0A 1D7MA 3NFQA 4I7ZC 3O6QA 4QUPA 3M0DC 1GL2B 1LTTC 1PV3A 1NOHA 2E75D 4BRYB 2A06D 3O8ZA 2BASA 4D6TE 2LR2A 1LJ2A 1NVOA 3NMDA 1LT9C 3MP7B 1XTGB 3BCCD 3D71A 1KILD 1FZCC 3HE5A 1GK6A 3I5CA 3JSVC 4GKGA 3GCEA 3CCMP 1NJIQ 2B89A 5AVYB 5L8RJ 3T97B 1DX7A 2QJKC 4C46A 3AEBC 1W2BO 2PAJA 3PRJA 1MZ9A 2WPVB 4HM4A 1L0LG 2N1TA 4WWIA 3KPEA 1TU3F 4K35A 3H1JJ 3S1KA 3F89A 2M8RA 2L5GB 1KILE 1L0NK 1LTSC 1PGPA 1T6AA 1NYKA 1URQC 3HD7B 1FDIA 5CCGD 1T3JA 3FGAD 2IZ1A 3II6A 3P8MC 1FOSE 3B5NB 1S5LE 5AEUA 4WB4A 2NWFA 1K04A 3GHGB 1A02J 3N4XA 5APUA 3AEAC 1M8OB 1L4AA 5GTHH 2Y9YA 5AW6B 2FY8A 1VQPP 3V6IA 1L0LE 2IDBA 1S5LX 3H1LJ 4AUWA 3D6YA 1BE3E 3CXHD 1KILC 1NU1G 4H13D 3FWLA 3IAOA 3TGUG 1N7SA 1XTCC 3B71A 1IFIA 5APWA 1NTKG 1R5LA 3ZDMA 1GW4A 2QVAA 1ZLLA 3P32A 2WPQA 2NPSD 1LTAC 5TJHA 3AE4C 2O01H 3JCUE 3Q5RA 2IX7C 1HWTC 1KORA 1O7NA 1LGHB 3QH9A 2OYHA 4B86A 2ZJSE 3C1LA 1MFTA 3F5HA 3LW5J 1GL2D 3ITKA 5CCGC 3H1HE 3M06A 2IFNA 1NU1E 2E76B 4P1CH 2FXMA 2W6AA 3TGUE 2PFXA 4Y99C 3L72J 3AE1C 1JTHB 3VCPA 1PZQA 2H8PD 3IR9A 1QVGO 4UB8E 5HL4A 2WSCH 4RESB 3BVHA 1QL2A 1SQPK 3WUTA 1BGYJ 1J1EB 4ASVA 3W67A 4PD4H 5KKZB 2Z5HA 3HE5B 1PIXA 2NPSC 2DE6D 3HD7D 4PD4I 1IK9A 3M9HA 2WSFJ 4EMJB 4C7RA 3SWKA 1W2EA 4GIFA 3GTEA 3CCJP 5AW4B 2IYOA 3MGNA 1JMMA 1KD1Q 1NO4A 2RKLA 3S9OA 3RGUA 2FYUG 2O3JA 4KHXA 2NVFA 1Y47A 1VQ7P 3Q3DA 4RO0A 3MUDC 3GLMA 1RE3C 1WRGA 2E4PA 1GU4A 5H2FH 2ZYGA 1RE4C 1L4AB 2AXCA 3L71J 1T2KD 3VMHD 1NAYA 3RL0B 2IBZI 4QUQA 2B87A 1VQ4P 2LKMA 4GDOA 1ZMEC 2JP3A 3G71P 1GU5A 1NTZD 2E74B 1YITP 2UWJE 3TF5A 3L75D 1U7JA 5CCHC 2RMZA 2E76D 3GW6A 4QDDA 3FXDA 4W7YA 2ZT9C 3AECC 4YXWH 1NTMJ 3V5BA 3KXDA 4MN4C 1Q82Q 3AEGC 5K5GB 1AJYA 2Y0CA 2JWDA 4HKZH 1EZVI 2OYHB 3AE8C 3RBZA 3QWOC 5B5EH 2WTYA 3A0BE 3EFFK 2HODB 1VF5B 1NTZE 1RIEA 3L70G 5BVZA 5TISH 1HGZA 3GZYA 3D70A 2P7JA 2KS1A 3RK2B 2YXQB 3C9IA 1AQ5A 3WU2E 3D89A 2P10A 3VMZA 3M9BA 2KUBA 1AQTA 4IL6E 2ZYAA 1X8YA 4N6JA 1VQOP 2WPRA 1N73C 3HTKA 2QA4P 4XE5B 1VQMP 3PTZA 4BXLA 4NBED 1SLQA 4HH2A 1FZAA 2N9BA 1U7MA 2FBWC 2YFJA 4IFDK 3CX5H 3L70E 4NBCD 2BCCD 2QIWA 2KNCA 2E76C 2ZXXA 3FX0A 2BEZF 1QEXA 5CBOA 3OW2O 1G8JB 2AXTH 2DW3A 3VYIA 3CX5I 2ZYLA 1EXJA 1K73Q 1VPCA 1SQBJ 3IF4A 5KLVJ 1ZP0C 1L0ND 3MD0A 1KTMA 2WPSA 2WSEH 3OA7A 3DQYA 1SQVG 2O01N 3AE9C 2HMKA 1RF1C 1VDFA 1DEEG 1CW5A 3RL0D 3LW5H 2GBXA 4GT1A 2D2CB 2HLOA 2O01J 1KFNA 5KKZC 4HM1A 1DEBA 2E74D 1SQXJ 3L73D 1WQLA 1EG9A 1L0NE 3L74G 1JCCA 3MZWB 2BEQD 1FAVA 2WMMA 2PGDA 3P8CD 2J5UA 1QX8A 2B87B 4TLFA 1LWUC 1ZN5A 1OX3A 3N0QA 4L76A 2C9LY 1VF5D 4WY4A 2BCCJ 3CWBJ 1N7LA 1OXZA 3L73E 1K8AQ 4HJGH 5CCHA 4ASWA 1EDIA 3RK2D 5AVXB 1HUCA 3TSIA 3L74E 4A7PA 1MFZA 4HYTB 1SQQJ 1UIIA 3H1IE 1JUNA 1KB9H 2QJPC 3H1KJ 1ULJA 3H32B 2Q3IA 1G2CB 2YO3A 2FFDC 5APXA 1JCDA 3BASA 1M1JC 2I1KA 3V2QA 4NPDA 1Q90D 2E74C 1QLED 2GM4A 3JC22 4OGQB 4U3FJ 1SQPG 1KYOE 1NTZK 3TNUA 1BCCJ 3A7OA 3A5TA 1USEA 1YQ3C 1CI6A 2OYIA 3H1JD 4D6TG 1JY2O 4IOIH 1LNQA 4UB6H 5DJTB 1Y8AA 3M9QA 1FDMA 1N73A 1VF5C 1OVUA 4DCKA 1NGMB 1DH3A 1VQ6P 3R4YA 5APTA 5BU5A 2KNCB 2NUMA 1ZRTD 3RK2C 1SQPE 1S3JA 2D2CD 5CHXA 1LP1A 1HH0A 4R4LA 2A06G 4QDFA 2KXPB 5C39A 1PP9E 5KAFE 1A02F 3H1LD 2XRXA 3CX5D 3CMAP 3FWNA 1DD4A 1USDA 1EXIA 3E7KA 3CCEP 1H88A 1OWAA 1S4XA 2GA1A 1Q90C 3AE5C 2WWWA 2JKVA 3N7NA 1JY3O 2R3SA 4ZKUA 1VQNP 2KI7B 1JOCA 1QGKB 3P7KA 2BMRA 1RF0C 1VM9A 2HR3A 2Q5UA 1GK4A 2R44A 5KAIE 4I2LC 1JM1A 2A06E 2G8YA 3A0HE 1BE3G 2YKQA 4DJGA 2WITA 1Q86Q 3BCCE 3C8VA 1RH5B 1YQ4C 4XA4A 1LTJA 3L72D 1MV8A 1X9VA 2HG5D 1KQFB 2KSJA 1O7PA 4HM3A 3HE4B 1IZNB 4PJ0H 3M91A 4JQ0D 2E75C 4OGQD 4BWNA 3KZIE 5AVWB 2XV5A 4NBGD 2KSEA 5APYA 1GD2E 4NBAD 5BU8B 2YKPA 3H1HG 3U1AA 3AZCA 1BGYD 3VP8A 1YBKA 3H6PA 2JO6A 4NB9D 5APSA 3PP5A 1SFCB 2QEXP 3CCRP 2WSEJ 3B4SA 3L36A 1LTBC 4H44B 1FZBA 3AE2C 1YJNP 2P67A 3KDPB 4IL6H 4NBDD 1PPJD 3H25A 2ZYDA 3ABVC 1L2PA 3CXHE 2E4QA 3IN6A 2WSSH 2OARA 5APVA 3AEFC 4AIVA 1O7MA 2XDJA 1IK7A 3CCVP 1JNMA 3GF3A 5AW8B 1G1IA 3KYQA 3V2PA 3BRVB 2R5BA 2KYVA 1L0LJ 3AEEC 2H88C 2WVRA 4LGDE 4HM5A 1BE3J 1YI2P 3O6QB 3L71D 3M0DA 5AVUB 2QRXA 4H13C 2KZJA 2I8DA 3G4SP 3NXSA 4QMAA 1AA0A 3CD6P 2K88A 3HUSC 1LT9A 2XSHA 1FZCA 2AEMA 2IPPA 4C7NA 2Q1KA 3CLQA 3G9RA 1JO5A 1RFSA 1NTMD 3FOUA 4HM8A 3B5ND 1J2JB 1YTZI 5KJ7D 3H1HJ 1R5SA 1NU1J 1GL2C 1Z56A 3TGUJ 2DE7D 3RK3B 2H43A 5AW5B 2N1TB 1NTKJ 1KQSO 2Q3EA 1FZFA 1LTJB 1URQA 4TT3H 3SWYA 3VTPC 5CJ0A 3VMXA 3CCQP 3Q1MA 2RN0A 1VQ5P 2VRSA 4KJMA 3UIAA 2YIUB 4U7JA 1SFCD 2C0XA 1GDTA 1NTZG 1HTLC 1N2DC 3OJAB 3L75G 2QJYB 1KILA 2W27A 5DJUB 3GF7A 3MHVA 2W8ZA 1N7SB 2HYNA 1P84H 3HD7C 1S9KD 1M90Q 3BRTB 1UUWA 1RY3A 2E42A 3B5NC 1IFNA 1RQUA 1SQBD 5AVRB 5KLVD 2KP8A 4QDCA 2B9BA 3GHGC 1SS1A 1P84I 4AAYB 2WT7A 2OGUA 2BMQA 4HB1A 2ZXEB 2ZVOB 2KLVA 1X22A 1OVVA 3GL0A 5GTIH 4OH8B 4DOJA 3L75E 2K1AA 5GTHE 3G6EP 3U1CA 5CCGA 1S9KE 2N9YB 3WMM0 4P1BH 1SQXD 2CK3H 2YFLA 2FYNB 4HM7A 1VQ8P 3RBXA 5B66E 5AVZB 3G3ZA 1KC8Q 1SFCC 1IFDA 2YKOA 1HGVA 3VMYA 1T2KC 2M3BA 1KV4A 1ULIA 2FYUJ 2OTLP 4NBBD 1MUUA 2PRRA 1YJ9P 1FQTA 3RK3D 1FE6A 3CWBD 2N1TD 3B8EB 1SQXE 2H89C 3HUSA 1FZCB 2B24A 2NPSA 1L0NG 1OW6A 4C7NB 2V4HA 1G1JA 1LT1A 1J1DB 2V7QJ 1NDOA 1GZLA 5AVVB 5AW9B 4XFJA 2JDIH 1SQQD 2O1JA 4AQRD 1BSHA 3H1KD 1YYCA 4PD4D 2P2UA 3TK1A 4R4MA 1GL2A 1L4AD 2JJLA 5E79E 1PGQA 5KTBA 4BRYA 2BCCE 1S72P 1VQKP 1FS0E 3RK3E 3CWBE 2XR8A 1FZEA 4U3FD 2P1JA 1S5LH 3A3YB 2SPZA 3EFGA 1OW7A 3L73G 1J1EC 2E5YA 3AE7C 1URQB 1O7GA 2HMNA 1BCCD 4N78D 3W68A 1FJPA 1N7SD 3MUDA 3CCUP 1SQQE 1RE3A 4EDFA 1ZV8A 5AW2B 3H1IG 4O9BA 3WUVA 4PD4E 1NTMK 1RE4A 3L70J 1YHQP 2JZAA 5AVSB 1IFJA 3RK3C 3GG2A 2N1TC 4U3FE 4YTPC 2IBZD 1HF9A 2KK7A 4M3LA 4I1LA 4LLHA 3VP9A 2LXBA 3JCUH 4RKUJ 1KQLA 2LXCB 2Y0DA 3V4QA 1SJGA 3AEDC 1N86A 3VN0A 3Q2YA 3GTSA 3P8CE 1L4AC 2YIUC 1EDKA 3RL0C 1Q7YQ 2IBZE 1EZVD 5H2FE 1EQ7A 4RJTA 2I1JA 1YJWP 1KB9I 1Y9BA 2QJYC 5AW1B 2HMJA 3Q5SA 1OFCX 1N7SC 2KS1B 4UB8H 1EC5A 1AVYA 4Y99B 3H1JG 2J58A 1PP9G 1SQVJ 2R3CA 3SWFA 3L4FA 2POHA 5BOKA 1SQBK 3USSA 5KLVK 4JYCA 2E5TA 3Q5PA 2OYHC 3HTKB 1EZVE 4JF7A 1N8RQ 2QM7A 4NBHD 1NYHA 1PL5A 2CKFA 3L74J 5B5EE 1JMBA 3H1IJ 2IFMA 2OTJP 3H1LG 3CC4P 4ZKPA 3V2RA 3VOPA 1JTHA 2FYNC 3H1JE 1SQXK 5TISE 1URQD 3D6ZA 3AE6C 4WBAA 1W5CE 3BCCG 3PLNA 2P58A 3V2NA 1NHLA 4HKVA 3S4RA 1RF1A 1E79H 1JB0J 1PFIA 1K05A 2YO2A 1ZRTE 4L73A 1OW8A 2B1XA 2H7HA 1ZXGA 1BDCA 4Y28J 3SSUA 4WVZA 4ZNCA 3H1LE 4PV1B 1WMKA 3CCLP 1KFMA 2M3EA 3CX5E 1J1DC 5CXMA 3E1RA 3I55P 5CBNA 1YIJP 3L72G 4EYYQ 2YFIA 2AXTE 4EI2A 1SQQK 1ZR4A 2M5AA 1SQPJ 2HMMA 1NKZB 2ITAA 4AYCA 1HVVA 1LWUA 1FOSF 4NPEA 1HJ0A 1HJBA 2D2CC 1PP9J 1L0LD 4WY4B 5AW7B 2OTKE 1BE3D 4D6TJ 2G3AA 1M1KQ 4N3YB 1KMIZ 1H8AA 2I7FA 2V7QH 1BGYG 3A0BH 2ZT9B 1SQVK 2QE7H 5AW0B 1PGOA 3L72E 3HRNA 3PHLA 4HM2A 2FFDA 1FBMA 1EDJA 2JO1A 4L75A 2GUSA 3SFEC 3FXEA 1M1JA 1U57A 5B66H 2C0WA 1KB9D 1PPJG 2HMOA 1X79B 3WU2H 3H1HD 3TNUB 2Q9IA 1NU1D 3BCCJ 1IFPA 3TGUD 5EFWB 2HPCA 3GZXA 1CI6B 1NTKD 1YTZT 2OYIB 1BGYE 2KLUA 2QM8A 2A45G 2C9NY 2NRGA 2FYZA 4KT0J 1UUVA 2XSOA 2XNXA 1N73B 5AVTB 3GB4A 4YPCA 2R5DA 2HODA 1FDOA 1RHZB 1KB9E 3MIWA 1H89A 3GOBA 4OGQC 3L71G 2OQQA 1PPJE 1FC2C 1LP1B 2QG4A 4LC1A 4QDFB 1NTKE 2Z4EA 1R8EA 2JEEA 2GBWA 4PV1D 5E79H 1UIXA 1H0TA 1O7HA 3TYYA 5M1BA 1IC2A 2YXRB 5AEWA 1RF1B 1NTMG 3CPWO 3EWKA 4UB6E 2NZ2A 2RH0A 1VQLP 4NBFD 3GL2A 3EN1A 3L71E 4W80A 1RF0A 4WY4D 3CC2P 4H0LB 1PGJA 1BSNA 2YVJB 5CCHD 3A2AA 4JYBA 3OAKA 2CPBA 1S1CX 4YXDC 4W7ZA 2AEFA 2W83C 2E43A 1FU1A 2ZT9D 1Q81Q 2GUVA 2M5AB 3AE3C 3VMAA 1LWUB 1NTME 1GMJA 1ZOYC 2AEJA 1S2EA 2FYUD 2XNDH 4PV1C 4H44D 1OVRA 1MKMA 2ZVNB 4IFMA 4DZOA 1QL1A 3IFMA 3NTNA 2YMYA 1K9MQ 1M56D 3RL0g 2QJPB 1KN7A 1SQBG 2FFDB 5KLVG 2W90A 1KYOH 2Y9ZA 1M1JB 5KJ7C 2W6JH 4WY4C 2FYUE 3VMGD 1KYOI 1WT6A 1L0LK 4QURA 3GKEA 2PP6A 4JBZA 1CZQA 2HPCB 2K9JA 3LIEA 1M57D 3TDKA 4PJ0E 1OZHA 1FZGA
chains in the Genus database with same CATH topology
2BMRA 5HL4A 1VM9A 4RKUJ 1SQBE 5KLVE 1JM1A 2A06E 1SJGA 2G8YA 3AEDC 3Q2YA 2K9YA 3GTSA 3BCCE 3C8VA 2YIUC 4H44C 2Q3WA 1YQ4C 4I7ZB 1PIXA 2DE6D 3EQQA 4HM0A 2IBZE 4H0LD 1KQFB 1Y9BA 2QJYC 1O7PA 4HM3A 2HMJA 3Q5SA 2E75C 4OGQD 2WSFJ 4HM6A 1RQVA 4EMJB 4NBGD 3GTEA 2FXPA 1DIPA 4NBAD 3VCAA 3S9OA 5BOKA 3AZCA 4IL6X 2NVFA 3Q5PA 1OMIA 3Q3DA 2NVGA 1EZVE 4HJLA 2JO6A 3GLMA 4NB9D 2E4PA 4NBHD 1NYHA 1PL5A 1KQGB 2WSEJ 2CKFA 4H44B 3AE2C 4NBDD 3VMHD 3H25A 1O7WA 2FYNC 4QUQA 3ABVC 1G8KB 3H1JE 3CXHE 4GDOA 2BMOA 3D6ZA 1ZMEC 2E4QA 2JP3A 3AE6C 3IN6A 3H1KE 2E74B 2YMKA 4NB8D 2QSIA 2NVEA 3AEFC 4HKVA 4H0LC 4AIVA 2E75B 1O7MA 3VMID 1IK7A 2NUKA 2E76D 3GF3A 1JB0J 4QDDA 1K05A 2ZT9C 3AECC 1ZRTE 3C0DA 3AEEC 3SFDC 2H88C 4QCKA 1OW8A 3AEGC 2B1XA 4HM5A 1BCCE 1AJYA 1SQVE 4Y28J 3AE8C 3H1LE 4PV1B 1WMKA 1VF5B 1DD3A 3CX5E 5CXMA 4H13C 1NTZE 1RIEA 3GZYA 2YFIA 3D70A 2WSCJ 2XSHA 1VL2A 2HMMA 3G9RA 1HJ0A 1RFSA 3FOUA 3GMAA 2D2CC 3D89A 2P10A 4HM8A 2G3AA 1KMIZ 2WQYC 4NBED 2DE7D 2I7FA 2FBWC 2ZT9B 2YFJA 1P84E 3L70E 4NBCD 2QIWA 2E76C 3L72E 2BEZF 4HM2A 1G8JB 2MKVA 4TT3H 2JO1A 2QPZA 3SFEC 2ZYLA 1EXJA 4H13B 1ZP0C 4Z1MH 1KTMA 1U57A 3Q1MA 2HMOA 3DQYA 4U7JA 3AE9C 2HMLA 2HMKA 5KLIC 3GZXA 1VCKA 2GBXA 2D2CB 3GF7A 2DE5D 2O01J 4KT0J 2XSOA 1UUVA 5KKZC 4HM1A 2E74D 4I7ZC 3O6QA 4QUPA 1UUWA 3GB4A 1WQLA 1EG9A 1FDOA 1PV3A 1L0NE 1RQUA 2E75D 2BEQD 4QDCA 1KB9E 3GOBA 4AAYB 4OGQC 2OQQA 2BMQA 1PPJE 3D71A 2J5UA 3GCEA 4QDFB 1NTKE 1R8EA 3GL0A 5L8RJ 2GBWA 3T97B 3N0QA 4PV1D 3L75E 2QJKC 1VF5D 1UIXA 3AEBC 1O7HA 3L73E 5M1BA 4P1BH 2YFLA 5AEWA 2WPVB 4HM4A 4HM7A 3L74E 1TU3F 3EWKA 2NZ2A 4NBFD 3GL2A 3H1IE 3EN1A 2QJPC 1KILE 3L71E 1ULJA 1NYKA 1FDIA 4H0LB 1ULIA 3FGAD 4NBBD 2YVJB 5AEUA 2NWFA 1S1CX 1K04A 1Q90D 2E74C 4YXDC 4OGQB 1FQTA 3AEAC 2H89C 1SQXE 1KYOE 2ZT9D 3AE3C 2B24A 1OW6A 1NTME 1YQ3C 2V7QJ 2IDBA 1L0LE 1NDOA 1S5LX 1GMJA 1ZOYC 3D6YA 4XFJA 1BE3E 4H13D 3IAOA 3B71A 4R4MA 4PV1C 1VF5C 4H44D 1MKMA 1NGMB 2BCCE 3RK3E 3CWBE 2XR8A 3R4YA 3AE4C 1OW7A 3Q5RA 3RL0g 2NUMA 1KORA 1O7NA 1SQPE 3AE7C 2D2CD 1O7GA 2HMNA 4R4LA 4QDFA 1PP9E 1SQQE 2XRXA 3LW5J 1DD4A 4PD4E 3H1HE 1EXIA 2FYUE 2E76B 1NU1E 3VMGD 4P1CH 4QURA 3GKEA 3TGUE 2JZAA 1Q90C 3AE1C 3AE5C 4U3FE 4YTPC 3VCPA 1HF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULJ A;  2BMO A;  1NYK A;  2QPZ A;  2E4Q A;  4H0L B;  1ULI A;  3H1K E;  2E74 B;  2BMR A;  2ZYL A;  5HL4 A;  4H13 B;  4NBB D;  1VM9 A;  2YVJ B;  4RKU J;  4NB8 D;  2QSI A;  1SQB E;  2NVE A;  5AEU A;  5KLV E;  1JM1 A;  2NWF A;  4HKV A;  4AIV A;  2E75 B;  1O7M A;  2A06 E;  1Q90 D;  2HMO A;  1SJG A;  3DQY A;  3VMI D;  4OGQ B;  2NUK A;  2E76 D;  1FQT A;  1JB0 J;  4QDD A;  1SQX E;  2HML A;  1KYO E;  2K9Y A;  2HMK A;  2ZT9 D;  3GTS A;  5KLI C;  3BCC E;  3C8V A;  3GZX A;  2YIU C;  1ZRT E;  2Q3W A;  1VCK A;  3C0D A;  2B24 A;  4QCK A;  4I7Z B;  2B1X A;  1NTM E;  2GBX A;  4HM5 A;  2D2C B;  1BCC E;  1L0L E;  1NDO A;  1S5L X;  2DE6 D;  3EQQ A;  2DE5 D;  4HM0 A;  2IBZ E;  2O01 J;  1SQV E;  4Y28 J;  1BE3 E;  4KT0 J;  2XSO A;  1UUV A;  3H1L E;  5KKZ C;  4H0L D;  4PV1 B;  4HM1 A;  2E74 D;  1VF5 B;  4H13 D;  2QJY C;  3CX5 E;  4QUP A;  5CXM A;  1NTZ E;  1O7P A;  1UUW A;  1RIE A;  3GB4 A;  4HM3 A;  1WQL A;  2HMJ A;  1EG9 A;  1L0N E;  2E75 D;  3GZY A;  2YFI A;  4QDC A;  1KB9 E;  4H44 D;  4OGQ D;  2WSF J;  3GOB A;  4HM6 A;  4AAY B;  2WSC J;  4EMJ B;  2BCC E;  3CWB E;  2XSH A;  4NBG D;  2BMQ A;  2XR8 A;  1PPJ E;  3GTE A;  2HMM A;  4NBA D;  2NUM A;  3VCA A;  1O7N A;  1SQP E;  5BOK A;  3GCE A;  4QDF B;  1NTK E;  3AZC A;  2D2C D;  1O7G A;  1RFS A;  2HMN A;  4IL6 X;  2NVF A;  3FOU A;  5L8R J;  3GL0 A;  3D89 A;  4HM8 A;  4QDF A;  2GBW A;  3N0Q A;  2NVG A;  1EZV E;  4PV1 D;  3L75 E;  1PP9 E;  2QJK C;  1SQQ E;  1VF5 D;  2XRX A;  4HJL A;  3LW5 J;  2JO6 A;  4NB9 D;  1O7H A;  2E4P A;  4NBH D;  3L73 E;  4PD4 E;  3H1H E;  4P1B H;  4NBE D;  2FYU E;  2E76 B;  1NU1 E;  2DE7 D;  3VMG D;  2I7F A;  2YFL A;  2WPV B;  4HM4 A;  4P1C H;  2CKF A;  2WSE J;  3GKE A;  4QUR A;  5AEW A;  3TGU E;  2ZT9 B;  2YFJ A;  4HM7 A;  1P84 E;  4H44 B;  2JZA A;  1Q90 C;  3L70 E;  4NBC D;  2QIW A;  3L74 E;  4NBD D;  3VMH D;  3L72 E;  4NBF D;  3GL2 A;  3H1I E;  4U3F E;  1O7W A;  3VCP A;  4HM2 A;  2FYN C;  3EN1 A;  4QUQ A;  2QJP C;  1G8J B;  1G8K B;  3H1J E;  3L71 E;  3CXH E; 
#chains in the Genus database with same CATH topology
 1LTI C;  1SQX G;  2Y0E A;  3H32 A;  2FXO A;  1G2C A;  1OIP A;  1EDL A;  1AVO A;  1SQB E;  3CCS P;  5KLV E;  5KLI B;  5CJ4 A;  2ZAE B;  1IFM A;  3CME P;  3I56 P;  5KAF H;  2K9Y A;  3L35 A;  4H44 C;  2Q3W A;  1AV1 A;  3L70 D;  4I7Z B;  1JEK A;  5AVQ B;  3BAT A;  4NPF X;  3EQQ A;  4HM0 A;  1JY2 P;  1NU1 K;  2BCC G;  3CWB G;  4H0L D;  2OYI C;  1X0T A;  2K37 A;  3M0A A;  2M0B A;  4OVN F;  1NTK K;  1H0T B;  5AW3 B;  4IFF A;  1CSB A;  4I6M C;  4JPZ B;  3U59 A;  1LT9 B;  1T8Z A;  4HM6 A;  1RQV A;  1IO4 A;  1SQQ G;  2FXP A;  1DIP A;  3H1K G;  5KAI H;  4DT0 A;  3VCA A;  1NTZ J;  2QJK B;  3A0H H;  1NKN A;  4IL6 X;  2CPS A;  3L75 J;  2NVG A;  1OMI A;  4HJL A;  2XZR A;  4U3F G;  3MTU E;  3E1I A;  2KOG A;  2HFE D;  1KQG B;  1BCC G;  2JR8 A;  2IYP A;  3R2P A;  4EIJ A;  2FKW B;  1JY3 P;  1O7W A;  1SQV D;  1G8K B;  1GW3 A;  1IJD B;  4CPG A;  2BMO A;  3T97 A;  3KZI H;  2O1K A;  1VQ9 P;  3H1K E;  2YMK A;  2B88 A;  4NB8 D;  2QSI A;  2NVE A;  4H0L C;  2E75 B;  1QVF O;  3VMI D;  2IBZ G;  2NUK A;  1ZW0 A;  2KB7 P;  3CI9 A;  3C0D A;  3CL3 D;  1KIL B;  3L74 D;  1JY2 N;  5APQ A;  3SFD C;  4QCK A;  1BCC E;  1M7L A;  3H1I D;  4N78 E;  1NAF A;  1LTJ C;  3HD7 A;  4GOF A;  1SQV E;  1Q2N A;  1DD3 A;  3B5N A;  1KZU B;  1NWQ A;  5KJ7 A;  3GHG A;  2KIK A;  1E5W A;  2WT7 B;  3CXH H;  3HE4 A;  1P84 D;  2YNY A;  2J59 M;  2WSC J;  1EZV G;  3PJS K;  1KYO D;  1VL2 A;  2Q7C A;  1LTG C;  2W6B A;  2K9J B;  2FYU K;  3CXH I;  2L91 A;  4L74 A;  5CMZ A;  3L37 A;  1L0N J;  3GMA A;  4GOE A;  1NH4 A;  1BDD A;  2K3R A;  2WSF H;  3KQG A;  2WQY C;  3V4W A;  4K3A A;  2OYO A;  1JY3 N;  1SVF A;  3K5B A;  1SFC A;  1FJK A;  1P84 E;  2XKM A;  3EQ2 A;  2KZI A;  2ZFC A;  2Z5I A;  2MJZ A;  2A45 H;  2MKV A;  1SQP D;  3LID A;  3KHU A;  2JWA A;  2QPZ A;  3L73 J;  4EOT A;  2R32 A;  3CC7 P;  1HBW A;  4H13 B;  4GOD A;  1ZR2 A;  1PP9 D;  4Z1M H;  3WUU A;  2A45 I;  4D6T D;  3HUS B;  1T3U A;  3PH0 A;  5GTI E;  2HML A;  1SP4 A;  2NPS B;  5KLI C;  2XU6 A;  1VCK A;  1AFO A;  4ZMD A;  2WZ7 A;  2Q6Q A;  4OWF A;  1GTW A;  2DE5 D;  1JM0 A;  2IZ0 A;  1D7M A;  3NFQ A;  4I7Z C;  3O6Q A;  4QUP A;  3M0D C;  1GL2 B;  1LTT C;  1PV3 A;  1NOH A;  2E75 D;  4BRY B;  2A06 D;  3O8Z A;  2BAS A;  4D6T E;  2LR2 A;  1LJ2 A;  1NVO A;  3NMD A;  1LT9 C;  3MP7 B;  1XTG B;  3BCC D;  3D71 A;  1KIL D;  1FZC C;  3HE5 A;  1GK6 A;  3I5C A;  3JSV C;  4GKG A;  3GCE A;  3CCM P;  1NJI Q;  2B89 A;  5AVY B;  5L8R J;  3T97 B;  1DX7 A;  2QJK C;  4C46 A;  3AEB C;  1W2B O;  2PAJ A;  3PRJ A;  1MZ9 A;  2WPV B;  4HM4 A;  1L0L G;  2N1T A;  4WWI A;  3KPE A;  1TU3 F;  4K35 A;  3H1J J;  3S1K A;  3F89 A;  2M8R A;  2L5G B;  1KIL E;  1L0N K;  1LTS C;  1PGP A;  1T6A A;  1NYK A;  1URQ C;  3HD7 B;  1FDI A;  5CCG D;  1T3J A;  3FGA D;  2IZ1 A;  3II6 A;  3P8M C;  1FOS E;  3B5N B;  1S5L E;  5AEU A;  4WB4 A;  2NWF A;  1K04 A;  3GHG B;  1A02 J;  3N4X A;  5APU A;  3AEA C;  1M8O B;  1L4A A;  5GTH H;  2Y9Y A;  5AW6 B;  2FY8 A;  1VQP P;  3V6I A;  1L0L E;  2IDB A;  1S5L X;  3H1L J;  4AUW A;  3D6Y A;  1BE3 E;  3CXH D;  1KIL C;  1NU1 G;  4H13 D;  3FWL A;  3IAO A;  3TGU G;  1N7S A;  1XTC C;  3B71 A;  1IFI A;  5APW A;  1NTK G;  1R5L A;  3ZDM A;  1GW4 A;  2QVA A;  1ZLL A;  3P32 A;  2WPQ A;  2NPS D;  1LTA C;  5TJH A;  3AE4 C;  2O01 H;  3JCU E;  3Q5R A;  2IX7 C;  1HWT C;  1KOR A;  1O7N A;  1LGH B;  3QH9 A;  2OYH A;  4B86 A;  2ZJS E;  3C1L A;  1MFT A;  3F5H A;  3LW5 J;  1GL2 D;  3ITK A;  5CCG C;  3H1H E;  3M06 A;  2IFN A;  1NU1 E;  2E76 B;  4P1C H;  2FXM A;  2W6A A;  3TGU E;  2PFX A;  4Y99 C;  3L72 J;  3AE1 C;  1JTH B;  3VCP A;  1PZQ A;  2H8P D;  3IR9 A;  1QVG O;  4UB8 E;  5HL4 A;  2WSC H;  4RES B;  3BVH A;  1QL2 A;  1SQP K;  3WUT A;  1BGY J;  1J1E B;  4ASV A;  3W67 A;  4PD4 H;  5KKZ B;  2Z5H A;  3HE5 B;  1PIX A;  2NPS C;  2DE6 D;  3HD7 D;  4PD4 I;  1IK9 A;  3M9H A;  2WSF J;  4EMJ B;  4C7R A;  3SWK A;  1W2E A;  4GIF A;  3GTE A;  3CCJ P;  5AW4 B;  2IYO A;  3MGN A;  1JMM A;  1KD1 Q;  1NO4 A;  2RKL A;  3S9O A;  3RGU A;  2FYU G;  2O3J A;  4KHX A;  2NVF A;  1Y47 A;  1VQ7 P;  3Q3D A;  4RO0 A;  3MUD C;  3GLM A;  1RE3 C;  1WRG A;  2E4P A;  1GU4 A;  5H2F H;  2ZYG A;  1RE4 C;  1L4A B;  2AXC A;  3L71 J;  1T2K D;  3VMH D;  1NAY A;  3RL0 B;  2IBZ I;  4QUQ A;  2B87 A;  1VQ4 P;  2LKM A;  4GDO A;  1ZME C;  2JP3 A;  3G71 P;  1GU5 A;  1NTZ D;  2E74 B;  1YIT P;  2UWJ E;  3TF5 A;  3L75 D;  1U7J A;  5CCH C;  2RMZ A;  2E76 D;  3GW6 A;  4QDD A;  3FXD A;  4W7Y A;  2ZT9 C;  3AEC C;  4YXW H;  1NTM J;  3V5B A;  3KXD A;  4MN4 C;  1Q82 Q;  3AEG C;  5K5G B;  1AJY A;  2Y0C A;  2JWD A;  4HKZ H;  1EZV I;  2OYH B;  3AE8 C;  3RBZ A;  3QWO C;  5B5E H;  2WTY A;  3A0B E;  3EFF K;  2HOD B;  1VF5 B;  1NTZ E;  1RIE A;  3L70 G;  5BVZ A;  5TIS H;  1HGZ A;  3GZY A;  3D70 A;  2P7J A;  2KS1 A;  3RK2 B;  2YXQ B;  3C9I A;  1AQ5 A;  3WU2 E;  3D89 A;  2P10 A;  3VMZ A;  3M9B A;  2KUB A;  1AQT A;  4IL6 E;  2ZYA A;  1X8Y A;  4N6J A;  1VQO P;  2WPR A;  1N73 C;  3HTK A;  2QA4 P;  4XE5 B;  1VQM P;  3PTZ A;  4BXL A;  4NBE D;  1SLQ A;  4HH2 A;  1FZA A;  2N9B A;  1U7M A;  2FBW C;  2YFJ A;  4IFD K;  3CX5 H;  3L70 E;  4NBC D;  2BCC D;  2QIW A;  2KNC A;  2E76 C;  2ZXX A;  3FX0 A;  2BEZ F;  1QEX A;  5CBO A;  3OW2 O;  1G8J B;  2AXT H;  2DW3 A;  3VYI A;  3CX5 I;  2ZYL A;  1EXJ A;  1K73 Q;  1VPC A;  1SQB J;  3IF4 A;  5KLV J;  1ZP0 C;  1L0N D;  3MD0 A;  1KTM A;  2WPS A;  2WSE H;  3OA7 A;  3DQY A;  1SQV G;  2O01 N;  3AE9 C;  2HMK A;  1RF1 C;  1VDF A;  1DEE G;  1CW5 A;  3RL0 D;  3LW5 H;  2GBX A;  4GT1 A;  2D2C B;  2HLO A;  2O01 J;  1KFN A;  5KKZ C;  4HM1 A;  1DEB A;  2E74 D;  1SQX J;  3L73 D;  1WQL A;  1EG9 A;  1L0N E;  3L74 G;  1JCC A;  3MZW B;  2BEQ D;  1FAV A;  2WMM A;  2PGD A;  3P8C D;  2J5U A;  1QX8 A;  2B87 B;  4TLF A;  1LWU C;  1ZN5 A;  1OX3 A;  3N0Q A;  4L76 A;  2C9L Y;  1VF5 D;  4WY4 A;  2BCC J;  3CWB J;  1N7L A;  1OXZ A;  3L73 E;  1K8A Q;  4HJG H;  5CCH A;  4ASW A;  1EDI A;  3RK2 D;  5AVX B;  1HUC A;  3TSI A;  3L74 E;  4A7P A;  1MFZ A;  4HYT B;  1SQQ J;  1UII A;  3H1I E;  1JUN A;  1KB9 H;  2QJP C;  3H1K J;  1ULJ A;  3H32 B;  2Q3I A;  1G2C B;  2YO3 A;  2FFD C;  5APX A;  1JCD A;  3BAS A;  1M1J C;  2I1K A;  3V2Q A;  4NPD A;  1Q90 D;  2E74 C;  1QLE D;  2GM4 A;  3JC2 2;  4OGQ B;  4U3F J;  1SQP G;  1KYO E;  1NTZ K;  3TNU A;  1BCC J;  3A7O A;  3A5T A;  1USE A;  1YQ3 C;  1CI6 A;  2OYI A;  3H1J D;  4D6T G;  1JY2 O;  4IOI H;  1LNQ A;  4UB6 H;  5DJT B;  1Y8A A;  3M9Q A;  1FDM A;  1N73 A;  1VF5 C;  1OVU A;  4DCK A;  1NGM B;  1DH3 A;  1VQ6 P;  3R4Y A;  5APT A;  5BU5 A;  2KNC B;  2NUM A;  1ZRT D;  3RK2 C;  1SQP E;  1S3J A;  2D2C D;  5CHX A;  1LP1 A;  1HH0 A;  4R4L A;  2A06 G;  4QDF A;  2KXP B;  5C39 A;  1PP9 E;  5KAF E;  1A02 F;  3H1L D;  2XRX A;  3CX5 D;  3CMA P;  3FWN A;  1DD4 A;  1USD A;  1EXI A;  3E7K A;  3CCE P;  1H88 A;  1OWA A;  1S4X A;  2GA1 A;  1Q90 C;  3AE5 C;  2WWW A;  2JKV A;  3N7N A;  1JY3 O;  2R3S A;  4ZKU A;  1VQN P;  2KI7 B;  1JOC A;  1QGK B;  3P7K A;  2BMR A;  1RF0 C;  1VM9 A;  2HR3 A;  2Q5U A;  1GK4 A;  2R44 A;  5KAI E;  4I2L C;  1JM1 A;  2A06 E;  2G8Y A;  3A0H E;  1BE3 G;  2YKQ A;  4DJG A;  2WIT A;  1Q86 Q;  3BCC E;  3C8V A;  1RH5 B;  1YQ4 C;  4XA4 A;  1LTJ A;  3L72 D;  1MV8 A;  1X9V A;  2HG5 D;  1KQF B;  2KSJ A;  1O7P A;  4HM3 A;  3HE4 B;  1IZN B;  4PJ0 H;  3M91 A;  4JQ0 D;  2E75 C;  4OGQ D;  4BWN A;  3KZI E;  5AVW B;  2XV5 A;  4NBG D;  2KSE A;  5APY A;  1GD2 E;  4NBA D;  5BU8 B;  2YKP A;  3H1H G;  3U1A A;  3AZC A;  1BGY D;  3VP8 A;  1YBK A;  3H6P A;  2JO6 A;  4NB9 D;  5APS A;  3PP5 A;  1SFC B;  2QEX P;  3CCR P;  2WSE J;  3B4S A;  3L36 A;  1LTB C;  4H44 B;  1FZB A;  3AE2 C;  1YJN P;  2P67 A;  3KDP B;  4IL6 H;  4NBD D;  1PPJ D;  3H25 A;  2ZYD A;  3ABV C;  1L2P A;  3CXH E;  2E4Q A;  3IN6 A;  2WSS H;  2OAR A;  5APV A;  3AEF C;  4AIV A;  1O7M A;  2XDJ A;  1IK7 A;  3CCV P;  1JNM A;  3GF3 A;  5AW8 B;  1G1I A;  3KYQ A;  3V2P A;  3BRV B;  2R5B A;  2KYV A;  1L0L J;  3AEE C;  2H88 C;  2WVR A;  4LGD E;  4HM5 A;  1BE3 J;  1YI2 P;  3O6Q B;  3L71 D;  3M0D A;  5AVU B;  2QRX A;  4H13 C;  2KZJ A;  2I8D A;  3G4S P;  3NXS A;  4QMA A;  1AA0 A;  3CD6 P;  2K88 A;  3HUS C;  1LT9 A;  2XSH A;  1FZC A;  2AEM A;  2IPP A;  4C7N A;  2Q1K A;  3CLQ A;  3G9R A;  1JO5 A;  1RFS A;  1NTM D;  3FOU A;  4HM8 A;  3B5N D;  1J2J B;  1YTZ I;  5KJ7 D;  3H1H J;  1R5S A;  1NU1 J;  1GL2 C;  1Z56 A;  3TGU J;  2DE7 D;  3RK3 B;  2H43 A;  5AW5 B;  2N1T B;  1NTK J;  1KQS O;  2Q3E A;  1FZF A;  1LTJ B;  1URQ A;  4TT3 H;  3SWY A;  3VTP C;  5CJ0 A;  3VMX A;  3CCQ P;  3Q1M A;  2RN0 A;  1VQ5 P;  2VRS A;  4KJM A;  3UIA A;  2YIU B;  4U7J A;  1SFC D;  2C0X A;  1GDT A;  1NTZ G;  1HTL C;  1N2D C;  3OJA B;  3L75 G;  2QJY B;  1KIL A;  2W27 A;  5DJU B;  3GF7 A;  3MHV A;  2W8Z A;  1N7S B;  2HYN A;  1P84 H;  3HD7 C;  1S9K D;  1M90 Q;  3BRT B;  1UUW A;  1RY3 A;  2E42 A;  3B5N C;  1IFN A;  1RQU A;  1SQB D;  5AVR B;  5KLV D;  2KP8 A;  4QDC A;  2B9B A;  3GHG C;  1SS1 A;  1P84 I;  4AAY B;  2WT7 A;  2OGU A;  2BMQ A;  4HB1 A;  2ZXE B;  2ZVO B;  2KLV A;  1X22 A;  1OVV A;  3GL0 A;  5GTI H;  4OH8 B;  4DOJ A;  3L75 E;  2K1A A;  5GTH E;  3G6E P;  3U1C A;  5CCG A;  1S9K E;  2N9Y B;  3WMM 0;  4P1B H;  1SQX D;  2CK3 H;  2YFL A;  2FYN B;  4HM7 A;  1VQ8 P;  3RBX A;  5B66 E;  5AVZ B;  3G3Z A;  1KC8 Q;  1SFC C;  1IFD A;  2YKO A;  1HGV A;  3VMY A;  1T2K C;  2M3B A;  1KV4 A;  1ULI A;  2FYU J;  2OTL P;  4NBB D;  1MUU A;  2PRR A;  1YJ9 P;  1FQT A;  3RK3 D;  1FE6 A;  3CWB D;  2N1T D;  3B8E B;  1SQX E;  2H89 C;  3HUS A;  1FZC B;  2B24 A;  2NPS A;  1L0N G;  1OW6 A;  4C7N B;  2V4H A;  1G1J A;  1LT1 A;  1J1D B;  2V7Q J;  1NDO A;  1GZL A;  5AVV B;  5AW9 B;  4XFJ A;  2JDI H;  1SQQ D;  2O1J A;  4AQR D;  1BSH A;  3H1K D;  1YYC A;  4PD4 D;  2P2U A;  3TK1 A;  4R4M A;  1GL2 A;  1L4A D;  2JJL A;  5E79 E;  1PGQ A;  5KTB A;  4BRY A;  2BCC E;  1S72 P;  1VQK P;  1FS0 E;  3RK3 E;  3CWB E;  2XR8 A;  1FZE A;  4U3F D;  2P1J A;  1S5L H;  3A3Y B;  2SPZ A;  3EFG A;  1OW7 A;  3L73 G;  1J1E C;  2E5Y A;  3AE7 C;  1URQ B;  1O7G A;  2HMN A;  1BCC D;  4N78 D;  3W68 A;  1FJP A;  1N7S D;  3MUD A;  3CCU P;  1SQQ E;  1RE3 A;  4EDF A;  1ZV8 A;  5AW2 B;  3H1I G;  4O9B A;  3WUV A;  4PD4 E;  1NTM K;  1RE4 A;  3L70 J;  1YHQ P;  2JZA A;  5AVS B;  1IFJ A;  3RK3 C;  3GG2 A;  2N1T C;  4U3F E;  4YTP C;  2IBZ D;  1HF9 A;  2KK7 A;  4M3L A;  4I1L A;  4LLH A;  3VP9 A;  2LXB A;  3JCU H;  4RKU J;  1KQL A;  2LXC B;  2Y0D A;  3V4Q A;  1SJG A;  3AED C;  1N86 A;  3VN0 A;  3Q2Y A;  3GTS A;  3P8C E;  1L4A C;  2YIU C;  1EDK A;  3RL0 C;  1Q7Y Q;  2IBZ E;  1EZV D;  5H2F E;  1EQ7 A;  4RJT A;  2I1J A;  1YJW P;  1KB9 I;  1Y9B A;  2QJY C;  5AW1 B;  2HMJ A;  3Q5S A;  1OFC X;  1N7S C;  2KS1 B;  4UB8 H;  1EC5 A;  1AVY A;  4Y99 B;  3H1J G;  2J58 A;  1PP9 G;  1SQV J;  2R3C A;  3SWF A;  3L4F A;  2POH A;  5BOK A;  1SQB K;  3USS A;  5KLV K;  4JYC A;  2E5T A;  3Q5P A;  2OYH C;  3HTK B;  1EZV E;  4JF7 A;  1N8R Q;  2QM7 A;  4NBH D;  1NYH A;  1PL5 A;  2CKF A;  3L74 J;  5B5E E;  1JMB A;  3H1I J;  2IFM A;  2OTJ P;  3H1L G;  3CC4 P;  4ZKP A;  3V2R A;  3VOP A;  1JTH A;  2FYN C;  3H1J E;  1SQX K;  5TIS E;  1URQ D;  3D6Z A;  3AE6 C;  4WBA A;  1W5C E;  3BCC G;  3PLN A;  2P58 A;  3V2N A;  1NHL A;  4HKV A;  3S4R A;  1RF1 A;  1E79 H;  1JB0 J;  1PFI A;  1K05 A;  2YO2 A;  1ZRT E;  4L73 A;  1OW8 A;  2B1X A;  2H7H A;  1ZXG A;  1BDC A;  4Y28 J;  3SSU A;  4WVZ A;  4ZNC A;  3H1L E;  4PV1 B;  1WMK A;  3CCL P;  1KFM A;  2M3E A;  3CX5 E;  1J1D C;  5CXM A;  3E1R A;  3I55 P;  5CBN A;  1YIJ P;  3L72 G;  4EYY Q;  2YFI A;  2AXT E;  4EI2 A;  1SQQ K;  1ZR4 A;  2M5A A;  1SQP J;  2HMM A;  1NKZ B;  2ITA A;  4AYC A;  1HVV A;  1LWU A;  1FOS F;  4NPE A;  1HJ0 A;  1HJB A;  2D2C C;  1PP9 J;  1L0L D;  4WY4 B;  5AW7 B;  2OTK E;  1BE3 D;  4D6T J;  2G3A A;  1M1K Q;  4N3Y B;  1KMI Z;  1H8A A;  2I7F A;  2V7Q H;  1BGY G;  3A0B H;  2ZT9 B;  1SQV K;  2QE7 H;  5AW0 B;  1PGO A;  3L72 E;  3HRN A;  3PHL A;  4HM2 A;  2FFD A;  1FBM A;  1EDJ A;  2JO1 A;  4L75 A;  2GUS A;  3SFE C;  3FXE A;  1M1J A;  1U57 A;  5B66 H;  2C0W A;  1KB9 D;  1PPJ G;  2HMO A;  1X79 B;  3WU2 H;  3H1H D;  3TNU B;  2Q9I A;  1NU1 D;  3BCC J;  1IFP A;  3TGU D;  5EFW B;  2HPC A;  3GZX A;  1CI6 B;  1NTK D;  1YTZ T;  2OYI B;  1BGY E;  2KLU A;  2QM8 A;  2A45 G;  2C9N Y;  2NRG A;  2FYZ A;  4KT0 J;  1UUV A;  2XSO A;  2XNX A;  1N73 B;  5AVT B;  3GB4 A;  4YPC A;  2R5D A;  2HOD A;  1FDO A;  1RHZ B;  1KB9 E;  3MIW A;  1H89 A;  3GOB A;  4OGQ C;  3L71 G;  2OQQ A;  1PPJ E;  1FC2 C;  1LP1 B;  2QG4 A;  4LC1 A;  4QDF B;  1NTK E;  2Z4E A;  1R8E A;  2JEE A;  2GBW A;  4PV1 D;  5E79 H;  1UIX A;  1H0T A;  1O7H A;  3TYY A;  5M1B A;  1IC2 A;  2YXR B;  5AEW A;  1RF1 B;  1NTM G;  3CPW O;  3EWK A;  4UB6 E;  2NZ2 A;  2RH0 A;  1VQL P;  4NBF D;  3GL2 A;  3EN1 A;  3L71 E;  4W80 A;  1RF0 A;  4WY4 D;  3CC2 P;  4H0L B;  1PGJ A;  1BSN A;  2YVJ B;  5CCH D;  3A2A A;  4JYB A;  3OAK A;  2CPB A;  1S1C X;  4YXD C;  4W7Z A;  2AEF A;  2W83 C;  2E43 A;  1FU1 A;  2ZT9 D;  1Q81 Q;  2GUV A;  2M5A B;  3AE3 C;  3VMA A;  1LWU B;  1NTM E;  1GMJ A;  1ZOY C;  2AEJ A;  1S2E A;  2FYU D;  2XND H;  4PV1 C;  4H44 D;  1OVR A;  1MKM A;  2ZVN B;  4IFM A;  4DZO A;  1QL1 A;  3IFM A;  3NTN A;  2YMY A;  1K9M Q;  1M56 D;  3RL0 g;  2QJP B;  1KN7 A;  1SQB G;  2FFD B;  5KLV G;  2W90 A;  1KYO H;  2Y9Z A;  1M1J B;  5KJ7 C;  2W6J H;  4WY4 C;  2FYU E;  3VMG D;  1KYO I;  1WT6 A;  1L0L K;  4QUR A;  3GKE A;  2PP6 A;  4JBZ A;  1CZQ A;  2HPC B;  2K9J A;  3LIE A;  1M57 D;  3TDK A;  4PJ0 E;  1OZH A;  1FZG A; 
#chains in the Genus database with same CATH homology
 2BMR A;  5HL4 A;  1VM9 A;  4RKU J;  1SQB E;  5KLV E;  1JM1 A;  2A06 E;  1SJG A;  2G8Y A;  3AED C;  3Q2Y A;  2K9Y A;  3GTS A;  3BCC E;  3C8V A;  2YIU C;  4H44 C;  2Q3W A;  1YQ4 C;  4I7Z B;  1PIX A;  2DE6 D;  3EQQ A;  4HM0 A;  2IBZ E;  4H0L D;  1KQF B;  1Y9B A;  2QJY C;  1O7P A;  4HM3 A;  2HMJ A;  3Q5S A;  2E75 C;  4OGQ D;  2WSF J;  4HM6 A;  1RQV A;  4EMJ B;  4NBG D;  3GTE A;  2FXP A;  1DIP A;  4NBA D;  3VCA A;  3S9O A;  5BOK A;  3AZC A;  4IL6 X;  2NVF A;  3Q5P A;  1OMI A;  3Q3D A;  2NVG A;  1EZV E;  4HJL A;  2JO6 A;  3GLM A;  4NB9 D;  2E4P A;  4NBH D;  1NYH A;  1PL5 A;  1KQG B;  2WSE J;  2CKF A;  4H44 B;  3AE2 C;  4NBD D;  3VMH D;  3H25 A;  1O7W A;  2FYN C;  4QUQ A;  3ABV C;  1G8K B;  3H1J E;  3CXH E;  4GDO A;  2BMO A;  3D6Z A;  1ZME C;  2E4Q A;  2JP3 A;  3AE6 C;  3IN6 A;  3H1K E;  2E74 B;  2YMK A;  4NB8 D;  2QSI A;  2NVE A;  3AEF C;  4HKV A;  4H0L C;  4AIV A;  2E75 B;  1O7M A;  3VMI D;  1IK7 A;  2NUK A;  2E76 D;  3GF3 A;  1JB0 J;  4QDD A;  1K05 A;  2ZT9 C;  3AEC C;  1ZRT E;  3C0D A;  3AEE C;  3SFD C;  2H88 C;  4QCK A;  1OW8 A;  3AEG C;  2B1X A;  4HM5 A;  1BCC E;  1AJY A;  1SQV E;  4Y28 J;  3AE8 C;  3H1L E;  4PV1 B;  1WMK A;  1VF5 B;  1DD3 A;  3CX5 E;  5CXM A;  4H13 C;  1NTZ E;  1RIE A;  3GZY A;  2YFI A;  3D70 A;  2WSC J;  2XSH A;  1VL2 A;  2HMM A;  3G9R A;  1HJ0 A;  1RFS A;  3FOU A;  3GMA A;  2D2C C;  3D89 A;  2P10 A;  4HM8 A;  2G3A A;  1KMI Z;  2WQY C;  4NBE D;  2DE7 D;  2I7F A;  2FBW C;  2ZT9 B;  2YFJ A;  1P84 E;  3L70 E;  4NBC D;  2QIW A;  2E76 C;  3L72 E;  2BEZ F;  4HM2 A;  1G8J B;  2MKV A;  4TT3 H;  2JO1 A;  2QPZ A;  3SFE C;  2ZYL A;  1EXJ A;  4H13 B;  1ZP0 C;  4Z1M H;  1KTM A;  1U57 A;  3Q1M A;  2HMO A;  3DQY A;  4U7J A;  3AE9 C;  2HML A;  2HMK A;  5KLI C;  3GZX A;  1VCK A;  2GBX A;  2D2C B;  3GF7 A;  2DE5 D;  2O01 J;  4KT0 J;  2XSO A;  1UUV A;  5KKZ C;  4HM1 A;  2E74 D;  4I7Z C;  3O6Q A;  4QUP A;  1UUW A;  3GB4 A;  1WQL A;  1EG9 A;  1FDO A;  1PV3 A;  1L0N E;  1RQU A;  2E75 D;  2BEQ D;  4QDC A;  1KB9 E;  3GOB A;  4AAY B;  4OGQ C;  2OQQ A;  2BMQ A;  1PPJ E;  3D71 A;  2J5U A;  3GCE A;  4QDF B;  1NTK E;  1R8E A;  3GL0 A;  5L8R J;  2GBW A;  3T97 B;  3N0Q A;  4PV1 D;  3L75 E;  2QJK C;  1VF5 D;  1UIX A;  3AEB C;  1O7H A;  3L73 E;  5M1B A;  4P1B H;  2YFL A;  5AEW A;  2WPV B;  4HM4 A;  4HM7 A;  3L74 E;  1TU3 F;  3EWK A;  2NZ2 A;  4NBF D;  3GL2 A;  3H1I E;  3EN1 A;  2QJP C;  1KIL E;  3L71 E;  1ULJ A;  1NYK A;  1FDI A;  4H0L B;  1ULI A;  3FGA D;  4NBB D;  2YVJ B;  5AEU A;  2NWF A;  1S1C X;  1K04 A;  1Q90 D;  2E74 C;  4YXD C;  4OGQ B;  1FQT A;  3AEA C;  2H89 C;  1SQX E;  1KYO E;  2ZT9 D;  3AE3 C;  2B24 A;  1OW6 A;  1NTM E;  1YQ3 C;  2V7Q J;  2IDB A;  1L0L E;  1NDO A;  1S5L X;  1GMJ A;  1ZOY C;  3D6Y A;  4XFJ A;  1BE3 E;  4H13 D;  3IAO A;  3B71 A;  4R4M A;  4PV1 C;  1VF5 C;  4H44 D;  1MKM A;  1NGM B;  2BCC E;  3RK3 E;  3CWB E;  2XR8 A;  3R4Y A;  3AE4 C;  1OW7 A;  3Q5R A;  3RL0 g;  2NUM A;  1KOR A;  1O7N A;  1SQP E;  3AE7 C;  2D2C D;  1O7G A;  2HMN A;  4R4L A;  4QDF A;  1PP9 E;  1SQQ E;  2XRX A;  3LW5 J;  1DD4 A;  4PD4 E;  3H1H E;  1EXI A;  2FYU E;  2E76 B;  1NU1 E;  3VMG D;  4P1C H;  4QUR A;  3GKE A;  3TGU E;  2JZA A;  1Q90 C;  3AE1 C;  3AE5 C;  4U3F E;  4YTP C;  3VCP A;  1HF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...